2QJPC

Crystal structure of wild type rhodobacter sphaeroides with stigmatellin and antimycin inhibited
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
molecule keywords Cytochrome b
total genus 46
structure length 179
sequence length 179
chains with identical sequence F, I, L
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qjpC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qjpC02
2QJYC 1BCCE 4NBGD 2ZT9D 4H13B 2NUMA 4RKUJ 2GBXA 1SQXE 3TGUE 4IL6X 2QJKC 1ULIA 4H44B 2QIWA 1RFSA 3GL0A 1ULJA 1NTZE 4NBCD 1FQTA 4NBDD 3L71E 1JB0J 2BMOA 2NVGA 1ZRTE 2HMOA 1O7MA 2XRXA 1VCKA 3AZCA 2WSFJ 1NYKA 5KLVE 3GKEA 4PV1D 4QDFA 1O7HA 2YIUC 2NVEA 3L73E 4HM4A 1RIEA 1NTME 1PPJE 1EZVE 2WPVB 2IBZE 2QJPC 2BMQA 1SQBE 1O7GA 4QUQA 2CKFA 3L72E 3EQQA 4HM8A 4AAYB 1VF5D 2D2CB 2HMNA 2HMLA 4AIVA 4EMJB 5KKZC 2E74D 5L8RJ 2XSHA 4HJLA 4NBAD 3VMID 4NB9D 1Q90D 1KYOE 4QDDA 3VCPA 2O01J 4OGQD 4QURA 3GL2A 4OGQB 2BMRA 4Y28J 3GOBA 3DQYA 1PP9E 4HM6A 4H0LD 1SQQE 2DE5D 4H0LB 2WSEJ 2A06E 3CX5E 2YFIA 4QCKA 1L0LE 3GZXA 1BE3E 3BCCE 4QDCA 4H44D 4HKVA 2FYNC 3LW5J 2HMMA 1O7NA 2E76B 2B24A 2ZYLA 2NVFA 2WSCJ 1UUWA 3D89A 2HMKA 2E4PA 2XSOA 4HM0A 2E74B 2B1XA 3VMGD 2E75B 5AEUA 4PV1B 2NUKA 2BCCE 3FOUA 3GTSA 2YVJB 1SQVE 1SQPE 4HM3A 2E4QA 1O7WA 3L70E 3L74E 1NU1E 3VCAA 5KLIC 1NTKE 3H1IE 3VMHD 2FYUE 2GBWA 1O7PA 2QPZA 1VF5B 1P84E 2JZAA 5HL4A 1JM1A 2YFJA 2E75D 5BOKA 2Q3WA 3H1JE 2JO6A 4NBBD 5CXMA 3GZYA 1G8KB 1UUVA 2D2CD 1NDOA 2I7FA 2YFLA 4HM7A 1SJGA 3N0QA 4NBED 4H13D 2XR8A 3H1LE 1KB9E 4PD4E 3EN1A 3H1KE 4KT0J 4I7ZB 4QUPA 3GTEA 1L0NE 1WQLA 4P1CH 2E76D 3C0DA 4P1BH 4QDFB 2QSIA 3C8VA 1G8JB 4NB8D 2NWFA 3CXHE 5AEWA 2K9YA 2HMJA 3GB4A 1EG9A 2DE6D 3H1HE 2DE7D 4HM2A 2ZT9B 1Q90C 4U3FE 1S5LX 3CWBE 3L75E 4HM5A 3GCEA 4NBFD 1VM9A 4HM1A 4NBHD
chains in the Genus database with same CATH superfamily
1BCCE 1GMJA 3GHGC 1ULIA 1M1JA 4NPEA 2A45H 1NTMD 5CCHC 1GD2E 4TT3H 3L72G 3FXEA 2XRXA 1GZLA 4MN4C 2ZFCA 2SPZA 3L73E 2FBWC 1PGOA 3AEBC 2J5UA 3CPWO 3L72E 2W6AA 1PP9G 5KAFH 2FFDC 5H2FE 5L8RJ 1PGPA 2GUVA 2B87B 3CWBD 2C9NY 2HR3A 2WSEJ 3ZDMA 1T2KD 3GZXA 1LGHB 1N7LA 1OZHA 1EDKA 4CPGA 3S9OA 3LW5J 3H1IJ 1BE3D 4PJ0E 2XSOA 1X8YA 3P8CE 3GF7A 1NKNA 4L73A 5GTHH 2M3EA 1SQBG 5B5EE 3VMHD 4JBZA 5HL4A 1IFIA 3V4WA 1YJNP 5CCHA 5AVQB 3V5BA 2Q3WA 3AEDC 3RGUA 1N86A 3P8CD 2YFLA 3VP9A 2QEXP 3KYQA 1VQNP 2Y9YA 2HYNA 2ZYAA 1QVGO 4IL6H 3MUDC 1SQXD 3CX5D 1RF1C 1N2DC 1S5LX 3L73G 2Y9ZA 3RK3C 2ZT9D 2KSJA 3PLNA 2NUMA 3IAOA 2KI7B 3PTZA 2YNYA 3AEFC 2W83C 2HODA 2QIWA 2Q7CA 2KSEA 4EI2A 2YKPA 2K88A 3L73D 2AEFA 1PGQA 4JYCA 2FYNB 1T2KC 3L71D 3MD0A 1NTME 4WY4A 2KIKA 4EYYQ 1OW8A 2G3AA 1Q90D 3VCPA 3AE5C 3EWKA 1BCCD 4ZKUA 3L75D 4PJ0H 4C46A 1HJBA 2YIUB 3N4XA 3CXHD 3KXDA 2OARA 2RKLA 1UUWA 3D89A 1ZP0C 5AW2B 2E75B 1VQ5P 2BCCE 2YVJB 1SQPE 1RY3A 3V2QA 1O7WA 2KS1B 5KLIC 2JZAA 3TSIA 2LR2A 4OH8B 4WY4C 3I5CA 5C39A 3LIDA 1NDOA 3HE5A 2FXOA 1Q86Q 1WRGA 1NTZG 1HF9A 3NFQA 2BEZF 1LTGC 1KC8Q 3CMEP 2HG5D 2XU6A 3W68A 2Q5UA 1OVUA 1NAFA 1SFCB 3VMAA 5BU5A 1IK9A 1LTIC 2B9BA 1L4AA 4W7ZA 1KILC 2V7QH 3ABVC 1NTZE 3WMM0 3CCSP 2Y0EA 4WY4B 1FJPA 5APTA 4IOIH 1NYKA 1YIJP 1KTMA 4HH2A 4HM8A 5AVSB 4AYCA 2ZXXA 2HMNA 4AIVA 2FYUK 2P2UA 3U59A 2E75C 4EIJA 3MGNA 3P7KA 2R3CA 1JY3N 2O1JA 1FDMA 1G2CA 1KB9I 4D6TD 1FBMA 1KN7A 3BCCE 4H44D 4GODA 2HMMA 5CCGD 1FDIA 3L70G 2YXQB 2QA4P 2KS1A 3KZIH 1VQ7P 1KILD 2JDIH 3FX0A 4I7ZC 3GTSA 1JY3P 1VQLP 1ZLLA 1LTBC 4D6TJ 3RK3E 1OW6A 3H6PA 2IYPA 5GTIE 1X22A 3QWOC 1YYCA 1KD1Q 5KLVD 2OYHA 3L75J 5CCGC 3IN6A 2B89A 1HGZA 1KB9E 5KLVK 5KAIE 3L71G 2E76D 5CHXA 1GK6A 1PP9D 2PP6A 2N1TA 3OW2O 2C0WA 4WVZA 1CI6A 3W67A 2IDBA 3LIEA 4DOJA 4RKUJ 2GBXA 1SQXE 3PRJA 3B5NA 1IJDB 3MHVA 3H1LD 2E42A 1SLQA 4QMAA 1ZRTD 1Q7YQ 1NTZD 1NYHA 1PGJA 1JCCA 1X79B 3TK1A 2WSSH 2BEQD 1GL2A 1J1DC 4NB9D 3G71P 1AA0A 1NTMJ 3L74G 3VN0A 4AQRD 3GOBA 3P32A 1KILE 3H1HD 2YFIA 4QDCA 1EQ7A 2HFED 3BCCD 5CCHD 1XTCC 3AE2C 2B1XA 1SQVE 1EZVG 1JY2P 3CWBJ 2E43A 3RK3B 1P84E 1KORA 1JCDA 1BGYJ 1KQGB 2JO6A 5B66H 2IZ0A 4WWIA 1HVVA 2O01H 2FY8A 2YMYA 2PRRA 4O9BA 1L0NE 4KJMA 1KILA 4EOTA 1NTMK 4D6TG 1VQ6P 1SQBK 1Q90C 2XNDH 3A0HH 4HM5A 4U7JA 3Q1MA 3HE4A 2QJYC 4ASWA 2NPSA 4LGDE 1KYOD 4NBGD 5AW6B 2I8DA 1SP4A 1E79H 4H13B 2Q1KA 1WT6A 3TGUJ 1GDTA 3D6ZA 2BMOA 4L76A 2AEJA 3CX5I 1VL2A 1GU5A 1JMBA 4HB1A 2ZT9C 1DEEG 3RL0g 2MJZA 4OWFA 1SQQJ 2LXBA 4RO0A 3VMID 1PP9J 3WUUA 2QJKB 1S5LE 4Y28J 3RK2B 3WU2E 1H8AA 2FKWB 5APYA 3H1KG 1BGYD 3MZWB 3RBZA 2A45I 1G1JA 1K04A 3U1AA 5AVVB 4W7YA 1FZCB 2NUKA 1JOCA 3FOUA 1OIPA 1AVYA 2E4QA 1NTZJ 2IFMA 5EFWB 1GL2B 2W6BA 4DCKA 1R8EA 2H89C 1NAYA 3ITKA 3JSVC 1GL2C 3CX5H 2IYOA 2W8ZA 1L0NK 4N6JA 4KT0J 3GB4A 2K9JA 1EG9A 3GCEA 2YMKA 1Y8AA 3B5NC 3V4QA 1QVFO 3HTKB 1S4XA 3HD7A 5M1BA 1LT9A 3A7OA 3CCMP 2Y0CA 1ULJA 1IFMA 3AE8C 1IFJA 2WSCH 5BU8B 5AW9B 3D6YA 1RE4A 5APVA 2ZAEB 2WITA 1BCCJ 2JP3A 4HM4A 1RIEA 4Z1MH 2HMLA 2E74D 2VRSA 2O1KA 3AE4C 4GOEA 1J1DB 5E79H 3DQYA 1ZN5A 3H25A 1JY2O 1NKZB 3M91A 1N73B 1S9KE 1FJKA 1OMIA 3H1KD 1SQQG 2M5AB 3VMGD 4PV1B 1USEA 1N7SD 3L71J 1UIXA 3L70E 3H1IE 4DJGA 2UWJE 1O7PA 2KXPB 3G9RA 1SQBD 2W90A 5BOKA 5AW7B 1NTKD 1YITP 1G2CB 3GZYA 3L70D 3H1KJ 3V2RA 3WUTA 2Y0DA 2C9LY 3AEGC 4H44C 1EDIA 3T97B 2ZXEB 1L4AB 2OGUA 2AEMA 4IFDK 2DW3A 2KLVA 2ZT9B 5AVTB 2P58A 5KJ7C 4NBFD 3A0HE 2POHA 4NBHD 1L4AC 1A02F 1FE6A 2WTYA 3HD7C 3HRNA 2KNCA 1HUCA 2WT7B 1NTMG 1PL5A 4KHXA 3D70A 3L37A 1JMMA 3RL0C 1VCKA 1SFCC 1J2JB 2NPSC 4QUQA 3GMAA 3TGUD 1P84D 1NHLA 1MFTA 2C0XA 2YO2A 3FXDA 1S3JA 3EFFK 2FYUJ 3VP8A 3CCJP 4GIFA 1NTKJ 2FXPA 3B8EB 3NMDA 3O8ZA 2HMKA 4R4LA 3F89A 2OYHB 1KQSO 1BE3G 2PAJA 1FS0E 5APUA 3VCAA 1H89A 1VQ8P 1TU3F 1LP1B 3CCLP 5APQA 1M1KQ 2D2CD 1HH0A 3UIAA 3M0DC 3TGUG 2KZIA 2WT7A 2XR8A 2NPSD 1JTHB 2OYIA 1X0TA 4QDFB 3C8VA 1D7MA 3A5TA 4UB6H 2KNCB 2BASA 2B87A 2OTJP 2IFNA 5KLIB 2L91A 2KOGA 3H1JG 3RBXA 1M57D 1R5SA 1FAVA 2HPCA 1JNMA 1O7HA 3PJSK 2NVEA 4YPCA 3F5HA 3H1HJ 1KYOI 3RK3D 4EMJB 3GF3A 3Q2YA 3L4FA 2Z4EA 1P84H 1KQLA 1FOSF 4HM6A 4H0LB 1ZV8A 1KFNA 1W5CE 1KZUB 1N7SC 1RQVA 1VQMP 2E76B 4AUWA 3RK2C 1SQQD 2BCCJ 2E4PA 5AW3B 1G1IA 1QL2A 2JEEA 2R3SA 3L74E 3CC4P 3BATA 3WUVA 4DZOA 1SVFA 3AE3C 1FU1A 1IC2A 1EZVD 1N73A 5CXMA 5GTHE 4NBED 3A0BE 2KZJA 3HD7B 1ZXGA 1K05A 1U7MA 4H13C 2OYIC 2XZRA 3U1CA 4P1CH 2QJYB 3C0DA 3VMZA 2FFDB 1Q2NA 5KJ7A 2KB7P 2K9YA 4HM2A 4U3FE 1LWUA 3M0DA 1NO4A 3I55P 2KYVA 4WBAA 1IK7A 1VQKP 3L73J 5H2FH 3O6QA 1ZR2A 1Z56A 4K35A 5AW5B 1QX8A 2JKVA 1L0LG 2H43A 3AE1C 1NU1J 3PHLA 1VQPP 4TLFA 4NBDD 3HTKA 2ZYDA 2P10A 1Q82Q 2WPVB 4N3YB 3SFEC 2AXTE 1J1EB 1AFOA 2QE7H 3HUSC 1R5LA 5GTIH 1PP9E 4H0LD 1DH3A 1URQD 5AVZB 5KLVG 3GW6A 4NPDA 4A7PA 2GM4A 1RF1B 3EFGA 5DJUB 2QG4A 5APXA 1M8OB 3SSUA 4YTPC 2WPRA 1DIPA 4K3AA 2RN0A 1LTJB 1BSHA 4GKGA 1VF5B 1RE4C 2YKOA 4C7RA 3SWFA 2M8RA 3S4RA 3P8MC 3AECC 1UUVA 1SQPK 2JO1A 2FYZA 5AVUB 3G3ZA 2JR8A 2GUSA 3M0AA 4DT0A 2YO3A 3H1LG 4QUPA 3H1JJ 2ZYGA 1VPCA 1LP1A 3B5NB 3O6QB 4NB8D 4D6TE 3WU2H 2DE6D 3L70J 2GA1A 3CC7P 5E79E 1BDDA 3CCRP 3HUSB 1NGMB 2XNXA 3IR9A 4JYBA 1FQTA 1OWAA 3AZCA 2HMOA 4IL6E 4W80A 4OVNF 3BRTB 1LTJA 3HE4B 1OW7A 4GDOA 2Q6QA 1AVOA 2JWDA 1NTKG 1RH5B 3RL0B 4AAYB 2FFDA 2KLUA 1KILB 4NBAD 4HJLA 4QDDA 2O01J 4QURA 3GL2A 3SWYA 2CPBA 1EZVI 3CCQP 5BVZA 4EDFA 2FYNC 1CSBA 3JCUE 2KUBA 1U57A 3MP7B 2W27A 2B24A 2ZVNB 2NVFA 1IZNB 3GHGA 5APSA 3BCCG 1VQOP 2ZJSE 1NJIQ 3AE6C 4I2LC 3H32A 4WB4A 3R2PA 4RESB 3AEAC 1W2BO 1T3UA 3L74D 1IFDA 3S1KA 3AEEC 1LTAC 2BCCD 2I7FA 1OVVA 1LT1A 1FZEA 1PZQA 3NXSA 3L75G 1BSNA 1SFCD 1AQ5A 1J1EC 2L5GB 1M56D 2OQQA 1S72P 1FDOA 1VM9A 1VF5C 3AE7C 4ZMDA 3E7KA 4I6MC 1JTHA 1SQXJ 4N78D 3GL0A 4PD4D 3BASA 1LWUB 2NVGA 2WQYC 2IX7C 1SQXK 2IBZE 3H1JD 3TYYA 3I56P 2V4HA 4PD4H 5KKZC 1SQXG 3FWLA 1PPJG 2QM8A 2JWAA 5TISH 2N1TD 1FC2C 1FZFA 3CX5E 2A06E 5TISE 2A06G 3MIWA 1ZMEC 1S9KD 3HE5B 1LTTC 3Q5RA 3CCEP 2E74B 4UB8H 3IF4A 5DJTB 3KQGA 2K1AA 1NU1E 3PP5A 2GBWA 1L4AD 1QEXA 1PFIA 1JM1A 1M7LA 2YFJA 3EQ2A 4XFJA 3M9HA 1OFCX 1PPJD 1H0TA 2QRXA 2HPCB 4XA4A 3Q5SA 1URQB 3MUDA 2P1JA 1WQLA 2I1JA 2N1TC 2D2CC 3VMXA 5AEWA 3NTNA 3CWBE 1SS1A 1ZOYC 4IFFA 3TNUA 1AQTA 1BCCG 2NZ2A 1W2EA 4HM1A 1S2EA 2XV5A 4LC1A 3T97A 3TGUE 5AVYB 2QJKC 2K3RA 3L72D 3CD6P 3BRVB 4ZKPA 3CI9A 1UIIA 4M3LA 1OXZA 3OJAB 1O7MA 1JY3O 2WSFJ 1N7SB 3GKEA 4PV1D 2H7HA 2YIUC 1K73Q 2NPSB 4H0LC 1S1CX 1L0NJ 1O7GA 1URQA 1LTJC 4OGQC 3A2AA 2G8YA 3AE9C 1KYOE 1NU1D 3CXHI 4YXDC 2BMRA 1EXJA 1T8ZA 3M9BA 5CJ0A 4HKVA 1BGYE 3RL0D 1N7SA 2N9BA 1S5LH 2R5DA 2LKMA 3B71A 1LTSC 3C9IA 1NTKE 1HGVA 3K5BA 2I1KA 3B5ND 3CWBG 3TF5A 2IBZD 3H1JE 4BRYA 1HTLC 2OYOA 2O01N 2WPQA 1P84I 1SQQK 1LT9C 1LJ2A 3N0QA 2HODB 4H13D 4PD4E 3EN1A 1YTZT 1KYOH 1FZBA 1SQVG 1GL2D 3V2NA 1L0LD 2H8PD 5KLVJ 3H1HE 2DE7D 4HKZH 1DEBA 3R4YA 1WMKA 1KB9H 1JEKA 1KV4A 1RF0C 4U3FG 2CPSA 1NOHA 2A45G 1EDJA 1BE3J 1VDFA 2IPPA 1L0LJ 2AXCA 1SQVJ 2Z5IA 3RK2D 4UB6E 2B88A 2CK3H 1IO4A 2J58A 3II6A 1EZVE 3EQQA 1KFMA 1JM0A 3H1LJ 3CXHH 1NWQA 2ITAA 3M06A 4I1LA 1SQVD 4GOFA 1USDA 2WWWA 2DE5D 2R5BA 4QCKA 1SQVK 1Q81Q 5CBOA 3KPEA 1L0NG 2YKQA 2WSCJ 2P7JA 5CCGA 2N1TB 3CC2P 2OYHC 5B5EH 5KAFE 2FYUE 1NU1K 2QPZA 5KTBA 5AW0B 3SWKA 4NBBD 1N73C 3PH0A 1RE3C 1YJ9P 2RMZA 5AW4B 4ASVA 4HM7A 2WVRA 2XKMA 4HYTB 1EXIA 2V7QJ 3H1LE 1HWTC 4JQ0D 3VTPC 3Q5PA 3CLQA 4P1BH 1LT9B 3V6IA 1DX7A 1RHZB 2QVAA 3VMYA 1VQ4P 3VOPA 2WSFH 2NRGA 4OGQD 4LLHA 2ZVOB 3E1IA 2XDJA 4PV1C 1RFSA 2IZ1A 2Q3IA 4NBCD 1KB9D 2KK7A 1K8AQ 2E76C 3BVHA 3TNUB 5KLVE 3JC22 1OX3A 2P67A 1JY2N 2Z5HA 1M1JB 2QJPC 2OYIB 1ZR4A 3KHUA 2E5YA 2BCCG 2XSHA 2FYUD 5AW8B 4BRYB 4BWNA 4JPZB 2J59M 4OGQB 1QLED 2M0BA 2YXRB 1T6AA 1M90Q 1Y9BA 2HLOA 1Y47A 1RE3A 4RJTA 3B4SA 1L0ND 1HJ0A 1AV1A 1H88A 2R44A 4XE5B 3L74J 3CL3D 1FZGA 3HD7D 1YQ4C 5KAIH 1YBKA 1H0TB 3A3YB 2E75D 1JO5A 4GT1A 1PIXA 1CW5A 1G8KB 1SQPD 1OVRA 2E5TA 4Y99B 1VQ9P 5AVXB 3GG2A 4U3FJ 3GHGB 3GTEA 1NU1G 3CXHE 2FXMA 3VYIA 5AVWB 3L75E 1HBWA 1SQPJ 1A02J 4L74A 5CBNA 4BXLA 1RQUA 4U3FD 1XTGB 1LWUC 2M3BA 4C7NA 1LNQA 4H44B 2OTLP 3M9QA 3G4SP 3L71E 1JB0J 1CZQA 1ZRTE 1YI2P 3E1RA 5B66E 1MZ9A 3SFDC 2WMMA 2LXCB 4YXWH 4C7NB 1GK4A 1U7JA 1SQPG 1ZW0A 2WSEH 1DD3A 1SQBE 2H88C 2IBZG 2CKFA 1NTKK 1QL1A 1VF5D 3V2PA 1IFPA 2O3JA 4R4MA 4ZNCA 5CMZA 2PFXA 1SQQE 2WZ7A 1BDCA 1YQ3C 2KP8A 3H32B 1O7NA 2ZYLA 3Q3DA 2PGDA 1FZCC 2RH0A 2K9JB 4HM3A 3KDPB 2AXTH 1M1JC 2QJPB 1YHQP 1FZCA 1YJWP 3LW5H 1MKMA 2WPSA 3JCUH 1BGYG 1EC5A 4IFMA 1QGKB 5TJHA 3GLMA 4I7ZB 1KMIZ 1SQBJ 1GTWA 4Y99C 2M5AA 1G8JB 1MUUA 3CCUP 1MFZA 4B86A 1L0LK 2QM7A 2HMJA 3L72J 3KZIE 1IFNA 3A0BH 2FYUG 1RF0A 4IL6X 1L2PA 1DD4A 1CI6B 3IFMA 2Q3EA 3C1LA 1T3JA 5KKZB 3BCCJ 1EDLA 3HUSA 1K9MQ 2W6JH 3N7NA 4QDFA 1KQFB 3FWNA 1PPJE 3G6EP 1GW3A 2IBZI 5APWA 2BMQA 3H1IG 5CJ4A 3FGAD 1GW4A 3CMAP 2D2CB 2JJLA 5KJ7D 2N9YB 3L36A 3MTUE 2E74C 1N8RQ 5AVRB 1NVOA 3L35A 1MV8A 1PV3A 2R32A 4UB8E 1L0LE 1BE3E 1NTZK 3USSA 1YTZI 2OTKE 2A06D 4HM0A 5AEUA 1X9VA 2Q9IA 1E5WA 1NH4A 4PD4I 1FZAA 2MKVA 1AJYA 5AW1B 2K37A 3H1ID 3TDKA 4NPFX 1SJGA 1SFCA 3OA7A 3H1HG 1FOSE 1GU4A 3D71A 1URQC 3H1KE 4N78E 1JUNA 2QSIA 3QH9A 2NWFA 4HJGH 4JF7A 4WY4D 1RF1A 4L75A 3CCVP 5K5GB 3OAKA
chains in the Genus database with same CATH topology
3O6QA 2QJYC 1BCCE 4NBGD 1GMJA 4H13B 1ULIA 3AE1C 3D6ZA 4NBDD 4TT3H 2BMOA 2XRXA 2P10A 3L73E 2FBWC 3AEBC 1VL2A 1EZVE 2WPVB 3SFEC 2ZT9C 2J5UA 3L72E 3EQQA 3RL0g 5L8RJ 3VMID 4Y28J 1PP9E 4H0LD 2DE5D 4QCKA 2WSEJ 3GZXA 3S9OA 3LW5J 2WSCJ 2XSOA 1K04A 4YTPC 2NUKA 3GF7A 1DIPA 3FOUA 2E4QA 3VMHD 2FYUE 2QPZA 1VF5B 1R8EA 5HL4A 2H89C 2Q3WA 4NBBD 3AEDC 3AECC 1UUVA 2JO1A 2YFLA 4HM7A 1EXIA 2V7QJ 3H1LE 4KT0J 3Q5PA 4QUPA 4P1BH 4NB8D 3GB4A 1EG9A 2DE6D 1S5LX 3GCEA 2YMKA 4OGQD 2ZT9D 2NUMA 3IAOA 5M1BA 3AEFC 4PV1C 2QIWA 1RFSA 1ULJA 1NGMB 3AE8C 4NBCD 1FQTA 2E76C 2HMOA 3AZCA 3D6YA 5KLVE 2JP3A 1OW7A 4HM4A 1RIEA 4GDOA 1NTME 4Z1MH 2QJPC 4AAYB 1OW8A 2HMLA 2G3AA 2E74D 2XSHA 4NBAD 4HJLA 3AE4C 1Q90D 4QDDA 3AE5C 3VCPA 2O01J 3EWKA 4QURA 3GL2A 4OGQB 3DQYA 3H25A 1Y9BA 2FYNC 1HJ0A 1U57A 2B24A 1OMIA 2NVFA 1UUWA 3D89A 1ZP0C 3VMGD 2E75B 4PV1B 2BCCE 2YVJB 1SQPE 1UIXA 1O7WA 3L70E 3AE6C 1YQ4C 5KLIC 3H1IE 1O7PA 2JZAA 3G9RA 2E75D 5BOKA 1PIXA 3AEAC 3GZYA 1G8KB 3AEEC 1NDOA 2I7FA 3AEGC 4H44C 3T97B 3GTEA 1HF9A 3CXHE 2BEZF 2OQQA 2ZT9B 1FDOA 3L75E 4NBFD 1VM9A 1VF5C 4NBHD 3AE7C 1RQUA 4H44B 3GL0A 3ABVC 1NTZE 1PL5A 3L71E 1JB0J 3D70A 2NVGA 1ZRTE 1VCKA 1NYKA 3SFDC 2WQYC 1KTMA 2IBZE 1DD3A 2H88C 4QUQA 1SQBE 2CKFA 3GMAA 4HM8A 1VF5D 2HMNA 4AIVA 5KKZC 4R4MA 1WMKA 2E75C 1SQQE 3CX5E 2A06E 3BCCE 4H44D 1YQ3C 2HMMA 1O7NA 1ZMEC 1FDIA 2FXPA 2ZYLA 3Q3DA 3Q5RA 2HMKA 4R4LA 2E74B 4I7ZC 3GTSA 4HM3A 1NU1E 3VCAA 1TU3F 2GBWA 3RK3E 1OW6A 1JM1A 2YFJA 1MKMA 4XFJA 2D2CD 3IN6A 3Q5SA 2XR8A 3GLMA 1KB9E 4I7ZB 1KMIZ 1WQLA 2E76D 4QDFB 3C8VA 1G8JB 2D2CC 5AEWA 2HMJA 3CWBE 1ZOYC 2NZ2A 4HM1A 2IDBA 4RKUJ 2GBXA 1SQXE 3TGUE 4IL6X 1DD4A 2QJKC 1O7MA 2WSFJ 3GKEA 4PV1D 4QDFA 1O7HA 2YIUC 2NVEA 1KQFB 1NYHA 1PPJE 4H0LC 1S1CX 2BMQA 1O7GA 3FGAD 4OGQC 2D2CB 4EMJB 3GF3A 2BEQD 2G8YA 3AE9C 4NB9D 3Q2YA 1KYOE 2E74C 4YXDC 2BMRA 3GOBA 1PV3A 4HM6A 1KILE 1EXJA 4H0LB 2YFIA 1L0LE 1BE3E 4QDCA 4HKVA 1RQVA 2E76B 4HM0A 2E4PA 3AE2C 2B1XA 5AEUA 3B71A 1SQVE 3L74E 1NTKE 2MKVA 1AJYA 1P84E 3AE3C 1KORA 3H1JE 1KQGB 2JO6A 5CXMA 1SJGA 3N0QA 4NBED 4H13D 3D71A 4PD4E 3EN1A 3H1KE 1K05A 4H13C 1L0NE 4P1CH 3C0DA 2QSIA 2NWFA 2K9YA 4HM2A 3H1HE 4U3FE 2DE7D 1Q90C 4HM5A 1IK7A 4U7JA 3Q1MA 3R4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJY C;  1BCC E;  4NBG D;  2ZT9 D;  4H13 B;  2NUM A;  4RKU J;  2GBX A;  1SQX E;  3TGU E;  4IL6 X;  2QJK C;  1ULI A;  4H44 B;  2QIW A;  1RFS A;  3GL0 A;  1ULJ A;  1NTZ E;  4NBC D;  1FQT A;  4NBD D;  3L71 E;  1JB0 J;  2BMO A;  2NVG A;  1ZRT E;  2HMO A;  1O7M A;  2XRX A;  1VCK A;  3AZC A;  2WSF J;  1NYK A;  5KLV E;  3GKE A;  4PV1 D;  4QDF A;  1O7H A;  2YIU C;  2NVE A;  3L73 E;  4HM4 A;  1RIE A;  1NTM E;  1PPJ E;  1EZV E;  2WPV B;  2IBZ E;  2QJP C;  2BMQ A;  1SQB E;  1O7G A;  4QUQ A;  2CKF A;  3L72 E;  3EQQ A;  4HM8 A;  4AAY B;  1VF5 D;  2D2C B;  2HMN A;  2HML A;  4AIV A;  4EMJ B;  5KKZ C;  2E74 D;  5L8R J;  2XSH A;  4HJL A;  4NBA D;  3VMI D;  4NB9 D;  1Q90 D;  1KYO E;  4QDD A;  3VCP A;  2O01 J;  4OGQ D;  4QUR A;  3GL2 A;  4OGQ B;  2BMR A;  4Y28 J;  3GOB A;  3DQY A;  1PP9 E;  4HM6 A;  4H0L D;  1SQQ E;  2DE5 D;  4H0L B;  2WSE J;  2A06 E;  3CX5 E;  2YFI A;  4QCK A;  1L0L E;  3GZX A;  1BE3 E;  3BCC E;  4QDC A;  4H44 D;  4HKV A;  2FYN C;  3LW5 J;  2HMM A;  1O7N A;  2E76 B;  2B24 A;  2ZYL A;  2NVF A;  2WSC J;  1UUW A;  3D89 A;  2HMK A;  2E4P A;  2XSO A;  4HM0 A;  2E74 B;  2B1X A;  3VMG D;  2E75 B;  5AEU A;  4PV1 B;  2NUK A;  2BCC E;  3FOU A;  3GTS A;  2YVJ B;  1SQV E;  1SQP E;  4HM3 A;  2E4Q A;  1O7W A;  3L70 E;  3L74 E;  1NU1 E;  3VCA A;  5KLI C;  1NTK E;  3H1I E;  3VMH D;  2FYU E;  2GBW A;  1O7P A;  2QPZ A;  1VF5 B;  1P84 E;  2JZA A;  5HL4 A;  1JM1 A;  2YFJ A;  2E75 D;  5BOK A;  2Q3W A;  3H1J E;  2JO6 A;  4NBB D;  5CXM A;  3GZY A;  1G8K B;  1UUV A;  2D2C D;  1NDO A;  2I7F A;  2YFL A;  4HM7 A;  1SJG A;  3N0Q A;  4NBE D;  4H13 D;  2XR8 A;  3H1L E;  1KB9 E;  4PD4 E;  3EN1 A;  3H1K E;  4KT0 J;  4I7Z B;  4QUP A;  3GTE A;  1L0N E;  1WQL A;  4P1C H;  2E76 D;  3C0D A;  4P1B H;  4QDF B;  2QSI A;  3C8V A;  1G8J B;  4NB8 D;  2NWF A;  3CXH E;  5AEW A;  2K9Y A;  2HMJ A;  3GB4 A;  1EG9 A;  2DE6 D;  3H1H E;  2DE7 D;  4HM2 A;  2ZT9 B;  1Q90 C;  4U3F E;  1S5L X;  3CWB E;  3L75 E;  4HM5 A;  3GCE A;  4NBF D;  1VM9 A;  4HM1 A;  4NBH D; 
#chains in the Genus database with same CATH topology
 1BCC E;  1GMJ A;  3GHG C;  1ULI A;  1M1J A;  4NPE A;  2A45 H;  1NTM D;  5CCH C;  1GD2 E;  4TT3 H;  3L72 G;  3FXE A;  2XRX A;  1GZL A;  4MN4 C;  2ZFC A;  2SPZ A;  3L73 E;  2FBW C;  1PGO A;  3AEB C;  2J5U A;  3CPW O;  3L72 E;  2W6A A;  1PP9 G;  5KAF H;  2FFD C;  5H2F E;  5L8R J;  1PGP A;  2GUV A;  2B87 B;  3CWB D;  2C9N Y;  2HR3 A;  2WSE J;  3ZDM A;  1T2K D;  3GZX A;  1LGH B;  1N7L A;  1OZH A;  1EDK A;  4CPG A;  3S9O A;  3LW5 J;  3H1I J;  1BE3 D;  4PJ0 E;  2XSO A;  1X8Y A;  3P8C E;  3GF7 A;  1NKN A;  4L73 A;  5GTH H;  2M3E A;  1SQB G;  5B5E E;  3VMH D;  4JBZ A;  5HL4 A;  1IFI A;  3V4W A;  1YJN P;  5CCH A;  5AVQ B;  3V5B A;  2Q3W A;  3AED C;  3RGU A;  1N86 A;  3P8C D;  2YFL A;  3VP9 A;  2QEX P;  3KYQ A;  1VQN P;  2Y9Y A;  2HYN A;  2ZYA A;  1QVG O;  4IL6 H;  3MUD C;  1SQX D;  3CX5 D;  1RF1 C;  1N2D C;  1S5L X;  3L73 G;  2Y9Z A;  3RK3 C;  2ZT9 D;  2KSJ A;  3PLN A;  2NUM A;  3IAO A;  2KI7 B;  3PTZ A;  2YNY A;  3AEF C;  2W83 C;  2HOD A;  2QIW A;  2Q7C A;  2KSE A;  4EI2 A;  2YKP A;  2K88 A;  3L73 D;  2AEF A;  1PGQ A;  4JYC A;  2FYN B;  1T2K C;  3L71 D;  3MD0 A;  1NTM E;  4WY4 A;  2KIK A;  4EYY Q;  1OW8 A;  2G3A A;  1Q90 D;  3VCP A;  3AE5 C;  3EWK A;  1BCC D;  4ZKU A;  3L75 D;  4PJ0 H;  4C46 A;  1HJB A;  2YIU B;  3N4X A;  3CXH D;  3KXD A;  2OAR A;  2RKL A;  1UUW A;  3D89 A;  1ZP0 C;  5AW2 B;  2E75 B;  1VQ5 P;  2BCC E;  2YVJ B;  1SQP E;  1RY3 A;  3V2Q A;  1O7W A;  2KS1 B;  5KLI C;  2JZA A;  3TSI A;  2LR2 A;  4OH8 B;  4WY4 C;  3I5C A;  5C39 A;  3LID A;  1NDO A;  3HE5 A;  2FXO A;  1Q86 Q;  1WRG A;  1NTZ G;  1HF9 A;  3NFQ A;  2BEZ F;  1LTG C;  1KC8 Q;  3CME P;  2HG5 D;  2XU6 A;  3W68 A;  2Q5U A;  1OVU A;  1NAF A;  1SFC B;  3VMA A;  5BU5 A;  1IK9 A;  1LTI C;  2B9B A;  1L4A A;  4W7Z A;  1KIL C;  2V7Q H;  3ABV C;  1NTZ E;  3WMM 0;  3CCS P;  2Y0E A;  4WY4 B;  1FJP A;  5APT A;  4IOI H;  1NYK A;  1YIJ P;  1KTM A;  4HH2 A;  4HM8 A;  5AVS B;  4AYC A;  2ZXX A;  2HMN A;  4AIV A;  2FYU K;  2P2U A;  3U59 A;  2E75 C;  4EIJ A;  3MGN A;  3P7K A;  2R3C A;  1JY3 N;  2O1J A;  1FDM A;  1G2C A;  1KB9 I;  4D6T D;  1FBM A;  1KN7 A;  3BCC E;  4H44 D;  4GOD A;  2HMM A;  5CCG D;  1FDI A;  3L70 G;  2YXQ B;  2QA4 P;  2KS1 A;  3KZI H;  1VQ7 P;  1KIL D;  2JDI H;  3FX0 A;  4I7Z C;  3GTS A;  1JY3 P;  1VQL P;  1ZLL A;  1LTB C;  4D6T J;  3RK3 E;  1OW6 A;  3H6P A;  2IYP A;  5GTI E;  1X22 A;  3QWO C;  1YYC A;  1KD1 Q;  5KLV D;  2OYH A;  3L75 J;  5CCG C;  3IN6 A;  2B89 A;  1HGZ A;  1KB9 E;  5KLV K;  5KAI E;  3L71 G;  2E76 D;  5CHX A;  1GK6 A;  1PP9 D;  2PP6 A;  2N1T A;  3OW2 O;  2C0W A;  4WVZ A;  1CI6 A;  3W67 A;  2IDB A;  3LIE A;  4DOJ A;  4RKU J;  2GBX A;  1SQX E;  3PRJ A;  3B5N A;  1IJD B;  3MHV A;  3H1L D;  2E42 A;  1SLQ A;  4QMA A;  1ZRT D;  1Q7Y Q;  1NTZ D;  1NYH A;  1PGJ A;  1JCC A;  1X79 B;  3TK1 A;  2WSS H;  2BEQ D;  1GL2 A;  1J1D C;  4NB9 D;  3G71 P;  1AA0 A;  1NTM J;  3L74 G;  3VN0 A;  4AQR D;  3GOB A;  3P32 A;  1KIL E;  3H1H D;  2YFI A;  4QDC A;  1EQ7 A;  2HFE D;  3BCC D;  5CCH D;  1XTC C;  3AE2 C;  2B1X A;  1SQV E;  1EZV G;  1JY2 P;  3CWB J;  2E43 A;  3RK3 B;  1P84 E;  1KOR A;  1JCD A;  1BGY J;  1KQG B;  2JO6 A;  5B66 H;  2IZ0 A;  4WWI A;  1HVV A;  2O01 H;  2FY8 A;  2YMY A;  2PRR A;  4O9B A;  1L0N E;  4KJM A;  1KIL A;  4EOT A;  1NTM K;  4D6T G;  1VQ6 P;  1SQB K;  1Q90 C;  2XND H;  3A0H H;  4HM5 A;  4U7J A;  3Q1M A;  3HE4 A;  2QJY C;  4ASW A;  2NPS A;  4LGD E;  1KYO D;  4NBG D;  5AW6 B;  2I8D A;  1SP4 A;  1E79 H;  4H13 B;  2Q1K A;  1WT6 A;  3TGU J;  1GDT A;  3D6Z A;  2BMO A;  4L76 A;  2AEJ A;  3CX5 I;  1VL2 A;  1GU5 A;  1JMB A;  4HB1 A;  2ZT9 C;  1DEE G;  3RL0 g;  2MJZ A;  4OWF A;  1SQQ J;  2LXB A;  4RO0 A;  3VMI D;  1PP9 J;  3WUU A;  2QJK B;  1S5L E;  4Y28 J;  3RK2 B;  3WU2 E;  1H8A A;  2FKW B;  5APY A;  3H1K G;  1BGY D;  3MZW B;  3RBZ A;  2A45 I;  1G1J A;  1K04 A;  3U1A A;  5AVV B;  4W7Y A;  1FZC B;  2NUK A;  1JOC A;  3FOU A;  1OIP A;  1AVY A;  2E4Q A;  1NTZ J;  2IFM A;  5EFW B;  1GL2 B;  2W6B A;  4DCK A;  1R8E A;  2H89 C;  1NAY A;  3ITK A;  3JSV C;  1GL2 C;  3CX5 H;  2IYO A;  2W8Z A;  1L0N K;  4N6J A;  4KT0 J;  3GB4 A;  2K9J A;  1EG9 A;  3GCE A;  2YMK A;  1Y8A A;  3B5N C;  3V4Q A;  1QVF O;  3HTK B;  1S4X A;  3HD7 A;  5M1B A;  1LT9 A;  3A7O A;  3CCM P;  2Y0C A;  1ULJ A;  1IFM A;  3AE8 C;  1IFJ A;  2WSC H;  5BU8 B;  5AW9 B;  3D6Y A;  1RE4 A;  5APV A;  2ZAE B;  2WIT A;  1BCC J;  2JP3 A;  4HM4 A;  1RIE A;  4Z1M H;  2HML A;  2E74 D;  2VRS A;  2O1K A;  3AE4 C;  4GOE A;  1J1D B;  5E79 H;  3DQY A;  1ZN5 A;  3H25 A;  1JY2 O;  1NKZ B;  3M91 A;  1N73 B;  1S9K E;  1FJK A;  1OMI A;  3H1K D;  1SQQ G;  2M5A B;  3VMG D;  4PV1 B;  1USE A;  1N7S D;  3L71 J;  1UIX A;  3L70 E;  3H1I E;  4DJG A;  2UWJ E;  1O7P A;  2KXP B;  3G9R A;  1SQB D;  2W90 A;  5BOK A;  5AW7 B;  1NTK D;  1YIT P;  1G2C B;  3GZY A;  3L70 D;  3H1K J;  3V2R A;  3WUT A;  2Y0D A;  2C9L Y;  3AEG C;  4H44 C;  1EDI A;  3T97 B;  2ZXE B;  1L4A B;  2OGU A;  2AEM A;  4IFD K;  2DW3 A;  2KLV A;  2ZT9 B;  5AVT B;  2P58 A;  5KJ7 C;  4NBF D;  3A0H E;  2POH A;  4NBH D;  1L4A C;  1A02 F;  1FE6 A;  2WTY A;  3HD7 C;  3HRN A;  2KNC A;  1HUC A;  2WT7 B;  1NTM G;  1PL5 A;  4KHX A;  3D70 A;  3L37 A;  1JMM A;  3RL0 C;  1VCK A;  1SFC C;  1J2J B;  2NPS C;  4QUQ A;  3GMA A;  3TGU D;  1P84 D;  1NHL A;  1MFT A;  2C0X A;  2YO2 A;  3FXD A;  1S3J A;  3EFF K;  2FYU J;  3VP8 A;  3CCJ P;  4GIF A;  1NTK J;  2FXP A;  3B8E B;  3NMD A;  3O8Z A;  2HMK A;  4R4L A;  3F89 A;  2OYH B;  1KQS O;  1BE3 G;  2PAJ A;  1FS0 E;  5APU A;  3VCA A;  1H89 A;  1VQ8 P;  1TU3 F;  1LP1 B;  3CCL P;  5APQ A;  1M1K Q;  2D2C D;  1HH0 A;  3UIA A;  3M0D C;  3TGU G;  2KZI A;  2WT7 A;  2XR8 A;  2NPS D;  1JTH B;  2OYI A;  1X0T A;  4QDF B;  3C8V A;  1D7M A;  3A5T A;  4UB6 H;  2KNC B;  2BAS A;  2B87 A;  2OTJ P;  2IFN A;  5KLI B;  2L91 A;  2KOG A;  3H1J G;  3RBX A;  1M57 D;  1R5S A;  1FAV A;  2HPC A;  1JNM A;  1O7H A;  3PJS K;  2NVE A;  4YPC A;  3F5H A;  3H1H J;  1KYO I;  3RK3 D;  4EMJ B;  3GF3 A;  3Q2Y A;  3L4F A;  2Z4E A;  1P84 H;  1KQL A;  1FOS F;  4HM6 A;  4H0L B;  1ZV8 A;  1KFN A;  1W5C E;  1KZU B;  1N7S C;  1RQV A;  1VQM P;  2E76 B;  4AUW A;  3RK2 C;  1SQQ D;  2BCC J;  2E4P A;  5AW3 B;  1G1I A;  1QL2 A;  2JEE A;  2R3S A;  3L74 E;  3CC4 P;  3BAT A;  3WUV A;  4DZO A;  1SVF A;  3AE3 C;  1FU1 A;  1IC2 A;  1EZV D;  1N73 A;  5CXM A;  5GTH E;  4NBE D;  3A0B E;  2KZJ A;  3HD7 B;  1ZXG A;  1K05 A;  1U7M A;  4H13 C;  2OYI C;  2XZR A;  3U1C A;  4P1C H;  2QJY B;  3C0D A;  3VMZ A;  2FFD B;  1Q2N A;  5KJ7 A;  2KB7 P;  2K9Y A;  4HM2 A;  4U3F E;  1LWU A;  3M0D A;  1NO4 A;  3I55 P;  2KYV A;  4WBA A;  1IK7 A;  1VQK P;  3L73 J;  5H2F H;  3O6Q A;  1ZR2 A;  1Z56 A;  4K35 A;  5AW5 B;  1QX8 A;  2JKV A;  1L0L G;  2H43 A;  3AE1 C;  1NU1 J;  3PHL A;  1VQP P;  4TLF A;  4NBD D;  3HTK A;  2ZYD A;  2P10 A;  1Q82 Q;  2WPV B;  4N3Y B;  3SFE C;  2AXT E;  1J1E B;  1AFO A;  2QE7 H;  3HUS C;  1R5L A;  5GTI H;  1PP9 E;  4H0L D;  1DH3 A;  1URQ D;  5AVZ B;  5KLV G;  3GW6 A;  4NPD A;  4A7P A;  2GM4 A;  1RF1 B;  3EFG A;  5DJU B;  2QG4 A;  5APX A;  1M8O B;  3SSU A;  4YTP C;  2WPR A;  1DIP A;  4K3A A;  2RN0 A;  1LTJ B;  1BSH A;  4GKG A;  1VF5 B;  1RE4 C;  2YKO A;  4C7R A;  3SWF A;  2M8R A;  3S4R A;  3P8M C;  3AEC C;  1UUV A;  1SQP K;  2JO1 A;  2FYZ A;  5AVU B;  3G3Z A;  2JR8 A;  2GUS A;  3M0A A;  4DT0 A;  2YO3 A;  3H1L G;  4QUP A;  3H1J J;  2ZYG A;  1VPC A;  1LP1 A;  3B5N B;  3O6Q B;  4NB8 D;  4D6T E;  3WU2 H;  2DE6 D;  3L70 J;  2GA1 A;  3CC7 P;  5E79 E;  1BDD A;  3CCR P;  3HUS B;  1NGM B;  2XNX A;  3IR9 A;  4JYB A;  1FQT A;  1OWA A;  3AZC A;  2HMO A;  4IL6 E;  4W80 A;  4OVN F;  3BRT B;  1LTJ A;  3HE4 B;  1OW7 A;  4GDO A;  2Q6Q A;  1AVO A;  2JWD A;  1NTK G;  1RH5 B;  3RL0 B;  4AAY B;  2FFD A;  2KLU A;  1KIL B;  4NBA D;  4HJL A;  4QDD A;  2O01 J;  4QUR A;  3GL2 A;  3SWY A;  2CPB A;  1EZV I;  3CCQ P;  5BVZ A;  4EDF A;  2FYN C;  1CSB A;  3JCU E;  2KUB A;  1U57 A;  3MP7 B;  2W27 A;  2B24 A;  2ZVN B;  2NVF A;  1IZN B;  3GHG A;  5APS A;  3BCC G;  1VQO P;  2ZJS E;  1NJI Q;  3AE6 C;  4I2L C;  3H32 A;  4WB4 A;  3R2P A;  4RES B;  3AEA C;  1W2B O;  1T3U A;  3L74 D;  1IFD A;  3S1K A;  3AEE C;  1LTA C;  2BCC D;  2I7F A;  1OVV A;  1LT1 A;  1FZE A;  1PZQ A;  3NXS A;  3L75 G;  1BSN A;  1SFC D;  1AQ5 A;  1J1E C;  2L5G B;  1M56 D;  2OQQ A;  1S72 P;  1FDO A;  1VM9 A;  1VF5 C;  3AE7 C;  4ZMD A;  3E7K A;  4I6M C;  1JTH A;  1SQX J;  4N78 D;  3GL0 A;  4PD4 D;  3BAS A;  1LWU B;  2NVG A;  2WQY C;  2IX7 C;  1SQX K;  2IBZ E;  3H1J D;  3TYY A;  3I56 P;  2V4H A;  4PD4 H;  5KKZ C;  1SQX G;  3FWL A;  1PPJ G;  2QM8 A;  2JWA A;  5TIS H;  2N1T D;  1FC2 C;  1FZF A;  3CX5 E;  2A06 E;  5TIS E;  2A06 G;  3MIW A;  1ZME C;  1S9K D;  3HE5 B;  1LTT C;  3Q5R A;  3CCE P;  2E74 B;  4UB8 H;  3IF4 A;  5DJT B;  3KQG A;  2K1A A;  1NU1 E;  3PP5 A;  2GBW A;  1L4A D;  1QEX A;  1PFI A;  1JM1 A;  1M7L A;  2YFJ A;  3EQ2 A;  4XFJ A;  3M9H A;  1OFC X;  1PPJ D;  1H0T A;  2QRX A;  2HPC B;  4XA4 A;  3Q5S A;  1URQ B;  3MUD A;  2P1J A;  1WQL A;  2I1J A;  2N1T C;  2D2C C;  3VMX A;  5AEW A;  3NTN A;  3CWB E;  1SS1 A;  1ZOY C;  4IFF A;  3TNU A;  1AQT A;  1BCC G;  2NZ2 A;  1W2E A;  4HM1 A;  1S2E A;  2XV5 A;  4LC1 A;  3T97 A;  3TGU E;  5AVY B;  2QJK C;  2K3R A;  3L72 D;  3CD6 P;  3BRV B;  4ZKP A;  3CI9 A;  1UII A;  4M3L A;  1OXZ A;  3OJA B;  1O7M A;  1JY3 O;  2WSF J;  1N7S B;  3GKE A;  4PV1 D;  2H7H A;  2YIU C;  1K73 Q;  2NPS B;  4H0L C;  1S1C X;  1L0N J;  1O7G A;  1URQ A;  1LTJ C;  4OGQ C;  3A2A A;  2G8Y A;  3AE9 C;  1KYO E;  1NU1 D;  3CXH I;  4YXD C;  2BMR A;  1EXJ A;  1T8Z A;  3M9B A;  5CJ0 A;  4HKV A;  1BGY E;  3RL0 D;  1N7S A;  2N9B A;  1S5L H;  2R5D A;  2LKM A;  3B71 A;  1LTS C;  3C9I A;  1NTK E;  1HGV A;  3K5B A;  2I1K A;  3B5N D;  3CWB G;  3TF5 A;  2IBZ D;  3H1J E;  4BRY A;  1HTL C;  2OYO A;  2O01 N;  2WPQ A;  1P84 I;  1SQQ K;  1LT9 C;  1LJ2 A;  3N0Q A;  2HOD B;  4H13 D;  4PD4 E;  3EN1 A;  1YTZ T;  1KYO H;  1FZB A;  1SQV G;  1GL2 D;  3V2N A;  1L0L D;  2H8P D;  5KLV J;  3H1H E;  2DE7 D;  4HKZ H;  1DEB A;  3R4Y A;  1WMK A;  1KB9 H;  1JEK A;  1KV4 A;  1RF0 C;  4U3F G;  2CPS A;  1NOH A;  2A45 G;  1EDJ A;  1BE3 J;  1VDF A;  2IPP A;  1L0L J;  2AXC A;  1SQV J;  2Z5I A;  3RK2 D;  4UB6 E;  2B88 A;  2CK3 H;  1IO4 A;  2J58 A;  3II6 A;  1EZV E;  3EQQ A;  1KFM A;  1JM0 A;  3H1L J;  3CXH H;  1NWQ A;  2ITA A;  3M06 A;  4I1L A;  1SQV D;  4GOF A;  1USD A;  2WWW A;  2DE5 D;  2R5B A;  4QCK A;  1SQV K;  1Q81 Q;  5CBO A;  3KPE A;  1L0N G;  2YKQ A;  2WSC J;  2P7J A;  5CCG A;  2N1T B;  3CC2 P;  2OYH C;  5B5E H;  5KAF E;  2FYU E;  1NU1 K;  2QPZ A;  5KTB A;  5AW0 B;  3SWK A;  4NBB D;  1N73 C;  3PH0 A;  1RE3 C;  1YJ9 P;  2RMZ A;  5AW4 B;  4ASV A;  4HM7 A;  2WVR A;  2XKM A;  4HYT B;  1EXI A;  2V7Q J;  3H1L E;  1HWT C;  4JQ0 D;  3VTP C;  3Q5P A;  3CLQ A;  4P1B H;  1LT9 B;  3V6I A;  1DX7 A;  1RHZ B;  2QVA A;  3VMY A;  1VQ4 P;  3VOP A;  2WSF H;  2NRG A;  4OGQ D;  4LLH A;  2ZVO B;  3E1I A;  2XDJ A;  4PV1 C;  1RFS A;  2IZ1 A;  2Q3I A;  4NBC D;  1KB9 D;  2KK7 A;  1K8A Q;  2E76 C;  3BVH A;  3TNU B;  5KLV E;  3JC2 2;  1OX3 A;  2P67 A;  1JY2 N;  2Z5H A;  1M1J B;  2QJP C;  2OYI B;  1ZR4 A;  3KHU A;  2E5Y A;  2BCC G;  2XSH A;  2FYU D;  5AW8 B;  4BRY B;  4BWN A;  4JPZ B;  2J59 M;  4OGQ B;  1QLE D;  2M0B A;  2YXR B;  1T6A A;  1M90 Q;  1Y9B A;  2HLO A;  1Y47 A;  1RE3 A;  4RJT A;  3B4S A;  1L0N D;  1HJ0 A;  1AV1 A;  1H88 A;  2R44 A;  4XE5 B;  3L74 J;  3CL3 D;  1FZG A;  3HD7 D;  1YQ4 C;  5KAI H;  1YBK A;  1H0T B;  3A3Y B;  2E75 D;  1JO5 A;  4GT1 A;  1PIX A;  1CW5 A;  1G8K B;  1SQP D;  1OVR A;  2E5T A;  4Y99 B;  1VQ9 P;  5AVX B;  3GG2 A;  4U3F J;  3GHG B;  3GTE A;  1NU1 G;  3CXH E;  2FXM A;  3VYI A;  5AVW B;  3L75 E;  1HBW A;  1SQP J;  1A02 J;  4L74 A;  5CBN A;  4BXL A;  1RQU A;  4U3F D;  1XTG B;  1LWU C;  2M3B A;  4C7N A;  1LNQ A;  4H44 B;  2OTL P;  3M9Q A;  3G4S P;  3L71 E;  1JB0 J;  1CZQ A;  1ZRT E;  1YI2 P;  3E1R A;  5B66 E;  1MZ9 A;  3SFD C;  2WMM A;  2LXC B;  4YXW H;  4C7N B;  1GK4 A;  1U7J A;  1SQP G;  1ZW0 A;  2WSE H;  1DD3 A;  1SQB E;  2H88 C;  2IBZ G;  2CKF A;  1NTK K;  1QL1 A;  1VF5 D;  3V2P A;  1IFP A;  2O3J A;  4R4M A;  4ZNC A;  5CMZ A;  2PFX A;  1SQQ E;  2WZ7 A;  1BDC A;  1YQ3 C;  2KP8 A;  3H32 B;  1O7N A;  2ZYL A;  3Q3D A;  2PGD A;  1FZC C;  2RH0 A;  2K9J B;  4HM3 A;  3KDP B;  2AXT H;  1M1J C;  2QJP B;  1YHQ P;  1FZC A;  1YJW P;  3LW5 H;  1MKM A;  2WPS A;  3JCU H;  1BGY G;  1EC5 A;  4IFM A;  1QGK B;  5TJH A;  3GLM A;  4I7Z B;  1KMI Z;  1SQB J;  1GTW A;  4Y99 C;  2M5A A;  1G8J B;  1MUU A;  3CCU P;  1MFZ A;  4B86 A;  1L0L K;  2QM7 A;  2HMJ A;  3L72 J;  3KZI E;  1IFN A;  3A0B H;  2FYU G;  1RF0 A;  4IL6 X;  1L2P A;  1DD4 A;  1CI6 B;  3IFM A;  2Q3E A;  3C1L A;  1T3J A;  5KKZ B;  3BCC J;  1EDL A;  3HUS A;  1K9M Q;  2W6J H;  3N7N A;  4QDF A;  1KQF B;  3FWN A;  1PPJ E;  3G6E P;  1GW3 A;  2IBZ I;  5APW A;  2BMQ A;  3H1I G;  5CJ4 A;  3FGA D;  1GW4 A;  3CMA P;  2D2C B;  2JJL A;  5KJ7 D;  2N9Y B;  3L36 A;  3MTU E;  2E74 C;  1N8R Q;  5AVR B;  1NVO A;  3L35 A;  1MV8 A;  1PV3 A;  2R32 A;  4UB8 E;  1L0L E;  1BE3 E;  1NTZ K;  3USS A;  1YTZ I;  2OTK E;  2A06 D;  4HM0 A;  5AEU A;  1X9V A;  2Q9I A;  1E5W A;  1NH4 A;  4PD4 I;  1FZA A;  2MKV A;  1AJY A;  5AW1 B;  2K37 A;  3H1I D;  3TDK A;  4NPF X;  1SJG A;  1SFC A;  3OA7 A;  3H1H G;  1FOS E;  1GU4 A;  3D71 A;  1URQ C;  3H1K E;  4N78 E;  1JUN A;  2QSI A;  3QH9 A;  2NWF A;  4HJG H;  4JF7 A;  4WY4 D;  1RF1 A;  4L75 A;  3CCV P;  5K5G B;  3OAK A; 
#chains in the Genus database with same CATH homology
 3O6Q A;  2QJY C;  1BCC E;  4NBG D;  1GMJ A;  4H13 B;  1ULI A;  3AE1 C;  3D6Z A;  4NBD D;  4TT3 H;  2BMO A;  2XRX A;  2P10 A;  3L73 E;  2FBW C;  3AEB C;  1VL2 A;  1EZV E;  2WPV B;  3SFE C;  2ZT9 C;  2J5U A;  3L72 E;  3EQQ A;  3RL0 g;  5L8R J;  3VMI D;  4Y28 J;  1PP9 E;  4H0L D;  2DE5 D;  4QCK A;  2WSE J;  3GZX A;  3S9O A;  3LW5 J;  2WSC J;  2XSO A;  1K04 A;  4YTP C;  2NUK A;  3GF7 A;  1DIP A;  3FOU A;  2E4Q A;  3VMH D;  2FYU E;  2QPZ A;  1VF5 B;  1R8E A;  5HL4 A;  2H89 C;  2Q3W A;  4NBB D;  3AED C;  3AEC C;  1UUV A;  2JO1 A;  2YFL A;  4HM7 A;  1EXI A;  2V7Q J;  3H1L E;  4KT0 J;  3Q5P A;  4QUP A;  4P1B H;  4NB8 D;  3GB4 A;  1EG9 A;  2DE6 D;  1S5L X;  3GCE A;  2YMK A;  4OGQ D;  2ZT9 D;  2NUM A;  3IAO A;  5M1B A;  3AEF C;  4PV1 C;  2QIW A;  1RFS A;  1ULJ A;  1NGM B;  3AE8 C;  4NBC D;  1FQT A;  2E76 C;  2HMO A;  3AZC A;  3D6Y A;  5KLV E;  2JP3 A;  1OW7 A;  4HM4 A;  1RIE A;  4GDO A;  1NTM E;  4Z1M H;  2QJP C;  4AAY B;  1OW8 A;  2HML A;  2G3A A;  2E74 D;  2XSH A;  4NBA D;  4HJL A;  3AE4 C;  1Q90 D;  4QDD A;  3AE5 C;  3VCP A;  2O01 J;  3EWK A;  4QUR A;  3GL2 A;  4OGQ B;  3DQY A;  3H25 A;  1Y9B A;  2FYN C;  1HJ0 A;  1U57 A;  2B24 A;  1OMI A;  2NVF A;  1UUW A;  3D89 A;  1ZP0 C;  3VMG D;  2E75 B;  4PV1 B;  2BCC E;  2YVJ B;  1SQP E;  1UIX A;  1O7W A;  3L70 E;  3AE6 C;  1YQ4 C;  5KLI C;  3H1I E;  1O7P A;  2JZA A;  3G9R A;  2E75 D;  5BOK A;  1PIX A;  3AEA C;  3GZY A;  1G8K B;  3AEE C;  1NDO A;  2I7F A;  3AEG C;  4H44 C;  3T97 B;  3GTE A;  1HF9 A;  3CXH E;  2BEZ F;  2OQQ A;  2ZT9 B;  1FDO A;  3L75 E;  4NBF D;  1VM9 A;  1VF5 C;  4NBH D;  3AE7 C;  1RQU A;  4H44 B;  3GL0 A;  3ABV C;  1NTZ E;  1PL5 A;  3L71 E;  1JB0 J;  3D70 A;  2NVG A;  1ZRT E;  1VCK A;  1NYK A;  3SFD C;  2WQY C;  1KTM A;  2IBZ E;  1DD3 A;  2H88 C;  4QUQ A;  1SQB E;  2CKF A;  3GMA A;  4HM8 A;  1VF5 D;  2HMN A;  4AIV A;  5KKZ C;  4R4M A;  1WMK A;  2E75 C;  1SQQ E;  3CX5 E;  2A06 E;  3BCC E;  4H44 D;  1YQ3 C;  2HMM A;  1O7N A;  1ZME C;  1FDI A;  2FXP A;  2ZYL A;  3Q3D A;  3Q5R A;  2HMK A;  4R4L A;  2E74 B;  4I7Z C;  3GTS A;  4HM3 A;  1NU1 E;  3VCA A;  1TU3 F;  2GBW A;  3RK3 E;  1OW6 A;  1JM1 A;  2YFJ A;  1MKM A;  4XFJ A;  2D2C D;  3IN6 A;  3Q5S A;  2XR8 A;  3GLM A;  1KB9 E;  4I7Z B;  1KMI Z;  1WQL A;  2E76 D;  4QDF B;  3C8V A;  1G8J B;  2D2C C;  5AEW A;  2HMJ A;  3CWB E;  1ZOY C;  2NZ2 A;  4HM1 A;  2IDB A;  4RKU J;  2GBX A;  1SQX E;  3TGU E;  4IL6 X;  1DD4 A;  2QJK C;  1O7M A;  2WSF J;  3GKE A;  4PV1 D;  4QDF A;  1O7H A;  2YIU C;  2NVE A;  1KQF B;  1NYH A;  1PPJ E;  4H0L C;  1S1C X;  2BMQ A;  1O7G A;  3FGA D;  4OGQ C;  2D2C B;  4EMJ B;  3GF3 A;  2BEQ D;  2G8Y A;  3AE9 C;  4NB9 D;  3Q2Y A;  1KYO E;  2E74 C;  4YXD C;  2BMR A;  3GOB A;  1PV3 A;  4HM6 A;  1KIL E;  1EXJ A;  4H0L B;  2YFI A;  1L0L E;  1BE3 E;  4QDC A;  4HKV A;  1RQV A;  2E76 B;  4HM0 A;  2E4P A;  3AE2 C;  2B1X A;  5AEU A;  3B71 A;  1SQV E;  3L74 E;  1NTK E;  2MKV A;  1AJY A;  1P84 E;  3AE3 C;  1KOR A;  3H1J E;  1KQG B;  2JO6 A;  5CXM A;  1SJG A;  3N0Q A;  4NBE D;  4H13 D;  3D71 A;  4PD4 E;  3EN1 A;  3H1K E;  1K05 A;  4H13 C;  1L0N E;  4P1C H;  3C0D A;  2QSI A;  2NWF A;  2K9Y A;  4HM2 A;  3H1H E;  4U3F E;  2DE7 D;  1Q90 C;  4HM5 A;  1IK7 A;  4U7J A;  3Q1M A;  3R4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...