2QJPB

Crystal structure of wild type rhodobacter sphaeroides with stigmatellin and antimycin inhibited
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
molecule keywords Cytochrome b
total genus 67
structure length 256
sequence length 256
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjpB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjpB02
4PJ0V 1HJ4A 2C1DA 1N9CA 4KMGA 4A7PA 1C52A 4WQAA 1CNOA 3CX5W 1PPJD 4QAOA 4WQ7A 5CIFB 5CICB 1I6EA 3C2CA 2BH4X 4PD4D 2RN0A 2N9IA 1A56A 2Y0EA 1DW1A 1K3HA 2CE0A 1I6DA 4RSZA 1CHHA 2JWAA 3WU2V 2D0WA 2CA3B 2IBZD 2C8SA 4L3GA 1RZ5A 3O5CA 1N15A 1KYOD 1NTZD 2GIWA 2BCCD 3CX5D 5E79V 4EIFA 1IRVA 3NWVA 5CIBB 1KB9D 4UB6V 4WQEA 5C9MA 4WQCA 2ZONG 1CEDA 1CRCA 1CYCA 1CRIA 3A0BV 2QJPB 1CIFA 2JTIB 2V08A 2N9YB 1HROA 1HZVA 4O1WA 2Y0CA 2LIRA 1LMSA 2K9JB 5B66V 1FI9A 1IZL0 3BCCD 3O1YA 1CYJA 5DJQB 2YK3A 2ZZS1 2LITA 1CXCA 5B5EV 3GG2A 1LC1A 3L73D 1NNOA 5C0ZA 3PXWA 1CO6A 1H9XA 1F1CA 5CIDB 1CHJA 5KLIB 1YNRA 1FOCA 2C1UA 2Y0DA 4AAMA 4FAVA 1CC5A 2FYNB 1CTYA 1E29A 1QN2A 1FCDC 1CORA 3ZIYA 1CCRA 4N0KA 2I8FA 3CXHW 1H33B 2OZ1A 1MG2D 4AALA 4RJTA 1I8PA 2QJYB 1HJ3A 1EB7A 1BCCD 1A2SA 1VYDA 4XYDB 4L3HA 3SWSA 1H32A 5DF5A 1CTJA 2DVHA 1LC2A 3TF5A 2BLFB 3WFEC 3RLMA 3CU4A 1CSUA 3DMIA 3HQ8A 2YQBA 2CE1A 1AOFA 1LFMA 1ZZHA 4UB8V 1U74B 3PXSA 5IY51 351CA 1DVHA 4WQDA 1KV9A 1CIGA 2RMZA 2N3YA 5H2FV 4IL6V 2FRCA 4XXLA 1CRGA 5TISV 1COTA 2HV4A 3WFCC 1IO3A 1P84D 3CXHD 1LS9A 1QKSA 3VNWA 1PP9D 1M70A 1CCHA 2OZ1B 2CXBA 1DW3A 1FHBA 1CYIA 2C1DB 3H1LD 4LJIA 3CYTI 1E8EA 1CRYA 1H32B 3VRDA 4DY9A 1NTMD 1KYOW 4WQ8A 2GC7D 1W2LA 3O0RC 4AAOA 3OA8B 1CSXA 4H0JA 1B7VA 2YIUB 1C6SA 1H1OA 1BL9A 4GYDA 1DW0A 3WFDC 1DIQC 2GC4D 1HH7A 1KB0A 1CXAA 2AI5A 5CYTR 2B12B 2ZOOA 3SXTA 4FANA 1H9YA 3VYMA 3ZCFA 2VHDA 4FA1A 5B6QA 1I54A 1L0ND 1I5TA 1K3GA 3ITKA 5KAFV 2GB8B 1OAEA 4D6TD 4FA5A 1S6VB 3M97X 3HQ7A 1KX2A 4AANA 1SQBD 3L4OA 3TDKA 3ZOWA 4MU8A 4O1QA 5GTHV 2YCCA 5CIHB 1AYGA 1QL4A 5EXQA 3CP5A 1YIQA 3NBTA 1FI3A 5KLVD 2QG4A 1CTZA 3OCDA 3L75D 3DP5A 1H31A 4Y5RA 3L70D 3L71D 1HRCA 2BCNB 2B10B 1KX7A 3PLNA 3JBTB 1WVEC 1OCDA 3PTZA 1FJ0A 1C2NA 3H1ID 1SQXD 2ZXYA 4EIEA 4WQ9A 4EICA 2Q3EA 1ETPA 4PWAA 1C2RA 4U3FD 4Q5PA 2MTAC 4NFGB 1GDVA 4YE1A 5DFSA 2KNCB 3L4MA 1N90A 4PW9B 2A06D 4J20A 1SQPD 5AURA 2L91A 3GW6A 1QYZA 1NTKD 1RAPA 1CSVA 4AX3A 2PCCB 1MZ4A 4FB1A 1C7MA 1CSWA 5CIEB 3L72D 2C9XB 2PACA 3H1JD 2XTSB 5GTIV 5CIGB 4WQBA 2AXTV 3HQ6A 3PRJA 3PH2B 2N3BA 3ZBMA 155CA 1F1FA 1U75B 3O20A 3X39A 1I8OA 4L1QA 1EZVD 1M6ZA 2B4ZA 3WFBC 4H0KA 1CRHA 3VMAA 451CA 3RN0A 1L0LD 2V07A 1FI7A 1A8CA 1NMIA 2BH5X 3L74D 2N18C 1C6OA 2EXVA 4GEDB 1W5CT 5DJQC 3PHLA 2BGVX 3TGUD 1DVVA 1H33A 1HCMA 1I55A 2QJKB 2AIUA 3HQ9A 4V2KA 2PCBB 1L9JC 1YICA 1SQQD 2C1VA 1CRJA 1KIBA 2KS1A 1E2RA 2MHMA 1L9BC 4EIDA 1CIEA 3PXTA 1WEJF 2BPBB 2ZBOA 4K3IA 1HJ5A 1JDLA 3ORVA 2CA4B 1M60A 1DW2A 1YEBA 2N9JA 1H31B 1DIIC 4P4QB 3WC8A 1HZUA 3MK7B 3RN1A 1BGYD 3DR0A 1IQCA 1YFCA 3RMZA 1N50A 2FYUD 4FA4A 2N18B 1GIWA 1NU1D 1CIHA 5TJHA 1AOQA 1GQ1A 3ZOXA 3WUIA 1SQVD 1RZ6A 1GU2A 1RAQA 3A0HV 3OCDB 1AKKA 1YEAA 1ZRTD 3TYIA 4JCGA 1IRWA 3ZOYA 1YTCA 2D0SA 2C2CA 2ORLA 3OA8A 4EDFA 3SJLA 2B11B 3SVWA 1R0QA 3H1KD 2JQRA 1NIRA 2O3JA 3ZOOA 1C6RA 3NBSA 4FA9A 5KKZB 1GKSA 3CWBD 3MK7C 1CHIA 3H1HD 2B0ZB 1MG3D 1DT1A 1C75A 3KHUA 1YCCA 1BE3D 3SLEA 3KZIV 2DGEA 2FWLA 1QL3A 3FWLA 1NMLA 3A9FA 1GJQA 2L4DA 5KAIV 1S5LV 1J3SA
chains in the Genus database with same CATH superfamily
1IK7A 1FAVA 1NYHA 3C8VA 2AEJA 2XU6A 4WQAA 1CNOA 1ZLLA 3S4RA 1PPJD 2BH4X 5APSA 2RN0A 2N9IA 3H1HJ 1K3HA 3H32A 4H44D 4C7NA 2KUBA 1JM0A 2JWAA 2D0WA 2BEQD 2WITA 5CMZA 1QEXA 4QMAA 3O5CA 1KC8Q 1SFCA 2BCCD 4W80A 1ZV8A 2AEMA 1GTWA 2FFDC 1AA0A 4H13D 3NWVA 3T97A 3UIAA 4OWFA 2YMYA 5CIBB 3HUSC 3CCSP 5C9MA 4NPDA 3CL3D 5AW6B 3RK2D 2ZONG 1CZQA 1PFIA 1EZVE 1MFTA 3R2PA 3AEDC 2KK7A 2JTIB 2KI7B 3K5BA 4IFMA 1X8YA 1VDFA 1LMSA 2K9JB 4XA4A 5E79E 5AVVB 3CCQP 1KQSO 1CYJA 1NU1J 1SFCC 4WY4A 1NWQA 4U7JA 5DJQB 2YK3A 1SS1A 3HTKB 2LITA 1URQC 1IFIA 2HODB 4ZKUA 4JF7A 1VQ8P 2J5UA 1JEKA 1F1CA 5CIDB 5APXA 4DJGA 1X79B 1USEA 3MD0A 1CTYA 1L0LK 2A45I 2BCCG 2OZ1A 1RF1B 2Y9ZA 5CCHA 2QJYB 1HJ3A 1VYDA 2Z4EA 3GF3A 4H44C 4L76A 3L71G 1JUNA 2XZRA 2DVHA 1LC2A 1S2EA 2LXBA 1NAFA 2H8PD 4Y99B 4IFDK 1L4AB 1LFMA 4UB8H 3CC2P 2YKQA 1Y8AA 3AE1C 4I7ZB 1EXJA 2WQYC 4WQDA 4GKGA 5H2FV 1SQVJ 1YTZT 4XXLA 1CRGA 1NTME 1X9VA 2HV4A 3WFCC 2FYUG 1QKSA 1BSNA 2OGUA 4ASWA 1G2CB 3Q5PA 4PV1D 2QE7H 1DW3A 1MV8A 3RK3E 3H1LD 4LJIA 2AXTE 2D2CB 3QWOC 1SQBE 1H32B 4KJMA 3G71P 1S9KD 1NTMK 3AE8C 3VMXA 4EYYQ 1KYOW 2GC7D 1IFDA 3B71A 1U57A 3OA8B 5KLVG 2KZJA 1H1OA 1BL9A 4GYDA 2HFED 2O01N 3V2RA 4IOIH 3BATA 3CC7P 2B9BA 1NTKK 4YXWH 1SFCB 2PGDA 1KB0A 1YTZI 5CJ0A 1LTJA 1WT6A 2AI5A 5CYTR 1H0TA 4I6MC 4LC1A 1HJBA 1IFNA 1JY2N 1GL2B 1GMJA 1I54A 3L71J 1GU4A 1I5TA 1K3GA 4N78E 3EQ2A 5KJ7D 4D6TD 3KQGA 3KZIE 1JCCA 1R8EA 1RE4C 3RK3B 1SQBD 1X0TA 3HE4B 4ZKPA 3FWNA 3CLQA 1KFMA 2P2UA 3CXHH 2H43A 1SQPG 1FI3A 5L8RJ 2PRRA 1CTZA 2O1JA 1NU1K 2QM8A 2E76B 2XNXA 1HRCA 2R44A 1KX7A 3H1JG 2OYOA 4ASVA 3OAKA 2FY8A 2MKVA 1FDIA 4PWAA 3AE4C 1AQTA 1M7LA 4R4LA 1VF5D 5CCGD 5KAIH 4NFGB 2FFDA 5DFSA 1D7MA 2RKLA 3FX0A 4H13C 1ZMEC 2NPSA 2A06D 1KZUB 1HJ0A 4DZOA 4IL6E 1SQPD 4HKZH 1NTKD 1CSVA 4WY4C 3MZWB 2B87B 1CSWA 3L35A 2C9XB 1L4AA 1J1EB 5APYA 3H1JD 2KIKA 3FXEA 1K9MQ 3M9BA 1GZLA 2H88C 1LT1A 3AEGC 3LW5H 3PRJA 1PP9E 3ZBMA 1CI6B 155CA 1F1FA 3TYYA 3AE3C 2B89A 3W67A 1AVOA 1M90Q 1M6ZA 2ZT9C 1FZBA 2UWJE 2N1TC 3WFBC 1CRHA 3MGNA 3VMAA 2V07A 2OQQA 2BH5X 2WZ7A 2C0WA 3TNUB 2RH0A 1LTTC 2JEEA 1DVVA 4IL6H 1VQ4P 2O1KA 5APVA 1I55A 5BU8B 2WSSH 3H32B 4C7NB 1YICA 2MHMA 2KSEA 2OYHB 4N78D 1WEJF 4IL6X 2Q6QA 2CA4B 3JSVC 2M5AB 2WMMA 3F5HA 1BGYE 3OA7A 3MK7B 5AVQB 1BGYD 2SPZA 1ZXGA 4D6TJ 1LGHB 3E1RA 3RMZA 1NO4A 1AJYA 1WRGA 1CSBA 2C0XA 1CIHA 3L73E 3L75G 3SWYA 1HF9A 3MUDC 4NPFX 2P67A 1LJ2A 1R5LA 1XTCC 2E42A 1RZ6A 1RAQA 3A0HV 3OCDB 1N86A 1AKKA 1JY3O 2ZVOB 4JCGA 5BVZA 5APWA 3H1JE 1K05A 4U3FG 2IBZG 3PP5A 2B11B 4MN4C 3H1KD 1NIRA 2O3JA 1FZEA 3NBSA 3CWBD 1SQPE 1VPCA 2V7QH 2B88A 3KHUA 1QGKB 1HWTC 1RE4A 1NJIQ 3SLEA 2FFDB 3KZIV 1OW8A 3M06A 1EZVG 2L4DA 1J3SA 1JNMA 2C1DA 1LWUB 2FXPA 1N9CA 5TISE 5E79H 4WQ7A 3RL0B 4RKUJ 2M0BA 1A56A 1DW1A 1L0LE 2CE0A 4RSZA 1KB9H 1CHHA 3WU2V 1BDDA 3AE6C 4XFJA 2WTYA 1S4XA 1L0NK 1N15A 2GIWA 3CX5D 1BCCE 4PV1C 2QJPC 1IRVA 1HGVA 3L74G 3P7KA 1KB9D 1LTSC 4O9BA 1SQQG 4UB6V 4WQCA 3L74J 3AE7C 3HD7A 3CWBG 3CCJP 1CRIA 3A0BV 1ZR4A 4U3FJ 1KQFB 3BCCJ 1KYOH 2N9YB 1OXZA 1Q81Q 2PFXA 2WSFH 4H44B 5B66V 1FI9A 3H1KJ 3V2PA 3BCCD 3O1YA 3MP7B 2PAJA 1T8ZA 2YNYA 3GG2A 3SWFA 1LC1A 2OYIA 4I7ZC 3PXWA 1H9XA 1NKNA 1NTZK 1YNRA 4I1LA 4AAMA 3BRTB 1GL2D 3CX5H 3NXSA 1K04A 1LTBC 5CJ4A 2WPVB 1E29A 2AEFA 3HE4A 5B66H 3B5NB 3H1KE 1SQXE 3P8MC 3JCUH 3SWSA 1FS0E 3A0BE 5DF5A 3BCCE 5AVSB 3TF5A 2BLFB 2KOGA 1LP1A 1FDMA 3CU4A 3HQ8A 2FKWB 1ZZHA 4UB8V 3L74E 1SQQJ 1P84I 1DVHA 1SP4A 1A02J 1N73A 3VP9A 1JY2P 1CIGA 1VF5C 2QSIA 5AW7B 4IL6V 1KFNA 1GW4A 1P84D 3WUTA 1GW3A 1L0NE 4ZNCA 3VNWA 1FJPA 2ZFCA 1CCHA 3HE5A 2OZ1B 1W5CE 5CHXA 3M9QA 2Y9YA 2C1DB 1LWUA 2H7HA 1SQQK 2WSCJ 3L72E 4DY9A 1YI2P 1OIPA 3JCUE 1KILA 1X22A 3GF7A 3PH0A 2KXPB 3L70G 3BASA 2N1TD 1DEBA 1N7LA 2GC4D 2V7QJ 2E76C 1CXAA 3CCRP 1NH4A 5AW1B 5CBNA 2OTJP 5KLVK 2ZOOA 3SXTA 1JTHB 3CC4P 1N7SC 4GOEA 2NZ2A 3M0DC 4FA1A 2IZ0A 1L0ND 3H1IG 3TGUJ 3CCLP 3ITKA 1FZGA 4IFFA 2Z5IA 1AV1A 3H1JJ 3MUDA 5KLVJ 2HLOA 1HVVA 1S6VB 3M97X 2HPCA 4RO0A 1DIPA 3HQ7A 1KX2A 1Z56A 2W8ZA 4K35A 1NTKJ 1EC5A 3TDKA 1JMBA 3NTNA 1AYGA 3S9OA 3L72G 1QL4A 4W7ZA 3IF4A 3GHGA 3CP5A 3L73J 5KLVD 2HODA 1RQUA 3DP5A 1L0NJ 3JBTB 5B5EH 1FJ0A 1C2NA 3H1ID 1SQXD 2ZXYA 1L0NG 4GDOA 4EIEA 1Q7YQ 1DEEG 3HD7C 3RK2C 1PPJE 4WQ9A 1BGYJ 1ETPA 4C46A 2E75C 1IFJA 1GDVA 2KNCB 3GLMA 3RK3D 3L4MA 1TU3F 5KAFH 2FBWC 3KZIH 4UB8E 3JC22 5CCGC 1JMMA 3VN0A 3GW6A 4GIFA 1QYZA 2GUVA 1RAPA 2M3EA 1S5LX 2GUSA 3GMAA 2PCCB 1LP1B 3Q3DA 1Y9BA 1MZ4A 4FB1A 2JR8A 5CIEB 2QM7A 1LTJC 1S1CX 4LGDE 5CIGB 1SQXG 2ZT9D 2WSEH 2OYHC 1PIXA 2P58A 4N3YB 4L73A 2J58A 2K3RA 4L1QA 1KTMA 3N4XA 1NOHA 3HUSA 2L5GB 4H0KA 1YQ3C 4EI2A 4H0LC 451CA 3RN0A 1L0LD 1G2CA 2ZXXA 1HGZA 1FI7A 1OWAA 3FXDA 1KB9E 1NMIA 1PP9J 1FZCB 2JKVA 1PGJA 3H1LE 4GEDB 1VQ9P 1W5CT 3PHLA 3V4QA 2CPBA 1H33A 5GTIE 1HCMA 4XE5B 2QJKB 4PJ0E 1L9JC 1P84E 1RE3C 1CRJA 1KIBA 3EWKA 3OJAB 2KS1A 3Q2YA 2N1TA 1QVFO 2FYNC 2ZBOA 3G6EP 1VQKP 1JDLA 1YEBA 1J2JB 5AW2B 4P4QB 3V2QA 1JTHA 4LLHA 5AW0B 1HZUA 3U1CA 3DR0A 5APUA 1M1JB 1IJDB 3AEBC 2I1JA 3HD7B 1YFCA 1EXIA 3CXHE 3CCMP 1Q86Q 4YXDC 1NU1D 4WBAA 1KILC 3L70E 3CMEP 1AOQA 1L0LG 2CK3H 2P7JA 3ZOXA 3V4WA 1JO5A 1LT9B 4PJ0H 3ZDMA 2OYHA 1YEAA 4R4MA 5AW8B 1IRWA 3ZOYA 2D0SA 4WY4D 4I2LC 3OA8A 1LTJB 1R0QA 1H0TB 1Y47A 2N9BA 4JQ0D 5KKZB 1SFCD 4DCKA 3KYQA 2B0ZB 1MG3D 4B86A 3IN6A 1MZ9A 1YCCA 1EZVI 1NU1G 4PV1B 3CMAP 2IPPA 2GM4A 4YPCA 2FWLA 3C1LA 4H0LB 2A45H 1RF1A 1N7SD 1GJQA 2YIUC 1S5LV 3HRNA 4PJ0V 1HJ4A 1FZCC 2E43A 4A7PA 3CX5W 1I6EA 3A3YB 3R4YA 2K9JA 2K88A 2QJKC 5C39A 1DD3A 5B5EE 2CA3B 2IBZD 2AXTH 3L73G 3QH9A 4L3GA 3I5CA 3HTKA 1T2KD 1RZ5A 3M0DA 1NTZD 1NTMJ 1SQVE 4JPZB 1J1EC 4EIFA 3G3ZA 3H1LG 1S5LE 4L74A 1M8OB 1HBWA 1FZFA 4W7YA 4WQEA 2Q9IA 1CEDA 1USDA 1CRCA 1CYCA 4GOFA 1CW5A 2E75D 1EQ7A 1OMIA 3M9HA 3A0HE 1HROA 1KILB 2R32A 1PGPA 2Y0CA 3O6QA 1BDCA 2B87A 3RBXA 1OW6A 4N6JA 5M1BA 1Q90D 1RQVA 1CXCA 1BE3J 3CWBE 1NNOA 1OFCX 2A06E 1KQLA 5C0ZA 1CO6A 1CHJA 2C1UA 2JWDA 1URQB 4FAVA 2Z5HA 1GD2E 1CC5A 2QVAA 1BE3E 3CWBJ 3AEFC 3TNUA 3H1HG 3D70A 3P8CD 1SLQA 3M91A 1CORA 3ZIYA 1G1JA 2O01H 1CCRA 2I8FA 1NU1E 3TK1A 1MG2D 4AALA 1I8PA 4KHXA 1YITP 1BCCD 1A2SA 1EDLA 1U7JA 1J1DB 4L3HA 5KJ7C 1H32A 1CTJA 3AECC 1VQ7P 4HB1A 2Q3IA 3RLMA 5KAIE 1CSUA 3DMIA 2C9NY 2YQBA 1AOFA 3LIEA 5IY51 3CCVP 3H6PA 2W6BA 4Y99C 1KV9A 2RMZA 2N3YA 1GK4A 4TLFA 2D2CC 4PD4H 2LKMA 5TISV 1COTA 1A02F 1IO3A 2IX7C 1EDJA 2JDIH 1M70A 3WU2H 4OGQC 2IBZE 4AUWA 1E8EA 1CRYA 3A0HH 1DH3A 5AVRB 3FGAD 1YBKA 1W2LA 4AAOA 5AVWB 1B7VA 2I1KA 3WFDC 3L75E 1DIQC 3I55P 5EFWB 1HH7A 1KMIZ 4Y28J 3RL0C 1LTGC 2WT7B 4TT3H 2B12B 3AE9C 1RHZB 2M8RA 1BGYG 2YMKA 3L75J 5KAFV 2WSEJ 2HR3A 1UIXA 1OAEA 2ZJSE 4JYCA 1GL2C 4KT0J 1NHLA 3H25A 3O8ZA 3WU2E 1DD4A 5CCHD 1L2PA 1RY3A 5AW5B 3O6QB 3V2NA 2WPSA 3ZOWA 4O1QA 3L36A 5GTHV 2YCCA 5CIHB 5GTHE 2OTKE 1SQBJ 3U59A 1J1DC 4WB4A 3L70J 2W6AA 3NBTA 2FYUK 1T3UA 3L70D 3L71D 5H2FE 1FOSE 3LW5J 2YO2A 3PLNA 2E5YA 1OVRA 3ABVC 2IYPA 3H1KG 4H13B 4EICA 2Q3EA 3TGUG 1WMKA 2QA4P 1ZRTE 2CPSA 1OVUA 3A0BH 2G8YA 4ZMDA 3CPWO 2BEZF 4Q5PA 3T97B 4YE1A 3VOPA 1YJNP 1OX3A 5GTIH 1RE3A 3KDPB 2L91A 3N7NA 1T3JA 2E74D 1GDTA 2OTLP 3A2AA 1C7MA 1HH0A 3L72D 5APQA 5KTBA 3H1LJ 2ZT9B 5GTIV 4WQBA 3HQ6A 3SWKA 1E5WA 2J59M 1ZP0C 4WY4B 2FYZA 4AQRD 3O20A 3WMM0 1ZOYC 2OYIB 1I8OA 1EZVD 2B4ZA 5AVYB 1JCDA 3AEEC 1PZQA 2O01J 4BXLA 2KB7P 3L74D 5KJ7A 2V4HA 3G9RA 5DJQC 2IYOA 1BCCG 5AVZB 3Q5RA 3GHGC 2ZYDA 3A5TA 3TGUD 1VL2A 1EDKA 3CCEP 5GTHH 2AIUA 3HQ9A 2PCBB 3IR9A 3V6IA 1T2KC 1YHQP 5AVUB 1E2RA 2I8DA 3KPEA 1L9BC 1CIEA 2BPBB 3ORVA 1DW2A 4DOJA 1H31B 1HTLC 1RF1C 3RN1A 2KLVA 2QJYC 1N73B 1FC2C 2NPSC 1IQCA 2ZXEB 1EDIA 1SVFA 4M3LA 1N50A 2HPCB 2N18B 5CCGA 3LIDA 1IFMA 1L4AC 3IAOA 3H1HE 3KXDA 1N7SB 1H8AA 1MKMA 2PP6A 5TJHA 2LXCB 1AQ5A 2Q1KA 4JBZA 3CX5E 4OGQD 1FU1A 4WVZA 2W27A 3TYIA 1YTCA 2IFMA 2C2CA 2ORLA 2FYUJ 1DX7A 4BWNA 3SJLA 1PGOA 3ZOOA 1OZHA 1GKSA 1W2EA 2E5TA 2BCCJ 1S72P 1FE6A 2IZ1A 2P1JA 3U1AA 1C75A 1KD1Q 3AE5C 2OARA 3SFDC 1GL2A 3BVHA 2IDBA 4UB6E 2FXOA 2KP8A 3FWLA 3A9FA 5KAIV 1NVOA 3B5ND 1NTKG 3D6ZA 4CPGA 3RK2B 1NKZB 4KMGA 1C52A 1Q2NA 5CIFB 4QAOA 5CICB 2QEXP 1IK9A 3GHGB 3C2CA 2E75B 5CCHC 1QL2A 4PD4D 2Y0EA 1I6DA 5AVTB 1YJWP 2P10A 5AW3B 3L37A 1JY3P 2C8SA 4L75A 3SFEC 2K37A 1ZW0A 1KYOD 1G1IA 4EIJA 4BRYB 3VMYA 3RK3C 5E79V 1FJKA 3BRVB 4HJGH 2XKMA 3HE5B 3RGUA 2IBZI 1SQQE 3OW2O 3P32A 2NPSB 1P84H 1K73Q 2QJPB 1PL5A 5CBOA 1CIFA 1PGQA 3PJSK 2V08A 1HZVA 4O1WA 2LIRA 2K1AA 1S5LH 3S1KA 1SQXJ 1IZL0 4RESB 1KILE 1R5SA 1H89A 3CI9A 1CI6A 1JOCA 3L4FA 5APTA 2ZZS1 3AEAC 5B5EV 1IZNB 2W90A 3L73D 2R3SA 1SQBK 2WVRA 1URQD 5KLIB 1FOCA 2Y0DA 3B5NC 1FZCA 3HUSB 2FYNB 1FDOA 4HH2A 1BSHA 2H89C 2XNDH 1LTIC 1M56D 1QN2A 1Q82Q 3SSUA 1FCDC 3WUVA 4N0KA 1RF0C 1S3JA 3CXHW 2DW3A 1H33B 2M3BA 4RJTA 3VYIA 1M1KQ 1EB7A 4XYDB 1YQ4C 1S9KE 3H1IJ 2WSCH 1KYOI 2N1TB 4U3FE 3WFEC 2KSJA 3B8EB 1IC2A 2CE1A 3D0WA 2A06G 1U74B 3Q1MA 3PXSA 1T6AA 2YKPA 351CA 2ZAEB 1KV4A 4NPEA 1AFOA 1LT9C 1M1JA 1MFZA 2FRCA 1YYCA 2W83C 4GT1A 5TISH 2KNCA 3CXHD 1LS9A 1GU5A 4YTPC 1PP9D 3HD7D 2QRXA 1AVYA 2CXBA 1VF5B 4D6TG 1FHBA 3B5NA 1CYIA 2NPSD 1L0LJ 3CYTI 3M0AA 2AXCA 4Z1MH 2WPRA 1VQ5P 1KN7A 1H88A 3VRDA 2MJZA 2ITAA 1NTKE 3EFGA 3NMDA 1NTMD 4WQ8A 1NTZJ 1L4AD 3O0RC 1SQVG 1CSXA 4H0JA 5AW9B 3RL0D 2YIUB 1LT9A 1C6SA 1FZAA 1DW0A 5KLVE 3P8CE 1U7MA 1UIIA 3TGUE 4BRYA 3CD6P 2KYVA 1YIJP 4GODA 1SQBG 3E1IA 2YXQB 4FANA 1H9YA 3VYMA 1QX8A 4PD4E 2Q7CA 3ZCFA 2ZYAA 2VHDA 2HYNA 1E79H 1SQXK 5B6QA 5KLIC 2Q5UA 2FYUE 2GB8B 4UB6H 1XTGB 4DT0A 4H0LD 3IFMA 4FA5A 1NTMG 3RL0g 4AANA 3G4SP 1M57D 3L4OA 1NTZE 1ZN5A 2K9YA 2WSFJ 3L72J 3VTPC 4MU8A 2W6JH 1SQVK 1GK6A 1K8AQ 1HUCA 1PP9G 1PPJG 2G3AA 5EXQA 3AE2C 1IO4A 1OVVA 1YIQA 3I56P 2QG4A 5B66E 3OCDA 2A45G 2C9LY 3L75D 1H31A 5K5GB 4Y5RA 3USSA 5KAFE 2BCNB 2B10B 1IFPA 4D6TE 1WVEC 1OCDA 3W68A 3PTZA 3Q5SA 4EOTA 3CX5I 1QLED 1LWUC 2OYIC 1KQGB 1N2DC 1C2RA 4U3FD 2MTAC 2D2CD 2E74C 1N90A 1N7SA 3CXHI 5H2FH 1N8RQ 4PW9B 4K3AA 4J20A 3RBZA 4PD4I 2XV5A 5AURA 3H1IE 2VRSA 1SQPK 2R5DA 4AX3A 3C9IA 1KILD 2PACA 2BASA 2E76D 2XTSB 5AVXB 1QL1A 2AXTV 1VQLP 2ZYGA 3PH2B 3VP8A 2N3BA 1VQOP 4OH8B 1KORA 1LTAC 1FOSF 1U75B 4OVNF 2ZVNB 3MTUE 3X39A 3MHVA 2M5AA 3VMZA 2R3CA 1N73C 1ZR2A 3D71A 1QVGO 1VQ6P 1A8CA 3TSIA 2XDJA 5BU5A 2N18C 1C6OA 2R5BA 2EXVA 1KB9I 2BGVX 1JB0J 2JO1A 1RF0A 1VQMP 3F89A 4WWIA 4V2KA 1SQQD 2C1VA 1MUUA 3MIWA 1NTZG 3WUUA 1BE3G 4OGQB 4EIDA 3PXTA 4K3IA 1YJ9P 1HJ5A 1M1JC 1M60A 2KLUA 3EFFK 1KYOE 2FXMA 2QIWA 2N9JA 1DIIC 3WC8A 1BCCJ 2NRGA 3BCCG 3E7KA 1JY2O 1FBMA 5DJTB 3CCUP 2YO3A 5AW4B 2FYUD 4FA4A 1GIWA 5DJUB 2YXRB 1OW7A 1PV3A 2E74B 1RH5B 3B4SA 1GQ1A 1NAYA 3WUIA 2POHA 1SQVD 2YKOA 1GU2A 1VQPP 2KS1B 5KKZC 2JJLA 4JYBA 1ZRTD 1JY3N 1NGMB 2HG5D 3II6A 4EDFA 1VQNP 4AYCA 3SVWA 2JQRA 3L71E 2WT7A 3D6YA 1W2BO 1LNQA 1C6RA 4FA9A 2JP3A 3MK7C 4C7RA 1URQA 1CHIA 3H1HD 2IFNA 2BCCE 1DT1A 1SQPJ 2KZIA 1BE3D 3NFQA 2DGEA 2LR2A 2GA1A 3V5BA 4HYTB 1QL3A 2WPQA 1NMLA 3A7OA 2WWWA
chains in the Genus database with same CATH topology
4PJ0V 1HJ4A 2C1DA 1N9CA 4KMGA 4A7PA 1C52A 4WQAA 1CNOA 3CX5W 1PPJD 4QAOA 4WQ7A 5CIFB 5CICB 1I6EA 3C2CA 2BH4X 4PD4D 2RN0A 2N9IA 1A56A 2Y0EA 1DW1A 1K3HA 2CE0A 1I6DA 4RSZA 1CHHA 2JWAA 3WU2V 2D0WA 2CA3B 2IBZD 2C8SA 4L3GA 1RZ5A 3O5CA 1N15A 1KYOD 1NTZD 2GIWA 2BCCD 3CX5D 5E79V 4EIFA 1IRVA 3NWVA 5CIBB 1KB9D 4UB6V 4WQEA 5C9MA 4WQCA 2ZONG 1CEDA 1CRCA 1CYCA 1CRIA 3A0BV 2QJPB 1CIFA 2JTIB 2V08A 2N9YB 1HROA 1HZVA 4O1WA 2Y0CA 2LIRA 1LMSA 2K9JB 5B66V 1FI9A 1IZL0 3BCCD 3O1YA 1CYJA 5DJQB 2YK3A 2ZZS1 2LITA 1CXCA 5B5EV 3GG2A 1LC1A 3L73D 1NNOA 5C0ZA 3PXWA 1CO6A 1H9XA 1F1CA 5CIDB 1CHJA 5KLIB 1YNRA 1FOCA 2C1UA 2Y0DA 4AAMA 4FAVA 1CC5A 2FYNB 1CTYA 1E29A 1QN2A 1FCDC 1CORA 3ZIYA 1CCRA 4N0KA 2I8FA 3CXHW 1H33B 2OZ1A 1MG2D 4AALA 4RJTA 1I8PA 2QJYB 1HJ3A 1EB7A 1BCCD 1A2SA 1VYDA 4XYDB 4L3HA 3SWSA 1H32A 5DF5A 1CTJA 2DVHA 1LC2A 3TF5A 2BLFB 3WFEC 3RLMA 3CU4A 1CSUA 3DMIA 3HQ8A 2YQBA 2CE1A 1AOFA 1LFMA 1ZZHA 4UB8V 1U74B 3PXSA 5IY51 351CA 1DVHA 4WQDA 1KV9A 1CIGA 2RMZA 2N3YA 5H2FV 4IL6V 2FRCA 4XXLA 1CRGA 5TISV 1COTA 2HV4A 3WFCC 1IO3A 1P84D 3CXHD 1LS9A 1QKSA 3VNWA 1PP9D 1M70A 1CCHA 2OZ1B 2CXBA 1DW3A 1FHBA 1CYIA 2C1DB 3H1LD 4LJIA 3CYTI 1E8EA 1CRYA 1H32B 3VRDA 4DY9A 1NTMD 1KYOW 4WQ8A 2GC7D 1W2LA 3O0RC 4AAOA 3OA8B 1CSXA 4H0JA 1B7VA 2YIUB 1C6SA 1H1OA 1BL9A 4GYDA 1DW0A 3WFDC 1DIQC 2GC4D 1HH7A 1KB0A 1CXAA 2AI5A 5CYTR 2B12B 2ZOOA 3SXTA 4FANA 1H9YA 3VYMA 3ZCFA 2VHDA 4FA1A 5B6QA 1I54A 1L0ND 1I5TA 1K3GA 3ITKA 5KAFV 2GB8B 1OAEA 4D6TD 4FA5A 1S6VB 3M97X 3HQ7A 1KX2A 4AANA 1SQBD 3L4OA 3TDKA 3ZOWA 4MU8A 4O1QA 5GTHV 2YCCA 5CIHB 1AYGA 1QL4A 5EXQA 3CP5A 1YIQA 3NBTA 1FI3A 5KLVD 2QG4A 1CTZA 3OCDA 3L75D 3DP5A 1H31A 4Y5RA 3L70D 3L71D 1HRCA 2BCNB 2B10B 1KX7A 3PLNA 3JBTB 1WVEC 1OCDA 3PTZA 1FJ0A 1C2NA 3H1ID 1SQXD 2ZXYA 4EIEA 4WQ9A 4EICA 2Q3EA 1ETPA 4PWAA 1C2RA 4U3FD 4Q5PA 2MTAC 4NFGB 1GDVA 4YE1A 5DFSA 2KNCB 3L4MA 1N90A 4PW9B 2A06D 4J20A 1SQPD 5AURA 2L91A 3GW6A 1QYZA 1NTKD 1RAPA 1CSVA 4AX3A 2PCCB 1MZ4A 4FB1A 1C7MA 1CSWA 5CIEB 3L72D 2C9XB 2PACA 3H1JD 2XTSB 5GTIV 5CIGB 4WQBA 2AXTV 3HQ6A 3PRJA 3PH2B 2N3BA 3ZBMA 155CA 1F1FA 1U75B 3O20A 3X39A 1I8OA 4L1QA 1EZVD 1M6ZA 2B4ZA 3WFBC 4H0KA 1CRHA 3VMAA 451CA 3RN0A 1L0LD 2V07A 1FI7A 1A8CA 1NMIA 2BH5X 3L74D 2N18C 1C6OA 2EXVA 4GEDB 1W5CT 5DJQC 3PHLA 2BGVX 3TGUD 1DVVA 1H33A 1HCMA 1I55A 2QJKB 2AIUA 3HQ9A 4V2KA 2PCBB 1L9JC 1YICA 1SQQD 2C1VA 1CRJA 1KIBA 2KS1A 1E2RA 2MHMA 1L9BC 4EIDA 1CIEA 3PXTA 1WEJF 2BPBB 2ZBOA 4K3IA 1HJ5A 1JDLA 3ORVA 2CA4B 1M60A 1DW2A 1YEBA 2N9JA 1H31B 1DIIC 4P4QB 3WC8A 1HZUA 3MK7B 3RN1A 1BGYD 3DR0A 1IQCA 1YFCA 3RMZA 1N50A 2FYUD 4FA4A 2N18B 1GIWA 1NU1D 1CIHA 5TJHA 1AOQA 1GQ1A 3ZOXA 3WUIA 1SQVD 1RZ6A 1GU2A 1RAQA 3A0HV 3OCDB 1AKKA 1YEAA 1ZRTD 3TYIA 4JCGA 1IRWA 3ZOYA 1YTCA 2D0SA 2C2CA 2ORLA 3OA8A 4EDFA 3SJLA 2B11B 3SVWA 1R0QA 3H1KD 2JQRA 1NIRA 2O3JA 3ZOOA 1C6RA 3NBSA 4FA9A 5KKZB 1GKSA 3CWBD 3MK7C 1CHIA 3H1HD 2B0ZB 1MG3D 1DT1A 1C75A 3KHUA 1YCCA 1BE3D 3SLEA 3KZIV 2DGEA 2FWLA 1QL3A 3FWLA 1NMLA 3A9FA 1GJQA 2L4DA 5KAIV 1S5LV 1J3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJ0 V;  1HJ4 A;  2C1D A;  1N9C A;  4KMG A;  4A7P A;  1C52 A;  4WQA A;  1CNO A;  3CX5 W;  1PPJ D;  4QAO A;  4WQ7 A;  5CIF B;  5CIC B;  1I6E A;  3C2C A;  2BH4 X;  4PD4 D;  2RN0 A;  2N9I A;  1A56 A;  2Y0E A;  1DW1 A;  1K3H A;  2CE0 A;  1I6D A;  4RSZ A;  1CHH A;  2JWA A;  3WU2 V;  2D0W A;  2CA3 B;  2IBZ D;  2C8S A;  4L3G A;  1RZ5 A;  3O5C A;  1N15 A;  1KYO D;  1NTZ D;  2GIW A;  2BCC D;  3CX5 D;  5E79 V;  4EIF A;  1IRV A;  3NWV A;  5CIB B;  1KB9 D;  4UB6 V;  4WQE A;  5C9M A;  4WQC A;  2ZON G;  1CED A;  1CRC A;  1CYC A;  1CRI A;  3A0B V;  2QJP B;  1CIF A;  2JTI B;  2V08 A;  2N9Y B;  1HRO A;  1HZV A;  4O1W A;  2Y0C A;  2LIR A;  1LMS A;  2K9J B;  5B66 V;  1FI9 A;  1IZL 0;  3BCC D;  3O1Y A;  1CYJ A;  5DJQ B;  2YK3 A;  2ZZS 1;  2LIT A;  1CXC A;  5B5E V;  3GG2 A;  1LC1 A;  3L73 D;  1NNO A;  5C0Z A;  3PXW A;  1CO6 A;  1H9X A;  1F1C A;  5CID B;  1CHJ A;  5KLI B;  1YNR A;  1FOC A;  2C1U A;  2Y0D A;  4AAM A;  4FAV A;  1CC5 A;  2FYN B;  1CTY A;  1E29 A;  1QN2 A;  1FCD C;  1COR A;  3ZIY A;  1CCR A;  4N0K A;  2I8F A;  3CXH W;  1H33 B;  2OZ1 A;  1MG2 D;  4AAL A;  4RJT A;  1I8P A;  2QJY B;  1HJ3 A;  1EB7 A;  1BCC D;  1A2S A;  1VYD A;  4XYD B;  4L3H A;  3SWS A;  1H32 A;  5DF5 A;  1CTJ A;  2DVH A;  1LC2 A;  3TF5 A;  2BLF B;  3WFE C;  3RLM A;  3CU4 A;  1CSU A;  3DMI A;  3HQ8 A;  2YQB A;  2CE1 A;  1AOF A;  1LFM A;  1ZZH A;  4UB8 V;  1U74 B;  3PXS A;  5IY5 1;  351C A;  1DVH A;  4WQD A;  1KV9 A;  1CIG A;  2RMZ A;  2N3Y A;  5H2F V;  4IL6 V;  2FRC A;  4XXL A;  1CRG A;  5TIS V;  1COT A;  2HV4 A;  3WFC C;  1IO3 A;  1P84 D;  3CXH D;  1LS9 A;  1QKS A;  3VNW A;  1PP9 D;  1M70 A;  1CCH A;  2OZ1 B;  2CXB A;  1DW3 A;  1FHB A;  1CYI A;  2C1D B;  3H1L D;  4LJI A;  3CYT I;  1E8E A;  1CRY A;  1H32 B;  3VRD A;  4DY9 A;  1NTM D;  1KYO W;  4WQ8 A;  2GC7 D;  1W2L A;  3O0R C;  4AAO A;  3OA8 B;  1CSX A;  4H0J A;  1B7V A;  2YIU B;  1C6S A;  1H1O A;  1BL9 A;  4GYD A;  1DW0 A;  3WFD C;  1DIQ C;  2GC4 D;  1HH7 A;  1KB0 A;  1CXA A;  2AI5 A;  5CYT R;  2B12 B;  2ZOO A;  3SXT A;  4FAN A;  1H9Y A;  3VYM A;  3ZCF A;  2VHD A;  4FA1 A;  5B6Q A;  1I54 A;  1L0N D;  1I5T A;  1K3G A;  3ITK A;  5KAF V;  2GB8 B;  1OAE A;  4D6T D;  4FA5 A;  1S6V B;  3M97 X;  3HQ7 A;  1KX2 A;  4AAN A;  1SQB D;  3L4O A;  3TDK A;  3ZOW A;  4MU8 A;  4O1Q A;  5GTH V;  2YCC A;  5CIH B;  1AYG A;  1QL4 A;  5EXQ A;  3CP5 A;  1YIQ A;  3NBT A;  1FI3 A;  5KLV D;  2QG4 A;  1CTZ A;  3OCD A;  3L75 D;  3DP5 A;  1H31 A;  4Y5R A;  3L70 D;  3L71 D;  1HRC A;  2BCN B;  2B10 B;  1KX7 A;  3PLN A;  3JBT B;  1WVE C;  1OCD A;  3PTZ A;  1FJ0 A;  1C2N A;  3H1I D;  1SQX D;  2ZXY A;  4EIE A;  4WQ9 A;  4EIC A;  2Q3E A;  1ETP A;  4PWA A;  1C2R A;  4U3F D;  4Q5P A;  2MTA C;  4NFG B;  1GDV A;  4YE1 A;  5DFS A;  2KNC B;  3L4M A;  1N90 A;  4PW9 B;  2A06 D;  4J20 A;  1SQP D;  5AUR A;  2L91 A;  3GW6 A;  1QYZ A;  1NTK D;  1RAP A;  1CSV A;  4AX3 A;  2PCC B;  1MZ4 A;  4FB1 A;  1C7M A;  1CSW A;  5CIE B;  3L72 D;  2C9X B;  2PAC A;  3H1J D;  2XTS B;  5GTI V;  5CIG B;  4WQB A;  2AXT V;  3HQ6 A;  3PRJ A;  3PH2 B;  2N3B A;  3ZBM A;  155C A;  1F1F A;  1U75 B;  3O20 A;  3X39 A;  1I8O A;  4L1Q A;  1EZV D;  1M6Z A;  2B4Z A;  3WFB C;  4H0K A;  1CRH A;  3VMA A;  451C A;  3RN0 A;  1L0L D;  2V07 A;  1FI7 A;  1A8C A;  1NMI A;  2BH5 X;  3L74 D;  2N18 C;  1C6O A;  2EXV A;  4GED B;  1W5C T;  5DJQ C;  3PHL A;  2BGV X;  3TGU D;  1DVV A;  1H33 A;  1HCM A;  1I55 A;  2QJK B;  2AIU A;  3HQ9 A;  4V2K A;  2PCB B;  1L9J C;  1YIC A;  1SQQ D;  2C1V A;  1CRJ A;  1KIB A;  2KS1 A;  1E2R A;  2MHM A;  1L9B C;  4EID A;  1CIE A;  3PXT A;  1WEJ F;  2BPB B;  2ZBO A;  4K3I A;  1HJ5 A;  1JDL A;  3ORV A;  2CA4 B;  1M60 A;  1DW2 A;  1YEB A;  2N9J A;  1H31 B;  1DII C;  4P4Q B;  3WC8 A;  1HZU A;  3MK7 B;  3RN1 A;  1BGY D;  3DR0 A;  1IQC A;  1YFC A;  3RMZ A;  1N50 A;  2FYU D;  4FA4 A;  2N18 B;  1GIW A;  1NU1 D;  1CIH A;  5TJH A;  1AOQ A;  1GQ1 A;  3ZOX A;  3WUI A;  1SQV D;  1RZ6 A;  1GU2 A;  1RAQ A;  3A0H V;  3OCD B;  1AKK A;  1YEA A;  1ZRT D;  3TYI A;  4JCG A;  1IRW A;  3ZOY A;  1YTC A;  2D0S A;  2C2C A;  2ORL A;  3OA8 A;  4EDF A;  3SJL A;  2B11 B;  3SVW A;  1R0Q A;  3H1K D;  2JQR A;  1NIR A;  2O3J A;  3ZOO A;  1C6R A;  3NBS A;  4FA9 A;  5KKZ B;  1GKS A;  3CWB D;  3MK7 C;  1CHI A;  3H1H D;  2B0Z B;  1MG3 D;  1DT1 A;  1C75 A;  3KHU A;  1YCC A;  1BE3 D;  3SLE A;  3KZI V;  2DGE A;  2FWL A;  1QL3 A;  3FWL A;  1NML A;  3A9F A;  1GJQ A;  2L4D A;  5KAI V;  1S5L V;  1J3S A; 
#chains in the Genus database with same CATH topology
 1IK7 A;  1FAV A;  1NYH A;  3C8V A;  2AEJ A;  2XU6 A;  4WQA A;  1CNO A;  1ZLL A;  3S4R A;  1PPJ D;  2BH4 X;  5APS A;  2RN0 A;  2N9I A;  3H1H J;  1K3H A;  3H32 A;  4H44 D;  4C7N A;  2KUB A;  1JM0 A;  2JWA A;  2D0W A;  2BEQ D;  2WIT A;  5CMZ A;  1QEX A;  4QMA A;  3O5C A;  1KC8 Q;  1SFC A;  2BCC D;  4W80 A;  1ZV8 A;  2AEM A;  1GTW A;  2FFD C;  1AA0 A;  4H13 D;  3NWV A;  3T97 A;  3UIA A;  4OWF A;  2YMY A;  5CIB B;  3HUS C;  3CCS P;  5C9M A;  4NPD A;  3CL3 D;  5AW6 B;  3RK2 D;  2ZON G;  1CZQ A;  1PFI A;  1EZV E;  1MFT A;  3R2P A;  3AED C;  2KK7 A;  2JTI B;  2KI7 B;  3K5B A;  4IFM A;  1X8Y A;  1VDF A;  1LMS A;  2K9J B;  4XA4 A;  5E79 E;  5AVV B;  3CCQ P;  1KQS O;  1CYJ A;  1NU1 J;  1SFC C;  4WY4 A;  1NWQ A;  4U7J A;  5DJQ B;  2YK3 A;  1SS1 A;  3HTK B;  2LIT A;  1URQ C;  1IFI A;  2HOD B;  4ZKU A;  4JF7 A;  1VQ8 P;  2J5U A;  1JEK A;  1F1C A;  5CID B;  5APX A;  4DJG A;  1X79 B;  1USE A;  3MD0 A;  1CTY A;  1L0L K;  2A45 I;  2BCC G;  2OZ1 A;  1RF1 B;  2Y9Z A;  5CCH A;  2QJY B;  1HJ3 A;  1VYD A;  2Z4E A;  3GF3 A;  4H44 C;  4L76 A;  3L71 G;  1JUN A;  2XZR A;  2DVH A;  1LC2 A;  1S2E A;  2LXB A;  1NAF A;  2H8P D;  4Y99 B;  4IFD K;  1L4A B;  1LFM A;  4UB8 H;  3CC2 P;  2YKQ A;  1Y8A A;  3AE1 C;  4I7Z B;  1EXJ A;  2WQY C;  4WQD A;  4GKG A;  5H2F V;  1SQV J;  1YTZ T;  4XXL A;  1CRG A;  1NTM E;  1X9V A;  2HV4 A;  3WFC C;  2FYU G;  1QKS A;  1BSN A;  2OGU A;  4ASW A;  1G2C B;  3Q5P A;  4PV1 D;  2QE7 H;  1DW3 A;  1MV8 A;  3RK3 E;  3H1L D;  4LJI A;  2AXT E;  2D2C B;  3QWO C;  1SQB E;  1H32 B;  4KJM A;  3G71 P;  1S9K D;  1NTM K;  3AE8 C;  3VMX A;  4EYY Q;  1KYO W;  2GC7 D;  1IFD A;  3B71 A;  1U57 A;  3OA8 B;  5KLV G;  2KZJ A;  1H1O A;  1BL9 A;  4GYD A;  2HFE D;  2O01 N;  3V2R A;  4IOI H;  3BAT A;  3CC7 P;  2B9B A;  1NTK K;  4YXW H;  1SFC B;  2PGD A;  1KB0 A;  1YTZ I;  5CJ0 A;  1LTJ A;  1WT6 A;  2AI5 A;  5CYT R;  1H0T A;  4I6M C;  4LC1 A;  1HJB A;  1IFN A;  1JY2 N;  1GL2 B;  1GMJ A;  1I54 A;  3L71 J;  1GU4 A;  1I5T A;  1K3G A;  4N78 E;  3EQ2 A;  5KJ7 D;  4D6T D;  3KQG A;  3KZI E;  1JCC A;  1R8E A;  1RE4 C;  3RK3 B;  1SQB D;  1X0T A;  3HE4 B;  4ZKP A;  3FWN A;  3CLQ A;  1KFM A;  2P2U A;  3CXH H;  2H43 A;  1SQP G;  1FI3 A;  5L8R J;  2PRR A;  1CTZ A;  2O1J A;  1NU1 K;  2QM8 A;  2E76 B;  2XNX A;  1HRC A;  2R44 A;  1KX7 A;  3H1J G;  2OYO A;  4ASV A;  3OAK A;  2FY8 A;  2MKV A;  1FDI A;  4PWA A;  3AE4 C;  1AQT A;  1M7L A;  4R4L A;  1VF5 D;  5CCG D;  5KAI H;  4NFG B;  2FFD A;  5DFS A;  1D7M A;  2RKL A;  3FX0 A;  4H13 C;  1ZME C;  2NPS A;  2A06 D;  1KZU B;  1HJ0 A;  4DZO A;  4IL6 E;  1SQP D;  4HKZ H;  1NTK D;  1CSV A;  4WY4 C;  3MZW B;  2B87 B;  1CSW A;  3L35 A;  2C9X B;  1L4A A;  1J1E B;  5APY A;  3H1J D;  2KIK A;  3FXE A;  1K9M Q;  3M9B A;  1GZL A;  2H88 C;  1LT1 A;  3AEG C;  3LW5 H;  3PRJ A;  1PP9 E;  3ZBM A;  1CI6 B;  155C A;  1F1F A;  3TYY A;  3AE3 C;  2B89 A;  3W67 A;  1AVO A;  1M90 Q;  1M6Z A;  2ZT9 C;  1FZB A;  2UWJ E;  2N1T C;  3WFB C;  1CRH A;  3MGN A;  3VMA A;  2V07 A;  2OQQ A;  2BH5 X;  2WZ7 A;  2C0W A;  3TNU B;  2RH0 A;  1LTT C;  2JEE A;  1DVV A;  4IL6 H;  1VQ4 P;  2O1K A;  5APV A;  1I55 A;  5BU8 B;  2WSS H;  3H32 B;  4C7N B;  1YIC A;  2MHM A;  2KSE A;  2OYH B;  4N78 D;  1WEJ F;  4IL6 X;  2Q6Q A;  2CA4 B;  3JSV C;  2M5A B;  2WMM A;  3F5H A;  1BGY E;  3OA7 A;  3MK7 B;  5AVQ B;  1BGY D;  2SPZ A;  1ZXG A;  4D6T J;  1LGH B;  3E1R A;  3RMZ A;  1NO4 A;  1AJY A;  1WRG A;  1CSB A;  2C0X A;  1CIH A;  3L73 E;  3L75 G;  3SWY A;  1HF9 A;  3MUD C;  4NPF X;  2P67 A;  1LJ2 A;  1R5L A;  1XTC C;  2E42 A;  1RZ6 A;  1RAQ A;  3A0H V;  3OCD B;  1N86 A;  1AKK A;  1JY3 O;  2ZVO B;  4JCG A;  5BVZ A;  5APW A;  3H1J E;  1K05 A;  4U3F G;  2IBZ G;  3PP5 A;  2B11 B;  4MN4 C;  3H1K D;  1NIR A;  2O3J A;  1FZE A;  3NBS A;  3CWB D;  1SQP E;  1VPC A;  2V7Q H;  2B88 A;  3KHU A;  1QGK B;  1HWT C;  1RE4 A;  1NJI Q;  3SLE A;  2FFD B;  3KZI V;  1OW8 A;  3M06 A;  1EZV G;  2L4D A;  1J3S A;  1JNM A;  2C1D A;  1LWU B;  2FXP A;  1N9C A;  5TIS E;  5E79 H;  4WQ7 A;  3RL0 B;  4RKU J;  2M0B A;  1A56 A;  1DW1 A;  1L0L E;  2CE0 A;  4RSZ A;  1KB9 H;  1CHH A;  3WU2 V;  1BDD A;  3AE6 C;  4XFJ A;  2WTY A;  1S4X A;  1L0N K;  1N15 A;  2GIW A;  3CX5 D;  1BCC E;  4PV1 C;  2QJP C;  1IRV A;  1HGV A;  3L74 G;  3P7K A;  1KB9 D;  1LTS C;  4O9B A;  1SQQ G;  4UB6 V;  4WQC A;  3L74 J;  3AE7 C;  3HD7 A;  3CWB G;  3CCJ P;  1CRI A;  3A0B V;  1ZR4 A;  4U3F J;  1KQF B;  3BCC J;  1KYO H;  2N9Y B;  1OXZ A;  1Q81 Q;  2PFX A;  2WSF H;  4H44 B;  5B66 V;  1FI9 A;  3H1K J;  3V2P A;  3BCC D;  3O1Y A;  3MP7 B;  2PAJ A;  1T8Z A;  2YNY A;  3GG2 A;  3SWF A;  1LC1 A;  2OYI A;  4I7Z C;  3PXW A;  1H9X A;  1NKN A;  1NTZ K;  1YNR A;  4I1L A;  4AAM A;  3BRT B;  1GL2 D;  3CX5 H;  3NXS A;  1K04 A;  1LTB C;  5CJ4 A;  2WPV B;  1E29 A;  2AEF A;  3HE4 A;  5B66 H;  3B5N B;  3H1K E;  1SQX E;  3P8M C;  3JCU H;  3SWS A;  1FS0 E;  3A0B E;  5DF5 A;  3BCC E;  5AVS B;  3TF5 A;  2BLF B;  2KOG A;  1LP1 A;  1FDM A;  3CU4 A;  3HQ8 A;  2FKW B;  1ZZH A;  4UB8 V;  3L74 E;  1SQQ J;  1P84 I;  1DVH A;  1SP4 A;  1A02 J;  1N73 A;  3VP9 A;  1JY2 P;  1CIG A;  1VF5 C;  2QSI A;  5AW7 B;  4IL6 V;  1KFN A;  1GW4 A;  1P84 D;  3WUT A;  1GW3 A;  1L0N E;  4ZNC A;  3VNW A;  1FJP A;  2ZFC A;  1CCH A;  3HE5 A;  2OZ1 B;  1W5C E;  5CHX A;  3M9Q A;  2Y9Y A;  2C1D B;  1LWU A;  2H7H A;  1SQQ K;  2WSC J;  3L72 E;  4DY9 A;  1YI2 P;  1OIP A;  3JCU E;  1KIL A;  1X22 A;  3GF7 A;  3PH0 A;  2KXP B;  3L70 G;  3BAS A;  2N1T D;  1DEB A;  1N7L A;  2GC4 D;  2V7Q J;  2E76 C;  1CXA A;  3CCR P;  1NH4 A;  5AW1 B;  5CBN A;  2OTJ P;  5KLV K;  2ZOO A;  3SXT A;  1JTH B;  3CC4 P;  1N7S C;  4GOE A;  2NZ2 A;  3M0D C;  4FA1 A;  2IZ0 A;  1L0N D;  3H1I G;  3TGU J;  3CCL P;  3ITK A;  1FZG A;  4IFF A;  2Z5I A;  1AV1 A;  3H1J J;  3MUD A;  5KLV J;  2HLO A;  1HVV A;  1S6V B;  3M97 X;  2HPC A;  4RO0 A;  1DIP A;  3HQ7 A;  1KX2 A;  1Z56 A;  2W8Z A;  4K35 A;  1NTK J;  1EC5 A;  3TDK A;  1JMB A;  3NTN A;  1AYG A;  3S9O A;  3L72 G;  1QL4 A;  4W7Z A;  3IF4 A;  3GHG A;  3CP5 A;  3L73 J;  5KLV D;  2HOD A;  1RQU A;  3DP5 A;  1L0N J;  3JBT B;  5B5E H;  1FJ0 A;  1C2N A;  3H1I D;  1SQX D;  2ZXY A;  1L0N G;  4GDO A;  4EIE A;  1Q7Y Q;  1DEE G;  3HD7 C;  3RK2 C;  1PPJ E;  4WQ9 A;  1BGY J;  1ETP A;  4C46 A;  2E75 C;  1IFJ A;  1GDV A;  2KNC B;  3GLM A;  3RK3 D;  3L4M A;  1TU3 F;  5KAF H;  2FBW C;  3KZI H;  4UB8 E;  3JC2 2;  5CCG C;  1JMM A;  3VN0 A;  3GW6 A;  4GIF A;  1QYZ A;  2GUV A;  1RAP A;  2M3E A;  1S5L X;  2GUS A;  3GMA A;  2PCC B;  1LP1 B;  3Q3D A;  1Y9B A;  1MZ4 A;  4FB1 A;  2JR8 A;  5CIE B;  2QM7 A;  1LTJ C;  1S1C X;  4LGD E;  5CIG B;  1SQX G;  2ZT9 D;  2WSE H;  2OYH C;  1PIX A;  2P58 A;  4N3Y B;  4L73 A;  2J58 A;  2K3R A;  4L1Q A;  1KTM A;  3N4X A;  1NOH A;  3HUS A;  2L5G B;  4H0K A;  1YQ3 C;  4EI2 A;  4H0L C;  451C A;  3RN0 A;  1L0L D;  1G2C A;  2ZXX A;  1HGZ A;  1FI7 A;  1OWA A;  3FXD A;  1KB9 E;  1NMI A;  1PP9 J;  1FZC B;  2JKV A;  1PGJ A;  3H1L E;  4GED B;  1VQ9 P;  1W5C T;  3PHL A;  3V4Q A;  2CPB A;  1H33 A;  5GTI E;  1HCM A;  4XE5 B;  2QJK B;  4PJ0 E;  1L9J C;  1P84 E;  1RE3 C;  1CRJ A;  1KIB A;  3EWK A;  3OJA B;  2KS1 A;  3Q2Y A;  2N1T A;  1QVF O;  2FYN C;  2ZBO A;  3G6E P;  1VQK P;  1JDL A;  1YEB A;  1J2J B;  5AW2 B;  4P4Q B;  3V2Q A;  1JTH A;  4LLH A;  5AW0 B;  1HZU A;  3U1C A;  3DR0 A;  5APU A;  1M1J B;  1IJD B;  3AEB C;  2I1J A;  3HD7 B;  1YFC A;  1EXI A;  3CXH E;  3CCM P;  1Q86 Q;  4YXD C;  1NU1 D;  4WBA A;  1KIL C;  3L70 E;  3CME P;  1AOQ A;  1L0L G;  2CK3 H;  2P7J A;  3ZOX A;  3V4W A;  1JO5 A;  1LT9 B;  4PJ0 H;  3ZDM A;  2OYH A;  1YEA A;  4R4M A;  5AW8 B;  1IRW A;  3ZOY A;  2D0S A;  4WY4 D;  4I2L C;  3OA8 A;  1LTJ B;  1R0Q A;  1H0T B;  1Y47 A;  2N9B A;  4JQ0 D;  5KKZ B;  1SFC D;  4DCK A;  3KYQ A;  2B0Z B;  1MG3 D;  4B86 A;  3IN6 A;  1MZ9 A;  1YCC A;  1EZV I;  1NU1 G;  4PV1 B;  3CMA P;  2IPP A;  2GM4 A;  4YPC A;  2FWL A;  3C1L A;  4H0L B;  2A45 H;  1RF1 A;  1N7S D;  1GJQ A;  2YIU C;  1S5L V;  3HRN A;  4PJ0 V;  1HJ4 A;  1FZC C;  2E43 A;  4A7P A;  3CX5 W;  1I6E A;  3A3Y B;  3R4Y A;  2K9J A;  2K88 A;  2QJK C;  5C39 A;  1DD3 A;  5B5E E;  2CA3 B;  2IBZ D;  2AXT H;  3L73 G;  3QH9 A;  4L3G A;  3I5C A;  3HTK A;  1T2K D;  1RZ5 A;  3M0D A;  1NTZ D;  1NTM J;  1SQV E;  4JPZ B;  1J1E C;  4EIF A;  3G3Z A;  3H1L G;  1S5L E;  4L74 A;  1M8O B;  1HBW A;  1FZF A;  4W7Y A;  4WQE A;  2Q9I A;  1CED A;  1USD A;  1CRC A;  1CYC A;  4GOF A;  1CW5 A;  2E75 D;  1EQ7 A;  1OMI A;  3M9H A;  3A0H E;  1HRO A;  1KIL B;  2R32 A;  1PGP A;  2Y0C A;  3O6Q A;  1BDC A;  2B87 A;  3RBX A;  1OW6 A;  4N6J A;  5M1B A;  1Q90 D;  1RQV A;  1CXC A;  1BE3 J;  3CWB E;  1NNO A;  1OFC X;  2A06 E;  1KQL A;  5C0Z A;  1CO6 A;  1CHJ A;  2C1U A;  2JWD A;  1URQ B;  4FAV A;  2Z5H A;  1GD2 E;  1CC5 A;  2QVA A;  1BE3 E;  3CWB J;  3AEF C;  3TNU A;  3H1H G;  3D70 A;  3P8C D;  1SLQ A;  3M91 A;  1COR A;  3ZIY A;  1G1J A;  2O01 H;  1CCR A;  2I8F A;  1NU1 E;  3TK1 A;  1MG2 D;  4AAL A;  1I8P A;  4KHX A;  1YIT P;  1BCC D;  1A2S A;  1EDL A;  1U7J A;  1J1D B;  4L3H A;  5KJ7 C;  1H32 A;  1CTJ A;  3AEC C;  1VQ7 P;  4HB1 A;  2Q3I A;  3RLM A;  5KAI E;  1CSU A;  3DMI A;  2C9N Y;  2YQB A;  1AOF A;  3LIE A;  5IY5 1;  3CCV P;  3H6P A;  2W6B A;  4Y99 C;  1KV9 A;  2RMZ A;  2N3Y A;  1GK4 A;  4TLF A;  2D2C C;  4PD4 H;  2LKM A;  5TIS V;  1COT A;  1A02 F;  1IO3 A;  2IX7 C;  1EDJ A;  2JDI H;  1M70 A;  3WU2 H;  4OGQ C;  2IBZ E;  4AUW A;  1E8E A;  1CRY A;  3A0H H;  1DH3 A;  5AVR B;  3FGA D;  1YBK A;  1W2L A;  4AAO A;  5AVW B;  1B7V A;  2I1K A;  3WFD C;  3L75 E;  1DIQ C;  3I55 P;  5EFW B;  1HH7 A;  1KMI Z;  4Y28 J;  3RL0 C;  1LTG C;  2WT7 B;  4TT3 H;  2B12 B;  3AE9 C;  1RHZ B;  2M8R A;  1BGY G;  2YMK A;  3L75 J;  5KAF V;  2WSE J;  2HR3 A;  1UIX A;  1OAE A;  2ZJS E;  4JYC A;  1GL2 C;  4KT0 J;  1NHL A;  3H25 A;  3O8Z A;  3WU2 E;  1DD4 A;  5CCH D;  1L2P A;  1RY3 A;  5AW5 B;  3O6Q B;  3V2N A;  2WPS A;  3ZOW A;  4O1Q A;  3L36 A;  5GTH V;  2YCC A;  5CIH B;  5GTH E;  2OTK E;  1SQB J;  3U59 A;  1J1D C;  4WB4 A;  3L70 J;  2W6A A;  3NBT A;  2FYU K;  1T3U A;  3L70 D;  3L71 D;  5H2F E;  1FOS E;  3LW5 J;  2YO2 A;  3PLN A;  2E5Y A;  1OVR A;  3ABV C;  2IYP A;  3H1K G;  4H13 B;  4EIC A;  2Q3E A;  3TGU G;  1WMK A;  2QA4 P;  1ZRT E;  2CPS A;  1OVU A;  3A0B H;  2G8Y A;  4ZMD A;  3CPW O;  2BEZ F;  4Q5P A;  3T97 B;  4YE1 A;  3VOP A;  1YJN P;  1OX3 A;  5GTI H;  1RE3 A;  3KDP B;  2L91 A;  3N7N A;  1T3J A;  2E74 D;  1GDT A;  2OTL P;  3A2A A;  1C7M A;  1HH0 A;  3L72 D;  5APQ A;  5KTB A;  3H1L J;  2ZT9 B;  5GTI V;  4WQB A;  3HQ6 A;  3SWK A;  1E5W A;  2J59 M;  1ZP0 C;  4WY4 B;  2FYZ A;  4AQR D;  3O20 A;  3WMM 0;  1ZOY C;  2OYI B;  1I8O A;  1EZV D;  2B4Z A;  5AVY B;  1JCD A;  3AEE C;  1PZQ A;  2O01 J;  4BXL A;  2KB7 P;  3L74 D;  5KJ7 A;  2V4H A;  3G9R A;  5DJQ C;  2IYO A;  1BCC G;  5AVZ B;  3Q5R A;  3GHG C;  2ZYD A;  3A5T A;  3TGU D;  1VL2 A;  1EDK A;  3CCE P;  5GTH H;  2AIU A;  3HQ9 A;  2PCB B;  3IR9 A;  3V6I A;  1T2K C;  1YHQ P;  5AVU B;  1E2R A;  2I8D A;  3KPE A;  1L9B C;  1CIE A;  2BPB B;  3ORV A;  1DW2 A;  4DOJ A;  1H31 B;  1HTL C;  1RF1 C;  3RN1 A;  2KLV A;  2QJY C;  1N73 B;  1FC2 C;  2NPS C;  1IQC A;  2ZXE B;  1EDI A;  1SVF A;  4M3L A;  1N50 A;  2HPC B;  2N18 B;  5CCG A;  3LID A;  1IFM A;  1L4A C;  3IAO A;  3H1H E;  3KXD A;  1N7S B;  1H8A A;  1MKM A;  2PP6 A;  5TJH A;  2LXC B;  1AQ5 A;  2Q1K A;  4JBZ A;  3CX5 E;  4OGQ D;  1FU1 A;  4WVZ A;  2W27 A;  3TYI A;  1YTC A;  2IFM A;  2C2C A;  2ORL A;  2FYU J;  1DX7 A;  4BWN A;  3SJL A;  1PGO A;  3ZOO A;  1OZH A;  1GKS A;  1W2E A;  2E5T A;  2BCC J;  1S72 P;  1FE6 A;  2IZ1 A;  2P1J A;  3U1A A;  1C75 A;  1KD1 Q;  3AE5 C;  2OAR A;  3SFD C;  1GL2 A;  3BVH A;  2IDB A;  4UB6 E;  2FXO A;  2KP8 A;  3FWL A;  3A9F A;  5KAI V;  1NVO A;  3B5N D;  1NTK G;  3D6Z A;  4CPG A;  3RK2 B;  1NKZ B;  4KMG A;  1C52 A;  1Q2N A;  5CIF B;  4QAO A;  5CIC B;  2QEX P;  1IK9 A;  3GHG B;  3C2C A;  2E75 B;  5CCH C;  1QL2 A;  4PD4 D;  2Y0E A;  1I6D A;  5AVT B;  1YJW P;  2P10 A;  5AW3 B;  3L37 A;  1JY3 P;  2C8S A;  4L75 A;  3SFE C;  2K37 A;  1ZW0 A;  1KYO D;  1G1I A;  4EIJ A;  4BRY B;  3VMY A;  3RK3 C;  5E79 V;  1FJK A;  3BRV B;  4HJG H;  2XKM A;  3HE5 B;  3RGU A;  2IBZ I;  1SQQ E;  3OW2 O;  3P32 A;  2NPS B;  1P84 H;  1K73 Q;  2QJP B;  1PL5 A;  5CBO A;  1CIF A;  1PGQ A;  3PJS K;  2V08 A;  1HZV A;  4O1W A;  2LIR A;  2K1A A;  1S5L H;  3S1K A;  1SQX J;  1IZL 0;  4RES B;  1KIL E;  1R5S A;  1H89 A;  3CI9 A;  1CI6 A;  1JOC A;  3L4F A;  5APT A;  2ZZS 1;  3AEA C;  5B5E V;  1IZN B;  2W90 A;  3L73 D;  2R3S A;  1SQB K;  2WVR A;  1URQ D;  5KLI B;  1FOC A;  2Y0D A;  3B5N C;  1FZC A;  3HUS B;  2FYN B;  1FDO A;  4HH2 A;  1BSH A;  2H89 C;  2XND H;  1LTI C;  1M56 D;  1QN2 A;  1Q82 Q;  3SSU A;  1FCD C;  3WUV A;  4N0K A;  1RF0 C;  1S3J A;  3CXH W;  2DW3 A;  1H33 B;  2M3B A;  4RJT A;  3VYI A;  1M1K Q;  1EB7 A;  4XYD B;  1YQ4 C;  1S9K E;  3H1I J;  2WSC H;  1KYO I;  2N1T B;  4U3F E;  3WFE C;  2KSJ A;  3B8E B;  1IC2 A;  2CE1 A;  3D0W A;  2A06 G;  1U74 B;  3Q1M A;  3PXS A;  1T6A A;  2YKP A;  351C A;  2ZAE B;  1KV4 A;  4NPE A;  1AFO A;  1LT9 C;  1M1J A;  1MFZ A;  2FRC A;  1YYC A;  2W83 C;  4GT1 A;  5TIS H;  2KNC A;  3CXH D;  1LS9 A;  1GU5 A;  4YTP C;  1PP9 D;  3HD7 D;  2QRX A;  1AVY A;  2CXB A;  1VF5 B;  4D6T G;  1FHB A;  3B5N A;  1CYI A;  2NPS D;  1L0L J;  3CYT I;  3M0A A;  2AXC A;  4Z1M H;  2WPR A;  1VQ5 P;  1KN7 A;  1H88 A;  3VRD A;  2MJZ A;  2ITA A;  1NTK E;  3EFG A;  3NMD A;  1NTM D;  4WQ8 A;  1NTZ J;  1L4A D;  3O0R C;  1SQV G;  1CSX A;  4H0J A;  5AW9 B;  3RL0 D;  2YIU B;  1LT9 A;  1C6S A;  1FZA A;  1DW0 A;  5KLV E;  3P8C E;  1U7M A;  1UII A;  3TGU E;  4BRY A;  3CD6 P;  2KYV A;  1YIJ P;  4GOD A;  1SQB G;  3E1I A;  2YXQ B;  4FAN A;  1H9Y A;  3VYM A;  1QX8 A;  4PD4 E;  2Q7C A;  3ZCF A;  2ZYA A;  2VHD A;  2HYN A;  1E79 H;  1SQX K;  5B6Q A;  5KLI C;  2Q5U A;  2FYU E;  2GB8 B;  4UB6 H;  1XTG B;  4DT0 A;  4H0L D;  3IFM A;  4FA5 A;  1NTM G;  3RL0 g;  4AAN A;  3G4S P;  1M57 D;  3L4O A;  1NTZ E;  1ZN5 A;  2K9Y A;  2WSF J;  3L72 J;  3VTP C;  4MU8 A;  2W6J H;  1SQV K;  1GK6 A;  1K8A Q;  1HUC A;  1PP9 G;  1PPJ G;  2G3A A;  5EXQ A;  3AE2 C;  1IO4 A;  1OVV A;  1YIQ A;  3I56 P;  2QG4 A;  5B66 E;  3OCD A;  2A45 G;  2C9L Y;  3L75 D;  1H31 A;  5K5G B;  4Y5R A;  3USS A;  5KAF E;  2BCN B;  2B10 B;  1IFP A;  4D6T E;  1WVE C;  1OCD A;  3W68 A;  3PTZ A;  3Q5S A;  4EOT A;  3CX5 I;  1QLE D;  1LWU C;  2OYI C;  1KQG B;  1N2D C;  1C2R A;  4U3F D;  2MTA C;  2D2C D;  2E74 C;  1N90 A;  1N7S A;  3CXH I;  5H2F H;  1N8R Q;  4PW9 B;  4K3A A;  4J20 A;  3RBZ A;  4PD4 I;  2XV5 A;  5AUR A;  3H1I E;  2VRS A;  1SQP K;  2R5D A;  4AX3 A;  3C9I A;  1KIL D;  2PAC A;  2BAS A;  2E76 D;  2XTS B;  5AVX B;  1QL1 A;  2AXT V;  1VQL P;  2ZYG A;  3PH2 B;  3VP8 A;  2N3B A;  1VQO P;  4OH8 B;  1KOR A;  1LTA C;  1FOS F;  1U75 B;  4OVN F;  2ZVN B;  3MTU E;  3X39 A;  3MHV A;  2M5A A;  3VMZ A;  2R3C A;  1N73 C;  1ZR2 A;  3D71 A;  1QVG O;  1VQ6 P;  1A8C A;  3TSI A;  2XDJ A;  5BU5 A;  2N18 C;  1C6O A;  2R5B A;  2EXV A;  1KB9 I;  2BGV X;  1JB0 J;  2JO1 A;  1RF0 A;  1VQM P;  3F89 A;  4WWI A;  4V2K A;  1SQQ D;  2C1V A;  1MUU A;  3MIW A;  1NTZ G;  3WUU A;  1BE3 G;  4OGQ B;  4EID A;  3PXT A;  4K3I A;  1YJ9 P;  1HJ5 A;  1M1J C;  1M60 A;  2KLU A;  3EFF K;  1KYO E;  2FXM A;  2QIW A;  2N9J A;  1DII C;  3WC8 A;  1BCC J;  2NRG A;  3BCC G;  3E7K A;  1JY2 O;  1FBM A;  5DJT B;  3CCU P;  2YO3 A;  5AW4 B;  2FYU D;  4FA4 A;  1GIW A;  5DJU B;  2YXR B;  1OW7 A;  1PV3 A;  2E74 B;  1RH5 B;  3B4S A;  1GQ1 A;  1NAY A;  3WUI A;  2POH A;  1SQV D;  2YKO A;  1GU2 A;  1VQP P;  2KS1 B;  5KKZ C;  2JJL A;  4JYB A;  1ZRT D;  1JY3 N;  1NGM B;  2HG5 D;  3II6 A;  4EDF A;  1VQN P;  4AYC A;  3SVW A;  2JQR A;  3L71 E;  2WT7 A;  3D6Y A;  1W2B O;  1LNQ A;  1C6R A;  4FA9 A;  2JP3 A;  3MK7 C;  4C7R A;  1URQ A;  1CHI A;  3H1H D;  2IFN A;  2BCC E;  1DT1 A;  1SQP J;  2KZI A;  1BE3 D;  3NFQ A;  2DGE A;  2LR2 A;  2GA1 A;  3V5B A;  4HYT B;  1QL3 A;  2WPQ A;  1NML A;  3A7O A;  2WWW A; 
#chains in the Genus database with same CATH homology
 4PJ0 V;  1HJ4 A;  2C1D A;  1N9C A;  4KMG A;  4A7P A;  1C52 A;  4WQA A;  1CNO A;  3CX5 W;  1PPJ D;  4QAO A;  4WQ7 A;  5CIF B;  5CIC B;  1I6E A;  3C2C A;  2BH4 X;  4PD4 D;  2RN0 A;  2N9I A;  1A56 A;  2Y0E A;  1DW1 A;  1K3H A;  2CE0 A;  1I6D A;  4RSZ A;  1CHH A;  2JWA A;  3WU2 V;  2D0W A;  2CA3 B;  2IBZ D;  2C8S A;  4L3G A;  1RZ5 A;  3O5C A;  1N15 A;  1KYO D;  1NTZ D;  2GIW A;  2BCC D;  3CX5 D;  5E79 V;  4EIF A;  1IRV A;  3NWV A;  5CIB B;  1KB9 D;  4UB6 V;  4WQE A;  5C9M A;  4WQC A;  2ZON G;  1CED A;  1CRC A;  1CYC A;  1CRI A;  3A0B V;  2QJP B;  1CIF A;  2JTI B;  2V08 A;  2N9Y B;  1HRO A;  1HZV A;  4O1W A;  2Y0C A;  2LIR A;  1LMS A;  2K9J B;  5B66 V;  1FI9 A;  1IZL 0;  3BCC D;  3O1Y A;  1CYJ A;  5DJQ B;  2YK3 A;  2ZZS 1;  2LIT A;  1CXC A;  5B5E V;  3GG2 A;  1LC1 A;  3L73 D;  1NNO A;  5C0Z A;  3PXW A;  1CO6 A;  1H9X A;  1F1C A;  5CID B;  1CHJ A;  5KLI B;  1YNR A;  1FOC A;  2C1U A;  2Y0D A;  4AAM A;  4FAV A;  1CC5 A;  2FYN B;  1CTY A;  1E29 A;  1QN2 A;  1FCD C;  1COR A;  3ZIY A;  1CCR A;  4N0K A;  2I8F A;  3CXH W;  1H33 B;  2OZ1 A;  1MG2 D;  4AAL A;  4RJT A;  1I8P A;  2QJY B;  1HJ3 A;  1EB7 A;  1BCC D;  1A2S A;  1VYD A;  4XYD B;  4L3H A;  3SWS A;  1H32 A;  5DF5 A;  1CTJ A;  2DVH A;  1LC2 A;  3TF5 A;  2BLF B;  3WFE C;  3RLM A;  3CU4 A;  1CSU A;  3DMI A;  3HQ8 A;  2YQB A;  2CE1 A;  1AOF A;  1LFM A;  1ZZH A;  4UB8 V;  1U74 B;  3PXS A;  5IY5 1;  351C A;  1DVH A;  4WQD A;  1KV9 A;  1CIG A;  2RMZ A;  2N3Y A;  5H2F V;  4IL6 V;  2FRC A;  4XXL A;  1CRG A;  5TIS V;  1COT A;  2HV4 A;  3WFC C;  1IO3 A;  1P84 D;  3CXH D;  1LS9 A;  1QKS A;  3VNW A;  1PP9 D;  1M70 A;  1CCH A;  2OZ1 B;  2CXB A;  1DW3 A;  1FHB A;  1CYI A;  2C1D B;  3H1L D;  4LJI A;  3CYT I;  1E8E A;  1CRY A;  1H32 B;  3VRD A;  4DY9 A;  1NTM D;  1KYO W;  4WQ8 A;  2GC7 D;  1W2L A;  3O0R C;  4AAO A;  3OA8 B;  1CSX A;  4H0J A;  1B7V A;  2YIU B;  1C6S A;  1H1O A;  1BL9 A;  4GYD A;  1DW0 A;  3WFD C;  1DIQ C;  2GC4 D;  1HH7 A;  1KB0 A;  1CXA A;  2AI5 A;  5CYT R;  2B12 B;  2ZOO A;  3SXT A;  4FAN A;  1H9Y A;  3VYM A;  3ZCF A;  2VHD A;  4FA1 A;  5B6Q A;  1I54 A;  1L0N D;  1I5T A;  1K3G A;  3ITK A;  5KAF V;  2GB8 B;  1OAE A;  4D6T D;  4FA5 A;  1S6V B;  3M97 X;  3HQ7 A;  1KX2 A;  4AAN A;  1SQB D;  3L4O A;  3TDK A;  3ZOW A;  4MU8 A;  4O1Q A;  5GTH V;  2YCC A;  5CIH B;  1AYG A;  1QL4 A;  5EXQ A;  3CP5 A;  1YIQ A;  3NBT A;  1FI3 A;  5KLV D;  2QG4 A;  1CTZ A;  3OCD A;  3L75 D;  3DP5 A;  1H31 A;  4Y5R A;  3L70 D;  3L71 D;  1HRC A;  2BCN B;  2B10 B;  1KX7 A;  3PLN A;  3JBT B;  1WVE C;  1OCD A;  3PTZ A;  1FJ0 A;  1C2N A;  3H1I D;  1SQX D;  2ZXY A;  4EIE A;  4WQ9 A;  4EIC A;  2Q3E A;  1ETP A;  4PWA A;  1C2R A;  4U3F D;  4Q5P A;  2MTA C;  4NFG B;  1GDV A;  4YE1 A;  5DFS A;  2KNC B;  3L4M A;  1N90 A;  4PW9 B;  2A06 D;  4J20 A;  1SQP D;  5AUR A;  2L91 A;  3GW6 A;  1QYZ A;  1NTK D;  1RAP A;  1CSV A;  4AX3 A;  2PCC B;  1MZ4 A;  4FB1 A;  1C7M A;  1CSW A;  5CIE B;  3L72 D;  2C9X B;  2PAC A;  3H1J D;  2XTS B;  5GTI V;  5CIG B;  4WQB A;  2AXT V;  3HQ6 A;  3PRJ A;  3PH2 B;  2N3B A;  3ZBM A;  155C A;  1F1F A;  1U75 B;  3O20 A;  3X39 A;  1I8O A;  4L1Q A;  1EZV D;  1M6Z A;  2B4Z A;  3WFB C;  4H0K A;  1CRH A;  3VMA A;  451C A;  3RN0 A;  1L0L D;  2V07 A;  1FI7 A;  1A8C A;  1NMI A;  2BH5 X;  3L74 D;  2N18 C;  1C6O A;  2EXV A;  4GED B;  1W5C T;  5DJQ C;  3PHL A;  2BGV X;  3TGU D;  1DVV A;  1H33 A;  1HCM A;  1I55 A;  2QJK B;  2AIU A;  3HQ9 A;  4V2K A;  2PCB B;  1L9J C;  1YIC A;  1SQQ D;  2C1V A;  1CRJ A;  1KIB A;  2KS1 A;  1E2R A;  2MHM A;  1L9B C;  4EID A;  1CIE A;  3PXT A;  1WEJ F;  2BPB B;  2ZBO A;  4K3I A;  1HJ5 A;  1JDL A;  3ORV A;  2CA4 B;  1M60 A;  1DW2 A;  1YEB A;  2N9J A;  1H31 B;  1DII C;  4P4Q B;  3WC8 A;  1HZU A;  3MK7 B;  3RN1 A;  1BGY D;  3DR0 A;  1IQC A;  1YFC A;  3RMZ A;  1N50 A;  2FYU D;  4FA4 A;  2N18 B;  1GIW A;  1NU1 D;  1CIH A;  5TJH A;  1AOQ A;  1GQ1 A;  3ZOX A;  3WUI A;  1SQV D;  1RZ6 A;  1GU2 A;  1RAQ A;  3A0H V;  3OCD B;  1AKK A;  1YEA A;  1ZRT D;  3TYI A;  4JCG A;  1IRW A;  3ZOY A;  1YTC A;  2D0S A;  2C2C A;  2ORL A;  3OA8 A;  4EDF A;  3SJL A;  2B11 B;  3SVW A;  1R0Q A;  3H1K D;  2JQR A;  1NIR A;  2O3J A;  3ZOO A;  1C6R A;  3NBS A;  4FA9 A;  5KKZ B;  1GKS A;  3CWB D;  3MK7 C;  1CHI A;  3H1H D;  2B0Z B;  1MG3 D;  1DT1 A;  1C75 A;  3KHU A;  1YCC A;  1BE3 D;  3SLE A;  3KZI V;  2DGE A;  2FWL A;  1QL3 A;  3FWL A;  1NML A;  3A9F A;  1GJQ A;  2L4D A;  5KAI V;  1S5L V;  1J3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...