2QJPB

Crystal structure of wild type rhodobacter sphaeroides with stigmatellin and antimycin inhibited
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
total genus 67
structure length 256
sequence length 256
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjpB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjpB02
2Y0EA 4PWAA 3NBSA 1H31B 1GQ1A 3A9FA 1CSUA 1C6SA 5TISV 2GB8B 4GYDA 4P4QB 1QKSA 4WQBA 3ZIYA 2DVHA 1U74B 1P84D 1HCMA 2EXVA 5GTIV 2C1DA 2RN0A 1KIBA 1RZ6A 4XXLA 1CSVA 1CTYA 2CE0A 3WFEC 3PTZA 3H1KD 5CYTR 4AAOA 1GKSA 1N15A 3DP5A 1YNRA 1CORA 4WQAA 1K3HA 1CC5A 2L91A 4UB8V 4EICA 3HQ7A 1H1OA 2D0SA 1I55A 2MHMA 2C1DB 1J3SA 1NMIA 5KAFV 1QYZA 4XYDB 1PP9D 3ZOXA 3BCCD 3OCDA 2OZ1A 4WQ8A 2MTAC 1M6ZA 1MG2D 3DMIA 2BH5X 2GC4D 3PXTA 1CIGA 2AIUA 1CSXA 2XTSB 1CCHA 1FJ0A 1HJ4A 1DIIC 2GIWA 1PPJD 1GU2A 1CYJA 1IRWA 2JQRA 3SLEA 1CTJA 3O0RC 4IL6V 3OCDB 2OZ1B 4K3IA 5KLIB 5B6QA 1H9XA 4QAOA 3L4OA 1AOQA 3SVWA 2FYNB 1NTKD 4L3GA 2BCNB 5KAIV 5DJQC 1E8EA 3WU2V 4O1WA 5TJHA 4EIEA 3CX5D 1DT1A 2N9IA 2N18B 4PW9B 4RJTA 3CYTI 4O1QA 2QJPB 1C52A 1CRIA 1L0ND 1CRGA 1CRYA 1NNOA 3HQ6A 1GJQA 1SQVD 4WQ9A 3PHLA 2YQBA 5GTHV 1I6EA 2N3YA 2C1VA 2JWAA 4A7PA 1CRJA 4J20A 1MG3D 2CXBA 1CEDA 2C9XB 351CA 1CHIA 3PRJA 2JTIB 1IZL0 5C9MA 1YIQA 1H9YA 2Y0CA 2RMZA 3PXSA 3TDKA 1QL4A 3PXWA 1A8CA 4JCGA 1CXAA 2GC7D 2YIUB 4PJ0V 4UB6V 3NWVA 1NTMD 2C8SA 4KMGA 1C75A 1I6DA 1DW1A 1FI9A 1YEBA 2KNCB 1KX7A 4EDFA 2IBZD 155CA 1GDVA 1AOFA 3RMZA 2BLFB 4FA1A 2FRCA 1KB9D 4FB1A 1DIQC 2B12B 3SWSA 1HROA 4EIFA 3OA8A 5B66V 1FI3A 2V08A 5CIBB 1AKKA 1S6VB 2N9JA 2Y0DA 3A0BV 1LC1A 4FA5A 3L72D 2VHDA 3O20A 4Y5RA 1C6RA 4NFGB 1B7VA 2I8FA 5B5EV 2N18C 2QJKB 3L73D 3WUIA 1CHJA 3OA8B 1ZZHA 1KYOW 3CU4A 1C2NA 3WC8A 1I8PA 1LFMA 2FWLA 1VYDA 5DFSA 2B0ZB 2ZONG 1HH7A 3HQ9A 1HRCA 1YCCA 4N0KA 1A56A 5CIEB 3TGUD 1BCCD 3MK7B 2CA4B 3CXHW 3VMAA 1HZUA 4D6TD 3RLMA 3WFBC 5KLVD 1RAPA 3TF5A 1EB7A 2PCBB 2K9JB 4FAVA 3CP5A 2ZOOA 1LC2A 2YCCA 1OCDA 3L71D 3NBTA 5CIGB 1KB0A 2ZBOA 1RAQA 3GW6A 4L1QA 4WQDA 4PD4D 1LMSA 1M70A 1CIFA 3ZOOA 1NU1D 2B11B 1GIWA 2BPBB 1SQBD 2LITA 4Q5PA 1I8OA 2BH4X 1N50A 3L4MA 451CA 1AYGA 1CYCA 1S5LV 1QN2A 4YE1A 3VRDA 4AX3A 1ETPA 5EXQA 3SJLA 1CIEA 2HV4A 2N3BA 3FWLA 2AI5A 1L9BC 1CYIA 2ZXYA 2A06D 2L4DA 1U75B 3WFCC 1BL9A 1W5CT 1CHHA 1CO6A 2BGVX 4FA9A 1FOCA 1MZ4A 3ZBMA 1CRCA 1JDLA 5E79V 1N90A 3ZCFA 1DVVA 1LS9A 1ZRTD 3HQ8A 3ORVA 3C2CA 2B4ZA 2CE1A 4U3FD 1R0QA 1SQXD 1H33A 3DR0A 4L3HA 1NTZD 1DW0A 1NIRA 3H1ID 1KX2A 4MU8A 1FI7A 4WQEA 5DF5A 2N9YB 1CXCA 1SQPD 1A2SA 1W2LA 3KHUA 2QJYB 1H33B 1NMLA 1COTA 3RN0A 3PH2B 4EIDA 1CTZA 1DW3A 3JBTB 3MK7C 3ZOWA 4H0KA 4GEDB 1L9JC 1QL3A 2LIRA 5IY51 1YFCA 1E29A 3CX5W 2ORLA 5KKZB 3KZIV 2DGEA 3VNWA 1RZ5A 3X39A 3WFDC 3L70D 5CIDB 1M60A 2YK3A 4AAMA 3SXTA 3TYIA 1HJ3A 1IQCA 1BE3D 4FANA 1F1CA 1CNOA 1FHBA 3GG2A 2PACA 1EZVD 2D0WA 1WEJF 1WVEC 1CSWA 4V2KA 2AXTV 5H2FV 3ZOYA 3H1LD 1E2RA 1KV9A 3A0HV 1CRHA 3O5CA 3L74D 2O3JA 3CWBD 2BCCD 1FCDC 1N9CA 2C1UA 1L0LD 2FYUD 4AANA 4WQ7A 4LJIA 3L75D 3H1JD 2ZZS1 5C0ZA 1H32A 4AALA 2C2CA 1HZVA 1F1FA 1OAEA 1IO3A 1BGYD 4H0JA 1KYOD 1I54A 3VYMA 1DVHA 1IRVA 1SQQD 2Q3EA 4FA4A 3RN1A 2V07A 1K3GA 1YTCA 3H1HD 1DW2A 2CA3B 3ITKA 5CIHB 1C6OA 2B10B 1H31A 1H32B 2PCCB 1CCRA 1CIHA 4WQCA 3CXHD 1HJ5A 5DJQB 5CICB 1I5TA 5CIFB 4DY9A 3O1YA 1C2RA 5AURA 2KS1A 1YICA 4RSZA 3PLNA 1YEAA 1C7MA 3M97X 2QG4A
chains in the Genus database with same CATH superfamily
2YXRB 1CI6A 1EZVI 4D6TJ 5KLVJ 1KB9H 3A9FA 1C6SA 2E74C 2L5GB 4I7ZB 3GF7A 2GB8B 2FKWB 1T2KD 4WQBA 3FX0A 3L37A 1IFPA 1U74B 1P84D 5GTIV 2KS1B 2FFDA 1KIBA 3VP8A 1PP9E 1HUCA 1BSNA 2IYOA 4AAOA 1VQKP 5APSA 1NU1J 2C9NY 2QM8A 1VQ4P 3TSIA 1RF0C 1K3HA 1CC5A 5B5EE 3GF3A 1BDDA 2ZXXA 3KZIH 4EICA 1FDMA 3HQ7A 1JY2P 2D0SA 1PPJE 2C1DB 1NTZK 3BCCD 2OZ1A 1M6ZA 2GC4D 2DW3A 3L4FA 3KXDA 3JSVC 2XTSB 4EIJA 1EDIA 1ZMEC 3V6IA 3CX5E 1GU2A 4IFFA 1NTZJ 4IL6V 3O0RC 2ZYDA 4GKGA 4GOEA 5KLIB 2JR8A 1NKZB 1T3JA 1GU5A 3NMDA 4GODA 3WU2V 4O1WA 2W6BA 1EDJA 1S3JA 3CCSP 1S5LE 2N9IA 3GMAA 3TYYA 2OYIB 1CSBA 1L0LG 4C7NB 1OXZA 1L0ND 1K05A 1SLQA 4B86A 1CRYA 1FZAA 1HTLC 3H1JG 1LTJC 3UIAA 3OAKA 3CC2P 1MG3D 3H25A 1BGYG 2C9XB 351CA 2JTIB 1VPCA 1NTME 3RK3E 1KC8Q 1IZNB 4O9BA 3U59A 3H1HG 2GM4A 1GZLA 2BASA 3PXSA 4JCGA 2I1JA 2YIUB 4PJ0V 2ZT9C 1DH3A 2FYUK 2FFDC 5AW1B 1JCDA 4ZNCA 1ZLLA 1I6DA 3H1LJ 3VMZA 2ZVNB 1GW3A 1M7LA 2IBZD 2BCCJ 4H0LD 4GT1A 3RMZA 2FYUJ 1HJBA 1LT9A 3L73E 2PAJA 2JP3A 4EIFA 4JYBA 1N7SB 1A02J 1H0TA 4OGQD 5CIBB 1ZOYC 1GW4A 3VOPA 3NTNA 2N9JA 5B66H 2VHDA 4Y5RA 1YHQP 3TGUE 1BCCE 5AVZB 2OQQA 3CMAP 2N18C 3WUIA 4OH8B 3OA8B 4OVNF 3AEFC 2D2CD 2E42A 3CU4A 4M3LA 1C2NA 1HH7A 1A56A 1VQ8P 3A0HE 1IFJA 2OYHA 1ZW0A 1E79H 1PPJG 2KP8A 5CCGA 3HE5A 4Z1MH 1S1CX 1J2JB 2K9JB 2WSFH 3CP5A 5CJ4A 1R5SA 2WSSH 2E74D 2WVRA 2XNXA 4L74A 3NBTA 5CIGB 4L1QA 4WQDA 2E5TA 2BEQD 4PD4D 1M70A 2B87B 1CIFA 3M06A 1GIWA 1KB9I 1GD2E 3NXSA 1QN2A 1ZRTE 3VRDA 1ETPA 2YO2A 1CIEA 2N3BA 2MKVA 4U3FE 1DD3A 1QVFO 3C8VA 3CD6P 1FZBA 2Z5IA 1JM0A 2L4DA 2IFNA 3BCCJ 1BDCA 2BGVX 1MZ4A 3H1IE 1Q90D 1DVVA 1NYHA 1LS9A 3HQ8A 1SQPE 3O6QA 1VL2A 1PGPA 5M1BA 1GK4A 1LT9C 1J1DC 2WSEJ 1NJIQ 4U7JA 1NIRA 1FZCA 2KI7B 1L0NK 1OIPA 2WTYA 1RE3C 1KX2A 3GHGB 4MU8A 1NTMG 5DF5A 1A2SA 1W2LA 3AE8C 3V4QA 2QE7H 1L9JC 4N3YB 1QL3A 1MUUA 1YFCA 3CCMP 1L0NJ 4JQ0D 3G6EP 2ORLA 1A02F 4NPDA 1KD1Q 3KZIV 3E7KA 5AVXB 2CPBA 2DGEA 3AE9C 2B88A 4L76A 4GDOA 3L70D 3Q5RA 5B5EH 4AAMA 5CCGC 3TYIA 1K04A 1IQCA 1PGJA 3L73G 2IZ1A 1PL5A 2IFMA 1BE3D 3M0AA 3MUDA 1YI2P 3L74E 1CNOA 3CWBE 1FHBA 1EZVD 2ZT9D 1WVEC 1IK9A 5APQA 3TNUA 3L75E 4V2KA 1YQ4C 2M5AA 1T2KC 3TGUG 3AEDC 1BCCG 3CX5H 2E5YA 1L4AA 3HUSA 1FDIA 5H2FH 2IDBA 2O1JA 3LW5H 1KYOE 2C1UA 2YXQB 5AW4B 1RQVA 1SQQE 4AANA 1S9KE 3QH9A 1CW5A 3RL0B 1GK6A 2WPRA 4AALA 2C2CA 1S5LH 3CXHE 1QL2A 1IO3A 4W7ZA 4H0JA 2LKMA 3RN1A 1YTCA 2WMMA 1FZCC 1DW2A 2YO3A 3IR9A 4N78E 1C6OA 1LTSC 5AVYB 3B8EB 2PCCB 1Y9BA 1JOCA 1OW6A 1S2EA 2YMKA 4HJGH 2OTJP 4BXLA 4WY4C 2H43A 4IOIH 1FC2C 3B4SA 4RSZA 1JY2O 1LTIC 4U3FG 3H1KE 1SFCA 2P7JA 4RO0A 1VQMP 3NBSA 1IFNA 1M8OB 2KSJA 5TISV 4GYDA 4P4QB 3AE3C 3H1IG 3ZIYA 1LTJB 4HYTB 5B66E 1SS1A 1SQPG 2RN0A 2CE0A 1Y47A 3PTZA 1FJPA 4BRYA 5CYTR 3SWKA 1CI6B 2C9LY 3V2NA 4HKZH 1IK7A 4WQAA 3V5BA 1G2CA 3MUDC 1FZEA 2L91A 2WT7B 1QLED 2ZT9B 1I55A 2GA1A 3PJSK 2FFDB 1NMIA 4JPZB 1QYZA 4XYDB 1OMIA 3Q5SA 3OCDA 1NO4A 2BH5X 5KAFH 3PXTA 1L4AC 3HUSC 1NTKE 2AIUA 2WPQA 1CSXA 3AE1C 1SP4A 3MP7B 2KLVA 3CCQP 3B5NC 1JY2N 1FJ0A 4YTPC 4MN4C 1W2BO 3CCUP 2AXTE 1HH0A 2RKLA 2WPVB 3SLEA 4N6JA 2K9YA 4JYCA 2OZ1B 4K3IA 2J5UA 5B6QA 4H0LC 2LXBA 4QAOA 1SQVE 2ZAEB 3A0HH 3SFEC 5CCHA 2BCNB 2M3EA 5DJQC 2H88C 3D71A 1E8EA 4EIEA 3L74G 5KAIH 2PGDA 3QWOC 2N18B 2N9BA 4RJTA 3RBXA 3RGUA 4I2LC 1OVUA 1GL2D 3L75G 1GJQA 3P8CE 3PHLA 3M91A 3Q5PA 1I6EA 2N3YA 2JWAA 4J20A 3VMXA 2D2CC 2E75C 1L0NG 3AEAC 5GTHH 3VMYA 3L70J 3VYIA 2IPPA 1IZL0 1SFCC 1LWUB 1SQQG 1H9YA 3G3ZA 1NKNA 1VDFA 2RMZA 1BE3J 2QSIA 3PXWA 2KNCA 1CXAA 2M0BA 3C1LA 4ZMDA 3FWNA 5AVSB 4WB4A 5APVA 3EFFK 4UB6H 4KMGA 3V2RA 4Y99C 1KILB 1YEBA 3F89A 1H88A 1GDVA 1VQNP 3CC7P 4DT0A 1KB9D 1HROA 3CX5I 2V08A 1AA0A 3H1KG 1EQ7A 2FYNC 1GU4A 3T97A 3BASA 3L72D 3O20A 4PV1B 4NFGB 3AEGC 3A0BH 2JDIH 1LT9B 1J1DB 5B5EV 2QJKB 5AW7B 2P1JA 4D6TE 1H0TB 1JMBA 5KLVE 2ZXEB 1HGZA 1M56D 1PIXA 5CCHC 2QIWA 1PGQA 3MHVA 5H2FE 2J58A 2P58A 2ZONG 2WSEH 3CI9A 4WY4D 4N0KA 2W6JH 1D7MA 2KYVA 1M1JA 1VQ7P 3MGNA 1NU1E 2ZYAA 1J1EC 1HBWA 2W6AA 3WFBC 4H13B 1RAPA 4NPEA 2ZOOA 1NAYA 1W2EA 1FOSF 1OCDA 3L71D 1WMKA 3G9RA 1RHZB 1NTKG 2ZBOA 3GW6A 4JBZA 1VQOP 2OYHB 1OZHA 1IJDB 2B11B 1IC2A 1KYOH 3HE5B 1SQBD 1I8OA 1M1KQ 3CCEP 1AYGA 1CYCA 1S5LV 5CBNA 1S4XA 5EXQA 3SJLA 2HV4A 3FWLA 2HODA 1JY3P 1SQVG 1Q86Q 1CYIA 2ZXYA 2A06D 1DEBA 3CCRP 1NTZE 2A45G 3CXHH 3WFCC 5APUA 2GUVA 1Q7YQ 1HJ0A 1JTHA 1CRCA 2P67A 4DZOA 1N90A 1L4AD 1KV4A 1URQD 2XU6A 3ORVA 3B5ND 2CE1A 4L75A 1R0QA 1AVOA 3WUTA 1FDOA 5AW6B 1IFDA 2KSEA 3Q2YA 3IAOA 1E5WA 3AECC 1KILE 2QJYB 1DEEG 2R3SA 3PP5A 1RY3A 4LLHA 1COTA 4WVZA 3PH2B 2Q7CA 1CTZA 1DW3A 3MK7C 3ZOWA 1RE3A 1FZCB 2AXCA 4UB8E 2K1AA 3USSA 5IY51 1SVFA 1E29A 3CX5W 2KOGA 5KAFE 1N73A 1OFCX 2HR3A 1RZ5A 4H44C 1YTZT 5CJ0A 1M1JC 1GL2A 2KK7A 4ASVA 2E75D 4YXDC 2YKPA 1SFCD 5AW0B 3SXTA 4DCKA 1ZR4A 1HJ3A 3H1LE 1Q81Q 5APXA 3MZWB 4W7YA 2BCCE 4DOJA 4QMAA 1YITP 2NPSC 5AW8B 2FYUE 3V2PA 1FAVA 5KAIE 3RK3C 2NZ2A 4IFMA 4I1LA 1E2RA 1X22A 1VQ5P 2AXTH 3A0HV 3O5CA 1RE4A 1HVVA 4D6TG 3M9BA 5KLVG 1H89A 1N9CA 1OVVA 3AE4C 1L0LD 3TNUB 1KZUB 3IN6A 2M5AB 5GTHE 2A45H 3H1JD 2ZZS1 1AV1A 2CPSA 1K73Q 1L4AB 2XNDH 2H89C 3HUSB 1NU1G 1X0TA 1BGYD 1DD4A 3L72J 3B71A 1N2DC 1I54A 1DVHA 1KTMA 3S9OA 1IRVA 2ZYGA 2Q3EA 5AW5B 3H1HD 2Q3IA 2JO1A 4H0LB 4RESB 4UB6E 1H31A 1LP1A 4WQCA 5CCHD 1HJ5A 5DJQB 1I5TA 1P84E 3O1YA 1C2RA 2FBWC 1JMMA 1LGHB 3NFQA 1YICA 4EYYQ 3AE7C 4OGQB 2B89A 1JEKA 3M9HA 4YPCA 1RF1A 2QG4A 2Y9ZA 4WBAA 1SQBK 3I55P 2ZFCA 2Y0EA 4PWAA 1NTZG 4DJGA 3RK2D 2FXMA 1CSUA 3LIEA 4WY4A 4AUWA 1N73C 1X8YA 3L71J 3BRTB 3FGAD 4KT0J 2EXVA 2D2CB 3L72E 1GL2C 1RZ6A 4XXLA 1CTYA 3BCCE 1SFCB 3A0BE 2P2UA 3AE6C 2UWJE 1N15A 1SQBJ 2V7QJ 2IZ0A 4IL6X 2MJZA 3CCJP 1H1OA 4LC1A 1T8ZA 2E76C 1J3SA 2YKOA 4BRYB 1MV8A 1PP9D 3CC4P 1ZN5A 2E74B 4AQRD 4Y99B 2MTAC 1MG2D 2AEMA 3DMIA 1G2CB 4KJMA 1RE4C 1CCHA 2HPCA 5BU5A 3MTUE 2K9JA 1PPJD 4HH2A 5AW3B 3L71E 1CYJA 4EI2A 2JQRA 3CXHI 2O1KA 2XZRA 4NPFX 3D70A 4C7RA 3OCDB 1URQA 1M57D 1H9XA 1L0NE 3B5NA 3HTKA 1AOQA 5AVTB 2VRSA 3KDPB 1EDKA 2FYNB 1K8AQ 3AE2C 3H1LG 1QGKB 3JCUH 3CX5D 1CZQA 2BCCG 1DT1A 3WUUA 3AEEC 4GOFA 2FYUG 1C52A 2N1TA 1CRIA 1CRGA 1NNOA 5KJ7D 4AYCA 3HQ6A 2FXPA 4WQ9A 3U1AA 2Z5HA 3H32A 3OW2O 2YKQA 2R3CA 1MZ9A 4A7PA 4I6MC 1CRJA 1G1JA 2CXBA 4H44D 5E79E 3L35A 5AW9B 3PRJA 1RF1C 5C9MA 1YIQA 2K37A 2IYPA 1J1EB 3TDKA 3HRNA 1QL4A 2K88A 2W90A 3R2PA 2IBZE 1VQPP 2NPSD 1L0LK 3II6A 3NWVA 2Q5UA 1ZP0C 3N7NA 2FXOA 1NTMD 2WWWA 3RK3D 1C75A 1QL1A 1FI9A 1N7LA 2JWDA 2KNCB 155CA 2ZJSE 1AVYA 2FRCA 4FB1A 1L0LJ 4XFJA 2WSFJ 1RH5B 3IFMA 4XA4A 3CPWO 3H1JJ 5B66V 1FI3A 2Q9IA 1S6VB 4UB8H 1BGYJ 5APWA 2FY8A 3AEBC 1C6RA 1AQTA 3VN0A 2I8FA 1FZFA 3L73D 3H1HJ 1URQC 2A45I 1CHJA 2JJLA 2QJPC 1ZZHA 3L72G 1FE6A 1KYOW 5APYA 2LR2A 3BCCG 5AVQB 1Q2NA 3WC8A 3T97B 1HF9A 2B0ZB 1HRCA 1YCCA 2CK3H 4Y28J 3TGUD 1BCCD 4PD4E 3MK7B 3G4SP 1Y8AA 2CA4B 3CXHW 1TU3F 2PRRA 2OTKE 3FXDA 2N1TC 2M8RA 2O01J 4EOTA 1LC2A 2YCCA 2OARA 1LTBC 3K5BA 1M1JB 3VP9A 1KORA 3L71G 2BH4X 2W27A 3L4MA 3D6ZA 4ZKPA 1USEA 4TLFA 3EQ2A 2IX7C 4AX3A 1L9BC 2E76D 3OJAB 1PP9J 1CO6A 1FOCA 3ZBMA 1FOSE 1JDLA 3ZCFA 3HD7A 1ZRTD 1X79B 2B4ZA 1JY3N 1OW8A 2HODB 4U3FD 1SQXD 2HFED 1H33A 1HGVA 3DR0A 1DW0A 1YQ3C 1P84H 1JTHB 3H1ID 5GTIE 2QEXP 1YYCA 4WQEA 3KPEA 4WWIA 1USDA 5KTBA 1CXCA 1SQPD 1T6AA 4JF7A 5K5GB 2KUBA 3L70E 5APTA 2IBZG 2WT7A 3SWFA 4H0KA 4GEDB 1WT6A 2KLUA 5CMZA 1M90Q 1KFNA 3CL3D 3LW5J 2LIRA 3WUVA 1LTGC 1BE3E 2WSCJ 1T3UA 3HE4A 3RBZA 1AJYA 2H7HA 1EZVE 3X39A 3WFDC 3TK1A 5EFWB 2JKVA 1NTMK 5KJ7A 1KQGB 1U57A 1LTTC 1ZR2A 1FS0E 2OTLP 2I1KA 2Z4EA 1YJWP 4FANA 3RL0C 1N73B 1GDTA 1KQLA 1K9MQ 1N7SD 4IL6E 1X9VA 3GG2A 1VQ6P 2PACA 1N8RQ 3JCUE 1KQFB 1GL2B 1AFOA 3RK2C 1Z56A 1NHLA 5H2FV 3M0DA 1NTMJ 1S72P 1Q82Q 1OX3A 3WU2E 3ZOYA 2NPSA 1KV9A 4XE5B 1CRHA 3L74D 2O3JA 3CWBD 1FCDC 2E76B 1QVGO 4WQ7A 1VF5C 1DIPA 3L75D 2V7QH 2XV5A 3RL0g 1H32A 1YTZI 2W83C 1LWUA 3HD7C 3M9QA 1F1FA 1L2PA 1HWTC 2SPZA 4LGDE 1KYOD 3N4XA 1VQ9P 1SQQD 2V07A 3L73J 2B9BA 2C0WA 2CA3B 1S9KD 1YBKA 4PJ0E 1QX8A 2B10B 1ZXGA 5E79H 2O01N 1CIHA 1JNMA 3CXHD 5KKZC 1KILA 5CIFB 4DY9A 1DX7A 5AURA 2KS1A 3PLNA 3JC22 3TGUJ 1BCCJ 1C7MA 3KQGA 1YIJP 4N78D 1H31B 2N1TD 1GQ1A 3O6QB 3OA7A 1LP1B 3A5TA 1GTWA 2I8DA 3A7OA 1QKSA 2DVHA 5TISH 1HCMA 2C1DA 1CSVA 3WFEC 5KJ7C 1RF1B 3H1KD 2WQYC 1GKSA 3F5HA 3DP5A 1YNRA 1CORA 4BWNA 4WY4B 5BVZA 1BSHA 4UB8V 3PH0A 3CCVP 1SQXK 2MHMA 4YXWH 3Q1MA 3Q3DA 3S4RA 5KAFV 5C39A 3ZOXA 3M0DC 2KZIA 4WQ8A 2POHA 3CMEP 3L70G 1CIGA 1SQPK 3W67A 1PGOA 1PP9G 1BE3G 1WRGA 4U3FJ 1HJ4A 1DIIC 2GIWA 1SQXJ 1IRWA 3D6YA 1CTJA 1EZVG 2OYIA 4C7NA 3L4OA 3H1IJ 1H8AA 3SVWA 1JO5A 1LWUC 4PD4H 1NTKD 4L3GA 1UIIA 2HPCB 5KAIV 3I5CA 3E1RA 1SQPJ 4R4MA 2Y9YA 5AVVB 1OWAA 5TJHA 1U7JA 1NWQA 4ZKUA 4PW9B 1RQUA 1URQB 1NOHA 3CYTI 5AVUB 1P84I 4O1QA 2QJPB 3B5NB 3HTKB 2ZVOB 1VQLP 4I7ZC 1SQVD 2YQBA 5GTHV 1KILC 1LJ2A 2C1VA 1MFZA 3ABVC 1GMJA 1CEDA 3EFGA 1EDLA 1CHIA 3SFDC 2JEEA 1SQXE 2N1TB 2Y0CA 2Q1KA 4R4LA 3P8CD 3H32B 1G1IA 3RL0D 1A8CA 2GC7D 3C9IA 4UB6V 2G3AA 1KB9E 4PV1C 2O01H 2OYOA 2C8SA 1EXJA 3P32A 1N7SA 1JB0J 2KZJA 2QJKC 1DW1A 2WZ7A 2E75B 1KX7A 3L74J 3CWBJ 4EDFA 5CBOA 2M3BA 1LT1A 2J59M 1SQQK 1AOFA 5GTIH 2BLFB 4FA1A 1DIQC 2B12B 2GUSA 3SWSA 1EC5A 1NVOA 1VF5D 1YJNP 3L75J 1R8EA 3KZIE 5KLIC 3OA8A 1EXIA 2KIKA 3MIWA 3KYQA 1AKKA 2Y0DA 3A0BV 1LC1A 4FA5A 3HD7D 4ASWA 2WPSA 4H13C 2KB7P 3P8MC 1B7VA 1KYOI 1SQQJ 2K3RA 3D0WA 3BVHA 2YNYA 2R32A 2OYIC 2OYHC 1YJ9P 1KQSO 3CCLP 1I8PA 1LFMA 2FWLA 1VYDA 5DFSA 2QVAA 3HQ9A 3I56P 5CIEB 2RH0A 1S5LX 4IL6H 2B87A 3VMAA 1SQBE 1HZUA 4D6TD 1FU1A 1W5CE 3L36A 3RLMA 5KLVD 3TF5A 1EB7A 2PCBB 1UIXA 2R5BA 4FAVA 1JUNA 1JCCA 1KFMA 3V2QA 2G8YA 2HG5D 3WU2H 2YIUC 1MFTA 3H6PA 1KB0A 1RAQA 2A06E 1PV3A 3BRVB 1LMSA 2IBZI 4C46A 3H1KJ 3ZOOA 1XTGB 1NU1D 2WITA 2BPBB 2LITA 2Q6QA 4Q5PA 2WSCH 1N50A 451CA 4KHXA 3MD0A 4YE1A 2W8ZA 2XDJA 2BEZF 4RKUJ 3CLQA 3ZDMA 2AI5A 1FZGA 3RK2B 3U1CA 3G71P 1ZV8A 1U75B 2QJYC 1BL9A 3O8ZA 1W5CT 1NGMB 1CHHA 1N7SC 4HB1A 4FA9A 4IFDK 3SSUA 1NTKK 5E79V 1IFMA 3GHGA 3S1KA 2E43A 3V4WA 1OVRA 3C2CA 3FXEA 4PJ0H 2H8PD 5TISE 4L3HA 5AVWB 1VF5B 1NTZD 1LNQA 3GLMA 5CHXA 1QEXA 3AE5C 1SQVK 1MKMA 1FI7A 1SQXG 3HD7B 2N9YB 1NTKJ 3KHUA 1FBMA 1KMIZ 3LIDA 1H33B 4OWFA 1NMLA 3RN0A 1LTAC 2XKMA 4EIDA 4TT3H 3JBTB 1PZQA 4GIFA 1IFIA 4W80A 5BU8B 4PD4I 1R5LA 1SQVJ 5KKZB 1NAFA 1KILD 2FYZA 3VNWA 5CIDB 1M60A 2YK3A 2R5DA 4K3AA 2QM7A 2P10A 5AW2B 3P7KA 2QRXA 2PFXA 1RF0A 3W68A 1F1CA 1XTCC 3HE4B 2OGUA 1U7MA 1JY3O 2D0WA 1WEJF 1L0LE 2AEJA 1CSWA 2AXTV 4PV1D 4CPGA 3E1IA 3H1JE 4L73A 3H1LD 2KXPB 5AVRB 3A2AA 4H44B 1PFIA 1AQ5A 2YMYA 1OW7A 1BGYE 2BCCD 2HLOA 1IO4A 5DJUB 2FYUD 5DJTB 1NH4A 2PP6A 2R44A 3H1HE 2ITAA 4LJIA 3CWBG 4OGQC 5C0ZA 2NPSB 3GHGC 1HZVA 4K35A 1SQBG 1OAEA 4H13D 3RK3B 3VYMA 2QA4P 3SWYA 3A3YB 1KN7A 4FA4A 3WMM0 1K3GA 2HYNA 2A06G 2V4HA 5L8RJ 5KLVK 3ITKA 5CIHB 1N86A 3IF4A 1H32B 3EWKA 2AEFA 1CCRA 2NRGA 3R4YA 5CCGD 2C0XA 5CICB 3VTPC 1LTJA 2LXCB 1FJKA 1YEAA 3BATA 1NU1K 3M97X
chains in the Genus database with same CATH topology
2Y0EA 4PWAA 3NBSA 1H31B 1GQ1A 3A9FA 1CSUA 1C6SA 5TISV 2GB8B 4GYDA 4P4QB 1QKSA 4WQBA 3ZIYA 2DVHA 1U74B 1P84D 1HCMA 2EXVA 5GTIV 2C1DA 2RN0A 1KIBA 1RZ6A 4XXLA 1CSVA 1CTYA 2CE0A 3WFEC 3PTZA 3H1KD 5CYTR 4AAOA 1GKSA 1N15A 3DP5A 1YNRA 1CORA 4WQAA 1K3HA 1CC5A 2L91A 4UB8V 4EICA 3HQ7A 1H1OA 2D0SA 1I55A 2MHMA 2C1DB 1J3SA 1NMIA 5KAFV 1QYZA 4XYDB 1PP9D 3ZOXA 3BCCD 3OCDA 2OZ1A 4WQ8A 2MTAC 1M6ZA 1MG2D 3DMIA 2BH5X 2GC4D 3PXTA 1CIGA 2AIUA 1CSXA 2XTSB 1CCHA 1FJ0A 1HJ4A 1DIIC 2GIWA 1PPJD 1GU2A 1CYJA 1IRWA 2JQRA 3SLEA 1CTJA 3O0RC 4IL6V 3OCDB 2OZ1B 4K3IA 5KLIB 5B6QA 1H9XA 4QAOA 3L4OA 1AOQA 3SVWA 2FYNB 1NTKD 4L3GA 2BCNB 5KAIV 5DJQC 1E8EA 3WU2V 4O1WA 5TJHA 4EIEA 3CX5D 1DT1A 2N9IA 2N18B 4PW9B 4RJTA 3CYTI 4O1QA 2QJPB 1C52A 1CRIA 1L0ND 1CRGA 1CRYA 1NNOA 3HQ6A 1GJQA 1SQVD 4WQ9A 3PHLA 2YQBA 5GTHV 1I6EA 2N3YA 2C1VA 2JWAA 4A7PA 1CRJA 4J20A 1MG3D 2CXBA 1CEDA 2C9XB 351CA 1CHIA 3PRJA 2JTIB 1IZL0 5C9MA 1YIQA 1H9YA 2Y0CA 2RMZA 3PXSA 3TDKA 1QL4A 3PXWA 1A8CA 4JCGA 1CXAA 2GC7D 2YIUB 4PJ0V 4UB6V 3NWVA 1NTMD 2C8SA 4KMGA 1C75A 1I6DA 1DW1A 1FI9A 1YEBA 2KNCB 1KX7A 4EDFA 2IBZD 155CA 1GDVA 1AOFA 3RMZA 2BLFB 4FA1A 2FRCA 1KB9D 4FB1A 1DIQC 2B12B 3SWSA 1HROA 4EIFA 3OA8A 5B66V 1FI3A 2V08A 5CIBB 1AKKA 1S6VB 2N9JA 2Y0DA 3A0BV 1LC1A 4FA5A 3L72D 2VHDA 3O20A 4Y5RA 1C6RA 4NFGB 1B7VA 2I8FA 5B5EV 2N18C 2QJKB 3L73D 3WUIA 1CHJA 3OA8B 1ZZHA 1KYOW 3CU4A 1C2NA 3WC8A 1I8PA 1LFMA 2FWLA 1VYDA 5DFSA 2B0ZB 2ZONG 1HH7A 3HQ9A 1HRCA 1YCCA 4N0KA 1A56A 5CIEB 3TGUD 1BCCD 3MK7B 2CA4B 3CXHW 3VMAA 1HZUA 4D6TD 3RLMA 3WFBC 5KLVD 1RAPA 3TF5A 1EB7A 2PCBB 2K9JB 4FAVA 3CP5A 2ZOOA 1LC2A 2YCCA 1OCDA 3L71D 3NBTA 5CIGB 1KB0A 2ZBOA 1RAQA 3GW6A 4L1QA 4WQDA 4PD4D 1LMSA 1M70A 1CIFA 3ZOOA 1NU1D 2B11B 1GIWA 2BPBB 1SQBD 2LITA 4Q5PA 1I8OA 2BH4X 1N50A 3L4MA 451CA 1AYGA 1CYCA 1S5LV 1QN2A 4YE1A 3VRDA 4AX3A 1ETPA 5EXQA 3SJLA 1CIEA 2HV4A 2N3BA 3FWLA 2AI5A 1L9BC 1CYIA 2ZXYA 2A06D 2L4DA 1U75B 3WFCC 1BL9A 1W5CT 1CHHA 1CO6A 2BGVX 4FA9A 1FOCA 1MZ4A 3ZBMA 1CRCA 1JDLA 5E79V 1N90A 3ZCFA 1DVVA 1LS9A 1ZRTD 3HQ8A 3ORVA 3C2CA 2B4ZA 2CE1A 4U3FD 1R0QA 1SQXD 1H33A 3DR0A 4L3HA 1NTZD 1DW0A 1NIRA 3H1ID 1KX2A 4MU8A 1FI7A 4WQEA 5DF5A 2N9YB 1CXCA 1SQPD 1A2SA 1W2LA 3KHUA 2QJYB 1H33B 1NMLA 1COTA 3RN0A 3PH2B 4EIDA 1CTZA 1DW3A 3JBTB 3MK7C 3ZOWA 4H0KA 4GEDB 1L9JC 1QL3A 2LIRA 5IY51 1YFCA 1E29A 3CX5W 2ORLA 5KKZB 3KZIV 2DGEA 3VNWA 1RZ5A 3X39A 3WFDC 3L70D 5CIDB 1M60A 2YK3A 4AAMA 3SXTA 3TYIA 1HJ3A 1IQCA 1BE3D 4FANA 1F1CA 1CNOA 1FHBA 3GG2A 2PACA 1EZVD 2D0WA 1WEJF 1WVEC 1CSWA 4V2KA 2AXTV 5H2FV 3ZOYA 3H1LD 1E2RA 1KV9A 3A0HV 1CRHA 3O5CA 3L74D 2O3JA 3CWBD 2BCCD 1FCDC 1N9CA 2C1UA 1L0LD 2FYUD 4AANA 4WQ7A 4LJIA 3L75D 3H1JD 2ZZS1 5C0ZA 1H32A 4AALA 2C2CA 1HZVA 1F1FA 1OAEA 1IO3A 1BGYD 4H0JA 1KYOD 1I54A 3VYMA 1DVHA 1IRVA 1SQQD 2Q3EA 4FA4A 3RN1A 2V07A 1K3GA 1YTCA 3H1HD 1DW2A 2CA3B 3ITKA 5CIHB 1C6OA 2B10B 1H31A 1H32B 2PCCB 1CCRA 1CIHA 4WQCA 3CXHD 1HJ5A 5DJQB 5CICB 1I5TA 5CIFB 4DY9A 3O1YA 1C2RA 5AURA 2KS1A 1YICA 4RSZA 3PLNA 1YEAA 1C7MA 3M97X 2QG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0E A;  4PWA A;  3NBS A;  1H31 B;  1GQ1 A;  3A9F A;  1CSU A;  1C6S A;  5TIS V;  2GB8 B;  4GYD A;  4P4Q B;  1QKS A;  4WQB A;  3ZIY A;  2DVH A;  1U74 B;  1P84 D;  1HCM A;  2EXV A;  5GTI V;  2C1D A;  2RN0 A;  1KIB A;  1RZ6 A;  4XXL A;  1CSV A;  1CTY A;  2CE0 A;  3WFE C;  3PTZ A;  3H1K D;  5CYT R;  4AAO A;  1GKS A;  1N15 A;  3DP5 A;  1YNR A;  1COR A;  4WQA A;  1K3H A;  1CC5 A;  2L91 A;  4UB8 V;  4EIC A;  3HQ7 A;  1H1O A;  2D0S A;  1I55 A;  2MHM A;  2C1D B;  1J3S A;  1NMI A;  5KAF V;  1QYZ A;  4XYD B;  1PP9 D;  3ZOX A;  3BCC D;  3OCD A;  2OZ1 A;  4WQ8 A;  2MTA C;  1M6Z A;  1MG2 D;  3DMI A;  2BH5 X;  2GC4 D;  3PXT A;  1CIG A;  2AIU A;  1CSX A;  2XTS B;  1CCH A;  1FJ0 A;  1HJ4 A;  1DII C;  2GIW A;  1PPJ D;  1GU2 A;  1CYJ A;  1IRW A;  2JQR A;  3SLE A;  1CTJ A;  3O0R C;  4IL6 V;  3OCD B;  2OZ1 B;  4K3I A;  5KLI B;  5B6Q A;  1H9X A;  4QAO A;  3L4O A;  1AOQ A;  3SVW A;  2FYN B;  1NTK D;  4L3G A;  2BCN B;  5KAI V;  5DJQ C;  1E8E A;  3WU2 V;  4O1W A;  5TJH A;  4EIE A;  3CX5 D;  1DT1 A;  2N9I A;  2N18 B;  4PW9 B;  4RJT A;  3CYT I;  4O1Q A;  2QJP B;  1C52 A;  1CRI A;  1L0N D;  1CRG A;  1CRY A;  1NNO A;  3HQ6 A;  1GJQ A;  1SQV D;  4WQ9 A;  3PHL A;  2YQB A;  5GTH V;  1I6E A;  2N3Y A;  2C1V A;  2JWA A;  4A7P A;  1CRJ A;  4J20 A;  1MG3 D;  2CXB A;  1CED A;  2C9X B;  351C A;  1CHI A;  3PRJ A;  2JTI B;  1IZL 0;  5C9M A;  1YIQ A;  1H9Y A;  2Y0C A;  2RMZ A;  3PXS A;  3TDK A;  1QL4 A;  3PXW A;  1A8C A;  4JCG A;  1CXA A;  2GC7 D;  2YIU B;  4PJ0 V;  4UB6 V;  3NWV A;  1NTM D;  2C8S A;  4KMG A;  1C75 A;  1I6D A;  1DW1 A;  1FI9 A;  1YEB A;  2KNC B;  1KX7 A;  4EDF A;  2IBZ D;  155C A;  1GDV A;  1AOF A;  3RMZ A;  2BLF B;  4FA1 A;  2FRC A;  1KB9 D;  4FB1 A;  1DIQ C;  2B12 B;  3SWS A;  1HRO A;  4EIF A;  3OA8 A;  5B66 V;  1FI3 A;  2V08 A;  5CIB B;  1AKK A;  1S6V B;  2N9J A;  2Y0D A;  3A0B V;  1LC1 A;  4FA5 A;  3L72 D;  2VHD A;  3O20 A;  4Y5R A;  1C6R A;  4NFG B;  1B7V A;  2I8F A;  5B5E V;  2N18 C;  2QJK B;  3L73 D;  3WUI A;  1CHJ A;  3OA8 B;  1ZZH A;  1KYO W;  3CU4 A;  1C2N A;  3WC8 A;  1I8P A;  1LFM A;  2FWL A;  1VYD A;  5DFS A;  2B0Z B;  2ZON G;  1HH7 A;  3HQ9 A;  1HRC A;  1YCC A;  4N0K A;  1A56 A;  5CIE B;  3TGU D;  1BCC D;  3MK7 B;  2CA4 B;  3CXH W;  3VMA A;  1HZU A;  4D6T D;  3RLM A;  3WFB C;  5KLV D;  1RAP A;  3TF5 A;  1EB7 A;  2PCB B;  2K9J B;  4FAV A;  3CP5 A;  2ZOO A;  1LC2 A;  2YCC A;  1OCD A;  3L71 D;  3NBT A;  5CIG B;  1KB0 A;  2ZBO A;  1RAQ A;  3GW6 A;  4L1Q A;  4WQD A;  4PD4 D;  1LMS A;  1M70 A;  1CIF A;  3ZOO A;  1NU1 D;  2B11 B;  1GIW A;  2BPB B;  1SQB D;  2LIT A;  4Q5P A;  1I8O A;  2BH4 X;  1N50 A;  3L4M A;  451C A;  1AYG A;  1CYC A;  1S5L V;  1QN2 A;  4YE1 A;  3VRD A;  4AX3 A;  1ETP A;  5EXQ A;  3SJL A;  1CIE A;  2HV4 A;  2N3B A;  3FWL A;  2AI5 A;  1L9B C;  1CYI A;  2ZXY A;  2A06 D;  2L4D A;  1U75 B;  3WFC C;  1BL9 A;  1W5C T;  1CHH A;  1CO6 A;  2BGV X;  4FA9 A;  1FOC A;  1MZ4 A;  3ZBM A;  1CRC A;  1JDL A;  5E79 V;  1N90 A;  3ZCF A;  1DVV A;  1LS9 A;  1ZRT D;  3HQ8 A;  3ORV A;  3C2C A;  2B4Z A;  2CE1 A;  4U3F D;  1R0Q A;  1SQX D;  1H33 A;  3DR0 A;  4L3H A;  1NTZ D;  1DW0 A;  1NIR A;  3H1I D;  1KX2 A;  4MU8 A;  1FI7 A;  4WQE A;  5DF5 A;  2N9Y B;  1CXC A;  1SQP D;  1A2S A;  1W2L A;  3KHU A;  2QJY B;  1H33 B;  1NML A;  1COT A;  3RN0 A;  3PH2 B;  4EID A;  1CTZ A;  1DW3 A;  3JBT B;  3MK7 C;  3ZOW A;  4H0K A;  4GED B;  1L9J C;  1QL3 A;  2LIR A;  5IY5 1;  1YFC A;  1E29 A;  3CX5 W;  2ORL A;  5KKZ B;  3KZI V;  2DGE A;  3VNW A;  1RZ5 A;  3X39 A;  3WFD C;  3L70 D;  5CID B;  1M60 A;  2YK3 A;  4AAM A;  3SXT A;  3TYI A;  1HJ3 A;  1IQC A;  1BE3 D;  4FAN A;  1F1C A;  1CNO A;  1FHB A;  3GG2 A;  2PAC A;  1EZV D;  2D0W A;  1WEJ F;  1WVE C;  1CSW A;  4V2K A;  2AXT V;  5H2F V;  3ZOY A;  3H1L D;  1E2R A;  1KV9 A;  3A0H V;  1CRH A;  3O5C A;  3L74 D;  2O3J A;  3CWB D;  2BCC D;  1FCD C;  1N9C A;  2C1U A;  1L0L D;  2FYU D;  4AAN A;  4WQ7 A;  4LJI A;  3L75 D;  3H1J D;  2ZZS 1;  5C0Z A;  1H32 A;  4AAL A;  2C2C A;  1HZV A;  1F1F A;  1OAE A;  1IO3 A;  1BGY D;  4H0J A;  1KYO D;  1I54 A;  3VYM A;  1DVH A;  1IRV A;  1SQQ D;  2Q3E A;  4FA4 A;  3RN1 A;  2V07 A;  1K3G A;  1YTC A;  3H1H D;  1DW2 A;  2CA3 B;  3ITK A;  5CIH B;  1C6O A;  2B10 B;  1H31 A;  1H32 B;  2PCC B;  1CCR A;  1CIH A;  4WQC A;  3CXH D;  1HJ5 A;  5DJQ B;  5CIC B;  1I5T A;  5CIF B;  4DY9 A;  3O1Y A;  1C2R A;  5AUR A;  2KS1 A;  1YIC A;  4RSZ A;  3PLN A;  1YEA A;  1C7M A;  3M97 X;  2QG4 A; 
#chains in the Genus database with same CATH topology
 2YXR B;  1CI6 A;  1EZV I;  4D6T J;  5KLV J;  1KB9 H;  3A9F A;  1C6S A;  2E74 C;  2L5G B;  4I7Z B;  3GF7 A;  2GB8 B;  2FKW B;  1T2K D;  4WQB A;  3FX0 A;  3L37 A;  1IFP A;  1U74 B;  1P84 D;  5GTI V;  2KS1 B;  2FFD A;  1KIB A;  3VP8 A;  1PP9 E;  1HUC A;  1BSN A;  2IYO A;  4AAO A;  1VQK P;  5APS A;  1NU1 J;  2C9N Y;  2QM8 A;  1VQ4 P;  3TSI A;  1RF0 C;  1K3H A;  1CC5 A;  5B5E E;  3GF3 A;  1BDD A;  2ZXX A;  3KZI H;  4EIC A;  1FDM A;  3HQ7 A;  1JY2 P;  2D0S A;  1PPJ E;  2C1D B;  1NTZ K;  3BCC D;  2OZ1 A;  1M6Z A;  2GC4 D;  2DW3 A;  3L4F A;  3KXD A;  3JSV C;  2XTS B;  4EIJ A;  1EDI A;  1ZME C;  3V6I A;  3CX5 E;  1GU2 A;  4IFF A;  1NTZ J;  4IL6 V;  3O0R C;  2ZYD A;  4GKG A;  4GOE A;  5KLI B;  2JR8 A;  1NKZ B;  1T3J A;  1GU5 A;  3NMD A;  4GOD A;  3WU2 V;  4O1W A;  2W6B A;  1EDJ A;  1S3J A;  3CCS P;  1S5L E;  2N9I A;  3GMA A;  3TYY A;  2OYI B;  1CSB A;  1L0L G;  4C7N B;  1OXZ A;  1L0N D;  1K05 A;  1SLQ A;  4B86 A;  1CRY A;  1FZA A;  1HTL C;  3H1J G;  1LTJ C;  3UIA A;  3OAK A;  3CC2 P;  1MG3 D;  3H25 A;  1BGY G;  2C9X B;  351C A;  2JTI B;  1VPC A;  1NTM E;  3RK3 E;  1KC8 Q;  1IZN B;  4O9B A;  3U59 A;  3H1H G;  2GM4 A;  1GZL A;  2BAS A;  3PXS A;  4JCG A;  2I1J A;  2YIU B;  4PJ0 V;  2ZT9 C;  1DH3 A;  2FYU K;  2FFD C;  5AW1 B;  1JCD A;  4ZNC A;  1ZLL A;  1I6D A;  3H1L J;  3VMZ A;  2ZVN B;  1GW3 A;  1M7L A;  2IBZ D;  2BCC J;  4H0L D;  4GT1 A;  3RMZ A;  2FYU J;  1HJB A;  1LT9 A;  3L73 E;  2PAJ A;  2JP3 A;  4EIF A;  4JYB A;  1N7S B;  1A02 J;  1H0T A;  4OGQ D;  5CIB B;  1ZOY C;  1GW4 A;  3VOP A;  3NTN A;  2N9J A;  5B66 H;  2VHD A;  4Y5R A;  1YHQ P;  3TGU E;  1BCC E;  5AVZ B;  2OQQ A;  3CMA P;  2N18 C;  3WUI A;  4OH8 B;  3OA8 B;  4OVN F;  3AEF C;  2D2C D;  2E42 A;  3CU4 A;  4M3L A;  1C2N A;  1HH7 A;  1A56 A;  1VQ8 P;  3A0H E;  1IFJ A;  2OYH A;  1ZW0 A;  1E79 H;  1PPJ G;  2KP8 A;  5CCG A;  3HE5 A;  4Z1M H;  1S1C X;  1J2J B;  2K9J B;  2WSF H;  3CP5 A;  5CJ4 A;  1R5S A;  2WSS H;  2E74 D;  2WVR A;  2XNX A;  4L74 A;  3NBT A;  5CIG B;  4L1Q A;  4WQD A;  2E5T A;  2BEQ D;  4PD4 D;  1M70 A;  2B87 B;  1CIF A;  3M06 A;  1GIW A;  1KB9 I;  1GD2 E;  3NXS A;  1QN2 A;  1ZRT E;  3VRD A;  1ETP A;  2YO2 A;  1CIE A;  2N3B A;  2MKV A;  4U3F E;  1DD3 A;  1QVF O;  3C8V A;  3CD6 P;  1FZB A;  2Z5I A;  1JM0 A;  2L4D A;  2IFN A;  3BCC J;  1BDC A;  2BGV X;  1MZ4 A;  3H1I E;  1Q90 D;  1DVV A;  1NYH A;  1LS9 A;  3HQ8 A;  1SQP E;  3O6Q A;  1VL2 A;  1PGP A;  5M1B A;  1GK4 A;  1LT9 C;  1J1D C;  2WSE J;  1NJI Q;  4U7J A;  1NIR A;  1FZC A;  2KI7 B;  1L0N K;  1OIP A;  2WTY A;  1RE3 C;  1KX2 A;  3GHG B;  4MU8 A;  1NTM G;  5DF5 A;  1A2S A;  1W2L A;  3AE8 C;  3V4Q A;  2QE7 H;  1L9J C;  4N3Y B;  1QL3 A;  1MUU A;  1YFC A;  3CCM P;  1L0N J;  4JQ0 D;  3G6E P;  2ORL A;  1A02 F;  4NPD A;  1KD1 Q;  3KZI V;  3E7K A;  5AVX B;  2CPB A;  2DGE A;  3AE9 C;  2B88 A;  4L76 A;  4GDO A;  3L70 D;  3Q5R A;  5B5E H;  4AAM A;  5CCG C;  3TYI A;  1K04 A;  1IQC A;  1PGJ A;  3L73 G;  2IZ1 A;  1PL5 A;  2IFM A;  1BE3 D;  3M0A A;  3MUD A;  1YI2 P;  3L74 E;  1CNO A;  3CWB E;  1FHB A;  1EZV D;  2ZT9 D;  1WVE C;  1IK9 A;  5APQ A;  3TNU A;  3L75 E;  4V2K A;  1YQ4 C;  2M5A A;  1T2K C;  3TGU G;  3AED C;  1BCC G;  3CX5 H;  2E5Y A;  1L4A A;  3HUS A;  1FDI A;  5H2F H;  2IDB A;  2O1J A;  3LW5 H;  1KYO E;  2C1U A;  2YXQ B;  5AW4 B;  1RQV A;  1SQQ E;  4AAN A;  1S9K E;  3QH9 A;  1CW5 A;  3RL0 B;  1GK6 A;  2WPR A;  4AAL A;  2C2C A;  1S5L H;  3CXH E;  1QL2 A;  1IO3 A;  4W7Z A;  4H0J A;  2LKM A;  3RN1 A;  1YTC A;  2WMM A;  1FZC C;  1DW2 A;  2YO3 A;  3IR9 A;  4N78 E;  1C6O A;  1LTS C;  5AVY B;  3B8E B;  2PCC B;  1Y9B A;  1JOC A;  1OW6 A;  1S2E A;  2YMK A;  4HJG H;  2OTJ P;  4BXL A;  4WY4 C;  2H43 A;  4IOI H;  1FC2 C;  3B4S A;  4RSZ A;  1JY2 O;  1LTI C;  4U3F G;  3H1K E;  1SFC A;  2P7J A;  4RO0 A;  1VQM P;  3NBS A;  1IFN A;  1M8O B;  2KSJ A;  5TIS V;  4GYD A;  4P4Q B;  3AE3 C;  3H1I G;  3ZIY A;  1LTJ B;  4HYT B;  5B66 E;  1SS1 A;  1SQP G;  2RN0 A;  2CE0 A;  1Y47 A;  3PTZ A;  1FJP A;  4BRY A;  5CYT R;  3SWK A;  1CI6 B;  2C9L Y;  3V2N A;  4HKZ H;  1IK7 A;  4WQA A;  3V5B A;  1G2C A;  3MUD C;  1FZE A;  2L91 A;  2WT7 B;  1QLE D;  2ZT9 B;  1I55 A;  2GA1 A;  3PJS K;  2FFD B;  1NMI A;  4JPZ B;  1QYZ A;  4XYD B;  1OMI A;  3Q5S A;  3OCD A;  1NO4 A;  2BH5 X;  5KAF H;  3PXT A;  1L4A C;  3HUS C;  1NTK E;  2AIU A;  2WPQ A;  1CSX A;  3AE1 C;  1SP4 A;  3MP7 B;  2KLV A;  3CCQ P;  3B5N C;  1JY2 N;  1FJ0 A;  4YTP C;  4MN4 C;  1W2B O;  3CCU P;  2AXT E;  1HH0 A;  2RKL A;  2WPV B;  3SLE A;  4N6J A;  2K9Y A;  4JYC A;  2OZ1 B;  4K3I A;  2J5U A;  5B6Q A;  4H0L C;  2LXB A;  4QAO A;  1SQV E;  2ZAE B;  3A0H H;  3SFE C;  5CCH A;  2BCN B;  2M3E A;  5DJQ C;  2H88 C;  3D71 A;  1E8E A;  4EIE A;  3L74 G;  5KAI H;  2PGD A;  3QWO C;  2N18 B;  2N9B A;  4RJT A;  3RBX A;  3RGU A;  4I2L C;  1OVU A;  1GL2 D;  3L75 G;  1GJQ A;  3P8C E;  3PHL A;  3M91 A;  3Q5P A;  1I6E A;  2N3Y A;  2JWA A;  4J20 A;  3VMX A;  2D2C C;  2E75 C;  1L0N G;  3AEA C;  5GTH H;  3VMY A;  3L70 J;  3VYI A;  2IPP A;  1IZL 0;  1SFC C;  1LWU B;  1SQQ G;  1H9Y A;  3G3Z A;  1NKN A;  1VDF A;  2RMZ A;  1BE3 J;  2QSI A;  3PXW A;  2KNC A;  1CXA A;  2M0B A;  3C1L A;  4ZMD A;  3FWN A;  5AVS B;  4WB4 A;  5APV A;  3EFF K;  4UB6 H;  4KMG A;  3V2R A;  4Y99 C;  1KIL B;  1YEB A;  3F89 A;  1H88 A;  1GDV A;  1VQN P;  3CC7 P;  4DT0 A;  1KB9 D;  1HRO A;  3CX5 I;  2V08 A;  1AA0 A;  3H1K G;  1EQ7 A;  2FYN C;  1GU4 A;  3T97 A;  3BAS A;  3L72 D;  3O20 A;  4PV1 B;  4NFG B;  3AEG C;  3A0B H;  2JDI H;  1LT9 B;  1J1D B;  5B5E V;  2QJK B;  5AW7 B;  2P1J A;  4D6T E;  1H0T B;  1JMB A;  5KLV E;  2ZXE B;  1HGZ A;  1M56 D;  1PIX A;  5CCH C;  2QIW A;  1PGQ A;  3MHV A;  5H2F E;  2J58 A;  2P58 A;  2ZON G;  2WSE H;  3CI9 A;  4WY4 D;  4N0K A;  2W6J H;  1D7M A;  2KYV A;  1M1J A;  1VQ7 P;  3MGN A;  1NU1 E;  2ZYA A;  1J1E C;  1HBW A;  2W6A A;  3WFB C;  4H13 B;  1RAP A;  4NPE A;  2ZOO A;  1NAY A;  1W2E A;  1FOS F;  1OCD A;  3L71 D;  1WMK A;  3G9R A;  1RHZ B;  1NTK G;  2ZBO A;  3GW6 A;  4JBZ A;  1VQO P;  2OYH B;  1OZH A;  1IJD B;  2B11 B;  1IC2 A;  1KYO H;  3HE5 B;  1SQB D;  1I8O A;  1M1K Q;  3CCE P;  1AYG A;  1CYC A;  1S5L V;  5CBN A;  1S4X A;  5EXQ A;  3SJL A;  2HV4 A;  3FWL A;  2HOD A;  1JY3 P;  1SQV G;  1Q86 Q;  1CYI A;  2ZXY A;  2A06 D;  1DEB A;  3CCR P;  1NTZ E;  2A45 G;  3CXH H;  3WFC C;  5APU A;  2GUV A;  1Q7Y Q;  1HJ0 A;  1JTH A;  1CRC A;  2P67 A;  4DZO A;  1N90 A;  1L4A D;  1KV4 A;  1URQ D;  2XU6 A;  3ORV A;  3B5N D;  2CE1 A;  4L75 A;  1R0Q A;  1AVO A;  3WUT A;  1FDO A;  5AW6 B;  1IFD A;  2KSE A;  3Q2Y A;  3IAO A;  1E5W A;  3AEC C;  1KIL E;  2QJY B;  1DEE G;  2R3S A;  3PP5 A;  1RY3 A;  4LLH A;  1COT A;  4WVZ A;  3PH2 B;  2Q7C A;  1CTZ A;  1DW3 A;  3MK7 C;  3ZOW A;  1RE3 A;  1FZC B;  2AXC A;  4UB8 E;  2K1A A;  3USS A;  5IY5 1;  1SVF A;  1E29 A;  3CX5 W;  2KOG A;  5KAF E;  1N73 A;  1OFC X;  2HR3 A;  1RZ5 A;  4H44 C;  1YTZ T;  5CJ0 A;  1M1J C;  1GL2 A;  2KK7 A;  4ASV A;  2E75 D;  4YXD C;  2YKP A;  1SFC D;  5AW0 B;  3SXT A;  4DCK A;  1ZR4 A;  1HJ3 A;  3H1L E;  1Q81 Q;  5APX A;  3MZW B;  4W7Y A;  2BCC E;  4DOJ A;  4QMA A;  1YIT P;  2NPS C;  5AW8 B;  2FYU E;  3V2P A;  1FAV A;  5KAI E;  3RK3 C;  2NZ2 A;  4IFM A;  4I1L A;  1E2R A;  1X22 A;  1VQ5 P;  2AXT H;  3A0H V;  3O5C A;  1RE4 A;  1HVV A;  4D6T G;  3M9B A;  5KLV G;  1H89 A;  1N9C A;  1OVV A;  3AE4 C;  1L0L D;  3TNU B;  1KZU B;  3IN6 A;  2M5A B;  5GTH E;  2A45 H;  3H1J D;  2ZZS 1;  1AV1 A;  2CPS A;  1K73 Q;  1L4A B;  2XND H;  2H89 C;  3HUS B;  1NU1 G;  1X0T A;  1BGY D;  1DD4 A;  3L72 J;  3B71 A;  1N2D C;  1I54 A;  1DVH A;  1KTM A;  3S9O A;  1IRV A;  2ZYG A;  2Q3E A;  5AW5 B;  3H1H D;  2Q3I A;  2JO1 A;  4H0L B;  4RES B;  4UB6 E;  1H31 A;  1LP1 A;  4WQC A;  5CCH D;  1HJ5 A;  5DJQ B;  1I5T A;  1P84 E;  3O1Y A;  1C2R A;  2FBW C;  1JMM A;  1LGH B;  3NFQ A;  1YIC A;  4EYY Q;  3AE7 C;  4OGQ B;  2B89 A;  1JEK A;  3M9H A;  4YPC A;  1RF1 A;  2QG4 A;  2Y9Z A;  4WBA A;  1SQB K;  3I55 P;  2ZFC A;  2Y0E A;  4PWA A;  1NTZ G;  4DJG A;  3RK2 D;  2FXM A;  1CSU A;  3LIE A;  4WY4 A;  4AUW A;  1N73 C;  1X8Y A;  3L71 J;  3BRT B;  3FGA D;  4KT0 J;  2EXV A;  2D2C B;  3L72 E;  1GL2 C;  1RZ6 A;  4XXL A;  1CTY A;  3BCC E;  1SFC B;  3A0B E;  2P2U A;  3AE6 C;  2UWJ E;  1N15 A;  1SQB J;  2V7Q J;  2IZ0 A;  4IL6 X;  2MJZ A;  3CCJ P;  1H1O A;  4LC1 A;  1T8Z A;  2E76 C;  1J3S A;  2YKO A;  4BRY B;  1MV8 A;  1PP9 D;  3CC4 P;  1ZN5 A;  2E74 B;  4AQR D;  4Y99 B;  2MTA C;  1MG2 D;  2AEM A;  3DMI A;  1G2C B;  4KJM A;  1RE4 C;  1CCH A;  2HPC A;  5BU5 A;  3MTU E;  2K9J A;  1PPJ D;  4HH2 A;  5AW3 B;  3L71 E;  1CYJ A;  4EI2 A;  2JQR A;  3CXH I;  2O1K A;  2XZR A;  4NPF X;  3D70 A;  4C7R A;  3OCD B;  1URQ A;  1M57 D;  1H9X A;  1L0N E;  3B5N A;  3HTK A;  1AOQ A;  5AVT B;  2VRS A;  3KDP B;  1EDK A;  2FYN B;  1K8A Q;  3AE2 C;  3H1L G;  1QGK B;  3JCU H;  3CX5 D;  1CZQ A;  2BCC G;  1DT1 A;  3WUU A;  3AEE C;  4GOF A;  2FYU G;  1C52 A;  2N1T A;  1CRI A;  1CRG A;  1NNO A;  5KJ7 D;  4AYC A;  3HQ6 A;  2FXP A;  4WQ9 A;  3U1A A;  2Z5H A;  3H32 A;  3OW2 O;  2YKQ A;  2R3C A;  1MZ9 A;  4A7P A;  4I6M C;  1CRJ A;  1G1J A;  2CXB A;  4H44 D;  5E79 E;  3L35 A;  5AW9 B;  3PRJ A;  1RF1 C;  5C9M A;  1YIQ A;  2K37 A;  2IYP A;  1J1E B;  3TDK A;  3HRN A;  1QL4 A;  2K88 A;  2W90 A;  3R2P A;  2IBZ E;  1VQP P;  2NPS D;  1L0L K;  3II6 A;  3NWV A;  2Q5U A;  1ZP0 C;  3N7N A;  2FXO A;  1NTM D;  2WWW A;  3RK3 D;  1C75 A;  1QL1 A;  1FI9 A;  1N7L A;  2JWD A;  2KNC B;  155C A;  2ZJS E;  1AVY A;  2FRC A;  4FB1 A;  1L0L J;  4XFJ A;  2WSF J;  1RH5 B;  3IFM A;  4XA4 A;  3CPW O;  3H1J J;  5B66 V;  1FI3 A;  2Q9I A;  1S6V B;  4UB8 H;  1BGY J;  5APW A;  2FY8 A;  3AEB C;  1C6R A;  1AQT A;  3VN0 A;  2I8F A;  1FZF A;  3L73 D;  3H1H J;  1URQ C;  2A45 I;  1CHJ A;  2JJL A;  2QJP C;  1ZZH A;  3L72 G;  1FE6 A;  1KYO W;  5APY A;  2LR2 A;  3BCC G;  5AVQ B;  1Q2N A;  3WC8 A;  3T97 B;  1HF9 A;  2B0Z B;  1HRC A;  1YCC A;  2CK3 H;  4Y28 J;  3TGU D;  1BCC D;  4PD4 E;  3MK7 B;  3G4S P;  1Y8A A;  2CA4 B;  3CXH W;  1TU3 F;  2PRR A;  2OTK E;  3FXD A;  2N1T C;  2M8R A;  2O01 J;  4EOT A;  1LC2 A;  2YCC A;  2OAR A;  1LTB C;  3K5B A;  1M1J B;  3VP9 A;  1KOR A;  3L71 G;  2BH4 X;  2W27 A;  3L4M A;  3D6Z A;  4ZKP A;  1USE A;  4TLF A;  3EQ2 A;  2IX7 C;  4AX3 A;  1L9B C;  2E76 D;  3OJA B;  1PP9 J;  1CO6 A;  1FOC A;  3ZBM A;  1FOS E;  1JDL A;  3ZCF A;  3HD7 A;  1ZRT D;  1X79 B;  2B4Z A;  1JY3 N;  1OW8 A;  2HOD B;  4U3F D;  1SQX D;  2HFE D;  1H33 A;  1HGV A;  3DR0 A;  1DW0 A;  1YQ3 C;  1P84 H;  1JTH B;  3H1I D;  5GTI E;  2QEX P;  1YYC A;  4WQE A;  3KPE A;  4WWI A;  1USD A;  5KTB A;  1CXC A;  1SQP D;  1T6A A;  4JF7 A;  5K5G B;  2KUB A;  3L70 E;  5APT A;  2IBZ G;  2WT7 A;  3SWF A;  4H0K A;  4GED B;  1WT6 A;  2KLU A;  5CMZ A;  1M90 Q;  1KFN A;  3CL3 D;  3LW5 J;  2LIR A;  3WUV A;  1LTG C;  1BE3 E;  2WSC J;  1T3U A;  3HE4 A;  3RBZ A;  1AJY A;  2H7H A;  1EZV E;  3X39 A;  3WFD C;  3TK1 A;  5EFW B;  2JKV A;  1NTM K;  5KJ7 A;  1KQG B;  1U57 A;  1LTT C;  1ZR2 A;  1FS0 E;  2OTL P;  2I1K A;  2Z4E A;  1YJW P;  4FAN A;  3RL0 C;  1N73 B;  1GDT A;  1KQL A;  1K9M Q;  1N7S D;  4IL6 E;  1X9V A;  3GG2 A;  1VQ6 P;  2PAC A;  1N8R Q;  3JCU E;  1KQF B;  1GL2 B;  1AFO A;  3RK2 C;  1Z56 A;  1NHL A;  5H2F V;  3M0D A;  1NTM J;  1S72 P;  1Q82 Q;  1OX3 A;  3WU2 E;  3ZOY A;  2NPS A;  1KV9 A;  4XE5 B;  1CRH A;  3L74 D;  2O3J A;  3CWB D;  1FCD C;  2E76 B;  1QVG O;  4WQ7 A;  1VF5 C;  1DIP A;  3L75 D;  2V7Q H;  2XV5 A;  3RL0 g;  1H32 A;  1YTZ I;  2W83 C;  1LWU A;  3HD7 C;  3M9Q A;  1F1F A;  1L2P A;  1HWT C;  2SPZ A;  4LGD E;  1KYO D;  3N4X A;  1VQ9 P;  1SQQ D;  2V07 A;  3L73 J;  2B9B A;  2C0W A;  2CA3 B;  1S9K D;  1YBK A;  4PJ0 E;  1QX8 A;  2B10 B;  1ZXG A;  5E79 H;  2O01 N;  1CIH A;  1JNM A;  3CXH D;  5KKZ C;  1KIL A;  5CIF B;  4DY9 A;  1DX7 A;  5AUR A;  2KS1 A;  3PLN A;  3JC2 2;  3TGU J;  1BCC J;  1C7M A;  3KQG A;  1YIJ P;  4N78 D;  1H31 B;  2N1T D;  1GQ1 A;  3O6Q B;  3OA7 A;  1LP1 B;  3A5T A;  1GTW A;  2I8D A;  3A7O A;  1QKS A;  2DVH A;  5TIS H;  1HCM A;  2C1D A;  1CSV A;  3WFE C;  5KJ7 C;  1RF1 B;  3H1K D;  2WQY C;  1GKS A;  3F5H A;  3DP5 A;  1YNR A;  1COR A;  4BWN A;  4WY4 B;  5BVZ A;  1BSH A;  4UB8 V;  3PH0 A;  3CCV P;  1SQX K;  2MHM A;  4YXW H;  3Q1M A;  3Q3D A;  3S4R A;  5KAF V;  5C39 A;  3ZOX A;  3M0D C;  2KZI A;  4WQ8 A;  2POH A;  3CME P;  3L70 G;  1CIG A;  1SQP K;  3W67 A;  1PGO A;  1PP9 G;  1BE3 G;  1WRG A;  4U3F J;  1HJ4 A;  1DII C;  2GIW A;  1SQX J;  1IRW A;  3D6Y A;  1CTJ A;  1EZV G;  2OYI A;  4C7N A;  3L4O A;  3H1I J;  1H8A A;  3SVW A;  1JO5 A;  1LWU C;  4PD4 H;  1NTK D;  4L3G A;  1UII A;  2HPC B;  5KAI V;  3I5C A;  3E1R A;  1SQP J;  4R4M A;  2Y9Y A;  5AVV B;  1OWA A;  5TJH A;  1U7J A;  1NWQ A;  4ZKU A;  4PW9 B;  1RQU A;  1URQ B;  1NOH A;  3CYT I;  5AVU B;  1P84 I;  4O1Q A;  2QJP B;  3B5N B;  3HTK B;  2ZVO B;  1VQL P;  4I7Z C;  1SQV D;  2YQB A;  5GTH V;  1KIL C;  1LJ2 A;  2C1V A;  1MFZ A;  3ABV C;  1GMJ A;  1CED A;  3EFG A;  1EDL A;  1CHI A;  3SFD C;  2JEE A;  1SQX E;  2N1T B;  2Y0C A;  2Q1K A;  4R4L A;  3P8C D;  3H32 B;  1G1I A;  3RL0 D;  1A8C A;  2GC7 D;  3C9I A;  4UB6 V;  2G3A A;  1KB9 E;  4PV1 C;  2O01 H;  2OYO A;  2C8S A;  1EXJ A;  3P32 A;  1N7S A;  1JB0 J;  2KZJ A;  2QJK C;  1DW1 A;  2WZ7 A;  2E75 B;  1KX7 A;  3L74 J;  3CWB J;  4EDF A;  5CBO A;  2M3B A;  1LT1 A;  2J59 M;  1SQQ K;  1AOF A;  5GTI H;  2BLF B;  4FA1 A;  1DIQ C;  2B12 B;  2GUS A;  3SWS A;  1EC5 A;  1NVO A;  1VF5 D;  1YJN P;  3L75 J;  1R8E A;  3KZI E;  5KLI C;  3OA8 A;  1EXI A;  2KIK A;  3MIW A;  3KYQ A;  1AKK A;  2Y0D A;  3A0B V;  1LC1 A;  4FA5 A;  3HD7 D;  4ASW A;  2WPS A;  4H13 C;  2KB7 P;  3P8M C;  1B7V A;  1KYO I;  1SQQ J;  2K3R A;  3D0W A;  3BVH A;  2YNY A;  2R32 A;  2OYI C;  2OYH C;  1YJ9 P;  1KQS O;  3CCL P;  1I8P A;  1LFM A;  2FWL A;  1VYD A;  5DFS A;  2QVA A;  3HQ9 A;  3I56 P;  5CIE B;  2RH0 A;  1S5L X;  4IL6 H;  2B87 A;  3VMA A;  1SQB E;  1HZU A;  4D6T D;  1FU1 A;  1W5C E;  3L36 A;  3RLM A;  5KLV D;  3TF5 A;  1EB7 A;  2PCB B;  1UIX A;  2R5B A;  4FAV A;  1JUN A;  1JCC A;  1KFM A;  3V2Q A;  2G8Y A;  2HG5 D;  3WU2 H;  2YIU C;  1MFT A;  3H6P A;  1KB0 A;  1RAQ A;  2A06 E;  1PV3 A;  3BRV B;  1LMS A;  2IBZ I;  4C46 A;  3H1K J;  3ZOO A;  1XTG B;  1NU1 D;  2WIT A;  2BPB B;  2LIT A;  2Q6Q A;  4Q5P A;  2WSC H;  1N50 A;  451C A;  4KHX A;  3MD0 A;  4YE1 A;  2W8Z A;  2XDJ A;  2BEZ F;  4RKU J;  3CLQ A;  3ZDM A;  2AI5 A;  1FZG A;  3RK2 B;  3U1C A;  3G71 P;  1ZV8 A;  1U75 B;  2QJY C;  1BL9 A;  3O8Z A;  1W5C T;  1NGM B;  1CHH A;  1N7S C;  4HB1 A;  4FA9 A;  4IFD K;  3SSU A;  1NTK K;  5E79 V;  1IFM A;  3GHG A;  3S1K A;  2E43 A;  3V4W A;  1OVR A;  3C2C A;  3FXE A;  4PJ0 H;  2H8P D;  5TIS E;  4L3H A;  5AVW B;  1VF5 B;  1NTZ D;  1LNQ A;  3GLM A;  5CHX A;  1QEX A;  3AE5 C;  1SQV K;  1MKM A;  1FI7 A;  1SQX G;  3HD7 B;  2N9Y B;  1NTK J;  3KHU A;  1FBM A;  1KMI Z;  3LID A;  1H33 B;  4OWF A;  1NML A;  3RN0 A;  1LTA C;  2XKM A;  4EID A;  4TT3 H;  3JBT B;  1PZQ A;  4GIF A;  1IFI A;  4W80 A;  5BU8 B;  4PD4 I;  1R5L A;  1SQV J;  5KKZ B;  1NAF A;  1KIL D;  2FYZ A;  3VNW A;  5CID B;  1M60 A;  2YK3 A;  2R5D A;  4K3A A;  2QM7 A;  2P10 A;  5AW2 B;  3P7K A;  2QRX A;  2PFX A;  1RF0 A;  3W68 A;  1F1C A;  1XTC C;  3HE4 B;  2OGU A;  1U7M A;  1JY3 O;  2D0W A;  1WEJ F;  1L0L E;  2AEJ A;  1CSW A;  2AXT V;  4PV1 D;  4CPG A;  3E1I A;  3H1J E;  4L73 A;  3H1L D;  2KXP B;  5AVR B;  3A2A A;  4H44 B;  1PFI A;  1AQ5 A;  2YMY A;  1OW7 A;  1BGY E;  2BCC D;  2HLO A;  1IO4 A;  5DJU B;  2FYU D;  5DJT B;  1NH4 A;  2PP6 A;  2R44 A;  3H1H E;  2ITA A;  4LJI A;  3CWB G;  4OGQ C;  5C0Z A;  2NPS B;  3GHG C;  1HZV A;  4K35 A;  1SQB G;  1OAE A;  4H13 D;  3RK3 B;  3VYM A;  2QA4 P;  3SWY A;  3A3Y B;  1KN7 A;  4FA4 A;  3WMM 0;  1K3G A;  2HYN A;  2A06 G;  2V4H A;  5L8R J;  5KLV K;  3ITK A;  5CIH B;  1N86 A;  3IF4 A;  1H32 B;  3EWK A;  2AEF A;  1CCR A;  2NRG A;  3R4Y A;  5CCG D;  2C0X A;  5CIC B;  3VTP C;  1LTJ A;  2LXC B;  1FJK A;  1YEA A;  3BAT A;  1NU1 K;  3M97 X; 
#chains in the Genus database with same CATH homology
 2Y0E A;  4PWA A;  3NBS A;  1H31 B;  1GQ1 A;  3A9F A;  1CSU A;  1C6S A;  5TIS V;  2GB8 B;  4GYD A;  4P4Q B;  1QKS A;  4WQB A;  3ZIY A;  2DVH A;  1U74 B;  1P84 D;  1HCM A;  2EXV A;  5GTI V;  2C1D A;  2RN0 A;  1KIB A;  1RZ6 A;  4XXL A;  1CSV A;  1CTY A;  2CE0 A;  3WFE C;  3PTZ A;  3H1K D;  5CYT R;  4AAO A;  1GKS A;  1N15 A;  3DP5 A;  1YNR A;  1COR A;  4WQA A;  1K3H A;  1CC5 A;  2L91 A;  4UB8 V;  4EIC A;  3HQ7 A;  1H1O A;  2D0S A;  1I55 A;  2MHM A;  2C1D B;  1J3S A;  1NMI A;  5KAF V;  1QYZ A;  4XYD B;  1PP9 D;  3ZOX A;  3BCC D;  3OCD A;  2OZ1 A;  4WQ8 A;  2MTA C;  1M6Z A;  1MG2 D;  3DMI A;  2BH5 X;  2GC4 D;  3PXT A;  1CIG A;  2AIU A;  1CSX A;  2XTS B;  1CCH A;  1FJ0 A;  1HJ4 A;  1DII C;  2GIW A;  1PPJ D;  1GU2 A;  1CYJ A;  1IRW A;  2JQR A;  3SLE A;  1CTJ A;  3O0R C;  4IL6 V;  3OCD B;  2OZ1 B;  4K3I A;  5KLI B;  5B6Q A;  1H9X A;  4QAO A;  3L4O A;  1AOQ A;  3SVW A;  2FYN B;  1NTK D;  4L3G A;  2BCN B;  5KAI V;  5DJQ C;  1E8E A;  3WU2 V;  4O1W A;  5TJH A;  4EIE A;  3CX5 D;  1DT1 A;  2N9I A;  2N18 B;  4PW9 B;  4RJT A;  3CYT I;  4O1Q A;  2QJP B;  1C52 A;  1CRI A;  1L0N D;  1CRG A;  1CRY A;  1NNO A;  3HQ6 A;  1GJQ A;  1SQV D;  4WQ9 A;  3PHL A;  2YQB A;  5GTH V;  1I6E A;  2N3Y A;  2C1V A;  2JWA A;  4A7P A;  1CRJ A;  4J20 A;  1MG3 D;  2CXB A;  1CED A;  2C9X B;  351C A;  1CHI A;  3PRJ A;  2JTI B;  1IZL 0;  5C9M A;  1YIQ A;  1H9Y A;  2Y0C A;  2RMZ A;  3PXS A;  3TDK A;  1QL4 A;  3PXW A;  1A8C A;  4JCG A;  1CXA A;  2GC7 D;  2YIU B;  4PJ0 V;  4UB6 V;  3NWV A;  1NTM D;  2C8S A;  4KMG A;  1C75 A;  1I6D A;  1DW1 A;  1FI9 A;  1YEB A;  2KNC B;  1KX7 A;  4EDF A;  2IBZ D;  155C A;  1GDV A;  1AOF A;  3RMZ A;  2BLF B;  4FA1 A;  2FRC A;  1KB9 D;  4FB1 A;  1DIQ C;  2B12 B;  3SWS A;  1HRO A;  4EIF A;  3OA8 A;  5B66 V;  1FI3 A;  2V08 A;  5CIB B;  1AKK A;  1S6V B;  2N9J A;  2Y0D A;  3A0B V;  1LC1 A;  4FA5 A;  3L72 D;  2VHD A;  3O20 A;  4Y5R A;  1C6R A;  4NFG B;  1B7V A;  2I8F A;  5B5E V;  2N18 C;  2QJK B;  3L73 D;  3WUI A;  1CHJ A;  3OA8 B;  1ZZH A;  1KYO W;  3CU4 A;  1C2N A;  3WC8 A;  1I8P A;  1LFM A;  2FWL A;  1VYD A;  5DFS A;  2B0Z B;  2ZON G;  1HH7 A;  3HQ9 A;  1HRC A;  1YCC A;  4N0K A;  1A56 A;  5CIE B;  3TGU D;  1BCC D;  3MK7 B;  2CA4 B;  3CXH W;  3VMA A;  1HZU A;  4D6T D;  3RLM A;  3WFB C;  5KLV D;  1RAP A;  3TF5 A;  1EB7 A;  2PCB B;  2K9J B;  4FAV A;  3CP5 A;  2ZOO A;  1LC2 A;  2YCC A;  1OCD A;  3L71 D;  3NBT A;  5CIG B;  1KB0 A;  2ZBO A;  1RAQ A;  3GW6 A;  4L1Q A;  4WQD A;  4PD4 D;  1LMS A;  1M70 A;  1CIF A;  3ZOO A;  1NU1 D;  2B11 B;  1GIW A;  2BPB B;  1SQB D;  2LIT A;  4Q5P A;  1I8O A;  2BH4 X;  1N50 A;  3L4M A;  451C A;  1AYG A;  1CYC A;  1S5L V;  1QN2 A;  4YE1 A;  3VRD A;  4AX3 A;  1ETP A;  5EXQ A;  3SJL A;  1CIE A;  2HV4 A;  2N3B A;  3FWL A;  2AI5 A;  1L9B C;  1CYI A;  2ZXY A;  2A06 D;  2L4D A;  1U75 B;  3WFC C;  1BL9 A;  1W5C T;  1CHH A;  1CO6 A;  2BGV X;  4FA9 A;  1FOC A;  1MZ4 A;  3ZBM A;  1CRC A;  1JDL A;  5E79 V;  1N90 A;  3ZCF A;  1DVV A;  1LS9 A;  1ZRT D;  3HQ8 A;  3ORV A;  3C2C A;  2B4Z A;  2CE1 A;  4U3F D;  1R0Q A;  1SQX D;  1H33 A;  3DR0 A;  4L3H A;  1NTZ D;  1DW0 A;  1NIR A;  3H1I D;  1KX2 A;  4MU8 A;  1FI7 A;  4WQE A;  5DF5 A;  2N9Y B;  1CXC A;  1SQP D;  1A2S A;  1W2L A;  3KHU A;  2QJY B;  1H33 B;  1NML A;  1COT A;  3RN0 A;  3PH2 B;  4EID A;  1CTZ A;  1DW3 A;  3JBT B;  3MK7 C;  3ZOW A;  4H0K A;  4GED B;  1L9J C;  1QL3 A;  2LIR A;  5IY5 1;  1YFC A;  1E29 A;  3CX5 W;  2ORL A;  5KKZ B;  3KZI V;  2DGE A;  3VNW A;  1RZ5 A;  3X39 A;  3WFD C;  3L70 D;  5CID B;  1M60 A;  2YK3 A;  4AAM A;  3SXT A;  3TYI A;  1HJ3 A;  1IQC A;  1BE3 D;  4FAN A;  1F1C A;  1CNO A;  1FHB A;  3GG2 A;  2PAC A;  1EZV D;  2D0W A;  1WEJ F;  1WVE C;  1CSW A;  4V2K A;  2AXT V;  5H2F V;  3ZOY A;  3H1L D;  1E2R A;  1KV9 A;  3A0H V;  1CRH A;  3O5C A;  3L74 D;  2O3J A;  3CWB D;  2BCC D;  1FCD C;  1N9C A;  2C1U A;  1L0L D;  2FYU D;  4AAN A;  4WQ7 A;  4LJI A;  3L75 D;  3H1J D;  2ZZS 1;  5C0Z A;  1H32 A;  4AAL A;  2C2C A;  1HZV A;  1F1F A;  1OAE A;  1IO3 A;  1BGY D;  4H0J A;  1KYO D;  1I54 A;  3VYM A;  1DVH A;  1IRV A;  1SQQ D;  2Q3E A;  4FA4 A;  3RN1 A;  2V07 A;  1K3G A;  1YTC A;  3H1H D;  1DW2 A;  2CA3 B;  3ITK A;  5CIH B;  1C6O A;  2B10 B;  1H31 A;  1H32 B;  2PCC B;  1CCR A;  1CIH A;  4WQC A;  3CXH D;  1HJ5 A;  5DJQ B;  5CIC B;  1I5T A;  5CIF B;  4DY9 A;  3O1Y A;  1C2R A;  5AUR A;  2KS1 A;  1YIC A;  4RSZ A;  3PLN A;  1YEA A;  1C7M A;  3M97 X;  2QG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...