2QJPB

Crystal structure of wild type rhodobacter sphaeroides with stigmatellin and antimycin inhibited
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
total genus 67
structure length 256
sequence length 256
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjpB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjpB02
3CXHW 2B11B 3L74D 4D6TD 4Y5RA 5DFSA 1YTCA 1H31B 1M70A 1ZZHA 3GG2A 3L73D 1CYCA 1I8PA 1DW0A 3BCCD 5C0ZA 1DIIC 5CIDB 3WU2V 1NTKD 3WFBC 2K9JB 1COTA 1H32B 2ZZS1 5CIHB 3ZCFA 3PTZA 2QJPB 2ZBOA 5CYTR 1I55A 4XYDB 1CRJA 2CA3B 1NTMD 2N18C 3H1HD 3NBTA 1H31A 4WQ7A 1AOFA 2MHMA 2ZOOA 3O20A 3CYTI 5KAIV 4YE1A 3H1ID 4PJ0V 1CYIA 1M60A 2L91A 1KV9A 1CHHA 3SVWA 1I5TA 3M97X 1S5LV 4EICA 1CSVA 1W2LA 3O5CA 4FB1A 1H1OA 4FA4A 2FYNB 1KIBA 1CXAA 4FAVA 2LIRA 1NTZD 4H0JA 1PPJD 1F1CA 2O3JA 2VHDA 1YNRA 1CRHA 2GC4D 2ORLA 3C2CA 2CE0A 1EB7A 1CC5A 2N3BA 3MK7C 5TISV 1IRWA 1NMLA 1DT1A 1L0ND 1E29A 1SQXD 2V07A 3CX5D 4UB8V 1HROA 1C6OA 2C9XB 3OCDB 1M6ZA 1CRCA 2OZ1B 1CHJA 1A2SA 1KX7A 1OAEA 2YQBA 1GJQA 2AIUA 2BCNB 3VNWA 2GC7D 2PCCB 1CCHA 1CRIA 4AANA 3TDKA 5KAFV 1B7VA 1LS9A 1NMIA 2Y0EA 1KB0A 2MTAC 1IQCA 4WQAA 3PXSA 2ZXYA 4PWAA 1IRVA 3OCDA 1FHBA 1CO6A 2OZ1A 3HQ8A 2C1UA 3L75D 3PH2B 1SQVD 1KYOD 3PXWA 3SLEA 3OA8A 3JBTB 2L4DA 1C52A 1U74B 1YICA 5CIEB 1CSWA 5KLIB 3RN1A 2YIUB 2ZONG 1KX2A 1HH7A 2PCBB 1DVVA 2QJYB 2B0ZB 2RN0A 4A7PA 3RN0A 4L3HA 1WEJF 1DVHA 1BCCD 2D0SA 2LITA 1RZ5A 5CIGB 1FOCA 4WQBA 4PW9B 3O1YA 4EIEA 2YK3A 5GTIV 1ETPA 2N18B 1L0LD 4JCGA 1QL3A 2AI5A 2BGVX 3PRJA 1N9CA 2GB8B 2N9IA 1NU1D 1FI7A 1LMSA 3ORVA 1H32A 1MG2D 1RZ6A 4FA5A 1R0QA 1CNOA 3H1KD 4PD4D 4P4QB 2BLFB 1DW2A 3WUIA 5KLVD 4K3IA 1QYZA 1CXCA 3L4OA 1HCMA 155CA 3A0HV 1PP9D 3PXTA 4EDFA 3CP5A 1DW1A 3DP5A 1CTJA 2HV4A 4FANA 2PACA 1U75B 3KZIV 1YCCA 3A0BV 1CTYA 2Y0CA 3L71D 4AALA 1HZUA 1LC1A 1W5CT 1QL4A 5B66V 4Q5PA 5DJQB 3ZOYA 1HRCA 5GTHV 1YFCA 1JDLA 4XXLA 4H0KA 5KKZB 2N9JA 1NNOA 2XTSB 1BGYD 3TYIA 1HJ5A 4WQCA 2FWLA 1CEDA 3CXHD 4WQ8A 3PLNA 2C1DB 1N50A 3X39A 3SWSA 4V2KA 1C6RA 1C2NA 1H33B 2FRCA 3WFEC 2EXVA 5E79V 3A9FA 2QG4A 1C2RA 1GKSA 1A8CA 4FA1A 3VMAA 1N90A 1OCDA 3PHLA 4EIFA 4RJTA 1YEAA 1GIWA 3CX5W 4L3GA 1CSUA 4EIDA 3WFDC 3FWLA 1E8EA 2N9YB 4AAMA 3L72D 3CU4A 4O1QA 1K3HA 2KNCB 4GEDB 5EXQA 4IL6V 3NWVA 1F1FA 4N0KA 1CCRA 1FJ0A 4MU8A 1H33A 1MG3D 1SQQD 1C6SA 3KHUA 1NIRA 3O0RC 2N3YA 3SXTA 1GU2A 5C9MA 1YIQA 2DVHA 1CIFA 1C7MA 4AAOA 1DIQC 3HQ7A 3VYMA 1C75A 3ZOXA 3ZOOA 1SQPD 4O1WA 1I6EA 1WVEC 2IBZD 4QAOA 5B6QA 1LC2A 1KYOW 1CIHA 3ZIYA 3RMZA 1I54A 4WQ9A 2FYUD 4L1QA 2QJKB 3CWBD 1QKSA 2BH5X 4GYDA 1CRGA 2Q3EA 1N15A 351CA 451CA 5TJHA 1SQBD 1YEBA 1GDVA 2CXBA 4KMGA 3TGUD 1HJ3A 1EZVD 1L9JC 2C1VA 1H9XA 5CICB 2AXTV 1MZ4A 3H1JD 2I8FA 2KS1A 3WFCC 4FA9A 2JWAA 1CORA 1CSXA 1KB9D 4UB6V 3TF5A 1P84D 1AKKA 2YCCA 3MK7B 1CRYA 1BE3D 3RLMA 3ZOWA 1FI3A 2JQRA 1QN2A 3WC8A 3NBSA 1CIEA 2C8SA 5B5EV 2CE1A 5H2FV 4AX3A 3VRDA 3L70D 2B12B 4DY9A 5CIBB 1LFMA 3DR0A 1K3GA 4J20A 2BH4X 3GW6A 1H9YA 5CIFB 1L9BC 2BPBB 1HZVA 1AOQA 1IO3A 4WQDA 4WQEA 1CTZA 1S6VB 1BL9A 2B10B 1RAPA 4RSZA 5DJQC 1ZRTD 1CYJA 1IZL0 3H1LD 3HQ6A 5IY51 2V08A 1CIGA 3L4MA 1DW3A 3OA8B 3ITKA 2C2CA 1FCDC 3HQ9A 1CHIA 2Y0DA 3SJLA 1A56A 2B4ZA 1GQ1A 1HJ4A 4LJIA 2CA4B 2DGEA 3DMIA 1E2RA 1FI9A 5DF5A 1I8OA 4NFGB 2GIWA 2C1DA 5AURA 1I6DA 2BCCD 1VYDA 4U3FD 3ZBMA 2D0WA 1J3SA 1RAQA 1AYGA 2A06D 2RMZA 2JTIB
chains in the Genus database with same CATH superfamily
1S5LH 3IAOA 1IFDA 4D6TD 5DFSA 3M9BA 1M70A 2ZT9B 1ZRTE 2WPSA 3RL0g 3T97A 3L73D 1NHLA 1I8PA 3BCCD 1SFCC 5B5EH 1LT9B 2RKLA 1L2PA 3PTZA 1RQVA 1M1JC 1DH3A 5GTIE 3Q5PA 2O01H 1D7MA 1ZR2A 2N18C 3NBTA 1H31A 1NU1J 2ZOOA 3CYTI 2D2CB 3BASA 5KJ7A 1CYIA 1PFIA 3H1IG 2QJKC 1PL5A 4O9BA 4EYYQ 2W6JH 5KLVJ 1JEKA 2AXCA 1KB9H 2FFDC 1W2LA 4FB1A 3NXSA 3MD0A 1BDCA 5CCGD 1BCCE 3F89A 2BASA 1BDDA 1EXJA 3MP7B 1PPJG 5APYA 1CRHA 2ORLA 4W7YA 3V6IA 1GL2B 1KFMA 1YJNP 3C1LA 1NMLA 3AEEC 4WY4C 1CI6A 5APSA 2IFMA 2W6BA 1SQXG 1QLED 1IFMA 1C6OA 2WTYA 1CRCA 1RH5B 2OZ1B 1CHJA 1A2SA 1UIXA 4BRYB 2ZXEB 1OAEA 1A02J 3H1KE 2XKMA 3O8ZA 3D6ZA 2B88A 1S9KD 3H1LJ 2QEXP 3TDKA 4QMAA 1LS9A 5GTIH 1Q7YQ 2Y0EA 1VQ4P 1S3JA 4WQAA 1GZLA 1Q2NA 2B87B 1SQPK 3PXSA 4PWAA 3HQ8A 3LIDA 4YXDC 4PJ0H 3L72J 3PXWA 2YNYA 2H7HA 1FOSF 1N8RQ 2FYUK 1N73C 1HGVA 3II6A 5CIEB 3L72G 1CSWA 2Q7CA 3VMZA 2HPCB 2VRSA 2N9BA 2BCCJ 2PAJA 2B0ZB 1IO4A 2M5AA 3RN0A 3CCMP 4LGDE 2ITAA 3G3ZA 1RZ5A 4ASVA 3GF7A 2NZ2A 1Q82Q 3B5NA 2YK3A 2ZT9C 2WVRA 1SFCD 4PV1B 2W90A 1ETPA 3H32A 4ASWA 1ZP0C 3FWNA 3GF3A 3CCLP 4KJMA 3L75E 3E1RA 3H6PA 1LT9C 4RKUJ 1N9CA 2JR8A 2JKVA 1LMSA 1J1EB 2Q1KA 1N7SB 4H44B 1R0QA 4PD4D 3R2PA 1KD1Q 3WUIA 1SQBG 3BVHA 1DEBA 1QYZA 3TGUG 1HCMA 3A2AA 3A0HV 1WT6A 2D2CC 3VMXA 1PP9D 4L73A 1DW1A 3DP5A 3AE6C 3BATA 1K04A 1GDTA 1CTJA 3AE3C 3TSIA 1YITP 2HV4A 5CCGA 3O6QA 1BE3G 2Y0CA 3L71D 5H2FE 4AALA 2FXMA 5B66V 3L70J 2A45G 1NU1E 1L4AB 5GTHV 3LIEA 1JDLA 4R4LA 4WY4D 2WSCH 3G71P 1GMJA 5KLVE 1HJ5A 2FBWC 2K88A 5CJ4A 2OTJP 5AVVB 3A3YB 3PLNA 4V2KA 3V2PA 1C2NA 1H33B 3WFEC 5E79V 1C2RA 2C0XA 2XU6A 4Z1MH 1M57D 1A8CA 1NTKK 3L35A 3PHLA 4EIFA 2OQQA 4EIDA 4ZNCA 3CU4A 5BU5A 1VQMP 3V4QA 4GEDB 5EXQA 1AQTA 3CXHI 1RF1A 2G8YA 4HKZH 4N0KA 2K9YA 2HODA 3CC7P 3L74J 1M1KQ 2YO2A 1NIRA 1X8YA 2DVHA 1C7MA 1NYHA 3L74G 3CXHE 1DIQC 3VYMA 1C75A 3M06A 3KZIH 3H1LE 3P8CE 4O1WA 5AVQB 4JF7A 2KNCA 1LC2A 3ZIYA 3NMDA 2ZT9D 4L1QA 4JPZB 3MUDC 3CWBD 3L72E 1NTMJ 3H1HJ 2XV5A 1KILE 4PV1C 1T3JA 2LXCB 1M1JA 1NTMG 3HE5A 4KMGA 2G3AA 5AVUB 3D6YA 1L9JC 1EZVD 2ZJSE 2BCCE 3LW5H 4YTPC 2IBZI 2A06E 1VQ5P 2I8FA 1MZ9A 1H8AA 1J1EC 3H1JG 4W80A 3G9RA 1HJ0A 1N7SC 4H44C 1CORA 4UB6V 3TF5A 4IFFA 1P84D 2D2CD 1AKKA 3MK7B 2OYOA 3KXDA 3RLMA 3ZOWA 1NVOA 5APQA 2IBZE 2FFDA 3WC8A 2CK3H 2C8SA 3G4SP 2OYIB 3VRDA 1GW3A 5AVXB 3RBZA 1NKZB 2P1JA 2B12B 5CIBB 1LFMA 3L71J 1Y8AA 4OWFA 3USSA 2N1TA 4JQ0D 5CHXA 1K3GA 2BH4X 1AOQA 1SQVK 1E79H 1JO5A 2YKPA 1RY3A 1BL9A 2YXQB 3CXHH 1L4AC 1MKMA 3CCQP 4WY4A 2UWJE 5IY51 3WUVA 2KK7A 3OA8B 1M56D 1OVUA 1CHIA 2XDJA 2Y0DA 3S1KA 2H88C 4AYCA 2FY8A 1KQGB 4I6MC 2ZVNB 3L70E 4WVZA 3NTNA 3PJSK 2GIWA 3EQ2A 1VYDA 2XZRA 2AXTH 4U3FD 5EFWB 1J3SA 1RAQA 3V2QA 2CPBA 3SWYA 3CXHW 1HF9A 2MJZA 4Y5RA 1YTCA 1VQ9P 1R8EA 1CYCA 4HH2A 4N78E 4RESB 3OAKA 2B9BA 4YXWH 4AQRD 5KLVK 3WFBC 3OJAB 1BCCG 2ZZS1 1S9KE 2QJPB 1L0LJ 1VPCA 5DJUB 3TNUA 1OX3A 5CYTR 3AEDC 1HGZA 2CA3B 2YO3A 2P67A 1AOFA 2MHMA 3O20A 5KAIV 3CWBJ 4YE1A 4IL6X 1SQXK 3H1ID 1M60A 1MV8A 4PV1D 1CHHA 3SVWA 3H1KJ 3M91A 3L74E 3VYIA 4C46A 4L76A 3Q5RA 3H1KG 2NPSA 3A0HE 1H1OA 4FA4A 2LXBA 1N7SD 1CXAA 4FAVA 1YYCA 2A45H 4H44D 2LIRA 1ZR4A 1NTZD 1YBKA 1LTGC 1PPJD 3AEGC 3HTKB 2VHDA 2GC4D 2CE0A 1CC5A 3MK7C 1NTME 2M8RA 3H1HE 1IRWA 2POHA 5B66E 1DT1A 1L0ND 1SQXD 3CX5D 4UB8V 1HROA 2GUVA 5GTHE 1LTTC 2OYIC 3OCDB 1AJYA 3S9OA 2KSJA 1BGYJ 1H0TB 1GJQA 3M9QA 1RE4C 2HFED 2O1JA 2IYOA 3GMAA 1LTJB 1L4AD 3V5BA 5KAFE 1FZFA 1JY2O 3WUUA 3ABVC 1S72P 1HH0A 2QE7H 1XTGB 1IK7A 1KB0A 2MTAC 1PV3A 5E79E 1KQFB 3FXEA 2ZXYA 1IRVA 2OZ1A 3V2NA 3EFFK 1JY2P 2E75B 3L71E 3JBTB 5AW3B 1YJWP 1YICA 2ZONG 2PCBB 1HH7A 1DVVA 1S2EA 2QJYB 2RN0A 1HJBA 4A7PA 1VDFA 1SQBK 2WT7B 3A0HH 1SQQJ 3I56P 2O1KA 4Y99C 3CCRP 1X0TA 3MTUE 2LITA 1SQQG 4WQBA 1KYOI 2CPSA 1K05A 1GD2E 1URQD 3O1YA 1AA0A 4JBZA 2WITA 3RBXA 2WZ7A 4BXLA 3GHGC 2Z5IA 1VQNP 2OYHB 1JY3P 3D0WA 3AECC 2HPCA 5B66H 1QL3A 1BSNA 1NWQA 2BGVX 1USDA 1FZGA 1KYOE 2GB8B 5GTHH 2N9IA 1NU1G 1EDJA 4IFMA 2K9JA 1SP4A 2KUBA 4WB4A 1H32A 1VQ6P 2QJPC 1LTBC 3QWOC 1RZ6A 4FA5A 3IR9A 3MUDA 4P4QB 2FKWB 4K3IA 5KLVG 1CXCA 3L4OA 1QGKB 5KAFH 1RE3C 3PXTA 3CP5A 1JCDA 5E79H 4UB6E 3AE2C 2V4HA 1LP1A 3M0AA 3A0BE 1DD3A 4GODA 2PACA 2H8PD 1A02F 2SPZA 1L0LE 2P58A 1NTZJ 2H43A 1G1JA 4GT1A 1VQ8P 2R44A 4Q5PA 4I2LC 3CWBE 3Q2YA 3HUSB 3IN6A 1LTSC 3SFDC 3K5BA 1JTHB 2XTSB 4WBAA 3TYIA 1OW8A 1MUUA 3AE9C 3WMM0 3PH0A 1JOCA 4WQCA 3I5CA 1OWAA 2J59M 1ZMEC 2C1DB 3X39A 1JUNA 3H1LG 2WPRA 2EXVA 3A9FA 5AVWB 2WSFJ 3RGUA 3VMAA 1N90A 1KYOH 4BWNA 1LTJC 1EQ7A 2KB7P 1YEAA 4KT0J 2ZXXA 4L3GA 3T97B 1PGQA 5AVZB 4AAMA 3R4YA 3FGAD 1H89A 1KFNA 4IL6V 3NWVA 1NTMK 1F1FA 1QL1A 1CZQA 2Z4EA 3AE8C 2BCCG 1H33A 1BGYE 2E76B 4D6TJ 2E75C 1C6SA 3AEBC 3P8MC 2A06G 2N3YA 1U7MA 2KZJA 3M9HA 5C9MA 3L73J 1YIQA 4UB6H 3BCCJ 3HQ7A 1J2JB 3JC22 2QJYC 3A0BH 1SQPD 1G2CA 1WVEC 3BCCG 4HYTB 3AE5C 3N7NA 4QAOA 5B6QA 2IBZG 1KYOW 1FBMA 3RMZA 1URQA 1I54A 4WQ9A 1S4XA 2KS1B 3IF4A 2FYUD 2B89A 1QKSA 1YIJP 3M0DA 3L4FA 1M90Q 1QEXA 2W27A 2OYHC 2ZFCA 2CXBA 1KC8Q 3RL0B 2OTKE 1HJ3A 5AW8B 2C1VA 1M7LA 1EDKA 2W83C 1SQQE 1AQ5A 2Q6QA 3H1JD 4FA9A 1UIIA 1RF0C 2Q9IA 1USEA 2YMYA 1KB9D 1CI6B 1YHQP 3CC4P 1FAVA 1SLQA 5KTBA 3KYQA 3V4WA 2JQRA 1YJ9P 3OA7A 3CCVP 5B5EV 2PP6A 1QVFO 3L70G 4DY9A 1GL2C 3MIWA 3JSVC 2IZ1A 1JMBA 1H9YA 4H0LB 1HZVA 4ZKPA 1IO3A 4UB8E 4WQEA 3CPWO 3HE4B 1J1DB 1ZW0A 1ZRTD 3G6EP 1LWUA 4NPDA 1HUCA 3C8VA 3HUSC 1KILB 3Q1MA 4N3YB 2KLUA 1FCDC 3Q3DA 4JYCA 3HQ9A 2HYNA 1A56A 4H13B 1IK9A 1OW6A 2DGEA 1NTZE 3DMIA 1I8OA 3VP8A 4NFGB 1I6DA 5CBNA 1YQ3C 2K3RA 4I7ZB 5BVZA 3B5NB 3C9IA 3S4RA 2JTIB 4DT0A 2ZYGA 1ZZHA 5M1BA 1LGHB 5K5GB 3GG2A 2KYVA 5C0ZA 2KIKA 1DIIC 1G1IA 3WU2V 1OXZA 1NTKD 1COTA 5H2FH 2YKQA 3AEFC 2E76C 5CIHB 2Y9YA 3ZCFA 1SFCA 1SQPJ 2E42A 2ZBOA 1VQ7P 3W68A 1I55A 2FXPA 1CRJA 1IZNB 1LNQA 3H1HG 4WQ7A 1U57A 3GHGA 4PJ0V 1FC2C 4TT3H 2L91A 1FDIA 1KV9A 1VQPP 3M97X 2OGUA 5BU8B 4EIJA 2C0WA 3B71A 4NPEA 4D6TE 3L73E 1CSVA 1JCCA 1NGMB 3O5CA 1PP9J 3BCCE 3RL0C 2FYNB 1KIBA 1PP9G 3AE4C 3U59A 3RK3B 1RE3A 2O3JA 5AW4B 1YNRA 3C2CA 2KSEA 2N3BA 2OTLP 5TISV 1NKNA 2JP3A 1FJPA 3L71G 2C9XB 5AVSB 1M6ZA 2IFNA 1GL2D 5AW2B 1Q90D 1X79B 2WPVB 2M3BA 1KX7A 1N86A 1T8ZA 4OH8B 3V2RA 3HTKA 2BCNB 4H0LC 2GC7D 1SQQK 2P2UA 1J1DC 1CCHA 1CRIA 2WSFH 4AANA 1RF1B 1B7VA 3A5TA 1GU5A 1IQCA 1KILC 3JCUE 3OCDA 1BSHA 2C1UA 3L75D 3PH2B 2Q3IA 1SQVD 2P7JA 3SLEA 1Q86Q 1NU1K 3CMAP 2L4DA 4H13C 2W6AA 1U74B 5KLIB 3RN1A 2E74B 1LTJA 4IL6E 2YIUB 4IOIH 1KX2A 1ZXGA 3CCJP 1N73A 3NFQA 4L3HA 1X9VA 3P32A 3CCSP 1NO4A 1DVHA 3BRTB 4I7ZC 2D0SA 3B5NC 1QVGO 5CIGB 1Z56A 1WMKA 5APWA 4EIEA 3HE5B 3HD7B 1NTKJ 1GTWA 2N18B 2E76D 4JCGA 1L0LG 1Y9BA 2AI5A 1LTAC 2LKMA 3PRJA 1NU1D 2WSEJ 2M0BA 2E5TA 3BRVB 3CWBG 1LT9A 2HLOA 1QX8A 1HVVA 1CNOA 2WPQA 1GW4A 3IFMA 5KLVD 1IFPA 2I8DA 2I1KA 1EZVG 2C9NY 5C39A 2N1TB 1GK4A 2FYZA 4XA4A 4OGQB 3RK2B 5AW5B 3JCUH 3RL0D 2QM8A 4FANA 1SQPE 1U75B 3GLMA 3KZIV 1YCCA 4PD4I 2FYNC 2E43A 4WY4B 1KZUB 2J58A 1AFOA 5DJQB 3AE7C 3ZOYA 3D71A 1HRCA 4IL6H 3RK3C 2WQYC 4H0KA 2BEQD 1FZAA 1NNOA 1EC5A 1KB9I 4PD4E 1BGYG 1VF5B 1S5LX 3CLQA 1GL2A 2L5GB 1PP9E 1FDMA 1CEDA 3CXHD 1N50A 3SWSA 4C7NB 1C6RA 2JWDA 4H0LD 1KB9E 1FS0E 4GDOA 1GKSA 2KOGA 3HUSA 4BRYA 4RJTA 5APUA 3CCUP 1GIWA 3FWLA 3WFDC 1JB0J 1E8EA 1H88A 1RF1C 5CCHC 3L72D 1IFNA 1EDLA 1KILD 1K9MQ 4XFJA 4U3FJ 5AW1B 4L74A 1X22A 4K3AA 2ZVOB 2GA1A 1FJ0A 1JY3O 4H13D 4MU8A 2B87A 1MG3D 4U3FG 4K35A 3TNUB 3KHUA 3L37A 1GU2A 2KXPB 2V7QJ 5KLIC 2E74C 2YIUC 3WU2E 1I6EA 3VOPA 3B5ND 1FJKA 4M3LA 2IBZD 3A7OA 1T2KC 2W8ZA 5CJ0A 2C9LY 2YKOA 4GYDA 2NPSB 1OIPA 1E5WA 351CA 3HD7C 451CA 1FZCB 1KV4A 5TJHA 4PD4H 1U7JA 1SQBD 4EOTA 2GM4A 3H1IJ 3TGUD 4PJ0E 1H9XA 2K1AA 5CICB 2AXTV 3AEAC 3SSUA 2KS1A 3WFCC 1CSXA 3LW5J 1N7SA 1CRYA 1BE3D 1FI3A 3MHVA 1NTKE 4DZOA 1HTLC 1EZVI 3E7KA 3CL3D 2AEMA 2N1TC 1NTZG 2LR2A 4OGQC 1SVFA 4N6JA 3L70D 3RK2C 4DCKA 4GIFA 5TISE 2AEJA 3WUTA 1L0NJ 3DR0A 2YMKA 1SQXJ 4J20A 1L9BC 2BPBB 1P84I 1EZVE 1L0NG 2K37A 3RK3D 1CTZA 2R5BA 1S6VB 3KQGA 1RAPA 5DJQC 4HJGH 1CYJA 1IZL0 2Z5HA 4N78D 2IPPA 3WU2H 1NH4A 5AVTB 3L4MA 1OFCX 1L4AA 2C2CA 1P84E 2R32A 2JEEA 3FX0A 1VF5C 3SJLA 2B4ZA 1GQ1A 2CA4B 5DJTB 3HE4A 1WRGA 1DIPA 2IDBA 4GOFA 4I1LA 2WWWA 5AURA 1OVRA 5CCHD 1KILA 1KQLA 3H25A 2RMZA 3E1IA 1QL2A 2B11B 3L74D 3VTPC 4D6TG 1H31B 1JY2N 4YPCA 1GU4A 1IC2A 1KTMA 3L73G 1DW0A 1N7LA 4AUWA 1R5LA 5CIDB 3SWKA 2K9JB 1W5CE 1H32B 2E74D 2Y9ZA 2JDIH 4XYDB 5TISH 2MKVA 2WSEH 1T2KD 1NTMD 3H1HD 5KAIE 3N4XA 4U7JA 1M8OB 3SFEC 4U3FE 1SQVE 1JY3N 1LP1B 3HD7D 1PGOA 1I5TA 2NPSC 2XNXA 1SQBJ 1YTZI 4Y28J 5APVA 1S5LV 1PGPA 3TGUJ 1FZCC 3EWKA 1VQKP 1FE6A 1W2EA 4EICA 2OARA 1P84H 5AW6B 4HB1A 2O01N 2H89C 1EDIA 1EXIA 4H0JA 1K8AQ 3CMEP 4IFDK 1F1CA 3CD6P 1BE3J 3W67A 3KZIE 1EB7A 3QH9A 5AVRB 4LC1A 4XE5B 1AVYA 4CPGA 1E29A 2N1TD 2V07A 4OGQD 1OW7A 1KN7A 3RK2D 3H1IE 2M3EA 4WWIA 1K73Q 2YQBA 2KP8A 2OYIA 4W7ZA 3CC2P 1NAYA 2AIUA 3VNWA 2PCCB 2NRGA 1RE4A 5AVYB 2M5AB 5KAFV 2WMMA 1NMIA 3CX5I 1PPJE 2IZ0A 3KPEA 1VF5D 1L0LK 1FHBA 5KAIH 2KLVA 1VQOP 1CO6A 1LTIC 1KYOD 3OA8A 1L0NE 1SQXE 1AVOA 3H32B 1C52A 1G2CB 3CX5E 4RO0A 2QIWA 1NJIQ 1LJ2A 1URQB 5CCHA 1KQSO 2V7QH 3SWFA 2E75D 1WEJF 1BCCD 2HG5D 1XTCC 3FXDA 1R5SA 3MGNA 3VP9A 1NOHA 1FOCA 2KI7B 4PW9B 3TK1A 5CBOA 3B8EB 5GTIV 1MFZA 1SQPG 1L0LD 5KJ7C 2FYUJ 4UB8H 4R4MA 2O01J 1FI7A 2GUSA 2J5UA 3ORVA 2FYUG 3B4SA 3U1CA 1YQ4C 3O6QB 1W2BO 2BEZF 3UIAA 1MG2D 1FZBA 4GOEA 1LT1A 3H1KD 2PRRA 2BLFB 1DW2A 1PZQA 4KHXA 3HD7A 2Q5UA 3H1JJ 155CA 2AXTE 4TLFA 2NPSD 4OVNF 1OZHA 1SS1A 4EDFA 1IJDB 1KORA 1ZLLA 2XNDH 2JO1A 1FOSE 1FZEA 2YXRB 2ZYAA 2QM7A 3A0BV 1CTYA 3VN0A 1LWUB 1YI2P 2P10A 1RHZB 1HZUA 1N2DC 1LC1A 1W5CT 1QL4A 1T6AA 3CX5H 3L36A 2DW3A 1DD4A 1YFCA 4XXLA 2KZIA 3OW2O 3Q5SA 5KKZB 2N9JA 2QRXA 1SQBE 1BGYD 1NAFA 3TGUE 4L75A 4EI2A 3TYYA 3PP5A 4JYBA 1ZN5A 2FWLA 4WQ8A 2A45I 1JMMA 2HODB 2FRCA 1S1CX 2QA4P 2QG4A 5L8RJ 3P7KA 4FA1A 1TU3F 2FXOA 4ZMDA 1OCDA 1BE3E 1H0TA 2IYPA 5APTA 3CX5W 1CSUA 2N9YB 5CMZA 4O1QA 4GKGA 1K3HA 2KNCB 1YTZT 2IX7C 1SFCB 1JM0A 4Y99B 4C7NA 1CCRA 2AEFA 2R3CA 1DX7A 2QSIA 1CW5A 1SQQD 3O0RC 3SXTA 4B86A 3RK3E 1MFTA 1M1JB 1CIFA 4AAOA 1FDOA 3ZOXA 1IFJA 3ZOOA 1URQC 3GHGB 1BCCJ 3EFGA 2WSSH 1CIHA 1NTKG 3M0DC 2WT7A 2R3SA 1CSBA 2R5DA 1VL2A 1HBWA 4LLHA 2QJKB 1NTZK 3F5HA 2BH5X 1IFIA 1CRGA 2Q3EA 1N15A 5KJ7D 1JNMA 4MN4C 2FFDB 1RQUA 3KDPB 1YEBA 2PGDA 1GDVA 1T3UA 5APXA 1L0NK 2HR3A 2OYHA 1MZ4A 1AV1A 5CCGC 1S5LE 1PGJA 1ZOYC 2JJLA 2JWAA 1GK6A 3AE1C 2YCCA 3VMYA 5AW0B 1RF0A 1FZCA 3ZDMA 5B5EE 1QN2A 3NBSA 1CIEA 3CI9A 2CE1A 4ZKUA 5H2FV 2I1JA 4C7RA 1KMIZ 2RH0A 1OVVA 2FYUE 4AX3A 3D70A 1Y47A 1OMIA 3I55P 1PIXA 2E5YA 4NPFX 1ZV8A 3GW6A 1HWTC 5CIFB 5AW7B 4WQDA 1LWUC 3U1AA 2B10B 4RSZA 2ZAEB 3H1JE 3H1LD 3HQ6A 2WSCJ 3P8CD 2V08A 2PFXA 1CIGA 4DJGA 1DW3A 3ITKA 5KKZC 3HRNA 4DOJA 2QVAA 1JTHA 3MZWB 1Q81Q 1HJ4A 1DEEG 1N73B 4LJIA 5AW9B 3L75J 1E2RA 1FI9A 1FU1A 1SQVJ 5DF5A 1VQLP 2C1DA 2ZYDA 2BCCD 3L75G 3ZBMA 2D0WA 1SQVG 1AYGA 2A06D 3CCEP
chains in the Genus database with same CATH topology
3CXHW 2B11B 3L74D 4D6TD 4Y5RA 5DFSA 1YTCA 1H31B 1M70A 1ZZHA 3GG2A 3L73D 1CYCA 1I8PA 1DW0A 3BCCD 5C0ZA 1DIIC 5CIDB 3WU2V 1NTKD 3WFBC 2K9JB 1COTA 1H32B 2ZZS1 5CIHB 3ZCFA 3PTZA 2QJPB 2ZBOA 5CYTR 1I55A 4XYDB 1CRJA 2CA3B 1NTMD 2N18C 3H1HD 3NBTA 1H31A 4WQ7A 1AOFA 2MHMA 2ZOOA 3O20A 3CYTI 5KAIV 4YE1A 3H1ID 4PJ0V 1CYIA 1M60A 2L91A 1KV9A 1CHHA 3SVWA 1I5TA 3M97X 1S5LV 4EICA 1CSVA 1W2LA 3O5CA 4FB1A 1H1OA 4FA4A 2FYNB 1KIBA 1CXAA 4FAVA 2LIRA 1NTZD 4H0JA 1PPJD 1F1CA 2O3JA 2VHDA 1YNRA 1CRHA 2GC4D 2ORLA 3C2CA 2CE0A 1EB7A 1CC5A 2N3BA 3MK7C 5TISV 1IRWA 1NMLA 1DT1A 1L0ND 1E29A 1SQXD 2V07A 3CX5D 4UB8V 1HROA 1C6OA 2C9XB 3OCDB 1M6ZA 1CRCA 2OZ1B 1CHJA 1A2SA 1KX7A 1OAEA 2YQBA 1GJQA 2AIUA 2BCNB 3VNWA 2GC7D 2PCCB 1CCHA 1CRIA 4AANA 3TDKA 5KAFV 1B7VA 1LS9A 1NMIA 2Y0EA 1KB0A 2MTAC 1IQCA 4WQAA 3PXSA 2ZXYA 4PWAA 1IRVA 3OCDA 1FHBA 1CO6A 2OZ1A 3HQ8A 2C1UA 3L75D 3PH2B 1SQVD 1KYOD 3PXWA 3SLEA 3OA8A 3JBTB 2L4DA 1C52A 1U74B 1YICA 5CIEB 1CSWA 5KLIB 3RN1A 2YIUB 2ZONG 1KX2A 1HH7A 2PCBB 1DVVA 2QJYB 2B0ZB 2RN0A 4A7PA 3RN0A 4L3HA 1WEJF 1DVHA 1BCCD 2D0SA 2LITA 1RZ5A 5CIGB 1FOCA 4WQBA 4PW9B 3O1YA 4EIEA 2YK3A 5GTIV 1ETPA 2N18B 1L0LD 4JCGA 1QL3A 2AI5A 2BGVX 3PRJA 1N9CA 2GB8B 2N9IA 1NU1D 1FI7A 1LMSA 3ORVA 1H32A 1MG2D 1RZ6A 4FA5A 1R0QA 1CNOA 3H1KD 4PD4D 4P4QB 2BLFB 1DW2A 3WUIA 5KLVD 4K3IA 1QYZA 1CXCA 3L4OA 1HCMA 155CA 3A0HV 1PP9D 3PXTA 4EDFA 3CP5A 1DW1A 3DP5A 1CTJA 2HV4A 4FANA 2PACA 1U75B 3KZIV 1YCCA 3A0BV 1CTYA 2Y0CA 3L71D 4AALA 1HZUA 1LC1A 1W5CT 1QL4A 5B66V 4Q5PA 5DJQB 3ZOYA 1HRCA 5GTHV 1YFCA 1JDLA 4XXLA 4H0KA 5KKZB 2N9JA 1NNOA 2XTSB 1BGYD 3TYIA 1HJ5A 4WQCA 2FWLA 1CEDA 3CXHD 4WQ8A 3PLNA 2C1DB 1N50A 3X39A 3SWSA 4V2KA 1C6RA 1C2NA 1H33B 2FRCA 3WFEC 2EXVA 5E79V 3A9FA 2QG4A 1C2RA 1GKSA 1A8CA 4FA1A 3VMAA 1N90A 1OCDA 3PHLA 4EIFA 4RJTA 1YEAA 1GIWA 3CX5W 4L3GA 1CSUA 4EIDA 3WFDC 3FWLA 1E8EA 2N9YB 4AAMA 3L72D 3CU4A 4O1QA 1K3HA 2KNCB 4GEDB 5EXQA 4IL6V 3NWVA 1F1FA 4N0KA 1CCRA 1FJ0A 4MU8A 1H33A 1MG3D 1SQQD 1C6SA 3KHUA 1NIRA 3O0RC 2N3YA 3SXTA 1GU2A 5C9MA 1YIQA 2DVHA 1CIFA 1C7MA 4AAOA 1DIQC 3HQ7A 3VYMA 1C75A 3ZOXA 3ZOOA 1SQPD 4O1WA 1I6EA 1WVEC 2IBZD 4QAOA 5B6QA 1LC2A 1KYOW 1CIHA 3ZIYA 3RMZA 1I54A 4WQ9A 2FYUD 4L1QA 2QJKB 3CWBD 1QKSA 2BH5X 4GYDA 1CRGA 2Q3EA 1N15A 351CA 451CA 5TJHA 1SQBD 1YEBA 1GDVA 2CXBA 4KMGA 3TGUD 1HJ3A 1EZVD 1L9JC 2C1VA 1H9XA 5CICB 2AXTV 1MZ4A 3H1JD 2I8FA 2KS1A 3WFCC 4FA9A 2JWAA 1CORA 1CSXA 1KB9D 4UB6V 3TF5A 1P84D 1AKKA 2YCCA 3MK7B 1CRYA 1BE3D 3RLMA 3ZOWA 1FI3A 2JQRA 1QN2A 3WC8A 3NBSA 1CIEA 2C8SA 5B5EV 2CE1A 5H2FV 4AX3A 3VRDA 3L70D 2B12B 4DY9A 5CIBB 1LFMA 3DR0A 1K3GA 4J20A 2BH4X 3GW6A 1H9YA 5CIFB 1L9BC 2BPBB 1HZVA 1AOQA 1IO3A 4WQDA 4WQEA 1CTZA 1S6VB 1BL9A 2B10B 1RAPA 4RSZA 5DJQC 1ZRTD 1CYJA 1IZL0 3H1LD 3HQ6A 5IY51 2V08A 1CIGA 3L4MA 1DW3A 3OA8B 3ITKA 2C2CA 1FCDC 3HQ9A 1CHIA 2Y0DA 3SJLA 1A56A 2B4ZA 1GQ1A 1HJ4A 4LJIA 2CA4B 2DGEA 3DMIA 1E2RA 1FI9A 5DF5A 1I8OA 4NFGB 2GIWA 2C1DA 5AURA 1I6DA 2BCCD 1VYDA 4U3FD 3ZBMA 2D0WA 1J3SA 1RAQA 1AYGA 2A06D 2RMZA 2JTIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXH W;  2B11 B;  3L74 D;  4D6T D;  4Y5R A;  5DFS A;  1YTC A;  1H31 B;  1M70 A;  1ZZH A;  3GG2 A;  3L73 D;  1CYC A;  1I8P A;  1DW0 A;  3BCC D;  5C0Z A;  1DII C;  5CID B;  3WU2 V;  1NTK D;  3WFB C;  2K9J B;  1COT A;  1H32 B;  2ZZS 1;  5CIH B;  3ZCF A;  3PTZ A;  2QJP B;  2ZBO A;  5CYT R;  1I55 A;  4XYD B;  1CRJ A;  2CA3 B;  1NTM D;  2N18 C;  3H1H D;  3NBT A;  1H31 A;  4WQ7 A;  1AOF A;  2MHM A;  2ZOO A;  3O20 A;  3CYT I;  5KAI V;  4YE1 A;  3H1I D;  4PJ0 V;  1CYI A;  1M60 A;  2L91 A;  1KV9 A;  1CHH A;  3SVW A;  1I5T A;  3M97 X;  1S5L V;  4EIC A;  1CSV A;  1W2L A;  3O5C A;  4FB1 A;  1H1O A;  4FA4 A;  2FYN B;  1KIB A;  1CXA A;  4FAV A;  2LIR A;  1NTZ D;  4H0J A;  1PPJ D;  1F1C A;  2O3J A;  2VHD A;  1YNR A;  1CRH A;  2GC4 D;  2ORL A;  3C2C A;  2CE0 A;  1EB7 A;  1CC5 A;  2N3B A;  3MK7 C;  5TIS V;  1IRW A;  1NML A;  1DT1 A;  1L0N D;  1E29 A;  1SQX D;  2V07 A;  3CX5 D;  4UB8 V;  1HRO A;  1C6O A;  2C9X B;  3OCD B;  1M6Z A;  1CRC A;  2OZ1 B;  1CHJ A;  1A2S A;  1KX7 A;  1OAE A;  2YQB A;  1GJQ A;  2AIU A;  2BCN B;  3VNW A;  2GC7 D;  2PCC B;  1CCH A;  1CRI A;  4AAN A;  3TDK A;  5KAF V;  1B7V A;  1LS9 A;  1NMI A;  2Y0E A;  1KB0 A;  2MTA C;  1IQC A;  4WQA A;  3PXS A;  2ZXY A;  4PWA A;  1IRV A;  3OCD A;  1FHB A;  1CO6 A;  2OZ1 A;  3HQ8 A;  2C1U A;  3L75 D;  3PH2 B;  1SQV D;  1KYO D;  3PXW A;  3SLE A;  3OA8 A;  3JBT B;  2L4D A;  1C52 A;  1U74 B;  1YIC A;  5CIE B;  1CSW A;  5KLI B;  3RN1 A;  2YIU B;  2ZON G;  1KX2 A;  1HH7 A;  2PCB B;  1DVV A;  2QJY B;  2B0Z B;  2RN0 A;  4A7P A;  3RN0 A;  4L3H A;  1WEJ F;  1DVH A;  1BCC D;  2D0S A;  2LIT A;  1RZ5 A;  5CIG B;  1FOC A;  4WQB A;  4PW9 B;  3O1Y A;  4EIE A;  2YK3 A;  5GTI V;  1ETP A;  2N18 B;  1L0L D;  4JCG A;  1QL3 A;  2AI5 A;  2BGV X;  3PRJ A;  1N9C A;  2GB8 B;  2N9I A;  1NU1 D;  1FI7 A;  1LMS A;  3ORV A;  1H32 A;  1MG2 D;  1RZ6 A;  4FA5 A;  1R0Q A;  1CNO A;  3H1K D;  4PD4 D;  4P4Q B;  2BLF B;  1DW2 A;  3WUI A;  5KLV D;  4K3I A;  1QYZ A;  1CXC A;  3L4O A;  1HCM A;  155C A;  3A0H V;  1PP9 D;  3PXT A;  4EDF A;  3CP5 A;  1DW1 A;  3DP5 A;  1CTJ A;  2HV4 A;  4FAN A;  2PAC A;  1U75 B;  3KZI V;  1YCC A;  3A0B V;  1CTY A;  2Y0C A;  3L71 D;  4AAL A;  1HZU A;  1LC1 A;  1W5C T;  1QL4 A;  5B66 V;  4Q5P A;  5DJQ B;  3ZOY A;  1HRC A;  5GTH V;  1YFC A;  1JDL A;  4XXL A;  4H0K A;  5KKZ B;  2N9J A;  1NNO A;  2XTS B;  1BGY D;  3TYI A;  1HJ5 A;  4WQC A;  2FWL A;  1CED A;  3CXH D;  4WQ8 A;  3PLN A;  2C1D B;  1N50 A;  3X39 A;  3SWS A;  4V2K A;  1C6R A;  1C2N A;  1H33 B;  2FRC A;  3WFE C;  2EXV A;  5E79 V;  3A9F A;  2QG4 A;  1C2R A;  1GKS A;  1A8C A;  4FA1 A;  3VMA A;  1N90 A;  1OCD A;  3PHL A;  4EIF A;  4RJT A;  1YEA A;  1GIW A;  3CX5 W;  4L3G A;  1CSU A;  4EID A;  3WFD C;  3FWL A;  1E8E A;  2N9Y B;  4AAM A;  3L72 D;  3CU4 A;  4O1Q A;  1K3H A;  2KNC B;  4GED B;  5EXQ A;  4IL6 V;  3NWV A;  1F1F A;  4N0K A;  1CCR A;  1FJ0 A;  4MU8 A;  1H33 A;  1MG3 D;  1SQQ D;  1C6S A;  3KHU A;  1NIR A;  3O0R C;  2N3Y A;  3SXT A;  1GU2 A;  5C9M A;  1YIQ A;  2DVH A;  1CIF A;  1C7M A;  4AAO A;  1DIQ C;  3HQ7 A;  3VYM A;  1C75 A;  3ZOX A;  3ZOO A;  1SQP D;  4O1W A;  1I6E A;  1WVE C;  2IBZ D;  4QAO A;  5B6Q A;  1LC2 A;  1KYO W;  1CIH A;  3ZIY A;  3RMZ A;  1I54 A;  4WQ9 A;  2FYU D;  4L1Q A;  2QJK B;  3CWB D;  1QKS A;  2BH5 X;  4GYD A;  1CRG A;  2Q3E A;  1N15 A;  351C A;  451C A;  5TJH A;  1SQB D;  1YEB A;  1GDV A;  2CXB A;  4KMG A;  3TGU D;  1HJ3 A;  1EZV D;  1L9J C;  2C1V A;  1H9X A;  5CIC B;  2AXT V;  1MZ4 A;  3H1J D;  2I8F A;  2KS1 A;  3WFC C;  4FA9 A;  2JWA A;  1COR A;  1CSX A;  1KB9 D;  4UB6 V;  3TF5 A;  1P84 D;  1AKK A;  2YCC A;  3MK7 B;  1CRY A;  1BE3 D;  3RLM A;  3ZOW A;  1FI3 A;  2JQR A;  1QN2 A;  3WC8 A;  3NBS A;  1CIE A;  2C8S A;  5B5E V;  2CE1 A;  5H2F V;  4AX3 A;  3VRD A;  3L70 D;  2B12 B;  4DY9 A;  5CIB B;  1LFM A;  3DR0 A;  1K3G A;  4J20 A;  2BH4 X;  3GW6 A;  1H9Y A;  5CIF B;  1L9B C;  2BPB B;  1HZV A;  1AOQ A;  1IO3 A;  4WQD A;  4WQE A;  1CTZ A;  1S6V B;  1BL9 A;  2B10 B;  1RAP A;  4RSZ A;  5DJQ C;  1ZRT D;  1CYJ A;  1IZL 0;  3H1L D;  3HQ6 A;  5IY5 1;  2V08 A;  1CIG A;  3L4M A;  1DW3 A;  3OA8 B;  3ITK A;  2C2C A;  1FCD C;  3HQ9 A;  1CHI A;  2Y0D A;  3SJL A;  1A56 A;  2B4Z A;  1GQ1 A;  1HJ4 A;  4LJI A;  2CA4 B;  2DGE A;  3DMI A;  1E2R A;  1FI9 A;  5DF5 A;  1I8O A;  4NFG B;  2GIW A;  2C1D A;  5AUR A;  1I6D A;  2BCC D;  1VYD A;  4U3F D;  3ZBM A;  2D0W A;  1J3S A;  1RAQ A;  1AYG A;  2A06 D;  2RMZ A;  2JTI B; 
#chains in the Genus database with same CATH topology
 1S5L H;  3IAO A;  1IFD A;  4D6T D;  5DFS A;  3M9B A;  1M70 A;  2ZT9 B;  1ZRT E;  2WPS A;  3RL0 g;  3T97 A;  3L73 D;  1NHL A;  1I8P A;  3BCC D;  1SFC C;  5B5E H;  1LT9 B;  2RKL A;  1L2P A;  3PTZ A;  1RQV A;  1M1J C;  1DH3 A;  5GTI E;  3Q5P A;  2O01 H;  1D7M A;  1ZR2 A;  2N18 C;  3NBT A;  1H31 A;  1NU1 J;  2ZOO A;  3CYT I;  2D2C B;  3BAS A;  5KJ7 A;  1CYI A;  1PFI A;  3H1I G;  2QJK C;  1PL5 A;  4O9B A;  4EYY Q;  2W6J H;  5KLV J;  1JEK A;  2AXC A;  1KB9 H;  2FFD C;  1W2L A;  4FB1 A;  3NXS A;  3MD0 A;  1BDC A;  5CCG D;  1BCC E;  3F89 A;  2BAS A;  1BDD A;  1EXJ A;  3MP7 B;  1PPJ G;  5APY A;  1CRH A;  2ORL A;  4W7Y A;  3V6I A;  1GL2 B;  1KFM A;  1YJN P;  3C1L A;  1NML A;  3AEE C;  4WY4 C;  1CI6 A;  5APS A;  2IFM A;  2W6B A;  1SQX G;  1QLE D;  1IFM A;  1C6O A;  2WTY A;  1CRC A;  1RH5 B;  2OZ1 B;  1CHJ A;  1A2S A;  1UIX A;  4BRY B;  2ZXE B;  1OAE A;  1A02 J;  3H1K E;  2XKM A;  3O8Z A;  3D6Z A;  2B88 A;  1S9K D;  3H1L J;  2QEX P;  3TDK A;  4QMA A;  1LS9 A;  5GTI H;  1Q7Y Q;  2Y0E A;  1VQ4 P;  1S3J A;  4WQA A;  1GZL A;  1Q2N A;  2B87 B;  1SQP K;  3PXS A;  4PWA A;  3HQ8 A;  3LID A;  4YXD C;  4PJ0 H;  3L72 J;  3PXW A;  2YNY A;  2H7H A;  1FOS F;  1N8R Q;  2FYU K;  1N73 C;  1HGV A;  3II6 A;  5CIE B;  3L72 G;  1CSW A;  2Q7C A;  3VMZ A;  2HPC B;  2VRS A;  2N9B A;  2BCC J;  2PAJ A;  2B0Z B;  1IO4 A;  2M5A A;  3RN0 A;  3CCM P;  4LGD E;  2ITA A;  3G3Z A;  1RZ5 A;  4ASV A;  3GF7 A;  2NZ2 A;  1Q82 Q;  3B5N A;  2YK3 A;  2ZT9 C;  2WVR A;  1SFC D;  4PV1 B;  2W90 A;  1ETP A;  3H32 A;  4ASW A;  1ZP0 C;  3FWN A;  3GF3 A;  3CCL P;  4KJM A;  3L75 E;  3E1R A;  3H6P A;  1LT9 C;  4RKU J;  1N9C A;  2JR8 A;  2JKV A;  1LMS A;  1J1E B;  2Q1K A;  1N7S B;  4H44 B;  1R0Q A;  4PD4 D;  3R2P A;  1KD1 Q;  3WUI A;  1SQB G;  3BVH A;  1DEB A;  1QYZ A;  3TGU G;  1HCM A;  3A2A A;  3A0H V;  1WT6 A;  2D2C C;  3VMX A;  1PP9 D;  4L73 A;  1DW1 A;  3DP5 A;  3AE6 C;  3BAT A;  1K04 A;  1GDT A;  1CTJ A;  3AE3 C;  3TSI A;  1YIT P;  2HV4 A;  5CCG A;  3O6Q A;  1BE3 G;  2Y0C A;  3L71 D;  5H2F E;  4AAL A;  2FXM A;  5B66 V;  3L70 J;  2A45 G;  1NU1 E;  1L4A B;  5GTH V;  3LIE A;  1JDL A;  4R4L A;  4WY4 D;  2WSC H;  3G71 P;  1GMJ A;  5KLV E;  1HJ5 A;  2FBW C;  2K88 A;  5CJ4 A;  2OTJ P;  5AVV B;  3A3Y B;  3PLN A;  4V2K A;  3V2P A;  1C2N A;  1H33 B;  3WFE C;  5E79 V;  1C2R A;  2C0X A;  2XU6 A;  4Z1M H;  1M57 D;  1A8C A;  1NTK K;  3L35 A;  3PHL A;  4EIF A;  2OQQ A;  4EID A;  4ZNC A;  3CU4 A;  5BU5 A;  1VQM P;  3V4Q A;  4GED B;  5EXQ A;  1AQT A;  3CXH I;  1RF1 A;  2G8Y A;  4HKZ H;  4N0K A;  2K9Y A;  2HOD A;  3CC7 P;  3L74 J;  1M1K Q;  2YO2 A;  1NIR A;  1X8Y A;  2DVH A;  1C7M A;  1NYH A;  3L74 G;  3CXH E;  1DIQ C;  3VYM A;  1C75 A;  3M06 A;  3KZI H;  3H1L E;  3P8C E;  4O1W A;  5AVQ B;  4JF7 A;  2KNC A;  1LC2 A;  3ZIY A;  3NMD A;  2ZT9 D;  4L1Q A;  4JPZ B;  3MUD C;  3CWB D;  3L72 E;  1NTM J;  3H1H J;  2XV5 A;  1KIL E;  4PV1 C;  1T3J A;  2LXC B;  1M1J A;  1NTM G;  3HE5 A;  4KMG A;  2G3A A;  5AVU B;  3D6Y A;  1L9J C;  1EZV D;  2ZJS E;  2BCC E;  3LW5 H;  4YTP C;  2IBZ I;  2A06 E;  1VQ5 P;  2I8F A;  1MZ9 A;  1H8A A;  1J1E C;  3H1J G;  4W80 A;  3G9R A;  1HJ0 A;  1N7S C;  4H44 C;  1COR A;  4UB6 V;  3TF5 A;  4IFF A;  1P84 D;  2D2C D;  1AKK A;  3MK7 B;  2OYO A;  3KXD A;  3RLM A;  3ZOW A;  1NVO A;  5APQ A;  2IBZ E;  2FFD A;  3WC8 A;  2CK3 H;  2C8S A;  3G4S P;  2OYI B;  3VRD A;  1GW3 A;  5AVX B;  3RBZ A;  1NKZ B;  2P1J A;  2B12 B;  5CIB B;  1LFM A;  3L71 J;  1Y8A A;  4OWF A;  3USS A;  2N1T A;  4JQ0 D;  5CHX A;  1K3G A;  2BH4 X;  1AOQ A;  1SQV K;  1E79 H;  1JO5 A;  2YKP A;  1RY3 A;  1BL9 A;  2YXQ B;  3CXH H;  1L4A C;  1MKM A;  3CCQ P;  4WY4 A;  2UWJ E;  5IY5 1;  3WUV A;  2KK7 A;  3OA8 B;  1M56 D;  1OVU A;  1CHI A;  2XDJ A;  2Y0D A;  3S1K A;  2H88 C;  4AYC A;  2FY8 A;  1KQG B;  4I6M C;  2ZVN B;  3L70 E;  4WVZ A;  3NTN A;  3PJS K;  2GIW A;  3EQ2 A;  1VYD A;  2XZR A;  2AXT H;  4U3F D;  5EFW B;  1J3S A;  1RAQ A;  3V2Q A;  2CPB A;  3SWY A;  3CXH W;  1HF9 A;  2MJZ A;  4Y5R A;  1YTC A;  1VQ9 P;  1R8E A;  1CYC A;  4HH2 A;  4N78 E;  4RES B;  3OAK A;  2B9B A;  4YXW H;  4AQR D;  5KLV K;  3WFB C;  3OJA B;  1BCC G;  2ZZS 1;  1S9K E;  2QJP B;  1L0L J;  1VPC A;  5DJU B;  3TNU A;  1OX3 A;  5CYT R;  3AED C;  1HGZ A;  2CA3 B;  2YO3 A;  2P67 A;  1AOF A;  2MHM A;  3O20 A;  5KAI V;  3CWB J;  4YE1 A;  4IL6 X;  1SQX K;  3H1I D;  1M60 A;  1MV8 A;  4PV1 D;  1CHH A;  3SVW A;  3H1K J;  3M91 A;  3L74 E;  3VYI A;  4C46 A;  4L76 A;  3Q5R A;  3H1K G;  2NPS A;  3A0H E;  1H1O A;  4FA4 A;  2LXB A;  1N7S D;  1CXA A;  4FAV A;  1YYC A;  2A45 H;  4H44 D;  2LIR A;  1ZR4 A;  1NTZ D;  1YBK A;  1LTG C;  1PPJ D;  3AEG C;  3HTK B;  2VHD A;  2GC4 D;  2CE0 A;  1CC5 A;  3MK7 C;  1NTM E;  2M8R A;  3H1H E;  1IRW A;  2POH A;  5B66 E;  1DT1 A;  1L0N D;  1SQX D;  3CX5 D;  4UB8 V;  1HRO A;  2GUV A;  5GTH E;  1LTT C;  2OYI C;  3OCD B;  1AJY A;  3S9O A;  2KSJ A;  1BGY J;  1H0T B;  1GJQ A;  3M9Q A;  1RE4 C;  2HFE D;  2O1J A;  2IYO A;  3GMA A;  1LTJ B;  1L4A D;  3V5B A;  5KAF E;  1FZF A;  1JY2 O;  3WUU A;  3ABV C;  1S72 P;  1HH0 A;  2QE7 H;  1XTG B;  1IK7 A;  1KB0 A;  2MTA C;  1PV3 A;  5E79 E;  1KQF B;  3FXE A;  2ZXY A;  1IRV A;  2OZ1 A;  3V2N A;  3EFF K;  1JY2 P;  2E75 B;  3L71 E;  3JBT B;  5AW3 B;  1YJW P;  1YIC A;  2ZON G;  2PCB B;  1HH7 A;  1DVV A;  1S2E A;  2QJY B;  2RN0 A;  1HJB A;  4A7P A;  1VDF A;  1SQB K;  2WT7 B;  3A0H H;  1SQQ J;  3I56 P;  2O1K A;  4Y99 C;  3CCR P;  1X0T A;  3MTU E;  2LIT A;  1SQQ G;  4WQB A;  1KYO I;  2CPS A;  1K05 A;  1GD2 E;  1URQ D;  3O1Y A;  1AA0 A;  4JBZ A;  2WIT A;  3RBX A;  2WZ7 A;  4BXL A;  3GHG C;  2Z5I A;  1VQN P;  2OYH B;  1JY3 P;  3D0W A;  3AEC C;  2HPC A;  5B66 H;  1QL3 A;  1BSN A;  1NWQ A;  2BGV X;  1USD A;  1FZG A;  1KYO E;  2GB8 B;  5GTH H;  2N9I A;  1NU1 G;  1EDJ A;  4IFM A;  2K9J A;  1SP4 A;  2KUB A;  4WB4 A;  1H32 A;  1VQ6 P;  2QJP C;  1LTB C;  3QWO C;  1RZ6 A;  4FA5 A;  3IR9 A;  3MUD A;  4P4Q B;  2FKW B;  4K3I A;  5KLV G;  1CXC A;  3L4O A;  1QGK B;  5KAF H;  1RE3 C;  3PXT A;  3CP5 A;  1JCD A;  5E79 H;  4UB6 E;  3AE2 C;  2V4H A;  1LP1 A;  3M0A A;  3A0B E;  1DD3 A;  4GOD A;  2PAC A;  2H8P D;  1A02 F;  2SPZ A;  1L0L E;  2P58 A;  1NTZ J;  2H43 A;  1G1J A;  4GT1 A;  1VQ8 P;  2R44 A;  4Q5P A;  4I2L C;  3CWB E;  3Q2Y A;  3HUS B;  3IN6 A;  1LTS C;  3SFD C;  3K5B A;  1JTH B;  2XTS B;  4WBA A;  3TYI A;  1OW8 A;  1MUU A;  3AE9 C;  3WMM 0;  3PH0 A;  1JOC A;  4WQC A;  3I5C A;  1OWA A;  2J59 M;  1ZME C;  2C1D B;  3X39 A;  1JUN A;  3H1L G;  2WPR A;  2EXV A;  3A9F A;  5AVW B;  2WSF J;  3RGU A;  3VMA A;  1N90 A;  1KYO H;  4BWN A;  1LTJ C;  1EQ7 A;  2KB7 P;  1YEA A;  4KT0 J;  2ZXX A;  4L3G A;  3T97 B;  1PGQ A;  5AVZ B;  4AAM A;  3R4Y A;  3FGA D;  1H89 A;  1KFN A;  4IL6 V;  3NWV A;  1NTM K;  1F1F A;  1QL1 A;  1CZQ A;  2Z4E A;  3AE8 C;  2BCC G;  1H33 A;  1BGY E;  2E76 B;  4D6T J;  2E75 C;  1C6S A;  3AEB C;  3P8M C;  2A06 G;  2N3Y A;  1U7M A;  2KZJ A;  3M9H A;  5C9M A;  3L73 J;  1YIQ A;  4UB6 H;  3BCC J;  3HQ7 A;  1J2J B;  3JC2 2;  2QJY C;  3A0B H;  1SQP D;  1G2C A;  1WVE C;  3BCC G;  4HYT B;  3AE5 C;  3N7N A;  4QAO A;  5B6Q A;  2IBZ G;  1KYO W;  1FBM A;  3RMZ A;  1URQ A;  1I54 A;  4WQ9 A;  1S4X A;  2KS1 B;  3IF4 A;  2FYU D;  2B89 A;  1QKS A;  1YIJ P;  3M0D A;  3L4F A;  1M90 Q;  1QEX A;  2W27 A;  2OYH C;  2ZFC A;  2CXB A;  1KC8 Q;  3RL0 B;  2OTK E;  1HJ3 A;  5AW8 B;  2C1V A;  1M7L A;  1EDK A;  2W83 C;  1SQQ E;  1AQ5 A;  2Q6Q A;  3H1J D;  4FA9 A;  1UII A;  1RF0 C;  2Q9I A;  1USE A;  2YMY A;  1KB9 D;  1CI6 B;  1YHQ P;  3CC4 P;  1FAV A;  1SLQ A;  5KTB A;  3KYQ A;  3V4W A;  2JQR A;  1YJ9 P;  3OA7 A;  3CCV P;  5B5E V;  2PP6 A;  1QVF O;  3L70 G;  4DY9 A;  1GL2 C;  3MIW A;  3JSV C;  2IZ1 A;  1JMB A;  1H9Y A;  4H0L B;  1HZV A;  4ZKP A;  1IO3 A;  4UB8 E;  4WQE A;  3CPW O;  3HE4 B;  1J1D B;  1ZW0 A;  1ZRT D;  3G6E P;  1LWU A;  4NPD A;  1HUC A;  3C8V A;  3HUS C;  1KIL B;  3Q1M A;  4N3Y B;  2KLU A;  1FCD C;  3Q3D A;  4JYC A;  3HQ9 A;  2HYN A;  1A56 A;  4H13 B;  1IK9 A;  1OW6 A;  2DGE A;  1NTZ E;  3DMI A;  1I8O A;  3VP8 A;  4NFG B;  1I6D A;  5CBN A;  1YQ3 C;  2K3R A;  4I7Z B;  5BVZ A;  3B5N B;  3C9I A;  3S4R A;  2JTI B;  4DT0 A;  2ZYG A;  1ZZH A;  5M1B A;  1LGH B;  5K5G B;  3GG2 A;  2KYV A;  5C0Z A;  2KIK A;  1DII C;  1G1I A;  3WU2 V;  1OXZ A;  1NTK D;  1COT A;  5H2F H;  2YKQ A;  3AEF C;  2E76 C;  5CIH B;  2Y9Y A;  3ZCF A;  1SFC A;  1SQP J;  2E42 A;  2ZBO A;  1VQ7 P;  3W68 A;  1I55 A;  2FXP A;  1CRJ A;  1IZN B;  1LNQ A;  3H1H G;  4WQ7 A;  1U57 A;  3GHG A;  4PJ0 V;  1FC2 C;  4TT3 H;  2L91 A;  1FDI A;  1KV9 A;  1VQP P;  3M97 X;  2OGU A;  5BU8 B;  4EIJ A;  2C0W A;  3B71 A;  4NPE A;  4D6T E;  3L73 E;  1CSV A;  1JCC A;  1NGM B;  3O5C A;  1PP9 J;  3BCC E;  3RL0 C;  2FYN B;  1KIB A;  1PP9 G;  3AE4 C;  3U59 A;  3RK3 B;  1RE3 A;  2O3J A;  5AW4 B;  1YNR A;  3C2C A;  2KSE A;  2N3B A;  2OTL P;  5TIS V;  1NKN A;  2JP3 A;  1FJP A;  3L71 G;  2C9X B;  5AVS B;  1M6Z A;  2IFN A;  1GL2 D;  5AW2 B;  1Q90 D;  1X79 B;  2WPV B;  2M3B A;  1KX7 A;  1N86 A;  1T8Z A;  4OH8 B;  3V2R A;  3HTK A;  2BCN B;  4H0L C;  2GC7 D;  1SQQ K;  2P2U A;  1J1D C;  1CCH A;  1CRI A;  2WSF H;  4AAN A;  1RF1 B;  1B7V A;  3A5T A;  1GU5 A;  1IQC A;  1KIL C;  3JCU E;  3OCD A;  1BSH A;  2C1U A;  3L75 D;  3PH2 B;  2Q3I A;  1SQV D;  2P7J A;  3SLE A;  1Q86 Q;  1NU1 K;  3CMA P;  2L4D A;  4H13 C;  2W6A A;  1U74 B;  5KLI B;  3RN1 A;  2E74 B;  1LTJ A;  4IL6 E;  2YIU B;  4IOI H;  1KX2 A;  1ZXG A;  3CCJ P;  1N73 A;  3NFQ A;  4L3H A;  1X9V A;  3P32 A;  3CCS P;  1NO4 A;  1DVH A;  3BRT B;  4I7Z C;  2D0S A;  3B5N C;  1QVG O;  5CIG B;  1Z56 A;  1WMK A;  5APW A;  4EIE A;  3HE5 B;  3HD7 B;  1NTK J;  1GTW A;  2N18 B;  2E76 D;  4JCG A;  1L0L G;  1Y9B A;  2AI5 A;  1LTA C;  2LKM A;  3PRJ A;  1NU1 D;  2WSE J;  2M0B A;  2E5T A;  3BRV B;  3CWB G;  1LT9 A;  2HLO A;  1QX8 A;  1HVV A;  1CNO A;  2WPQ A;  1GW4 A;  3IFM A;  5KLV D;  1IFP A;  2I8D A;  2I1K A;  1EZV G;  2C9N Y;  5C39 A;  2N1T B;  1GK4 A;  2FYZ A;  4XA4 A;  4OGQ B;  3RK2 B;  5AW5 B;  3JCU H;  3RL0 D;  2QM8 A;  4FAN A;  1SQP E;  1U75 B;  3GLM A;  3KZI V;  1YCC A;  4PD4 I;  2FYN C;  2E43 A;  4WY4 B;  1KZU B;  2J58 A;  1AFO A;  5DJQ B;  3AE7 C;  3ZOY A;  3D71 A;  1HRC A;  4IL6 H;  3RK3 C;  2WQY C;  4H0K A;  2BEQ D;  1FZA A;  1NNO A;  1EC5 A;  1KB9 I;  4PD4 E;  1BGY G;  1VF5 B;  1S5L X;  3CLQ A;  1GL2 A;  2L5G B;  1PP9 E;  1FDM A;  1CED A;  3CXH D;  1N50 A;  3SWS A;  4C7N B;  1C6R A;  2JWD A;  4H0L D;  1KB9 E;  1FS0 E;  4GDO A;  1GKS A;  2KOG A;  3HUS A;  4BRY A;  4RJT A;  5APU A;  3CCU P;  1GIW A;  3FWL A;  3WFD C;  1JB0 J;  1E8E A;  1H88 A;  1RF1 C;  5CCH C;  3L72 D;  1IFN A;  1EDL A;  1KIL D;  1K9M Q;  4XFJ A;  4U3F J;  5AW1 B;  4L74 A;  1X22 A;  4K3A A;  2ZVO B;  2GA1 A;  1FJ0 A;  1JY3 O;  4H13 D;  4MU8 A;  2B87 A;  1MG3 D;  4U3F G;  4K35 A;  3TNU B;  3KHU A;  3L37 A;  1GU2 A;  2KXP B;  2V7Q J;  5KLI C;  2E74 C;  2YIU C;  3WU2 E;  1I6E A;  3VOP A;  3B5N D;  1FJK A;  4M3L A;  2IBZ D;  3A7O A;  1T2K C;  2W8Z A;  5CJ0 A;  2C9L Y;  2YKO A;  4GYD A;  2NPS B;  1OIP A;  1E5W A;  351C A;  3HD7 C;  451C A;  1FZC B;  1KV4 A;  5TJH A;  4PD4 H;  1U7J A;  1SQB D;  4EOT A;  2GM4 A;  3H1I J;  3TGU D;  4PJ0 E;  1H9X A;  2K1A A;  5CIC B;  2AXT V;  3AEA C;  3SSU A;  2KS1 A;  3WFC C;  1CSX A;  3LW5 J;  1N7S A;  1CRY A;  1BE3 D;  1FI3 A;  3MHV A;  1NTK E;  4DZO A;  1HTL C;  1EZV I;  3E7K A;  3CL3 D;  2AEM A;  2N1T C;  1NTZ G;  2LR2 A;  4OGQ C;  1SVF A;  4N6J A;  3L70 D;  3RK2 C;  4DCK A;  4GIF A;  5TIS E;  2AEJ A;  3WUT A;  1L0N J;  3DR0 A;  2YMK A;  1SQX J;  4J20 A;  1L9B C;  2BPB B;  1P84 I;  1EZV E;  1L0N G;  2K37 A;  3RK3 D;  1CTZ A;  2R5B A;  1S6V B;  3KQG A;  1RAP A;  5DJQ C;  4HJG H;  1CYJ A;  1IZL 0;  2Z5H A;  4N78 D;  2IPP A;  3WU2 H;  1NH4 A;  5AVT B;  3L4M A;  1OFC X;  1L4A A;  2C2C A;  1P84 E;  2R32 A;  2JEE A;  3FX0 A;  1VF5 C;  3SJL A;  2B4Z A;  1GQ1 A;  2CA4 B;  5DJT B;  3HE4 A;  1WRG A;  1DIP A;  2IDB A;  4GOF A;  4I1L A;  2WWW A;  5AUR A;  1OVR A;  5CCH D;  1KIL A;  1KQL A;  3H25 A;  2RMZ A;  3E1I A;  1QL2 A;  2B11 B;  3L74 D;  3VTP C;  4D6T G;  1H31 B;  1JY2 N;  4YPC A;  1GU4 A;  1IC2 A;  1KTM A;  3L73 G;  1DW0 A;  1N7L A;  4AUW A;  1R5L A;  5CID B;  3SWK A;  2K9J B;  1W5C E;  1H32 B;  2E74 D;  2Y9Z A;  2JDI H;  4XYD B;  5TIS H;  2MKV A;  2WSE H;  1T2K D;  1NTM D;  3H1H D;  5KAI E;  3N4X A;  4U7J A;  1M8O B;  3SFE C;  4U3F E;  1SQV E;  1JY3 N;  1LP1 B;  3HD7 D;  1PGO A;  1I5T A;  2NPS C;  2XNX A;  1SQB J;  1YTZ I;  4Y28 J;  5APV A;  1S5L V;  1PGP A;  3TGU J;  1FZC C;  3EWK A;  1VQK P;  1FE6 A;  1W2E A;  4EIC A;  2OAR A;  1P84 H;  5AW6 B;  4HB1 A;  2O01 N;  2H89 C;  1EDI A;  1EXI A;  4H0J A;  1K8A Q;  3CME P;  4IFD K;  1F1C A;  3CD6 P;  1BE3 J;  3W67 A;  3KZI E;  1EB7 A;  3QH9 A;  5AVR B;  4LC1 A;  4XE5 B;  1AVY A;  4CPG A;  1E29 A;  2N1T D;  2V07 A;  4OGQ D;  1OW7 A;  1KN7 A;  3RK2 D;  3H1I E;  2M3E A;  4WWI A;  1K73 Q;  2YQB A;  2KP8 A;  2OYI A;  4W7Z A;  3CC2 P;  1NAY A;  2AIU A;  3VNW A;  2PCC B;  2NRG A;  1RE4 A;  5AVY B;  2M5A B;  5KAF V;  2WMM A;  1NMI A;  3CX5 I;  1PPJ E;  2IZ0 A;  3KPE A;  1VF5 D;  1L0L K;  1FHB A;  5KAI H;  2KLV A;  1VQO P;  1CO6 A;  1LTI C;  1KYO D;  3OA8 A;  1L0N E;  1SQX E;  1AVO A;  3H32 B;  1C52 A;  1G2C B;  3CX5 E;  4RO0 A;  2QIW A;  1NJI Q;  1LJ2 A;  1URQ B;  5CCH A;  1KQS O;  2V7Q H;  3SWF A;  2E75 D;  1WEJ F;  1BCC D;  2HG5 D;  1XTC C;  3FXD A;  1R5S A;  3MGN A;  3VP9 A;  1NOH A;  1FOC A;  2KI7 B;  4PW9 B;  3TK1 A;  5CBO A;  3B8E B;  5GTI V;  1MFZ A;  1SQP G;  1L0L D;  5KJ7 C;  2FYU J;  4UB8 H;  4R4M A;  2O01 J;  1FI7 A;  2GUS A;  2J5U A;  3ORV A;  2FYU G;  3B4S A;  3U1C A;  1YQ4 C;  3O6Q B;  1W2B O;  2BEZ F;  3UIA A;  1MG2 D;  1FZB A;  4GOE A;  1LT1 A;  3H1K D;  2PRR A;  2BLF B;  1DW2 A;  1PZQ A;  4KHX A;  3HD7 A;  2Q5U A;  3H1J J;  155C A;  2AXT E;  4TLF A;  2NPS D;  4OVN F;  1OZH A;  1SS1 A;  4EDF A;  1IJD B;  1KOR A;  1ZLL A;  2XND H;  2JO1 A;  1FOS E;  1FZE A;  2YXR B;  2ZYA A;  2QM7 A;  3A0B V;  1CTY A;  3VN0 A;  1LWU B;  1YI2 P;  2P10 A;  1RHZ B;  1HZU A;  1N2D C;  1LC1 A;  1W5C T;  1QL4 A;  1T6A A;  3CX5 H;  3L36 A;  2DW3 A;  1DD4 A;  1YFC A;  4XXL A;  2KZI A;  3OW2 O;  3Q5S A;  5KKZ B;  2N9J A;  2QRX A;  1SQB E;  1BGY D;  1NAF A;  3TGU E;  4L75 A;  4EI2 A;  3TYY A;  3PP5 A;  4JYB A;  1ZN5 A;  2FWL A;  4WQ8 A;  2A45 I;  1JMM A;  2HOD B;  2FRC A;  1S1C X;  2QA4 P;  2QG4 A;  5L8R J;  3P7K A;  4FA1 A;  1TU3 F;  2FXO A;  4ZMD A;  1OCD A;  1BE3 E;  1H0T A;  2IYP A;  5APT A;  3CX5 W;  1CSU A;  2N9Y B;  5CMZ A;  4O1Q A;  4GKG A;  1K3H A;  2KNC B;  1YTZ T;  2IX7 C;  1SFC B;  1JM0 A;  4Y99 B;  4C7N A;  1CCR A;  2AEF A;  2R3C A;  1DX7 A;  2QSI A;  1CW5 A;  1SQQ D;  3O0R C;  3SXT A;  4B86 A;  3RK3 E;  1MFT A;  1M1J B;  1CIF A;  4AAO A;  1FDO A;  3ZOX A;  1IFJ A;  3ZOO A;  1URQ C;  3GHG B;  1BCC J;  3EFG A;  2WSS H;  1CIH A;  1NTK G;  3M0D C;  2WT7 A;  2R3S A;  1CSB A;  2R5D A;  1VL2 A;  1HBW A;  4LLH A;  2QJK B;  1NTZ K;  3F5H A;  2BH5 X;  1IFI A;  1CRG A;  2Q3E A;  1N15 A;  5KJ7 D;  1JNM A;  4MN4 C;  2FFD B;  1RQU A;  3KDP B;  1YEB A;  2PGD A;  1GDV A;  1T3U A;  5APX A;  1L0N K;  2HR3 A;  2OYH A;  1MZ4 A;  1AV1 A;  5CCG C;  1S5L E;  1PGJ A;  1ZOY C;  2JJL A;  2JWA A;  1GK6 A;  3AE1 C;  2YCC A;  3VMY A;  5AW0 B;  1RF0 A;  1FZC A;  3ZDM A;  5B5E E;  1QN2 A;  3NBS A;  1CIE A;  3CI9 A;  2CE1 A;  4ZKU A;  5H2F V;  2I1J A;  4C7R A;  1KMI Z;  2RH0 A;  1OVV A;  2FYU E;  4AX3 A;  3D70 A;  1Y47 A;  1OMI A;  3I55 P;  1PIX A;  2E5Y A;  4NPF X;  1ZV8 A;  3GW6 A;  1HWT C;  5CIF B;  5AW7 B;  4WQD A;  1LWU C;  3U1A A;  2B10 B;  4RSZ A;  2ZAE B;  3H1J E;  3H1L D;  3HQ6 A;  2WSC J;  3P8C D;  2V08 A;  2PFX A;  1CIG A;  4DJG A;  1DW3 A;  3ITK A;  5KKZ C;  3HRN A;  4DOJ A;  2QVA A;  1JTH A;  3MZW B;  1Q81 Q;  1HJ4 A;  1DEE G;  1N73 B;  4LJI A;  5AW9 B;  3L75 J;  1E2R A;  1FI9 A;  1FU1 A;  1SQV J;  5DF5 A;  1VQL P;  2C1D A;  2ZYD A;  2BCC D;  3L75 G;  3ZBM A;  2D0W A;  1SQV G;  1AYG A;  2A06 D;  3CCE P; 
#chains in the Genus database with same CATH homology
 3CXH W;  2B11 B;  3L74 D;  4D6T D;  4Y5R A;  5DFS A;  1YTC A;  1H31 B;  1M70 A;  1ZZH A;  3GG2 A;  3L73 D;  1CYC A;  1I8P A;  1DW0 A;  3BCC D;  5C0Z A;  1DII C;  5CID B;  3WU2 V;  1NTK D;  3WFB C;  2K9J B;  1COT A;  1H32 B;  2ZZS 1;  5CIH B;  3ZCF A;  3PTZ A;  2QJP B;  2ZBO A;  5CYT R;  1I55 A;  4XYD B;  1CRJ A;  2CA3 B;  1NTM D;  2N18 C;  3H1H D;  3NBT A;  1H31 A;  4WQ7 A;  1AOF A;  2MHM A;  2ZOO A;  3O20 A;  3CYT I;  5KAI V;  4YE1 A;  3H1I D;  4PJ0 V;  1CYI A;  1M60 A;  2L91 A;  1KV9 A;  1CHH A;  3SVW A;  1I5T A;  3M97 X;  1S5L V;  4EIC A;  1CSV A;  1W2L A;  3O5C A;  4FB1 A;  1H1O A;  4FA4 A;  2FYN B;  1KIB A;  1CXA A;  4FAV A;  2LIR A;  1NTZ D;  4H0J A;  1PPJ D;  1F1C A;  2O3J A;  2VHD A;  1YNR A;  1CRH A;  2GC4 D;  2ORL A;  3C2C A;  2CE0 A;  1EB7 A;  1CC5 A;  2N3B A;  3MK7 C;  5TIS V;  1IRW A;  1NML A;  1DT1 A;  1L0N D;  1E29 A;  1SQX D;  2V07 A;  3CX5 D;  4UB8 V;  1HRO A;  1C6O A;  2C9X B;  3OCD B;  1M6Z A;  1CRC A;  2OZ1 B;  1CHJ A;  1A2S A;  1KX7 A;  1OAE A;  2YQB A;  1GJQ A;  2AIU A;  2BCN B;  3VNW A;  2GC7 D;  2PCC B;  1CCH A;  1CRI A;  4AAN A;  3TDK A;  5KAF V;  1B7V A;  1LS9 A;  1NMI A;  2Y0E A;  1KB0 A;  2MTA C;  1IQC A;  4WQA A;  3PXS A;  2ZXY A;  4PWA A;  1IRV A;  3OCD A;  1FHB A;  1CO6 A;  2OZ1 A;  3HQ8 A;  2C1U A;  3L75 D;  3PH2 B;  1SQV D;  1KYO D;  3PXW A;  3SLE A;  3OA8 A;  3JBT B;  2L4D A;  1C52 A;  1U74 B;  1YIC A;  5CIE B;  1CSW A;  5KLI B;  3RN1 A;  2YIU B;  2ZON G;  1KX2 A;  1HH7 A;  2PCB B;  1DVV A;  2QJY B;  2B0Z B;  2RN0 A;  4A7P A;  3RN0 A;  4L3H A;  1WEJ F;  1DVH A;  1BCC D;  2D0S A;  2LIT A;  1RZ5 A;  5CIG B;  1FOC A;  4WQB A;  4PW9 B;  3O1Y A;  4EIE A;  2YK3 A;  5GTI V;  1ETP A;  2N18 B;  1L0L D;  4JCG A;  1QL3 A;  2AI5 A;  2BGV X;  3PRJ A;  1N9C A;  2GB8 B;  2N9I A;  1NU1 D;  1FI7 A;  1LMS A;  3ORV A;  1H32 A;  1MG2 D;  1RZ6 A;  4FA5 A;  1R0Q A;  1CNO A;  3H1K D;  4PD4 D;  4P4Q B;  2BLF B;  1DW2 A;  3WUI A;  5KLV D;  4K3I A;  1QYZ A;  1CXC A;  3L4O A;  1HCM A;  155C A;  3A0H V;  1PP9 D;  3PXT A;  4EDF A;  3CP5 A;  1DW1 A;  3DP5 A;  1CTJ A;  2HV4 A;  4FAN A;  2PAC A;  1U75 B;  3KZI V;  1YCC A;  3A0B V;  1CTY A;  2Y0C A;  3L71 D;  4AAL A;  1HZU A;  1LC1 A;  1W5C T;  1QL4 A;  5B66 V;  4Q5P A;  5DJQ B;  3ZOY A;  1HRC A;  5GTH V;  1YFC A;  1JDL A;  4XXL A;  4H0K A;  5KKZ B;  2N9J A;  1NNO A;  2XTS B;  1BGY D;  3TYI A;  1HJ5 A;  4WQC A;  2FWL A;  1CED A;  3CXH D;  4WQ8 A;  3PLN A;  2C1D B;  1N50 A;  3X39 A;  3SWS A;  4V2K A;  1C6R A;  1C2N A;  1H33 B;  2FRC A;  3WFE C;  2EXV A;  5E79 V;  3A9F A;  2QG4 A;  1C2R A;  1GKS A;  1A8C A;  4FA1 A;  3VMA A;  1N90 A;  1OCD A;  3PHL A;  4EIF A;  4RJT A;  1YEA A;  1GIW A;  3CX5 W;  4L3G A;  1CSU A;  4EID A;  3WFD C;  3FWL A;  1E8E A;  2N9Y B;  4AAM A;  3L72 D;  3CU4 A;  4O1Q A;  1K3H A;  2KNC B;  4GED B;  5EXQ A;  4IL6 V;  3NWV A;  1F1F A;  4N0K A;  1CCR A;  1FJ0 A;  4MU8 A;  1H33 A;  1MG3 D;  1SQQ D;  1C6S A;  3KHU A;  1NIR A;  3O0R C;  2N3Y A;  3SXT A;  1GU2 A;  5C9M A;  1YIQ A;  2DVH A;  1CIF A;  1C7M A;  4AAO A;  1DIQ C;  3HQ7 A;  3VYM A;  1C75 A;  3ZOX A;  3ZOO A;  1SQP D;  4O1W A;  1I6E A;  1WVE C;  2IBZ D;  4QAO A;  5B6Q A;  1LC2 A;  1KYO W;  1CIH A;  3ZIY A;  3RMZ A;  1I54 A;  4WQ9 A;  2FYU D;  4L1Q A;  2QJK B;  3CWB D;  1QKS A;  2BH5 X;  4GYD A;  1CRG A;  2Q3E A;  1N15 A;  351C A;  451C A;  5TJH A;  1SQB D;  1YEB A;  1GDV A;  2CXB A;  4KMG A;  3TGU D;  1HJ3 A;  1EZV D;  1L9J C;  2C1V A;  1H9X A;  5CIC B;  2AXT V;  1MZ4 A;  3H1J D;  2I8F A;  2KS1 A;  3WFC C;  4FA9 A;  2JWA A;  1COR A;  1CSX A;  1KB9 D;  4UB6 V;  3TF5 A;  1P84 D;  1AKK A;  2YCC A;  3MK7 B;  1CRY A;  1BE3 D;  3RLM A;  3ZOW A;  1FI3 A;  2JQR A;  1QN2 A;  3WC8 A;  3NBS A;  1CIE A;  2C8S A;  5B5E V;  2CE1 A;  5H2F V;  4AX3 A;  3VRD A;  3L70 D;  2B12 B;  4DY9 A;  5CIB B;  1LFM A;  3DR0 A;  1K3G A;  4J20 A;  2BH4 X;  3GW6 A;  1H9Y A;  5CIF B;  1L9B C;  2BPB B;  1HZV A;  1AOQ A;  1IO3 A;  4WQD A;  4WQE A;  1CTZ A;  1S6V B;  1BL9 A;  2B10 B;  1RAP A;  4RSZ A;  5DJQ C;  1ZRT D;  1CYJ A;  1IZL 0;  3H1L D;  3HQ6 A;  5IY5 1;  2V08 A;  1CIG A;  3L4M A;  1DW3 A;  3OA8 B;  3ITK A;  2C2C A;  1FCD C;  3HQ9 A;  1CHI A;  2Y0D A;  3SJL A;  1A56 A;  2B4Z A;  1GQ1 A;  1HJ4 A;  4LJI A;  2CA4 B;  2DGE A;  3DMI A;  1E2R A;  1FI9 A;  5DF5 A;  1I8O A;  4NFG B;  2GIW A;  2C1D A;  5AUR A;  1I6D A;  2BCC D;  1VYD A;  4U3F D;  3ZBM A;  2D0W A;  1J3S A;  1RAQ A;  1AYG A;  2A06 D;  2RMZ A;  2JTI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...