2QJPB

Crystal structure of wild type rhodobacter sphaeroides with stigmatellin and antimycin inhibited
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
b'AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
total genus 67
structure length 256
sequence length 256
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2qjpB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2qjpB02
1J3SA 1CRJA 1N9CA 1KIBA 3TYIA 1CRHA 1CIGA 3TDKA 3L74D 3RMZA 1NTZD 3ZOOA 451CA 1CORA 2BLFB 2B10B 5H2FV 2O3JA 1E8EA 5TISV 5B66V 1BE3D 2CXBA 4XYDB 2KS1A 1CSUA 1YIQA 1QL4A 3DR0A 5B6QA 1KYOW 1OAEA 5B5EV 3MK7C 1FOCA 4EDFA 2GC7D 2Y0CA 2B0ZB 4QAOA 4EIDA 3JBTB 4AX3A 2JWAA 1YFCA 3OCDA 4AAMA 3RN1A 3OA8A 1M6ZA 2N9JA 2FYNB 1CYIA 1OCDA 1WEJF 3A0HV 2ZONG 1DIQC 5CYTR 2MTAC 4FA9A 2D0WA 2BH4X 4NFGB 4V2KA 1IQCA 2MHMA 1U74B 5DFSA 2C2CA 1N15A 4Q5PA 1SQQD 4FB1A 4JCGA 1IZL0 2CA4B 2QJYB 2L91A 155CA 3L4OA 1L0ND 3SLEA 1IO3A 1N90A 1C75A 1W5CT 2C1DA 1U75B 3CXHW 4AALA 5CIFB 2PACA 3RN0A 3A9FA 2ZXYA 2Q3EA 1H31A 5GTIV 3NWVA 1I6EA 5EXQA 1W2LA 1E2RA 1CSWA 3BCCD 3PTZA 1EB7A 1HJ3A 1A2SA 1C6OA 1L0LD 3CX5D 4WQDA 5CIDB 1FI7A 3L71D 1CSXA 1QL3A 5C0ZA 1KB0A 1AKKA 2D0SA 2ORLA 4N0KA 3HQ9A 3ZOYA 4FANA 2C9XB 4EICA 351CA 1NMIA 2PCBB 2A06D 1DT1A 3A0BV 1CXAA 4H0KA 5DF5A 2IBZD 3SVWA 5CIEB 2JTIB 4J20A 4UB6V 1C6RA 1LFMA 1CCRA 1I8PA 1L9BC 5KLVD 1ZZHA 4AANA 3FWLA 1YICA 2RN0A 2Y0EA 1NNOA 2DGEA 1BGYD 3NBTA 2QJPB 3PHLA 1M70A 1CRCA 1DW1A 1I55A 1M60A 1S5LV 1FJ0A 1NTMD 1DIIC 1PP9D 3WFCC 2XTSB 2K9JB 1GU2A 5CIHB 1SQVD 4EIEA 3KZIV 1AOQA 3VRDA 3CP5A 2GIWA 5TJHA 3RLMA 1CEDA 3PLNA 1CSVA 1DVVA 3O5CA 3SWSA 1QKSA 1KX7A 1MZ4A 3WFEC 3L70D 2C8SA 2YK3A 2ZOOA 5C9MA 1AYGA 1CRIA 3ZCFA 1NTKD 4MU8A 5DJQB 1NU1D 2RMZA 1FI9A 3H1KD 1CTJA 4PD4D 3KHUA 2I8FA 4PJ0V 3WFDC 1FI3A 2N3BA 1COTA 3HQ6A 3PXSA 4AAOA 2N18B 4WQAA 4PW9B 5CIGB 3ORVA 4WQ8A 1RAPA 1EZVD 4WQBA 3SJLA 1MG2D 2CE0A 4KMGA 1C7MA 3ITKA 1H9XA 1CHHA 2C1VA 2PCCB 3GG2A 1CRGA 2YCCA 3WU2V 5GTHV 3M97X 1GQ1A 1C6SA 3SXTA 3GW6A 1RAQA 4RJTA 1I54A 2BH5X 1I8OA 1R0QA 3ZBMA 1CTZA 1CIHA 1ETPA 2GB8B 3PH2B 1H32B 1CYJA 2ZZS1 4XXLA 1FHBA 3MK7B 1CHIA 1A56A 1H33B 4D6TD 3H1HD 3VYMA 1A8CA 1YNRA 1CC5A 2C1UA 5AURA 2BCCD 3WC8A 4H0JA 2KNCB 5CICB 1GIWA 1BCCD 1N50A 1HRCA 1C2NA 4O1WA 3ZOXA 1CYCA 1GDVA 3ZIYA 2AXTV 2B11B 3CYTI 2N3YA 3H1LD 3O0RC 4WQ9A 3ZOWA 4L1QA 3X39A 1E29A 4EIFA 3HQ7A 1CNOA 1H32A 5CIBB 1WVEC 3CU4A 1K3HA 1RZ6A 5KAFV 1CIEA 4P4QB 4Y5RA 3L72D 1HJ4A 2DVHA 1NIRA 4GEDB 4WQEA 2N9YB 1H33A 2EXVA 2AIUA 1HCMA 2FWLA 2FYUD 3PXWA 1CRYA 1LMSA 1ZRTD 4WQ7A 3WFBC 2LIRA 1KYOD 3L73D 1CCHA 2BGVX 3CWBD 4DY9A 2N9IA 2V07A 4WQCA 2B12B 2L4DA 1PPJD 4U3FD 1CO6A 1JDLA 3L75D 5IY51 2C1DB 2V08A 4YE1A 1S6VB 2QJKB 5KLIB 1B7VA 3C2CA 2QG4A 2Y0DA 1DW3A 1H31B 1H9YA 2OZ1B 4A7PA 2BCNB 1DW0A 2JQRA 2VHDA 2YIUB 2FRCA 1LS9A 1CHJA 3PRJA 1FCDC 3HQ8A 5KAIV 1CXCA 1HROA 3NBSA 1RZ5A 3PXTA 1C2RA 3VNWA 1GKSA 1HZVA 2ZBOA 1DW2A 3CXHD 1SQXD 4FA4A 1LC1A 3DMIA 2CA3B 3O20A 4GYDA 3O1YA 1CTYA 1I5TA 1HH7A 3H1JD 1IRWA 1L9JC 4O1QA 1IRVA 1P84D 1GJQA 3WUIA 1I6DA 1SQPD 3DP5A 2BPBB 2OZ1A 1QN2A 3CX5W 4RSZA 4FAVA 4K3IA 1F1CA 5E79V 1BL9A 4UB8V 5DJQC 2B4ZA 4LJIA 4FA5A 2CE1A 1YEBA 1H1OA 4FA1A 3H1ID 1YCCA 1VYDA 2HV4A 1LC2A 1KX2A 3VMAA 1HJ5A 4IL6V 4L3HA 4PWAA 5KKZB 1SQBD 1YEAA 1HZUA 3L4MA 1DVHA 1YTCA 1CIFA 1F1FA 1KV9A 3TF5A 2N18C 1C52A 2LITA 2GC4D 3OCDB 1K3GA 1MG3D 3OA8B 1QYZA 2AI5A 1AOFA 1NMLA 2YQBA 1KB9D 3TGUD 4L3GA
chains in the Genus database with same CATH superfamily
1KILA 1YQ3C 1BSNA 1SQVJ 2JWDA 3Q1MA 2WQYC 1DX7A 3GHGC 1J1DB 1CW5A 1CORA 2B10B 3WU2E 1Q2NA 2WSSH 4GDOA 3CI9A 2KS1A 1CSUA 2HPCB 1YIQA 1X79B 2B89A 2RH0A 1OAEA 1FOCA 1KQLA 4EDFA 4QAOA 3AE7C 2A45I 2QA4P 1LTJB 5BU8B 3OA8A 2WWWA 3BATA 1GW3A 1CYIA 2A06G 4ZKPA 1MFZA 1KTMA 4AYCA 4IL6X 2KB7P 2L5GB 1VQ9P 1DIQC 1H8AA 5CYTR 2MTAC 4FA9A 4H44B 3R2PA 2MHMA 4O9BA 5B66H 1S72P 3V4QA 1VF5D 5DFSA 2E74D 1BCCG 4Q5PA 1DEBA 4FB1A 2M0BA 5CCGA 3NFQA 3L35A 4W7ZA 1M7LA 1QL1A 4HJGH 2R5DA 3H1LG 3SLEA 2NPSC 1PFIA 4WY4C 1C75A 3B5NB 2C1DA 3CXHW 3TNUB 2PACA 3L72E 2ZXYA 3AE1C 1RH5B 3JCUH 3WMM0 1E2RA 1U7JA 3MUDA 2FYUG 5KLVK 1A2SA 1KYOE 1C6OA 3G3ZA 1L0LD 1FZEA 3L71D 1S9KD 2OYOA 4PD4I 3RK3B 3CXHH 2GUSA 1AKKA 3CCSP 2D0SA 3L75E 2R3SA 3HQ9A 3ZOYA 1AQ5A 351CA 3UIAA 2PCBB 4PV1B 1DT1A 2IBZD 1FU1A 1BCCJ 3SVWA 1FZGA 2JTIB 5APXA 3M0AA 1P84H 1S1CX 1CCRA 1I8PA 1ZZHA 3H1LJ 2YIUC 1NJIQ 2GUVA 3PHLA 2OYHC 4AQRD 5AW1B 1JOCA 1AVOA 3GMAA 2YMYA 3T97B 3WFCC 2R3CA 3VP8A 3HUSB 1VQ7P 1YTZI 1R5LA 2FYUJ 4I7ZB 1VQKP 2IYOA 1AOQA 3VRDA 3CP5A 3RLMA 2Z5IA 3PLNA 1VQ4P 3H1JE 3M06A 3SWSA 1QKSA 2QM8A 1MZ4A 3P32A 3BRVB 3TK1A 3L70D 1ZXGA 2ZOOA 2HYNA 2E43A 1L0NK 1H89A 5C9MA 1WRGA 1KQFB 1CRIA 2OARA 1M57D 2WSFH 2Y9YA 4WVZA 1LJ2A 4XE5B 2W6JH 1LWUA 2K37A 1CTJA 5H2FH 2I8FA 3H1IG 4GIFA 4IL6E 3O6QA 2N18B 3AE4C 2WZ7A 2YO3A 4PW9B 1IFPA 5CMZA 5CIGB 2E75D 3AEDC 1EDKA 4WWIA 5B5EH 3NMDA 1G1IA 3P8CD 3CCMP 1URQC 1WT6A 2ITAA 3SJLA 1MG2D 3D70A 1N73C 5C39A 4BRYA 1H9XA 2QEXP 2C1VA 3MP7B 2Q9IA 2YCCA 1C6SA 3M97X 1QX8A 2O01N 1T2KD 3A0HH 5CCHC 1VQLP 3VYIA 4RKUJ 2K3RA 2V7QH 1SQVE 2GB8B 2O1JA 1VQPP 1NGMB 3OW2O 5CBNA 1ZN5A 1K73Q 4W7YA 3MK7B 1NTMK 3LW5J 3RK2C 4D6TD 2ZT9B 1FC2C 3H1HD 3H1IJ 1CC5A 2E76D 2KLUA 2IYPA 1AVYA 3TNUA 3RL0B 2PAJA 5CICB 5GTIH 3VP9A 2OTLP 2Y9ZA 4PD4E 2YMKA 1FZCC 3W67A 4PJ0E 2N3YA 1VQ5P 2H8PD 3TGUJ 1PGJA 3FX0A 3HTKB 4WQ9A 4L1QA 3X39A 4EIFA 2NRGA 1RE4A 1H32A 5CIBB 4GOFA 1WVEC 1SQXG 1RF1A 3SWKA 3A0BH 4GEDB 3C1LA 1NIRA 1HVVA 2N9YB 3R4YA 4RESB 4OGQC 2OQQA 1CRYA 1X9VA 1LMSA 1N7SC 2WSEH 1IFIA 1ZRTD 1CCHA 3CPWO 3CWBD 5AW0B 1KC8Q 1FOSF 3Q5PA 2B12B 1QEXA 1OXZA 3U59A 1AQTA 1N86A 1S5LH 3VMXA 1M1KQ 4YE1A 3L71G 1S6VB 1B7VA 2CK3H 2Y0DA 1ZV8A 3S4RA 2B87B 5KAFH 1H9YA 1VQ6P 4C7NA 2HODA 2XDJA 1LT9B 2BCNB 2A06E 2IBZG 1KB9I 5KLVE 1FCDC 3HQ8A 1SQXJ 1XTGB 3NBSA 3L4FA 1C2RA 3VNWA 1GKSA 1BGYE 3KPEA 2IDBA 1DW2A 3CXHD 1BDCA 4FA4A 3DMIA 3HE5A 1PP9E 1KQSO 1RQVA 2SPZA 1NHLA 1CTYA 3KZIE 1L9JC 1P84D 1I6DA 1KILB 1ZR2A 3L71J 2MJZA 2OZ1A 1QN2A 3N7NA 2FYUE 4K3IA 1CSBA 4H13B 1BL9A 4FA5A 1A02J 2CPBA 3WU2H 4OVNF 1H1OA 2N1TC 4EOTA 2FXOA 1VYDA 1LC2A 3V5BA 1GL2D 4L3HA 2C9NY 3JC22 3FXDA 4QMAA 4TLFA 1DVHA 1YTCA 1F1FA 1C52A 1KILE 1GMJA 2GC4D 3OA8B 1QYZA 1VQ8P 1LTIC 1PGQA 2V4HA 5AW4B 1NVOA 4L3GA 2XNDH 4H0LB 1CRJA 1N9CA 3TYIA 4JQ0D 1CIGA 1HUCA 3L74D 3RMZA 3HD7C 5CJ0A 5H2FV 2O3JA 1RF0A 2D2CD 5DJUB 1JCCA 1BE3D 2CXBA 5AW6B 1L4AC 4M3LA 1N7LA 2IX7C 3DR0A 3BCCG 5B6QA 1KYOW 5B5EV 1KILC 1AJYA 1RY3A 4AX3A 2IBZI 3OCDA 1M1JC 5CBOA 3V2QA 2FYNB 5E79E 2C0WA 1OVRA 3A0HV 2ZYGA 4HYTB 3F89A 4NPEA 2BCCE 2DW3A 4N78D 3RL0g 4KT0J 2D0WA 4V2KA 1KYOH 1KN7A 1FAVA 1K9MQ 1U74B 2Z4EA 2ZVOB 1Y8AA 1IZL0 2CA4B 2QJYB 2AXTE 4IOIH 1KORA 1L0ND 3L36A 1IO3A 1N90A 2KI7B 3SFEC 1LTGC 1EXIA 2JKVA 4Y99C 5CIFB 3PH0A 1ZMEC 4LLHA 3RN0A 3BCCJ 1J2JB 1OWAA 1W2EA 3A9FA 2B87A 5GTIV 3NWVA 1I6EA 4H0LD 4MN4C 1LT9A 1MUUA 2YXRB 2YKOA 1W2LA 1BSHA 1EB7A 5M1BA 4I6MC 3H1HJ 1FI7A 4OWFA 2W27A 3V2RA 3CWBG 3VOPA 1DIPA 1NTKG 1VF5B 2E74B 1NU1G 4N0KA 5L8RJ 4FANA 4EICA 2OTJP 3O8ZA 3A0BV 5DF5A 2JO1A 1SQVK 2LR2A 4J20A 4UB6V 3MUDC 1OMIA 3MIWA 3WUVA 1QVGO 2RN0A 3IFMA 2QJPB 4YXWH 1M70A 1HJ0A 1LWUB 2P1JA 2QSIA 4ZMDA 2J58A 1GW4A 1M60A 1S5LV 3Q5RA 1NTMD 2ZYAA 1JTHA 4AUWA 2QRXA 2K9JB 3O6QB 1SQXE 4L73A 3CX5I 4IL6H 2K88A 2AEJA 3Q3DA 2A45H 1VQMP 1JCDA 3CWBJ 5TJHA 1EDJA 3D6ZA 1CEDA 3TSIA 1NTKJ 1DVVA 3O5CA 4BRYB 1NU1J 1HGZA 3WFEC 1EC5A 2C8SA 2YK3A 3ZCFA 2QVAA 2P58A 5DJQB 1FE6A 2RMZA 3CCQP 1K04A 4DT0A 1M8OB 3H1KD 1KZUB 3KQGA 1OVUA 4W80A 3WFDC 1UIXA 5KKZC 3B8EB 1EXJA 2AEFA 3I5CA 3M9BA 1J1EC 2P10A 3ZDMA 4L75A 3ORVA 1YYCA 1EZVD 5BU5A 2FBWC 4EYYQ 1JM0A 2E5YA 2YKQA 3WU2V 5GTHV 3MD0A 1J1DC 3GW6A 1FZAA 2PGDA 1I54A 4PD4H 3L74G 1NTZE 1YBKA 4PJ0H 1CTZA 2Q1KA 1CIHA 2W90A 3CLQA 5TISE 3L73G 3PH2B 2OTKE 5AW9B 3CC7P 1HBWA 2NPSD 1H32B 4WY4D 2H7HA 4XXLA 4I1LA 2WT7B 1RF1B 2I1JA 3AECC 4C46A 1FZBA 2E75B 2BASA 3D0WA 4HH2A 1LTJC 2H43A 3QWOC 3CCEP 4OH8B 2C1UA 1FS0E 2O1KA 2FFDA 1FJKA 1GIWA 3D6YA 1N50A 2KZIA 3GHGA 4KHXA 4NPDA 4H44C 2FYUK 1C2NA 4O1WA 3AE8C 4CPGA 2J5UA 1CYCA 1GDVA 3ZIYA 1VDFA 2B11B 3CXHI 3RK3E 3O0RC 3ZOWA 1SQQE 2WSFJ 4C7NB 3E1IA 2HODB 3L74J 1CNOA 2POHA 1K3HA 1RZ6A 1Y9BA 1FDMA 3B5NC 3L72D 3KYQA 1HJ4A 3L73J 1IFNA 1CI6B 4WQEA 2FY8A 1H33A 1BE3J 1HCMA 2O01J 5AVWB 4BXLA 2E76B 5APUA 1KYOD 1NAFA 2KXPB 3MGNA 4DY9A 2N9IA 1IFJA 2KNCA 3AEFC 3HE5B 2HLOA 3BCCE 5AVQB 3CX5E 3L75D 3RK3C 1RF1C 2QJKB 5KLIB 3CC2P 2MKVA 2QG4A 3KZIH 4PV1C 1H31B 2K9JA 2NPSA 2OZ1B 4A7PA 4WY4A 3V4WA 2V7QJ 5KTBA 1SQBG 3I56P 2IFMA 1W5CE 2XZRA 2ZVNB 1EQ7A 1LS9A 1QVFO 2G8YA 1EDLA 1CHJA 1X22A 2RKLA 3H6PA 5KAIV 1IK7A 1CXCA 2BEZF 1HROA 1L0NJ 1RZ5A 3PXTA 1NH4A 4ASVA 4YTPC 3TGUG 1DD3A 2KP8A 2XV5A 1U7MA 3HUSC 3O20A 3OJAB 3O1YA 4I7ZC 4WBAA 1I5TA 1LNQA 3H1JD 1IRWA 1URQD 4LGDE 2W6BA 3P7KA 1OFCX 1SQPD 3SWYA 2GM4A 1F1CA 3N4XA 4L76A 1SFCD 1GZLA 2M5AA 5CCHD 2CE1A 1NTKE 1SQBJ 1NU1E 1HJ5A 5KLIC 4IL6V 1KQGB 3H1KG 2R44A 1YEAA 2C0XA 3IAOA 3RBXA 2E5TA 2N18C 3RK2D 2NZ2A 1IFMA 3OCDB 3HE4B 4K35A 1NTMJ 3MTUE 1U57A 2WT7A 3M0DA 5E79H 1YHQP 1JEKA 1KIBA 2Q7CA 3FGAD 3LW5H 2K9YA 1GK4A 1E8EA 5B66V 1JMBA 1PGPA 1IZNB 1GL2B 3EWKA 2AXTH 2ZFCA 3G6EP 4BWNA 2Z5HA 1L0LG 1YJNP 1E5WA 3CCUP 3MK7C 3WUUA 1JY2O 2ZT9C 2GC7D 2PRRA 4EIDA 1JY2N 2IZ0A 3JBTB 1SQXK 2YXQB 3NTNA 4OGQD 1YFCA 3H1KJ 1N7SD 3RN1A 2N9JA 1T3UA 1URQA 1RF0C 1JY2P 1OCDA 1WEJF 2H89C 5APYA 3RL0C 1CI6A 4L74A 4NFGB 2BH4X 1T6AA 1JY3O 1BCCE 1SFCA 1JY3N 1N15A 2D2CB 5CCHA 3RGUA 1H88A 1OW7A 3SFDC 3H1LE 155CA 1JY3P 1JUNA 1W5CT 1PV3A 2KYVA 2LXCB 1U75B 4AALA 1N8RQ 3BASA 1LTTC 3D71A 3EQ2A 1FBMA 1K05A 1AFOA 2GA1A 1L0LJ 3L72G 1H31A 3H32A 1OVVA 4ZNCA 1CSWA 2B9BA 1JTHB 1TU3F 3L73E 3L70G 4WQDA 1CSXA 3AEBC 5C0ZA 1FZCA 5KJ7C 3CCRP 5AVYB 1RE3C 1NTZK 3L75G 3CMEP 1NMIA 3CCVP 2A06D 4H0KA 1ZOYC 1CXAA 5CIEB 1LT9C 2PFXA 3JSVC 1C6RA 5KLVD 1E79H 1ZP0C 4AANA 1N2DC 1YICA 2Y0EA 1BGYD 2N1TD 1CRCA 3V2PA 2HG5D 3IF4A 1DIIC 1PP9D 2B88A 3L72J 1LP1A 2KSJA 1KV4A 1GU2A 4EIEA 4XA4A 3CMAP 3KZIV 3L70J 2KZJA 4JPZB 1PL5A 1LTBC 1GU4A 2I1KA 1CSVA 4ZKUA 1KX7A 1SQQK 3OAKA 4TT3H 2P7JA 5CHXA 3L75J 2H88C 3HD7D 3KXDA 1SQPG 4H13C 1NO4A 4MU8A 4D6TG 3OA7A 3H1HG 3GF7A 3HE4A 1YJ9P 4UB8E 1PIXA 1HJBA 4N6JA 1SVFA 1YTZT 1FI9A 1L4AD 1LTSC 1S2EA 4WB4A 3H1IE 2YO2A 5TISH 1FI3A 1COTA 3HQ6A 3PXSA 4AAOA 2XU6A 1SQBE 4EI2A 1M90Q 1GL2A 4WQ8A 1VQOP 4UB6E 5DJTB 4WQBA 2CE0A 2FFDB 4KMGA 1C7MA 3ITKA 1KB9E 4H0LC 3TGUE 1SP4A 2PCCB 3GG2A 1CRGA 3GHGB 5AW7B 1GU5A 1GQ1A 4DOJA 4YPCA 3SXTA 1X0TA 2KLVA 2KOGA 1Q90D 1KYOI 3H1JJ 1R0QA 5CCGC 3FXEA 3ZBMA 2N1TA 1SQPJ 1ETPA 4LC1A 4D6TJ 1NKZB 4DCKA 2QE7H 5APVA 3A7OA 2ZZS1 2HFED 1FHBA 2WSCH 1CHIA 1H33B 3MHVA 5AW8B 1ZW0A 3VYMA 1YNRA 1SS1A 3NXSA 2CPSA 3GF3A 2XNXA 2WPVB 2W6AA 2FYNC 2WTYA 2BCCD 2JP3A 3II6A 4U7JA 4H0JA 2KNCB 2LXBA 1OIPA 1VQNP 1HRCA 3H1KE 4GT1A 3S9OA 3ZOXA 1GD2E 2AXTV 3CX5H 2OYIA 3V6IA 1KFMA 1NTKK 1S3JA 2QJYC 1L4AA 1NU1K 1G2CA 1E29A 2NPSB 4IFDK 4WY4B 3CD6P 5AW5B 1R8EA 1QLED 5KAFV 4Z1MH 1CIEA 4P4QB 2FFDC 2AIUA 2E42A 1MZ9A 1IK9A 1M1JA 1LTAC 1IJDB 5GTHE 3WFBC 2V07A 4WQCA 2ZAEB 1GK6A 1FDOA 1YI2P 4R4LA 1PPJD 4U3FD 1CO6A 1T3JA 3VMYA 1JDLA 1L0LE 5IY51 1VF5C 2E74C 3L71E 1S9KE 2V08A 2J59M 1JNMA 3AE2C 1T8ZA 3FWNA 1QL2A 2W8ZA 4K3AA 1IO4A 1DW0A 2JQRA 1QGKB 2IBZE 1HH0A 2VHDA 1DD4A 2YIUB 2M5AB 3PRJA 2WPRA 2QJPC 5KLVG 2OYHB 5AW3B 4N3YB 1LWUC 1BGYG 3IN6A 1HWTC 3M9HA 1NAYA 1H0TA 2KUBA 2AXCA 1SQXD 3E7KA 2CA3B 1W2BO 1PP9G 3WUTA 5CJ4A 2Q3IA 1BE3G 4O1QA 1IRVA 3WUIA 3S1KA 3LIDA 4NPFX 1FZFA 3DP5A 2BPBB 4FAVA 2IZ1A 1IFDA 1AV1A 3SWFA 3L70E 5DJQC 1OX3A 1Q82Q 4LJIA 4KJMA 4HB1A 1YEBA 4FA1A 1YCCA 2HV4A 2ZJSE 4XFJA 1K8AQ 5KLVJ 1HZUA 1KV9A 3F5HA 1BGYJ 3TF5A 1K3GA 1DEEG 1URQB 1AOFA 1NMLA 1PP9J 1OW8A 2BEQD 1N73B 1ZLLA 1BDDA 1L0NG 4Y28J 3P8CE 1J3SA 1P84I 1CRHA 5KAIE 3TDKA 2P2UA 3EFFK 4H44D 1NTZD 3ZOOA 451CA 1SFCB 2BLFB 1PGOA 5TISV 3AE6C 2ZXEB 4XYDB 2YKPA 2LKMA 1Q81Q 3PP5A 1VL2A 1QL4A 1RE4C 1AA0A 1JMMA 3M0DC 3B5ND 2FXMA 1X8YA 1YIJP 3RK2B 2Y0CA 2B0ZB 2JWAA 4EIJA 1SQPE 2E75C 3H32B 4D6TE 4AAMA 3H1HE 2YNYA 3MZWB 1NKNA 1M6ZA 2IFNA 2WPSA 2ZONG 2PP6A 5BVZA 1IQCA 2BCCG 1T2KC 1FZCB 2K1AA 3RK3D 1HF9A 2C2CA 5AVZB 1SQQD 2O01H 3CL3D 4JCGA 3B71A 3ABVC 2L91A 2HR3A 4PV1D 3L4OA 2HPCA 1NTMG 2UWJE 3G71P 1EDIA 4IFFA 1GDTA 2G3AA 5EFWB 1FJPA 3Q2YA 4OGQB 1SQBK 2Q3EA 1N7SB 1LTJA 2E76C 1SFCC 5EXQA 1UIIA 3C8VA 1ZRTE 3BCCD 3PTZA 1HJ3A 2R5BA 4DZOA 1S4XA 1LP1B 4GODA 5B66E 3CWBE 3CX5D 5CIDB 1QL3A 2OYHA 1KB0A 2WVRA 1PPJG 4U3FG 3IR9A 2QJKC 4B86A 2ORLA 1FDIA 2BCCJ 2C9XB 2WSEJ 3RBZA 3BVHA 3CCLP 2M3BA 3I55P 1JO5A 3B5NA 1USDA 1LFMA 1L9BC 1MV8A 3FWLA 2R32A 1NNOA 2DGEA 3JCUE 3NBTA 3LIEA 1DW1A 1EZVG 1MKMA 4UB8H 2W83C 1I55A 1FJ0A 2M8RA 4C7RA 2XTSB 2KK7A 5CIHB 1SQVD 1KMIZ 3CXHE 3V2NA 2I8DA 3E1RA 1NYHA 3L37A 2ZYDA 2GIWA 2VRSA 4UB6H 3TYYA 4U3FJ 1P84E 5APSA 1HGVA 3G4SP 2JEEA 3HRNA 1KB9H 1Q86Q 1DH3A 1AYGA 2FKWB 1NTKD 1NU1D 2P67A 1N73A 1L2PA 1NOHA 2N1TB 4PD4D 5AVVB 3VTPC 3KHUA 4PJ0V 2N3BA 3T97A 4R4MA 4RO0A 3HUSA 4WQAA 1USEA 2ZT9D 1L0LK 2QIWA 1RAPA 3USSA 3W68A 3QH9A 1S5LX 1CHHA 1YQ4C 3RL0D 1Y47A 2IPPA 3AE9C 4JF7A 3HD7B 3Q5SA 4JYBA 3BRTB 3AE3C 1RAQA 4RJTA 3L74E 2BH5X 1I8OA 5AW2B 1YJWP 2OYIB 5AVXB 1NTZG 1ZR4A 5H2FE 1L4AB 4DJGA 1G2CB 1GL2C 1BE3E 1M56D 1CYJA 2XKMA 2AEMA 2N9BA 3C9IA 3CCJP 1G1JA 1A56A 1RQUA 3AEGC 5AVRB 5B5EE 1M1JB 1A8CA 4GOEA 5AURA 1EZVI 5GTHH 1KFNA 5APWA 5AVTB 3WC8A 1KD1Q 5APTA 2KS1B 1BCCD 4YXDC 3A5TA 3A0HE 1N7SA 4N78E 2JDIH 3VN0A 5KJ7D 3CYTI 2D2CC 1YITP 3H1LD 1RHZB 1PZQA 3P8MC 1LT1A 1SQQG 3HQ7A 4IFMA 4ASWA 5K5GB 2WMMA 3B4SA 3CU4A 1NTZJ 1L0NE 4Y99B 4Y5RA 3H25A 2DVHA 2EXVA 3PJSK 1MFTA 2FWLA 3EFGA 2FYUD 3PXWA 3H1JG 4WQ7A 3U1CA 1HTLC 1XTCC 3A2AA 2LIRA 3L73D 2BGVX 1A02F 5GTIE 2OYIC 1H0TB 1OZHA 1D7MA 3KDPB 4GKGA 2L4DA 2FYZA 5APQA 5AVSB 2C1DB 1NWQA 5AVUB 3C2CA 1R5SA 3HTKA 3U1AA 1DW3A 1KILD 2OGUA 1FOSE 3A0BE 2A45G 4H13D 1SQQJ 2FRCA 2WSCJ 1SQPK 1LGHB 1HZVA 2KSEA 1GTWA 2ZBOA 2Q5UA 1LC1A 1S5LE 3G9RA 1NTME 1Q7YQ 3CC4P 2FXPA 4GYDA 1CZQA 2JR8A 5KJ7A 1SQVG 3VMZA 1HH7A 1RE3A 5KAFE 3M9QA 2JJLA 3AE5C 4I2LC 4JBZA 1GJQA 1VPCA 1OW6A 3CX5W 4RSZA 2WITA 5E79V 5KAIH 2M3EA 4UB8V 2C9LY 2B4ZA 2WPQA 3AEEC 5CCGD 3H1ID 1PPJE 2ZXXA 4U3FE 1KX2A 3VMAA 2QM7A 3SSUA 4PWAA 3A3YB 5KKZB 3HD7A 1WMKA 2KIKA 1Z56A 1SQBD 3K5BA 3L4MA 4HKZH 1CIFA 1J1EB 2LITA 2Q6QA 3GLMA 1MG3D 1JB0J 2AI5A 3M91A 1SLQA 2YQBA 1KB9D 4JYCA 3TGUD 1EZVE 1IC2A 3AEAC
chains in the Genus database with same CATH topology
1J3SA 1CRJA 1N9CA 1KIBA 3TYIA 1CRHA 1CIGA 3TDKA 3L74D 3RMZA 1NTZD 3ZOOA 451CA 1CORA 2BLFB 2B10B 5H2FV 2O3JA 1E8EA 5TISV 5B66V 1BE3D 2CXBA 4XYDB 2KS1A 1CSUA 1YIQA 1QL4A 3DR0A 5B6QA 1KYOW 1OAEA 5B5EV 3MK7C 1FOCA 4EDFA 2GC7D 2Y0CA 2B0ZB 4QAOA 4EIDA 3JBTB 4AX3A 2JWAA 1YFCA 3OCDA 4AAMA 3RN1A 3OA8A 1M6ZA 2N9JA 2FYNB 1CYIA 1OCDA 1WEJF 3A0HV 2ZONG 1DIQC 5CYTR 2MTAC 4FA9A 2D0WA 2BH4X 4NFGB 4V2KA 1IQCA 2MHMA 1U74B 5DFSA 2C2CA 1N15A 4Q5PA 1SQQD 4FB1A 4JCGA 1IZL0 2CA4B 2QJYB 2L91A 155CA 3L4OA 1L0ND 3SLEA 1IO3A 1N90A 1C75A 1W5CT 2C1DA 1U75B 3CXHW 4AALA 5CIFB 2PACA 3RN0A 3A9FA 2ZXYA 2Q3EA 1H31A 5GTIV 3NWVA 1I6EA 5EXQA 1W2LA 1E2RA 1CSWA 3BCCD 3PTZA 1EB7A 1HJ3A 1A2SA 1C6OA 1L0LD 3CX5D 4WQDA 5CIDB 1FI7A 3L71D 1CSXA 1QL3A 5C0ZA 1KB0A 1AKKA 2D0SA 2ORLA 4N0KA 3HQ9A 3ZOYA 4FANA 2C9XB 4EICA 351CA 1NMIA 2PCBB 2A06D 1DT1A 3A0BV 1CXAA 4H0KA 5DF5A 2IBZD 3SVWA 5CIEB 2JTIB 4J20A 4UB6V 1C6RA 1LFMA 1CCRA 1I8PA 1L9BC 5KLVD 1ZZHA 4AANA 3FWLA 1YICA 2RN0A 2Y0EA 1NNOA 2DGEA 1BGYD 3NBTA 2QJPB 3PHLA 1M70A 1CRCA 1DW1A 1I55A 1M60A 1S5LV 1FJ0A 1NTMD 1DIIC 1PP9D 3WFCC 2XTSB 2K9JB 1GU2A 5CIHB 1SQVD 4EIEA 3KZIV 1AOQA 3VRDA 3CP5A 2GIWA 5TJHA 3RLMA 1CEDA 3PLNA 1CSVA 1DVVA 3O5CA 3SWSA 1QKSA 1KX7A 1MZ4A 3WFEC 3L70D 2C8SA 2YK3A 2ZOOA 5C9MA 1AYGA 1CRIA 3ZCFA 1NTKD 4MU8A 5DJQB 1NU1D 2RMZA 1FI9A 3H1KD 1CTJA 4PD4D 3KHUA 2I8FA 4PJ0V 3WFDC 1FI3A 2N3BA 1COTA 3HQ6A 3PXSA 4AAOA 2N18B 4WQAA 4PW9B 5CIGB 3ORVA 4WQ8A 1RAPA 1EZVD 4WQBA 3SJLA 1MG2D 2CE0A 4KMGA 1C7MA 3ITKA 1H9XA 1CHHA 2C1VA 2PCCB 3GG2A 1CRGA 2YCCA 3WU2V 5GTHV 3M97X 1GQ1A 1C6SA 3SXTA 3GW6A 1RAQA 4RJTA 1I54A 2BH5X 1I8OA 1R0QA 3ZBMA 1CTZA 1CIHA 1ETPA 2GB8B 3PH2B 1H32B 1CYJA 2ZZS1 4XXLA 1FHBA 3MK7B 1CHIA 1A56A 1H33B 4D6TD 3H1HD 3VYMA 1A8CA 1YNRA 1CC5A 2C1UA 5AURA 2BCCD 3WC8A 4H0JA 2KNCB 5CICB 1GIWA 1BCCD 1N50A 1HRCA 1C2NA 4O1WA 3ZOXA 1CYCA 1GDVA 3ZIYA 2AXTV 2B11B 3CYTI 2N3YA 3H1LD 3O0RC 4WQ9A 3ZOWA 4L1QA 3X39A 1E29A 4EIFA 3HQ7A 1CNOA 1H32A 5CIBB 1WVEC 3CU4A 1K3HA 1RZ6A 5KAFV 1CIEA 4P4QB 4Y5RA 3L72D 1HJ4A 2DVHA 1NIRA 4GEDB 4WQEA 2N9YB 1H33A 2EXVA 2AIUA 1HCMA 2FWLA 2FYUD 3PXWA 1CRYA 1LMSA 1ZRTD 4WQ7A 3WFBC 2LIRA 1KYOD 3L73D 1CCHA 2BGVX 3CWBD 4DY9A 2N9IA 2V07A 4WQCA 2B12B 2L4DA 1PPJD 4U3FD 1CO6A 1JDLA 3L75D 5IY51 2C1DB 2V08A 4YE1A 1S6VB 2QJKB 5KLIB 1B7VA 3C2CA 2QG4A 2Y0DA 1DW3A 1H31B 1H9YA 2OZ1B 4A7PA 2BCNB 1DW0A 2JQRA 2VHDA 2YIUB 2FRCA 1LS9A 1CHJA 3PRJA 1FCDC 3HQ8A 5KAIV 1CXCA 1HROA 3NBSA 1RZ5A 3PXTA 1C2RA 3VNWA 1GKSA 1HZVA 2ZBOA 1DW2A 3CXHD 1SQXD 4FA4A 1LC1A 3DMIA 2CA3B 3O20A 4GYDA 3O1YA 1CTYA 1I5TA 1HH7A 3H1JD 1IRWA 1L9JC 4O1QA 1IRVA 1P84D 1GJQA 3WUIA 1I6DA 1SQPD 3DP5A 2BPBB 2OZ1A 1QN2A 3CX5W 4RSZA 4FAVA 4K3IA 1F1CA 5E79V 1BL9A 4UB8V 5DJQC 2B4ZA 4LJIA 4FA5A 2CE1A 1YEBA 1H1OA 4FA1A 3H1ID 1YCCA 1VYDA 2HV4A 1LC2A 1KX2A 3VMAA 1HJ5A 4IL6V 4L3HA 4PWAA 5KKZB 1SQBD 1YEAA 1HZUA 3L4MA 1DVHA 1YTCA 1CIFA 1F1FA 1KV9A 3TF5A 2N18C 1C52A 2LITA 2GC4D 3OCDB 1K3GA 1MG3D 3OA8B 1QYZA 2AI5A 1AOFA 1NMLA 2YQBA 1KB9D 3TGUD 4L3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J3S A;  1CRJ A;  1N9C A;  1KIB A;  3TYI A;  1CRH A;  1CIG A;  3TDK A;  3L74 D;  3RMZ A;  1NTZ D;  3ZOO A;  451C A;  1COR A;  2BLF B;  2B10 B;  5H2F V;  2O3J A;  1E8E A;  5TIS V;  5B66 V;  1BE3 D;  2CXB A;  4XYD B;  2KS1 A;  1CSU A;  1YIQ A;  1QL4 A;  3DR0 A;  5B6Q A;  1KYO W;  1OAE A;  5B5E V;  3MK7 C;  1FOC A;  4EDF A;  2GC7 D;  2Y0C A;  2B0Z B;  4QAO A;  4EID A;  3JBT B;  4AX3 A;  2JWA A;  1YFC A;  3OCD A;  4AAM A;  3RN1 A;  3OA8 A;  1M6Z A;  2N9J A;  2FYN B;  1CYI A;  1OCD A;  1WEJ F;  3A0H V;  2ZON G;  1DIQ C;  5CYT R;  2MTA C;  4FA9 A;  2D0W A;  2BH4 X;  4NFG B;  4V2K A;  1IQC A;  2MHM A;  1U74 B;  5DFS A;  2C2C A;  1N15 A;  4Q5P A;  1SQQ D;  4FB1 A;  4JCG A;  1IZL 0;  2CA4 B;  2QJY B;  2L91 A;  155C A;  3L4O A;  1L0N D;  3SLE A;  1IO3 A;  1N90 A;  1C75 A;  1W5C T;  2C1D A;  1U75 B;  3CXH W;  4AAL A;  5CIF B;  2PAC A;  3RN0 A;  3A9F A;  2ZXY A;  2Q3E A;  1H31 A;  5GTI V;  3NWV A;  1I6E A;  5EXQ A;  1W2L A;  1E2R A;  1CSW A;  3BCC D;  3PTZ A;  1EB7 A;  1HJ3 A;  1A2S A;  1C6O A;  1L0L D;  3CX5 D;  4WQD A;  5CID B;  1FI7 A;  3L71 D;  1CSX A;  1QL3 A;  5C0Z A;  1KB0 A;  1AKK A;  2D0S A;  2ORL A;  4N0K A;  3HQ9 A;  3ZOY A;  4FAN A;  2C9X B;  4EIC A;  351C A;  1NMI A;  2PCB B;  2A06 D;  1DT1 A;  3A0B V;  1CXA A;  4H0K A;  5DF5 A;  2IBZ D;  3SVW A;  5CIE B;  2JTI B;  4J20 A;  4UB6 V;  1C6R A;  1LFM A;  1CCR A;  1I8P A;  1L9B C;  5KLV D;  1ZZH A;  4AAN A;  3FWL A;  1YIC A;  2RN0 A;  2Y0E A;  1NNO A;  2DGE A;  1BGY D;  3NBT A;  2QJP B;  3PHL A;  1M70 A;  1CRC A;  1DW1 A;  1I55 A;  1M60 A;  1S5L V;  1FJ0 A;  1NTM D;  1DII C;  1PP9 D;  3WFC C;  2XTS B;  2K9J B;  1GU2 A;  5CIH B;  1SQV D;  4EIE A;  3KZI V;  1AOQ A;  3VRD A;  3CP5 A;  2GIW A;  5TJH A;  3RLM A;  1CED A;  3PLN A;  1CSV A;  1DVV A;  3O5C A;  3SWS A;  1QKS A;  1KX7 A;  1MZ4 A;  3WFE C;  3L70 D;  2C8S A;  2YK3 A;  2ZOO A;  5C9M A;  1AYG A;  1CRI A;  3ZCF A;  1NTK D;  4MU8 A;  5DJQ B;  1NU1 D;  2RMZ A;  1FI9 A;  3H1K D;  1CTJ A;  4PD4 D;  3KHU A;  2I8F A;  4PJ0 V;  3WFD C;  1FI3 A;  2N3B A;  1COT A;  3HQ6 A;  3PXS A;  4AAO A;  2N18 B;  4WQA A;  4PW9 B;  5CIG B;  3ORV A;  4WQ8 A;  1RAP A;  1EZV D;  4WQB A;  3SJL A;  1MG2 D;  2CE0 A;  4KMG A;  1C7M A;  3ITK A;  1H9X A;  1CHH A;  2C1V A;  2PCC B;  3GG2 A;  1CRG A;  2YCC A;  3WU2 V;  5GTH V;  3M97 X;  1GQ1 A;  1C6S A;  3SXT A;  3GW6 A;  1RAQ A;  4RJT A;  1I54 A;  2BH5 X;  1I8O A;  1R0Q A;  3ZBM A;  1CTZ A;  1CIH A;  1ETP A;  2GB8 B;  3PH2 B;  1H32 B;  1CYJ A;  2ZZS 1;  4XXL A;  1FHB A;  3MK7 B;  1CHI A;  1A56 A;  1H33 B;  4D6T D;  3H1H D;  3VYM A;  1A8C A;  1YNR A;  1CC5 A;  2C1U A;  5AUR A;  2BCC D;  3WC8 A;  4H0J A;  2KNC B;  5CIC B;  1GIW A;  1BCC D;  1N50 A;  1HRC A;  1C2N A;  4O1W A;  3ZOX A;  1CYC A;  1GDV A;  3ZIY A;  2AXT V;  2B11 B;  3CYT I;  2N3Y A;  3H1L D;  3O0R C;  4WQ9 A;  3ZOW A;  4L1Q A;  3X39 A;  1E29 A;  4EIF A;  3HQ7 A;  1CNO A;  1H32 A;  5CIB B;  1WVE C;  3CU4 A;  1K3H A;  1RZ6 A;  5KAF V;  1CIE A;  4P4Q B;  4Y5R A;  3L72 D;  1HJ4 A;  2DVH A;  1NIR A;  4GED B;  4WQE A;  2N9Y B;  1H33 A;  2EXV A;  2AIU A;  1HCM A;  2FWL A;  2FYU D;  3PXW A;  1CRY A;  1LMS A;  1ZRT D;  4WQ7 A;  3WFB C;  2LIR A;  1KYO D;  3L73 D;  1CCH A;  2BGV X;  3CWB D;  4DY9 A;  2N9I A;  2V07 A;  4WQC A;  2B12 B;  2L4D A;  1PPJ D;  4U3F D;  1CO6 A;  1JDL A;  3L75 D;  5IY5 1;  2C1D B;  2V08 A;  4YE1 A;  1S6V B;  2QJK B;  5KLI B;  1B7V A;  3C2C A;  2QG4 A;  2Y0D A;  1DW3 A;  1H31 B;  1H9Y A;  2OZ1 B;  4A7P A;  2BCN B;  1DW0 A;  2JQR A;  2VHD A;  2YIU B;  2FRC A;  1LS9 A;  1CHJ A;  3PRJ A;  1FCD C;  3HQ8 A;  5KAI V;  1CXC A;  1HRO A;  3NBS A;  1RZ5 A;  3PXT A;  1C2R A;  3VNW A;  1GKS A;  1HZV A;  2ZBO A;  1DW2 A;  3CXH D;  1SQX D;  4FA4 A;  1LC1 A;  3DMI A;  2CA3 B;  3O20 A;  4GYD A;  3O1Y A;  1CTY A;  1I5T A;  1HH7 A;  3H1J D;  1IRW A;  1L9J C;  4O1Q A;  1IRV A;  1P84 D;  1GJQ A;  3WUI A;  1I6D A;  1SQP D;  3DP5 A;  2BPB B;  2OZ1 A;  1QN2 A;  3CX5 W;  4RSZ A;  4FAV A;  4K3I A;  1F1C A;  5E79 V;  1BL9 A;  4UB8 V;  5DJQ C;  2B4Z A;  4LJI A;  4FA5 A;  2CE1 A;  1YEB A;  1H1O A;  4FA1 A;  3H1I D;  1YCC A;  1VYD A;  2HV4 A;  1LC2 A;  1KX2 A;  3VMA A;  1HJ5 A;  4IL6 V;  4L3H A;  4PWA A;  5KKZ B;  1SQB D;  1YEA A;  1HZU A;  3L4M A;  1DVH A;  1YTC A;  1CIF A;  1F1F A;  1KV9 A;  3TF5 A;  2N18 C;  1C52 A;  2LIT A;  2GC4 D;  3OCD B;  1K3G A;  1MG3 D;  3OA8 B;  1QYZ A;  2AI5 A;  1AOF A;  1NML A;  2YQB A;  1KB9 D;  3TGU D;  4L3G A; 
#chains in the Genus database with same CATH topology
 1KIL A;  1YQ3 C;  1BSN A;  1SQV J;  2JWD A;  3Q1M A;  2WQY C;  1DX7 A;  3GHG C;  1J1D B;  1CW5 A;  1COR A;  2B10 B;  3WU2 E;  1Q2N A;  2WSS H;  4GDO A;  3CI9 A;  2KS1 A;  1CSU A;  2HPC B;  1YIQ A;  1X79 B;  2B89 A;  2RH0 A;  1OAE A;  1FOC A;  1KQL A;  4EDF A;  4QAO A;  3AE7 C;  2A45 I;  2QA4 P;  1LTJ B;  5BU8 B;  3OA8 A;  2WWW A;  3BAT A;  1GW3 A;  1CYI A;  2A06 G;  4ZKP A;  1MFZ A;  1KTM A;  4AYC A;  4IL6 X;  2KB7 P;  2L5G B;  1VQ9 P;  1DIQ C;  1H8A A;  5CYT R;  2MTA C;  4FA9 A;  4H44 B;  3R2P A;  2MHM A;  4O9B A;  5B66 H;  1S72 P;  3V4Q A;  1VF5 D;  5DFS A;  2E74 D;  1BCC G;  4Q5P A;  1DEB A;  4FB1 A;  2M0B A;  5CCG A;  3NFQ A;  3L35 A;  4W7Z A;  1M7L A;  1QL1 A;  4HJG H;  2R5D A;  3H1L G;  3SLE A;  2NPS C;  1PFI A;  4WY4 C;  1C75 A;  3B5N B;  2C1D A;  3CXH W;  3TNU B;  2PAC A;  3L72 E;  2ZXY A;  3AE1 C;  1RH5 B;  3JCU H;  3WMM 0;  1E2R A;  1U7J A;  3MUD A;  2FYU G;  5KLV K;  1A2S A;  1KYO E;  1C6O A;  3G3Z A;  1L0L D;  1FZE A;  3L71 D;  1S9K D;  2OYO A;  4PD4 I;  3RK3 B;  3CXH H;  2GUS A;  1AKK A;  3CCS P;  2D0S A;  3L75 E;  2R3S A;  3HQ9 A;  3ZOY A;  1AQ5 A;  351C A;  3UIA A;  2PCB B;  4PV1 B;  1DT1 A;  2IBZ D;  1FU1 A;  1BCC J;  3SVW A;  1FZG A;  2JTI B;  5APX A;  3M0A A;  1P84 H;  1S1C X;  1CCR A;  1I8P A;  1ZZH A;  3H1L J;  2YIU C;  1NJI Q;  2GUV A;  3PHL A;  2OYH C;  4AQR D;  5AW1 B;  1JOC A;  1AVO A;  3GMA A;  2YMY A;  3T97 B;  3WFC C;  2R3C A;  3VP8 A;  3HUS B;  1VQ7 P;  1YTZ I;  1R5L A;  2FYU J;  4I7Z B;  1VQK P;  2IYO A;  1AOQ A;  3VRD A;  3CP5 A;  3RLM A;  2Z5I A;  3PLN A;  1VQ4 P;  3H1J E;  3M06 A;  3SWS A;  1QKS A;  2QM8 A;  1MZ4 A;  3P32 A;  3BRV B;  3TK1 A;  3L70 D;  1ZXG A;  2ZOO A;  2HYN A;  2E43 A;  1L0N K;  1H89 A;  5C9M A;  1WRG A;  1KQF B;  1CRI A;  2OAR A;  1M57 D;  2WSF H;  2Y9Y A;  4WVZ A;  1LJ2 A;  4XE5 B;  2W6J H;  1LWU A;  2K37 A;  1CTJ A;  5H2F H;  2I8F A;  3H1I G;  4GIF A;  4IL6 E;  3O6Q A;  2N18 B;  3AE4 C;  2WZ7 A;  2YO3 A;  4PW9 B;  1IFP A;  5CMZ A;  5CIG B;  2E75 D;  3AED C;  1EDK A;  4WWI A;  5B5E H;  3NMD A;  1G1I A;  3P8C D;  3CCM P;  1URQ C;  1WT6 A;  2ITA A;  3SJL A;  1MG2 D;  3D70 A;  1N73 C;  5C39 A;  4BRY A;  1H9X A;  2QEX P;  2C1V A;  3MP7 B;  2Q9I A;  2YCC A;  1C6S A;  3M97 X;  1QX8 A;  2O01 N;  1T2K D;  3A0H H;  5CCH C;  1VQL P;  3VYI A;  4RKU J;  2K3R A;  2V7Q H;  1SQV E;  2GB8 B;  2O1J A;  1VQP P;  1NGM B;  3OW2 O;  5CBN A;  1ZN5 A;  1K73 Q;  4W7Y A;  3MK7 B;  1NTM K;  3LW5 J;  3RK2 C;  4D6T D;  2ZT9 B;  1FC2 C;  3H1H D;  3H1I J;  1CC5 A;  2E76 D;  2KLU A;  2IYP A;  1AVY A;  3TNU A;  3RL0 B;  2PAJ A;  5CIC B;  5GTI H;  3VP9 A;  2OTL P;  2Y9Z A;  4PD4 E;  2YMK A;  1FZC C;  3W67 A;  4PJ0 E;  2N3Y A;  1VQ5 P;  2H8P D;  3TGU J;  1PGJ A;  3FX0 A;  3HTK B;  4WQ9 A;  4L1Q A;  3X39 A;  4EIF A;  2NRG A;  1RE4 A;  1H32 A;  5CIB B;  4GOF A;  1WVE C;  1SQX G;  1RF1 A;  3SWK A;  3A0B H;  4GED B;  3C1L A;  1NIR A;  1HVV A;  2N9Y B;  3R4Y A;  4RES B;  4OGQ C;  2OQQ A;  1CRY A;  1X9V A;  1LMS A;  1N7S C;  2WSE H;  1IFI A;  1ZRT D;  1CCH A;  3CPW O;  3CWB D;  5AW0 B;  1KC8 Q;  1FOS F;  3Q5P A;  2B12 B;  1QEX A;  1OXZ A;  3U59 A;  1AQT A;  1N86 A;  1S5L H;  3VMX A;  1M1K Q;  4YE1 A;  3L71 G;  1S6V B;  1B7V A;  2CK3 H;  2Y0D A;  1ZV8 A;  3S4R A;  2B87 B;  5KAF H;  1H9Y A;  1VQ6 P;  4C7N A;  2HOD A;  2XDJ A;  1LT9 B;  2BCN B;  2A06 E;  2IBZ G;  1KB9 I;  5KLV E;  1FCD C;  3HQ8 A;  1SQX J;  1XTG B;  3NBS A;  3L4F A;  1C2R A;  3VNW A;  1GKS A;  1BGY E;  3KPE A;  2IDB A;  1DW2 A;  3CXH D;  1BDC A;  4FA4 A;  3DMI A;  3HE5 A;  1PP9 E;  1KQS O;  1RQV A;  2SPZ A;  1NHL A;  1CTY A;  3KZI E;  1L9J C;  1P84 D;  1I6D A;  1KIL B;  1ZR2 A;  3L71 J;  2MJZ A;  2OZ1 A;  1QN2 A;  3N7N A;  2FYU E;  4K3I A;  1CSB A;  4H13 B;  1BL9 A;  4FA5 A;  1A02 J;  2CPB A;  3WU2 H;  4OVN F;  1H1O A;  2N1T C;  4EOT A;  2FXO A;  1VYD A;  1LC2 A;  3V5B A;  1GL2 D;  4L3H A;  2C9N Y;  3JC2 2;  3FXD A;  4QMA A;  4TLF A;  1DVH A;  1YTC A;  1F1F A;  1C52 A;  1KIL E;  1GMJ A;  2GC4 D;  3OA8 B;  1QYZ A;  1VQ8 P;  1LTI C;  1PGQ A;  2V4H A;  5AW4 B;  1NVO A;  4L3G A;  2XND H;  4H0L B;  1CRJ A;  1N9C A;  3TYI A;  4JQ0 D;  1CIG A;  1HUC A;  3L74 D;  3RMZ A;  3HD7 C;  5CJ0 A;  5H2F V;  2O3J A;  1RF0 A;  2D2C D;  5DJU B;  1JCC A;  1BE3 D;  2CXB A;  5AW6 B;  1L4A C;  4M3L A;  1N7L A;  2IX7 C;  3DR0 A;  3BCC G;  5B6Q A;  1KYO W;  5B5E V;  1KIL C;  1AJY A;  1RY3 A;  4AX3 A;  2IBZ I;  3OCD A;  1M1J C;  5CBO A;  3V2Q A;  2FYN B;  5E79 E;  2C0W A;  1OVR A;  3A0H V;  2ZYG A;  4HYT B;  3F89 A;  4NPE A;  2BCC E;  2DW3 A;  4N78 D;  3RL0 g;  4KT0 J;  2D0W A;  4V2K A;  1KYO H;  1KN7 A;  1FAV A;  1K9M Q;  1U74 B;  2Z4E A;  2ZVO B;  1Y8A A;  1IZL 0;  2CA4 B;  2QJY B;  2AXT E;  4IOI H;  1KOR A;  1L0N D;  3L36 A;  1IO3 A;  1N90 A;  2KI7 B;  3SFE C;  1LTG C;  1EXI A;  2JKV A;  4Y99 C;  5CIF B;  3PH0 A;  1ZME C;  4LLH A;  3RN0 A;  3BCC J;  1J2J B;  1OWA A;  1W2E A;  3A9F A;  2B87 A;  5GTI V;  3NWV A;  1I6E A;  4H0L D;  4MN4 C;  1LT9 A;  1MUU A;  2YXR B;  2YKO A;  1W2L A;  1BSH A;  1EB7 A;  5M1B A;  4I6M C;  3H1H J;  1FI7 A;  4OWF A;  2W27 A;  3V2R A;  3CWB G;  3VOP A;  1DIP A;  1NTK G;  1VF5 B;  2E74 B;  1NU1 G;  4N0K A;  5L8R J;  4FAN A;  4EIC A;  2OTJ P;  3O8Z A;  3A0B V;  5DF5 A;  2JO1 A;  1SQV K;  2LR2 A;  4J20 A;  4UB6 V;  3MUD C;  1OMI A;  3MIW A;  3WUV A;  1QVG O;  2RN0 A;  3IFM A;  2QJP B;  4YXW H;  1M70 A;  1HJ0 A;  1LWU B;  2P1J A;  2QSI A;  4ZMD A;  2J58 A;  1GW4 A;  1M60 A;  1S5L V;  3Q5R A;  1NTM D;  2ZYA A;  1JTH A;  4AUW A;  2QRX A;  2K9J B;  3O6Q B;  1SQX E;  4L73 A;  3CX5 I;  4IL6 H;  2K88 A;  2AEJ A;  3Q3D A;  2A45 H;  1VQM P;  1JCD A;  3CWB J;  5TJH A;  1EDJ A;  3D6Z A;  1CED A;  3TSI A;  1NTK J;  1DVV A;  3O5C A;  4BRY B;  1NU1 J;  1HGZ A;  3WFE C;  1EC5 A;  2C8S A;  2YK3 A;  3ZCF A;  2QVA A;  2P58 A;  5DJQ B;  1FE6 A;  2RMZ A;  3CCQ P;  1K04 A;  4DT0 A;  1M8O B;  3H1K D;  1KZU B;  3KQG A;  1OVU A;  4W80 A;  3WFD C;  1UIX A;  5KKZ C;  3B8E B;  1EXJ A;  2AEF A;  3I5C A;  3M9B A;  1J1E C;  2P10 A;  3ZDM A;  4L75 A;  3ORV A;  1YYC A;  1EZV D;  5BU5 A;  2FBW C;  4EYY Q;  1JM0 A;  2E5Y A;  2YKQ A;  3WU2 V;  5GTH V;  3MD0 A;  1J1D C;  3GW6 A;  1FZA A;  2PGD A;  1I54 A;  4PD4 H;  3L74 G;  1NTZ E;  1YBK A;  4PJ0 H;  1CTZ A;  2Q1K A;  1CIH A;  2W90 A;  3CLQ A;  5TIS E;  3L73 G;  3PH2 B;  2OTK E;  5AW9 B;  3CC7 P;  1HBW A;  2NPS D;  1H32 B;  4WY4 D;  2H7H A;  4XXL A;  4I1L A;  2WT7 B;  1RF1 B;  2I1J A;  3AEC C;  4C46 A;  1FZB A;  2E75 B;  2BAS A;  3D0W A;  4HH2 A;  1LTJ C;  2H43 A;  3QWO C;  3CCE P;  4OH8 B;  2C1U A;  1FS0 E;  2O1K A;  2FFD A;  1FJK A;  1GIW A;  3D6Y A;  1N50 A;  2KZI A;  3GHG A;  4KHX A;  4NPD A;  4H44 C;  2FYU K;  1C2N A;  4O1W A;  3AE8 C;  4CPG A;  2J5U A;  1CYC A;  1GDV A;  3ZIY A;  1VDF A;  2B11 B;  3CXH I;  3RK3 E;  3O0R C;  3ZOW A;  1SQQ E;  2WSF J;  4C7N B;  3E1I A;  2HOD B;  3L74 J;  1CNO A;  2POH A;  1K3H A;  1RZ6 A;  1Y9B A;  1FDM A;  3B5N C;  3L72 D;  3KYQ A;  1HJ4 A;  3L73 J;  1IFN A;  1CI6 B;  4WQE A;  2FY8 A;  1H33 A;  1BE3 J;  1HCM A;  2O01 J;  5AVW B;  4BXL A;  2E76 B;  5APU A;  1KYO D;  1NAF A;  2KXP B;  3MGN A;  4DY9 A;  2N9I A;  1IFJ A;  2KNC A;  3AEF C;  3HE5 B;  2HLO A;  3BCC E;  5AVQ B;  3CX5 E;  3L75 D;  3RK3 C;  1RF1 C;  2QJK B;  5KLI B;  3CC2 P;  2MKV A;  2QG4 A;  3KZI H;  4PV1 C;  1H31 B;  2K9J A;  2NPS A;  2OZ1 B;  4A7P A;  4WY4 A;  3V4W A;  2V7Q J;  5KTB A;  1SQB G;  3I56 P;  2IFM A;  1W5C E;  2XZR A;  2ZVN B;  1EQ7 A;  1LS9 A;  1QVF O;  2G8Y A;  1EDL A;  1CHJ A;  1X22 A;  2RKL A;  3H6P A;  5KAI V;  1IK7 A;  1CXC A;  2BEZ F;  1HRO A;  1L0N J;  1RZ5 A;  3PXT A;  1NH4 A;  4ASV A;  4YTP C;  3TGU G;  1DD3 A;  2KP8 A;  2XV5 A;  1U7M A;  3HUS C;  3O20 A;  3OJA B;  3O1Y A;  4I7Z C;  4WBA A;  1I5T A;  1LNQ A;  3H1J D;  1IRW A;  1URQ D;  4LGD E;  2W6B A;  3P7K A;  1OFC X;  1SQP D;  3SWY A;  2GM4 A;  1F1C A;  3N4X A;  4L76 A;  1SFC D;  1GZL A;  2M5A A;  5CCH D;  2CE1 A;  1NTK E;  1SQB J;  1NU1 E;  1HJ5 A;  5KLI C;  4IL6 V;  1KQG B;  3H1K G;  2R44 A;  1YEA A;  2C0X A;  3IAO A;  3RBX A;  2E5T A;  2N18 C;  3RK2 D;  2NZ2 A;  1IFM A;  3OCD B;  3HE4 B;  4K35 A;  1NTM J;  3MTU E;  1U57 A;  2WT7 A;  3M0D A;  5E79 H;  1YHQ P;  1JEK A;  1KIB A;  2Q7C A;  3FGA D;  3LW5 H;  2K9Y A;  1GK4 A;  1E8E A;  5B66 V;  1JMB A;  1PGP A;  1IZN B;  1GL2 B;  3EWK A;  2AXT H;  2ZFC A;  3G6E P;  4BWN A;  2Z5H A;  1L0L G;  1YJN P;  1E5W A;  3CCU P;  3MK7 C;  3WUU A;  1JY2 O;  2ZT9 C;  2GC7 D;  2PRR A;  4EID A;  1JY2 N;  2IZ0 A;  3JBT B;  1SQX K;  2YXQ B;  3NTN A;  4OGQ D;  1YFC A;  3H1K J;  1N7S D;  3RN1 A;  2N9J A;  1T3U A;  1URQ A;  1RF0 C;  1JY2 P;  1OCD A;  1WEJ F;  2H89 C;  5APY A;  3RL0 C;  1CI6 A;  4L74 A;  4NFG B;  2BH4 X;  1T6A A;  1JY3 O;  1BCC E;  1SFC A;  1JY3 N;  1N15 A;  2D2C B;  5CCH A;  3RGU A;  1H88 A;  1OW7 A;  3SFD C;  3H1L E;  155C A;  1JY3 P;  1JUN A;  1W5C T;  1PV3 A;  2KYV A;  2LXC B;  1U75 B;  4AAL A;  1N8R Q;  3BAS A;  1LTT C;  3D71 A;  3EQ2 A;  1FBM A;  1K05 A;  1AFO A;  2GA1 A;  1L0L J;  3L72 G;  1H31 A;  3H32 A;  1OVV A;  4ZNC A;  1CSW A;  2B9B A;  1JTH B;  1TU3 F;  3L73 E;  3L70 G;  4WQD A;  1CSX A;  3AEB C;  5C0Z A;  1FZC A;  5KJ7 C;  3CCR P;  5AVY B;  1RE3 C;  1NTZ K;  3L75 G;  3CME P;  1NMI A;  3CCV P;  2A06 D;  4H0K A;  1ZOY C;  1CXA A;  5CIE B;  1LT9 C;  2PFX A;  3JSV C;  1C6R A;  5KLV D;  1E79 H;  1ZP0 C;  4AAN A;  1N2D C;  1YIC A;  2Y0E A;  1BGY D;  2N1T D;  1CRC A;  3V2P A;  2HG5 D;  3IF4 A;  1DII C;  1PP9 D;  2B88 A;  3L72 J;  1LP1 A;  2KSJ A;  1KV4 A;  1GU2 A;  4EIE A;  4XA4 A;  3CMA P;  3KZI V;  3L70 J;  2KZJ A;  4JPZ B;  1PL5 A;  1LTB C;  1GU4 A;  2I1K A;  1CSV A;  4ZKU A;  1KX7 A;  1SQQ K;  3OAK A;  4TT3 H;  2P7J A;  5CHX A;  3L75 J;  2H88 C;  3HD7 D;  3KXD A;  1SQP G;  4H13 C;  1NO4 A;  4MU8 A;  4D6T G;  3OA7 A;  3H1H G;  3GF7 A;  3HE4 A;  1YJ9 P;  4UB8 E;  1PIX A;  1HJB A;  4N6J A;  1SVF A;  1YTZ T;  1FI9 A;  1L4A D;  1LTS C;  1S2E A;  4WB4 A;  3H1I E;  2YO2 A;  5TIS H;  1FI3 A;  1COT A;  3HQ6 A;  3PXS A;  4AAO A;  2XU6 A;  1SQB E;  4EI2 A;  1M90 Q;  1GL2 A;  4WQ8 A;  1VQO P;  4UB6 E;  5DJT B;  4WQB A;  2CE0 A;  2FFD B;  4KMG A;  1C7M A;  3ITK A;  1KB9 E;  4H0L C;  3TGU E;  1SP4 A;  2PCC B;  3GG2 A;  1CRG A;  3GHG B;  5AW7 B;  1GU5 A;  1GQ1 A;  4DOJ A;  4YPC A;  3SXT A;  1X0T A;  2KLV A;  2KOG A;  1Q90 D;  1KYO I;  3H1J J;  1R0Q A;  5CCG C;  3FXE A;  3ZBM A;  2N1T A;  1SQP J;  1ETP A;  4LC1 A;  4D6T J;  1NKZ B;  4DCK A;  2QE7 H;  5APV A;  3A7O A;  2ZZS 1;  2HFE D;  1FHB A;  2WSC H;  1CHI A;  1H33 B;  3MHV A;  5AW8 B;  1ZW0 A;  3VYM A;  1YNR A;  1SS1 A;  3NXS A;  2CPS A;  3GF3 A;  2XNX A;  2WPV B;  2W6A A;  2FYN C;  2WTY A;  2BCC D;  2JP3 A;  3II6 A;  4U7J A;  4H0J A;  2KNC B;  2LXB A;  1OIP A;  1VQN P;  1HRC A;  3H1K E;  4GT1 A;  3S9O A;  3ZOX A;  1GD2 E;  2AXT V;  3CX5 H;  2OYI A;  3V6I A;  1KFM A;  1NTK K;  1S3J A;  2QJY C;  1L4A A;  1NU1 K;  1G2C A;  1E29 A;  2NPS B;  4IFD K;  4WY4 B;  3CD6 P;  5AW5 B;  1R8E A;  1QLE D;  5KAF V;  4Z1M H;  1CIE A;  4P4Q B;  2FFD C;  2AIU A;  2E42 A;  1MZ9 A;  1IK9 A;  1M1J A;  1LTA C;  1IJD B;  5GTH E;  3WFB C;  2V07 A;  4WQC A;  2ZAE B;  1GK6 A;  1FDO A;  1YI2 P;  4R4L A;  1PPJ D;  4U3F D;  1CO6 A;  1T3J A;  3VMY A;  1JDL A;  1L0L E;  5IY5 1;  1VF5 C;  2E74 C;  3L71 E;  1S9K E;  2V08 A;  2J59 M;  1JNM A;  3AE2 C;  1T8Z A;  3FWN A;  1QL2 A;  2W8Z A;  4K3A A;  1IO4 A;  1DW0 A;  2JQR A;  1QGK B;  2IBZ E;  1HH0 A;  2VHD A;  1DD4 A;  2YIU B;  2M5A B;  3PRJ A;  2WPR A;  2QJP C;  5KLV G;  2OYH B;  5AW3 B;  4N3Y B;  1LWU C;  1BGY G;  3IN6 A;  1HWT C;  3M9H A;  1NAY A;  1H0T A;  2KUB A;  2AXC A;  1SQX D;  3E7K A;  2CA3 B;  1W2B O;  1PP9 G;  3WUT A;  5CJ4 A;  2Q3I A;  1BE3 G;  4O1Q A;  1IRV A;  3WUI A;  3S1K A;  3LID A;  4NPF X;  1FZF A;  3DP5 A;  2BPB B;  4FAV A;  2IZ1 A;  1IFD A;  1AV1 A;  3SWF A;  3L70 E;  5DJQ C;  1OX3 A;  1Q82 Q;  4LJI A;  4KJM A;  4HB1 A;  1YEB A;  4FA1 A;  1YCC A;  2HV4 A;  2ZJS E;  4XFJ A;  1K8A Q;  5KLV J;  1HZU A;  1KV9 A;  3F5H A;  1BGY J;  3TF5 A;  1K3G A;  1DEE G;  1URQ B;  1AOF A;  1NML A;  1PP9 J;  1OW8 A;  2BEQ D;  1N73 B;  1ZLL A;  1BDD A;  1L0N G;  4Y28 J;  3P8C E;  1J3S A;  1P84 I;  1CRH A;  5KAI E;  3TDK A;  2P2U A;  3EFF K;  4H44 D;  1NTZ D;  3ZOO A;  451C A;  1SFC B;  2BLF B;  1PGO A;  5TIS V;  3AE6 C;  2ZXE B;  4XYD B;  2YKP A;  2LKM A;  1Q81 Q;  3PP5 A;  1VL2 A;  1QL4 A;  1RE4 C;  1AA0 A;  1JMM A;  3M0D C;  3B5N D;  2FXM A;  1X8Y A;  1YIJ P;  3RK2 B;  2Y0C A;  2B0Z B;  2JWA A;  4EIJ A;  1SQP E;  2E75 C;  3H32 B;  4D6T E;  4AAM A;  3H1H E;  2YNY A;  3MZW B;  1NKN A;  1M6Z A;  2IFN A;  2WPS A;  2ZON G;  2PP6 A;  5BVZ A;  1IQC A;  2BCC G;  1T2K C;  1FZC B;  2K1A A;  3RK3 D;  1HF9 A;  2C2C A;  5AVZ B;  1SQQ D;  2O01 H;  3CL3 D;  4JCG A;  3B71 A;  3ABV C;  2L91 A;  2HR3 A;  4PV1 D;  3L4O A;  2HPC A;  1NTM G;  2UWJ E;  3G71 P;  1EDI A;  4IFF A;  1GDT A;  2G3A A;  5EFW B;  1FJP A;  3Q2Y A;  4OGQ B;  1SQB K;  2Q3E A;  1N7S B;  1LTJ A;  2E76 C;  1SFC C;  5EXQ A;  1UII A;  3C8V A;  1ZRT E;  3BCC D;  3PTZ A;  1HJ3 A;  2R5B A;  4DZO A;  1S4X A;  1LP1 B;  4GOD A;  5B66 E;  3CWB E;  3CX5 D;  5CID B;  1QL3 A;  2OYH A;  1KB0 A;  2WVR A;  1PPJ G;  4U3F G;  3IR9 A;  2QJK C;  4B86 A;  2ORL A;  1FDI A;  2BCC J;  2C9X B;  2WSE J;  3RBZ A;  3BVH A;  3CCL P;  2M3B A;  3I55 P;  1JO5 A;  3B5N A;  1USD A;  1LFM A;  1L9B C;  1MV8 A;  3FWL A;  2R32 A;  1NNO A;  2DGE A;  3JCU E;  3NBT A;  3LIE A;  1DW1 A;  1EZV G;  1MKM A;  4UB8 H;  2W83 C;  1I55 A;  1FJ0 A;  2M8R A;  4C7R A;  2XTS B;  2KK7 A;  5CIH B;  1SQV D;  1KMI Z;  3CXH E;  3V2N A;  2I8D A;  3E1R A;  1NYH A;  3L37 A;  2ZYD A;  2GIW A;  2VRS A;  4UB6 H;  3TYY A;  4U3F J;  1P84 E;  5APS A;  1HGV A;  3G4S P;  2JEE A;  3HRN A;  1KB9 H;  1Q86 Q;  1DH3 A;  1AYG A;  2FKW B;  1NTK D;  1NU1 D;  2P67 A;  1N73 A;  1L2P A;  1NOH A;  2N1T B;  4PD4 D;  5AVV B;  3VTP C;  3KHU A;  4PJ0 V;  2N3B A;  3T97 A;  4R4M A;  4RO0 A;  3HUS A;  4WQA A;  1USE A;  2ZT9 D;  1L0L K;  2QIW A;  1RAP A;  3USS A;  3W68 A;  3QH9 A;  1S5L X;  1CHH A;  1YQ4 C;  3RL0 D;  1Y47 A;  2IPP A;  3AE9 C;  4JF7 A;  3HD7 B;  3Q5S A;  4JYB A;  3BRT B;  3AE3 C;  1RAQ A;  4RJT A;  3L74 E;  2BH5 X;  1I8O A;  5AW2 B;  1YJW P;  2OYI B;  5AVX B;  1NTZ G;  1ZR4 A;  5H2F E;  1L4A B;  4DJG A;  1G2C B;  1GL2 C;  1BE3 E;  1M56 D;  1CYJ A;  2XKM A;  2AEM A;  2N9B A;  3C9I A;  3CCJ P;  1G1J A;  1A56 A;  1RQU A;  3AEG C;  5AVR B;  5B5E E;  1M1J B;  1A8C A;  4GOE A;  5AUR A;  1EZV I;  5GTH H;  1KFN A;  5APW A;  5AVT B;  3WC8 A;  1KD1 Q;  5APT A;  2KS1 B;  1BCC D;  4YXD C;  3A5T A;  3A0H E;  1N7S A;  4N78 E;  2JDI H;  3VN0 A;  5KJ7 D;  3CYT I;  2D2C C;  1YIT P;  3H1L D;  1RHZ B;  1PZQ A;  3P8M C;  1LT1 A;  1SQQ G;  3HQ7 A;  4IFM A;  4ASW A;  5K5G B;  2WMM A;  3B4S A;  3CU4 A;  1NTZ J;  1L0N E;  4Y99 B;  4Y5R A;  3H25 A;  2DVH A;  2EXV A;  3PJS K;  1MFT A;  2FWL A;  3EFG A;  2FYU D;  3PXW A;  3H1J G;  4WQ7 A;  3U1C A;  1HTL C;  1XTC C;  3A2A A;  2LIR A;  3L73 D;  2BGV X;  1A02 F;  5GTI E;  2OYI C;  1H0T B;  1OZH A;  1D7M A;  3KDP B;  4GKG A;  2L4D A;  2FYZ A;  5APQ A;  5AVS B;  2C1D B;  1NWQ A;  5AVU B;  3C2C A;  1R5S A;  3HTK A;  3U1A A;  1DW3 A;  1KIL D;  2OGU A;  1FOS E;  3A0B E;  2A45 G;  4H13 D;  1SQQ J;  2FRC A;  2WSC J;  1SQP K;  1LGH B;  1HZV A;  2KSE A;  1GTW A;  2ZBO A;  2Q5U A;  1LC1 A;  1S5L E;  3G9R A;  1NTM E;  1Q7Y Q;  3CC4 P;  2FXP A;  4GYD A;  1CZQ A;  2JR8 A;  5KJ7 A;  1SQV G;  3VMZ A;  1HH7 A;  1RE3 A;  5KAF E;  3M9Q A;  2JJL A;  3AE5 C;  4I2L C;  4JBZ A;  1GJQ A;  1VPC A;  1OW6 A;  3CX5 W;  4RSZ A;  2WIT A;  5E79 V;  5KAI H;  2M3E A;  4UB8 V;  2C9L Y;  2B4Z A;  2WPQ A;  3AEE C;  5CCG D;  3H1I D;  1PPJ E;  2ZXX A;  4U3F E;  1KX2 A;  3VMA A;  2QM7 A;  3SSU A;  4PWA A;  3A3Y B;  5KKZ B;  3HD7 A;  1WMK A;  2KIK A;  1Z56 A;  1SQB D;  3K5B A;  3L4M A;  4HKZ H;  1CIF A;  1J1E B;  2LIT A;  2Q6Q A;  3GLM A;  1MG3 D;  1JB0 J;  2AI5 A;  3M91 A;  1SLQ A;  2YQB A;  1KB9 D;  4JYC A;  3TGU D;  1EZV E;  1IC2 A;  3AEA C; 
#chains in the Genus database with same CATH homology
 1J3S A;  1CRJ A;  1N9C A;  1KIB A;  3TYI A;  1CRH A;  1CIG A;  3TDK A;  3L74 D;  3RMZ A;  1NTZ D;  3ZOO A;  451C A;  1COR A;  2BLF B;  2B10 B;  5H2F V;  2O3J A;  1E8E A;  5TIS V;  5B66 V;  1BE3 D;  2CXB A;  4XYD B;  2KS1 A;  1CSU A;  1YIQ A;  1QL4 A;  3DR0 A;  5B6Q A;  1KYO W;  1OAE A;  5B5E V;  3MK7 C;  1FOC A;  4EDF A;  2GC7 D;  2Y0C A;  2B0Z B;  4QAO A;  4EID A;  3JBT B;  4AX3 A;  2JWA A;  1YFC A;  3OCD A;  4AAM A;  3RN1 A;  3OA8 A;  1M6Z A;  2N9J A;  2FYN B;  1CYI A;  1OCD A;  1WEJ F;  3A0H V;  2ZON G;  1DIQ C;  5CYT R;  2MTA C;  4FA9 A;  2D0W A;  2BH4 X;  4NFG B;  4V2K A;  1IQC A;  2MHM A;  1U74 B;  5DFS A;  2C2C A;  1N15 A;  4Q5P A;  1SQQ D;  4FB1 A;  4JCG A;  1IZL 0;  2CA4 B;  2QJY B;  2L91 A;  155C A;  3L4O A;  1L0N D;  3SLE A;  1IO3 A;  1N90 A;  1C75 A;  1W5C T;  2C1D A;  1U75 B;  3CXH W;  4AAL A;  5CIF B;  2PAC A;  3RN0 A;  3A9F A;  2ZXY A;  2Q3E A;  1H31 A;  5GTI V;  3NWV A;  1I6E A;  5EXQ A;  1W2L A;  1E2R A;  1CSW A;  3BCC D;  3PTZ A;  1EB7 A;  1HJ3 A;  1A2S A;  1C6O A;  1L0L D;  3CX5 D;  4WQD A;  5CID B;  1FI7 A;  3L71 D;  1CSX A;  1QL3 A;  5C0Z A;  1KB0 A;  1AKK A;  2D0S A;  2ORL A;  4N0K A;  3HQ9 A;  3ZOY A;  4FAN A;  2C9X B;  4EIC A;  351C A;  1NMI A;  2PCB B;  2A06 D;  1DT1 A;  3A0B V;  1CXA A;  4H0K A;  5DF5 A;  2IBZ D;  3SVW A;  5CIE B;  2JTI B;  4J20 A;  4UB6 V;  1C6R A;  1LFM A;  1CCR A;  1I8P A;  1L9B C;  5KLV D;  1ZZH A;  4AAN A;  3FWL A;  1YIC A;  2RN0 A;  2Y0E A;  1NNO A;  2DGE A;  1BGY D;  3NBT A;  2QJP B;  3PHL A;  1M70 A;  1CRC A;  1DW1 A;  1I55 A;  1M60 A;  1S5L V;  1FJ0 A;  1NTM D;  1DII C;  1PP9 D;  3WFC C;  2XTS B;  2K9J B;  1GU2 A;  5CIH B;  1SQV D;  4EIE A;  3KZI V;  1AOQ A;  3VRD A;  3CP5 A;  2GIW A;  5TJH A;  3RLM A;  1CED A;  3PLN A;  1CSV A;  1DVV A;  3O5C A;  3SWS A;  1QKS A;  1KX7 A;  1MZ4 A;  3WFE C;  3L70 D;  2C8S A;  2YK3 A;  2ZOO A;  5C9M A;  1AYG A;  1CRI A;  3ZCF A;  1NTK D;  4MU8 A;  5DJQ B;  1NU1 D;  2RMZ A;  1FI9 A;  3H1K D;  1CTJ A;  4PD4 D;  3KHU A;  2I8F A;  4PJ0 V;  3WFD C;  1FI3 A;  2N3B A;  1COT A;  3HQ6 A;  3PXS A;  4AAO A;  2N18 B;  4WQA A;  4PW9 B;  5CIG B;  3ORV A;  4WQ8 A;  1RAP A;  1EZV D;  4WQB A;  3SJL A;  1MG2 D;  2CE0 A;  4KMG A;  1C7M A;  3ITK A;  1H9X A;  1CHH A;  2C1V A;  2PCC B;  3GG2 A;  1CRG A;  2YCC A;  3WU2 V;  5GTH V;  3M97 X;  1GQ1 A;  1C6S A;  3SXT A;  3GW6 A;  1RAQ A;  4RJT A;  1I54 A;  2BH5 X;  1I8O A;  1R0Q A;  3ZBM A;  1CTZ A;  1CIH A;  1ETP A;  2GB8 B;  3PH2 B;  1H32 B;  1CYJ A;  2ZZS 1;  4XXL A;  1FHB A;  3MK7 B;  1CHI A;  1A56 A;  1H33 B;  4D6T D;  3H1H D;  3VYM A;  1A8C A;  1YNR A;  1CC5 A;  2C1U A;  5AUR A;  2BCC D;  3WC8 A;  4H0J A;  2KNC B;  5CIC B;  1GIW A;  1BCC D;  1N50 A;  1HRC A;  1C2N A;  4O1W A;  3ZOX A;  1CYC A;  1GDV A;  3ZIY A;  2AXT V;  2B11 B;  3CYT I;  2N3Y A;  3H1L D;  3O0R C;  4WQ9 A;  3ZOW A;  4L1Q A;  3X39 A;  1E29 A;  4EIF A;  3HQ7 A;  1CNO A;  1H32 A;  5CIB B;  1WVE C;  3CU4 A;  1K3H A;  1RZ6 A;  5KAF V;  1CIE A;  4P4Q B;  4Y5R A;  3L72 D;  1HJ4 A;  2DVH A;  1NIR A;  4GED B;  4WQE A;  2N9Y B;  1H33 A;  2EXV A;  2AIU A;  1HCM A;  2FWL A;  2FYU D;  3PXW A;  1CRY A;  1LMS A;  1ZRT D;  4WQ7 A;  3WFB C;  2LIR A;  1KYO D;  3L73 D;  1CCH A;  2BGV X;  3CWB D;  4DY9 A;  2N9I A;  2V07 A;  4WQC A;  2B12 B;  2L4D A;  1PPJ D;  4U3F D;  1CO6 A;  1JDL A;  3L75 D;  5IY5 1;  2C1D B;  2V08 A;  4YE1 A;  1S6V B;  2QJK B;  5KLI B;  1B7V A;  3C2C A;  2QG4 A;  2Y0D A;  1DW3 A;  1H31 B;  1H9Y A;  2OZ1 B;  4A7P A;  2BCN B;  1DW0 A;  2JQR A;  2VHD A;  2YIU B;  2FRC A;  1LS9 A;  1CHJ A;  3PRJ A;  1FCD C;  3HQ8 A;  5KAI V;  1CXC A;  1HRO A;  3NBS A;  1RZ5 A;  3PXT A;  1C2R A;  3VNW A;  1GKS A;  1HZV A;  2ZBO A;  1DW2 A;  3CXH D;  1SQX D;  4FA4 A;  1LC1 A;  3DMI A;  2CA3 B;  3O20 A;  4GYD A;  3O1Y A;  1CTY A;  1I5T A;  1HH7 A;  3H1J D;  1IRW A;  1L9J C;  4O1Q A;  1IRV A;  1P84 D;  1GJQ A;  3WUI A;  1I6D A;  1SQP D;  3DP5 A;  2BPB B;  2OZ1 A;  1QN2 A;  3CX5 W;  4RSZ A;  4FAV A;  4K3I A;  1F1C A;  5E79 V;  1BL9 A;  4UB8 V;  5DJQ C;  2B4Z A;  4LJI A;  4FA5 A;  2CE1 A;  1YEB A;  1H1O A;  4FA1 A;  3H1I D;  1YCC A;  1VYD A;  2HV4 A;  1LC2 A;  1KX2 A;  3VMA A;  1HJ5 A;  4IL6 V;  4L3H A;  4PWA A;  5KKZ B;  1SQB D;  1YEA A;  1HZU A;  3L4M A;  1DVH A;  1YTC A;  1CIF A;  1F1F A;  1KV9 A;  3TF5 A;  2N18 C;  1C52 A;  2LIT A;  2GC4 D;  3OCD B;  1K3G A;  1MG3 D;  3OA8 B;  1QYZ A;  2AI5 A;  1AOF A;  1NML A;  2YQB A;  1KB9 D;  3TGU D;  4L3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...