2QJPC

Crystal structure of wild type rhodobacter sphaeroides with stigmatellin and antimycin inhibited
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
total genus 46
structure length 179
sequence length 179
chains with identical sequence F, I, L
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qjpC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qjpC02
3GTEA 1RFSA 3BCCE 2YFJA 1RIEA 2BMOA 3C0DA 4QUPA 1JM1A 1ULIA 2NVFA 4QURA 4HKVA 4HM0A 2QJPC 5KLIC 2QJYC 4IL6X 4NB9D 1Q90D 2NVEA 3L73E 4HM3A 1VM9A 3GL0A 4QUQA 5KKZC 4NBDD 4H13B 1NYKA 4Y28J 2YIUC 4HJLA 3GZYA 1NTKE 1FQTA 1UUWA 4HM6A 1O7NA 2XR8A 2E76D 3VCPA 2A06E 2E75D 2BMQA 2E4QA 2B1XA 1UUVA 2E74B 1O7PA 2DE5D 2B24A 4AAYB 4NBHD 2WSEJ 2Q3WA 3EQQA 4H0LB 1EZVE 2NVGA 3LW5J 4PV1D 2O01J 2ZT9B 1NDOA 5HL4A 4HM7A 4NBBD 1O7WA 3EN1A 1L0LE 3H1LE 4QDFA 2D2CB 1G8JB 2HMNA 4HM5A 1Q90C 1KB9E 2QJKC 3VMGD 2BCCE 2BMRA 4HM4A 4NBED 2YVJB 2XSHA 3GTSA 1SQQE 5AEUA 3CWBE 4OGQB 1G8KB 4NBCD 5L8RJ 1BCCE 2I7FA 3GB4A 2NUKA 3L71E 3L74E 4QCKA 1S5LX 2XRXA 1VF5D 4HM1A 3DQYA 2E74D 4RKUJ 3GKEA 3CX5E 1SQVE 2QSIA 1NTZE 2HMOA 2HMJA 4H0LD 4NBGD 2ZT9D 2QPZA 3L72E 4QDCA 2HMMA 2NWFA 3L75E 2JO6A 1BE3E 5CXMA 3H1JE 5BOKA 4NB8D 3VMHD 2YFLA 1L0NE 4H13D 4QDFB 4NBFD 1NTME 2E76B 1WQLA 3AZCA 2QIWA 2E75B 3D89A 3H1KE 1PPJE 4H44B 1VCKA 3TGUE 3VMID 1KYOE 3FOUA 2HMLA 1SQBE 1P84E 4PV1B 1SJGA 2ZYLA 1O7GA 3H1IE 1EG9A 2NUMA 4U3FE 3L70E 2DE6D 1PP9E 4HM2A 2WSCJ 5AEWA 2WSFJ 3N0QA 2CKFA 1SQXE 3GZXA 1O7MA 4HM8A 3GCEA 4P1CH 1JB0J 4I7ZB 4EMJB 2D2CD 3C8VA 4KT0J 1O7HA 2YFIA 5KLVE 2WPVB 2GBXA 4AIVA 2GBWA 4PD4E 3VCAA 2FYNC 2HMKA 3CXHE 4P1BH 4QDDA 3GL2A 2IBZE 3H1HE 4NBAD 1VF5B 2E4PA 1SQPE 2JZAA 4H44D 1ULJA 1NU1E 2XSOA 2K9YA 2FYUE 3GOBA 2DE7D 4OGQD 1ZRTE
chains in the Genus database with same CATH superfamily
1T6AA 3BCCE 1M1JA 3C0DA 2WVRA 1NVOA 5M1BA 2C0WA 1HGVA 4QMAA 2M5AB 4Y99C 2H8PD 4ASVA 3CI9A 2HPCA 4C7NA 1XTGB 1LTGC 2I8DA 1OVVA 1FZCA 3GMAA 2L5GB 2JWDA 3L75G 2Q3WA 2O01J 2ZT9B 1S5LH 2IZ1A 1NDOA 1Z56A 3GHGA 2HMNA 2NPSB 1GDTA 1QVGO 3A2AA 3TGUG 1KB9E 3HD7B 1JO5A 1K04A 4OGQB 4HYTB 2W6JH 1HH0A 2MJZA 4U3FG 1SQPD 2HG5D 1BGYJ 4XA4A 4L76A 1N7LA 1DEEG 4BWNA 2HMJA 1OX3A 4NBGD 2VRSA 2YO3A 1JMBA 1KORA 3LIDA 4A7PA 1NTZJ 5CCHD 1QGKB 3AZCA 3S9OA 3D89A 3A3YB 1VCKA 3VP8A 1J1DB 5AVQB 1EXIA 2OGUA 3CX5D 1SQVD 3F5HA 1QX8A 1IFMA 2CKFA 3L4FA 2SPZA 3AE7C 5EFWB 2QA4P 4N3YB 3VCAA 3O6QA 4P1BH 3SWKA 1FDOA 1USEA 1L0LG 2YMKA 1OZHA 3AE1C 2P2UA 2NVEA 4HM3A 1AJYA 2V7QH 2Q5UA 4D6TG 4H13B 1JMMA 3H1JD 1SVFA 2J59M 3L73J 1TU3F 3L71G 5E79H 2HODA 1VQ9P 3QH9A 2WMMA 2NPSC 1QEXA 2E74B 3FWNA 3TF5A 1VL2A 2R5BA 3FXDA 4ZNCA 5KAFH 3H1ID 1CI6A 4RESB 4OGQC 1L0NG 1S4XA 3AECC 1OXZA 2AXCA 2J5UA 3CL3D 3RL0D 1OVUA 3AE4C 1PIXA 4I7ZC 4AUWA 1VF5D 2NZ2A 1ZOYC 1SQXG 1L0LK 3Q1MA 2E5YA 1HWTC 4QDCA 5KJ7A 3D70A 3H25A 2HFED 1HBWA 1KILE 3KYQA 3OW2O 1H0TA 1AA0A 2A06D 2GA1A 2IFNA 5AVRB 3TDKA 2GM4A 1K9MQ 5AVTB 4HM2A 2IYPA 3GW6A 4HKZH 3GZXA 3GCEA 4NPFX 1M90Q 4N6JA 3WU2H 4PD4I 4H13C 1ZW0A 2XSOA 3SFDC 1IJDB 1ZRTE 5KLVJ 3A0BH 1JM0A 3EQ2A 2QM8A 1Q90D 2G8YA 3HE4B 4QUQA 2KLUA 3JC22 3M9HA 1L4AD 1KD1Q 1NAFA 1NTKE 4BXLA 1YHQP 2QJYB 2UWJE 3II6A 1YTZT 1LTJB 2NRGA 1VQPP 2B1XA 1N7SA 4GT1A 1IFDA 1EZVE 3LW5J 2K9JB 3RK3D 2KLVA 1KILA 3B5NA 1X9VA 3AE8C 4M3LA 1OW6A 5APYA 2J58A 1Q82Q 4NBED 1W2EA 3RBZA 3H1LJ 1JY2O 1G8KB 1GL2C 3L70G 3N7NA 2WT7A 2FY8A 2BEZF 1EC5A 4HM1A 1FS0E 3S4RA 3BCCD 1EZVI 1OWAA 2HYNA 2ZT9D 2NWFA 3V5BA 1DH3A 1NTKK 2YXRB 3HTKB 1NU1G 2KI7B 3HD7D 3VMZA 1VDFA 1X0TA 1NH4A 2E43A 5BU8B 4LC1A 1RF0C 1FOSE 4ZMDA 1SJGA 2E42A 2Q6QA 1M57D 1U7MA 3NXSA 3IFMA 3P7KA 1FJPA 2DW3A 1O7MA 1T2KC 2JP3A 4OWFA 1KB9D 2WPVB 1PGPA 2YXQB 3HUSC 1WMKA 1KQFB 2AXTH 3B8EB 5H2FH 4HKVA 2QJPC 2QJYC 4IL6X 1SQPJ 2ZYAA 3IAOA 3KXDA 3E1RA 5KTBA 1SFCA 1EDIA 1LTJC 3S1KA 1NYKA 4HJLA 1FAVA 5B66H 1NU1K 5KLIB 1LGHB 4TT3H 2RMZA 2BCCJ 1O7PA 2KZJA 2IPPA 1U7JA 2KXPB 2KS1A 4PV1D 2B89A 1M56D 4GOFA 4KJMA 5BU5A 1O7WA 1JY2P 3PP5A 1SQVJ 4MN4C 1GZLA 3G9RA 5AW6B 2BCCE 2BMRA 3D6YA 3F89A 2XSHA 1BE3J 1FJKA 3MZWB 3H32A 1OW7A 1S5LX 2E74D 3CX5E 1SQVE 3P8MC 2QPZA 4L73A 1BE3E 2R44A 1LT1A 1L2PA 4NBFD 3A7OA 4YTPC 3BASA 4B86A 2OYOA 1QLED 1IK9A 2P10A 1ZV8A 2AEMA 1W5CE 1NKNA 1IFJA 5AW2B 1H88A 1UIXA 2XZRA 2WSCJ 2POHA 3M9QA 3C8VA 3CXHI 2HMKA 4NBAD 2N1TB 5CCGC 3VTPC 1K8AQ 1EDJA 1RIEA 1RE4A 3T97B 5KLIC 4LGDE 5CCHA 1RE3C 1BCCG 1KB9H 1FBMA 1PGOA 2PFXA 1O7NA 3L74G 1KILD 1LTBC 4PD4D 2KNCA 1OW8A 2E75D 2W83C 2E4QA 2YKOA 2O01H 3L72G 2WSEJ 1G1IA 5HL4A 1NTMG 2WWWA 1G8JB 3H1KG 1LWUB 1IO4A 1LWUC 1LT9A 1U57A 1DIPA 5L8RJ 1NAYA 1M7LA 4Y99B 1ZRTD 3BATA 1S9KD 1LP1A 5CXMA 3N4XA 3CC7P 1NTKD 3R2PA 2HMLA 3HE5A 3JCUH 1EZVD 2P7JA 1FDIA 2IYOA 1NTMK 4AQRD 1A02J 3B4SA 1URQB 3KPEA 3ZDMA 3AE5C 2JZAA 2OTKE 3MTUE 2DE7D 1S72P 3RBXA 3A0HE 1FZAA 4W7YA 3BCCJ 2FFDA 1N73A 4JYBA 3V2PA 5TISE 2Q1KA 1QL2A 4Z1MH 2JO1A 1GK4A 2GUSA 5AVWB 3TNUB 4C7RA 3EN1A 1NHLA 2QVAA 2D2CB 5GTIH 1SQBG 4JF7A 1PL5A 4OVNF 4WY4C 1PP9G 3DQYA 4RJTA 4RKUJ 3TGUJ 5AW4B 1L4AA 3CCVP 3L75E 3VMHD 1AV1A 4U3FJ 3AE2C 4NPDA 3TGUE 3RK2D 1KYOI 5GTHE 1URQC 2B87A 3Q2YA 1KFMA 4U3FE 2M5AA 3W67A 1IFIA 2OTLP 3FWLA 1BDDA 3OAKA 4H0LC 3BRVB 4I7ZB 4K3AA 2BCCD 1ZP0C 1PZQA 2GBWA 2FYNC 1PFIA 2OARA 1YI2P 4ASWA 3MUDA 2BMOA 1G2CB 1M1KQ 4QUPA 3PTZA 1BGYG 3HD7A 3B71A 1BE3D 1FZCC 2ZYDA 1L0LJ 2D2CC 1NTZG 3LW5H 1VQ7P 5AW5B 3BVHA 2N1TD 4D6TJ 2R5DA 1VPCA 2O1KA 4NBHD 4H44C 3I5CA 5AW9B 1L0LE 5B5EE 3AE6C 3RK3C 4I2LC 4UB8E 3IR9A 5APUA 4D6TE 1EQ7A 4NBCD 3L71E 1Y9BA 2JKVA 3G71P 3C9IA 1QVFO 1OIPA 3P8CE 2IBZG 3H1HG 1L0NE 1SLQA 4NPEA 2QIWA 1S3JA 3L36A 5AVYB 1RHZB 4EIJA 1JCCA 2QEXP 1J2JB 3L73G 1CSBA 1P84E 4PJ0E 3GG2A 2M3BA 1SQXE 2A45H 4I1LA 1GL2B 3CCJP 4GIFA 3NFQA 4PD4E 4QDDA 2Y9ZA 2K9YA 4XE5B 3GF3A 1P84I 3WUUA 4RO0A 4K35A 3VMXA 1ULIA 1PV3A 1YJ9P 5KKZC 1GU5A 3CWBG 1L0NK 5AW8B 1X8YA 3U1AA 3KZIH 2XR8A 1VQ4P 1ZN5A 1YTZI 2KZIA 1NTKJ 2YIUB 1LTIC 2NVGA 5AVVB 4HM7A 3CX5H 3M91A 3PH0A 3E1IA 1S9KE 1SQXK 1X79B 1AQTA 1PPJG 1RH5B 3HUSB 3B5NB 2QJKC 2RN0A 3WUTA 5AEUA 1W2BO 2E5TA 3EWKA 2QJPB 5KJ7C 2LXCB 2CPBA 2OYIB 3V2RA 2WT7B 3GKEA 1XTCC 2QSIA 2HMMA 5KLVG 5APXA 2E76B 2K37A 3EFGA 3PRJA 4UB6E 3CCSP 1HF9A 3VMID 2OTJP 1JEKA 5AW0B 3UIAA 2ITAA 1DX7A 3HE4A 1GMJA 3L70E 1NU1J 3G4SP 1YQ3C 5AEWA 3N0QA 1JOCA 2V7QJ 3ABVC 1IC2A 1Y8AA 2NPSD 1DEBA 1NYHA 3CCRP 3AEFC 1ULJA 1NU1E 5TJHA 2K9JA 3GOBA 4OGQD 2Q9IA 5AVZB 3H1LG 4QURA 3VN0A 4NBDD 3L75D 3GLMA 4DZOA 1SFCB 2YIUC 1CZQA 3MIWA 3CCMP 4HM6A 4GKGA 1N7SC 2KB7P 5APVA 1MV8A 2WTYA 2WSEH 1MFZA 3TGUD 3PJSK 3R4YA 3B5NC 1JY2N 1VQ5P 2MKVA 4U3FD 1FU1A 3HTKA 1KTMA 2OYIC 1LTAC 4I6MC 4DCKA 2I7FA 2NUKA 4IFMA 1JNMA 2A45G 2ZXXA 2C0XA 2E76C 1VQ6P 1SS1A 2HMOA 3SWYA 2R32A 1H89A 1SQPG 2Y9YA 4H13D 1GU4A 2PRRA 2FYUG 3P32A 4GDOA 4LLHA 1BSNA 5AW1B 2Z5HA 1GW3A 3AEGC 1L0LD 1QL1A 2W6AA 2Q3IA 5K5GB 1O7HA 4WVZA 3Q5RA 2YFIA 3CXHE 4D6TD 4DOJA 3M0DC 2E4PA 1FZEA 1HTLC 1SFCC 3OJAB 5TISH 3L71D 4DJGA 1GTWA 1MKMA 4JPZB 1RF1B 3KHUA 2JJLA 4GOEA 1RY3A 3P8CD 1UUWA 1GL2D 1L0ND 2L91A 2KIKA 2FYUK 3W68A 4N78E 2KNCB 1GW4A 1KC8Q 2Z5IA 1P84D 3H1JG 4JQ0D 1BCCJ 3VYIA 1SQXD 3L72J 2B88A 3GTSA 3MHVA 2H7HA 3H1IG 1BCCE 1NTMJ 3L74E 2XDJA 3Q5PA 3H1KJ 2LR2A 1X22A 4XFJA 1T2KD 3AEAC 3USSA 3L72E 2IX7C 1IFNA 1RQUA 2YFLA 1JY3O 1Q2NA 4QDFB 1NTME 3H6PA 2XKMA 4DT0A 1FOSF 2N1TA 3H1KE 4IFDK 1JTHB 4IOIH 3AE9C 3T97A 1O7GA 1EG9A 5KAIE 3AEBC 2Q3EA 1AFOA 2A06G 4WY4B 3TSIA 3JSVC 2K88A 1RF1C 3RL0B 2OYHA 1RE4C 1J1EB 1Q7YQ 3GL2A 1VF5B 3SFEC 3U59A 5CCHC 1EDKA 2YFJA 4W7ZA 3VOPA 1JM1A 4HM0A 2XNDH 1VM9A 1LWUA 2PAJA 1SQQG 4UB8H 2XU6A 1R5SA 2B9BA 2RH0A 3M0AA 2QG4A 2B24A 4H0LB 3V4QA 3E7KA 4BRYB 4EYYQ 2FXPA 2OQQA 3L70D 1M1JB 2FYNB 4HM5A 2C9LY 3LIEA 1ZR2A 2YO2A 1VQNP 1HVVA 2HPCB 4U7JA 1N8RQ 2N9BA 4C7NB 1NU1D 2YKQA 1FZCB 2AEFA 1VQMP 4TLFA 2BASA 2JWAA 1URQA 4NB8D 1FC2C 3I56P 1SQQK 3WMM0 3GHGB 3HRNA 1KQGB 1LTTC 2W8ZA 5CCGD 3L75J 1LNQA 3BCCG 4H44B 4L75A 3IF4A 4PD4H 2AEJA 1KYOE 3TYYA 1KFNA 1SQBE 2ZYLA 3VMYA 3RK3B 3RL0C 1J1EC 2B87B 1PP9E 1VF5C 2N9YB 1G1JA 2WSFJ 4YXDC 1D7MA 3BRTB 2GBXA 1VQOP 3TNUA 3CCLP 5CJ4A 1RFSA 2FFDC 2ZJSE 1PGJA 1N86A 4NB9D 5APQA 2IDBA 2K3RA 1N73C 3NTNA 2XV5A 4WB4A 1E79H 2M0BA 1KN7A 3GF7A 1M1JC 3M06A 5APSA 1SQBK 4C46A 3PHLA 1IZNB 2R3SA 2FYUD 3O6QB 1UUVA 1HUCA 2WITA 2NPSA 3VMAA 1BSHA 1Q90C 1KB9I 4JYCA 3VMGD 3O8ZA 1BGYE 2YVJB 2WPQA 2JEEA 1L4AC 3CXHD 3EFFK 4UB6H 2HODB 5KKZB 2Y0CA 3GHGC 1FZGA 3VP9A 2FBWC 1NTZE 3MP7B 3L71J 4HH2A 1CI6B 1LTSC 3FXEA 5APTA 2QRXA 3ITKA 1WQLA 4IFFA 1H8AA 3WUVA 3KQGA 1G2CA 3JCUE 1L0NJ 4N78D 1KZUB 4PV1B 1KV4A 3H1HJ 2QJKB 2HR3A 2KSEA 1AQ5A 2I1KA 4HM8A 2ZT9C 2H88C 3MUDC 1S1CX 2IBZE 3H1HE 1SQXJ 1A02F 1BCCD 1H0TB 3HD7C 2WZ7A 1LJ2A 3L74D 3U1CA 1Q81Q 2ZVOB 1VQKP 1NTZK 2GUVA 2NVFA 1YJWP 5CBNA 1OMIA 3L73E 2M8RA 4IL6E 2WPSA 3L72D 1USDA 4Y28J 5CMZA 1OFCX 5BVZA 1K73Q 1NTMD 4WY4D 1NGMB 2Z4EA 5DJTB 3H1KD 2IBZI 1AVOA 2BMQA 3KDPB 3SWFA 2KOGA 3CWBJ 3CCEP 1J1DC 5GTIE 1YIJP 1Y47A 1OVRA 4HM4A 3CWBE 4CPGA 1URQD 2HLOA 4L74A 4QCKA 1S5LE 2FXOA 4H0LD 1N7SB 2G3AA 2RKLA 4OH8B 3A5TA 1GL2A 1WT6A 1KQSO 2ZFCA 4PV1C 2JDIH 4EI2A 2KP8A 1KILB 1SQQD 2E75B 2Y0DA 1PPJE 2H89C 3CXHH 3FGAD 3FOUA 5CBOA 2JR8A 1NTKG 2E74C 1RF0A 4P1CH 3QWOC 1JB0J 3CLQA 3V6IA 4EMJB 2D2CD 2KYVA 3L70J 5KLVE 1R8EA 5AW7B 1EZVG 4EDFA 4H44D 4NBBD 3G6EP 3FX0A 2WSCH 1R5LA 1FZBA 1SP4A 1NJIQ 3GL0A 3HUSA 1MUUA 2P58A 3GZYA 3MD0A 2QM7A 1ZXGA 1LTJA 2OYIA 1KYOD 1SQBD 3EQQA 4YXWH 4W80A 1PP9D 3H1LE 1N2DC 3MGNA 5KLVK 1NO4A 1E5WA 4WWIA 2R3CA 4JBZA 5E79E 2IFMA 2Q7CA 3M9BA 3RGUA 3GB4A 2YNYA 1KILC 5KAFE 3NMDA 2E75C 2PGDA 1VQ8P 5CJ0A 3CMAP 1UIIA 5KAIH 2KS1B 2PP6A 2H43A 2ZYGA 1S2EA 1NWQA 1ZR4A 3H32B 2Y0EA 3M0DA 2FYUJ 3K5BA 2BEQD 2YMYA 4EOTA 2KK7A 1IFPA 3CD6P 1YQ4C 3Q5SA 1BGYD 1NOHA 1SQPE 2FYUE 2IZ0A 1CW5A 1EXJA 4YPCA 3CCUP 3A0HH 2BCCG 1NTZD 2ZAEB 1AVYA 5CCGA 2A45I 2WPRA 1EDLA 1Q86Q 3KZIE 1FQTA 3WU2E 5KJ7D 3RK2B 4HB1A 3V2NA 3L35A 2QE7H 1RE3A 3VCPA 1NKZB 1SQVG 3A0BE 4AAYB 1BE3G 2FXMA 5AVSB 4O9BA 2W6BA 1FDMA 1JUNA 1ZLLA 5C39A 2P67A 4R4LA 3IN6A 3H1JJ 1SQPK 4ZKPA 1HJBA 2IBZD 3H1HD 1DD4A 1KYOH 2XRXA 5DJUB 1GK6A 2KSJA 2WSSH 1FZFA 1JCDA 3CX5I 1RQVA 3L73D 2ZVNB 3L74J 3H1JE 1PGQA 3H1IJ 3G3ZA 2M3EA 3I55P 1BDCA 4GODA 2WQYC 1WRGA 1LT9B 1DD3A 1RF1A 1SQVK 1VQLP 3V2QA 1MZ9A 2WSFH 3H1IE 5GTHH 2NUMA 4AYCA 1N7SD 2O1JA 5AVXB 3Q3DA 1LP1B 3CMEP 2LKMA 1T8ZA 3B5ND 2V4HA 3CWBD 2OYHB 3AE3C 3OA7A 1HGZA 1MFTA 5AVUB 2K1AA 3TK1A 3GTEA 3RK2C 3HE5B 2ZXEB 1FE6A 1YITP 3PLNA 2E76D 1PPJD 1T3UA 2A06E 3V4WA 3CC4P 4WBAA 2AXTE 2DE5D 1HJ0A 1M8OB 1SQQJ 1YJNP 2LXBA 5H2FE 2I1JA 2YKPA 3D6ZA 4QDFA 3CCQP 5B66E 4HJGH 3L37A 4R4MA 5B5EH 5APWA 3AEEC 2W90A 4ZKUA 1JTHA 1SQQE 5KLVD 1ZMEC 2P1JA 2FFDB 1JY3N 1N73B 2O3JA 2C9NY 2FKWB 2N1TC 1LT9C 4WY4A 1T3JA 2JO6A 5BOKA 5CHXA 2CK3H 1SFCD 2KUBA 1GD2E 1YBKA 1KMIZ 1KQLA 2FYZA 2CPSA 3SSUA 2XNXA 1P84H 1JY3P 2O01N 3RK3E 4PJ0H 1K05A 2OYHC 2DE6D 2W27A 1SQBJ 3D71A 4IL6H 1L4AB 4KHXA 3H1LD 3RL0g 4KT0J 1PP9J 3CC2P 4AIVA 3AEDC 3C1LA 1IK7A 5AW3B 1YYCA 4BRYA 3CPWO
chains in the Genus database with same CATH topology
3BCCE 1RIEA 3C0DA 3T97B 2NVFA 4QURA 5KLIC 5M1BA 1OMIA 3L73E 4NBDD 3GLMA 4Y28J 2YIUC 4HM6A 1O7NA 1NGMB 1OW8A 2E75D 2BMQA 2E4QA 3R4YA 3GMAA 2WSEJ 2Q3WA 5HL4A 2O01J 2ZT9B 1NDOA 2MKVA 1KTMA 1G8JB 2HMNA 1KB9E 4HM4A 1U57A 3CWBE 1DIPA 1K04A 4OGQB 5L8RJ 2I7FA 2NUKA 4QCKA 2E76C 2HMOA 4H0LD 2HMJA 2G3AA 4NBGD 5CXMA 4PV1C 1KORA 4H13D 3AZCA 2E75B 3S9OA 3D89A 1PPJE 2H89C 1VCKA 3FGAD 3FOUA 4GDOA 2HMLA 1EXIA 1FDIA 2E74C 3AEGC 2CKFA 4P1CH 3AE7C 1JB0J 4EMJB 2D2CD 1O7HA 2YFIA 3Q5RA 5KLVE 1R8EA 3VCAA 3CXHE 3O6QA 4P1BH 1FDOA 3AE5C 2E4PA 2JZAA 4H44D 4NBBD 2DE7D 2YMKA 1MKMA 3AE1C 2NVEA 4HM3A 3GL0A 1AJYA 4H13B 3GZYA 1UUWA 1TU3F 2E74B 4Z1MH 2JO1A 1VL2A 3EQQA 4OGQC 3EN1A 3AECC 3H1LE 2D2CB 2J5UA 3GTSA 1BCCE 1PL5A 3AE4C 1PIXA 4I7ZC 3GB4A 3L74E 1VF5D 3Q5PA 3DQYA 4RKUJ 2NZ2A 2E75C 1ZOYC 4XFJA 3AEAC 3Q1MA 3L72E 4QDCA 3L75E 3D70A 3H25A 3VMHD 1RQUA 3AE2C 2YFLA 4QDFB 1NTME 1KILE 3H1KE 3TGUE 3AE9C 1O7GA 3Q2YA 1EG9A 4U3FE 4HM2A 3AEBC 3GZXA 3GCEA 2BEQD 4H0LC 4I7ZB 1YQ4C 1ZP0C 3Q5SA 2GBWA 2FYNC 3GL2A 1VF5B 4H13C 3SFEC 1SQPE 2XSOA 2FYUE 3SFDC 1ZRTE 2YFJA 2BMOA 4QUPA 1JM1A 4HM0A 1EXJA 1Q90D 1VM9A 2G8YA 4QUQA 3B71A 1NTKE 1FQTA 3VCPA 2D2CC 2B1XA 4AAYB 2B24A 4NBHD 4H0LB 1EZVE 3LW5J 4H44C 2FXPA 2OQQA 1L0LE 3AE6C 4HM5A 3AE8C 1OW6A 4R4LA 4NBED 3IN6A 4U7JA 1G8KB 4NBCD 1DD4A 3L71E 2XRXA 2BEZF 4HM1A 1Y9BA 1RQVA 2ZT9D 2NWFA 3H1JE 4NB8D 1L0NE 1KQGB 2QIWA 2WQYC 4H44B 1KYOE 1SQBE 1DD3A 1P84E 1SJGA 2ZYLA 3H1IE 2NUMA 1PP9E 1VF5C 2WSFJ 1SQXE 4YXDC 1O7MA 3Q3DA 2JP3A 2WPVB 2GBXA 4PD4E 4QDDA 3AE3C 2K9YA 1WMKA 1KQFB 3GF3A 3GTEA 1RFSA 1ULIA 1PV3A 4HKVA 2QJPC 2QJYC 4IL6X 4NB9D 3IAOA 2IDBA 5KKZC 1NYKA 4HJLA 3GF7A 2XR8A 4TT3H 2E76D 2A06E 1UUVA 2DE5D 1HJ0A 1O7PA 2NVGA 4PV1D 4HM7A 1O7WA 3D6ZA 4QDFA 1Q90C 3G9RA 4R4MA 3VMGD 2QJKC 2BCCE 2BMRA 3AEEC 3D6YA 2YVJB 2XSHA 5AEUA 1SQQE 1ZMEC 3EWKA 1OW7A 1S5LX 2E74D 3GKEA 3CX5E 1SQVE 2QSIA 2FBWC 1NTZE 2QPZA 2HMMA 2JO6A 1BE3E 5BOKA 4NBFD 2E76B 1WQLA 4YTPC 2P10A 1HF9A 3VMID 1KMIZ 4PV1B 3RK3E 1GMJA 1UIXA 1K05A 3L70E 2DE6D 2WSCJ 1YQ3C 5AEWA 3D71A 3N0QA 4HM8A 2V7QJ 3ABVC 2ZT9C 3RL0g 3C8VA 4KT0J 2H88C 4AIVA 3AEDC 1NYHA 2HMKA 1S1CX 1IK7A 2IBZE 3H1HE 4NBAD 3AEFC 1ULJA 1NU1E 3GOBA 4OGQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTE A;  1RFS A;  3BCC E;  2YFJ A;  1RIE A;  2BMO A;  3C0D A;  4QUP A;  1JM1 A;  1ULI A;  2NVF A;  4QUR A;  4HKV A;  4HM0 A;  2QJP C;  5KLI C;  2QJY C;  4IL6 X;  4NB9 D;  1Q90 D;  2NVE A;  3L73 E;  4HM3 A;  1VM9 A;  3GL0 A;  4QUQ A;  5KKZ C;  4NBD D;  4H13 B;  1NYK A;  4Y28 J;  2YIU C;  4HJL A;  3GZY A;  1NTK E;  1FQT A;  1UUW A;  4HM6 A;  1O7N A;  2XR8 A;  2E76 D;  3VCP A;  2A06 E;  2E75 D;  2BMQ A;  2E4Q A;  2B1X A;  1UUV A;  2E74 B;  1O7P A;  2DE5 D;  2B24 A;  4AAY B;  4NBH D;  2WSE J;  2Q3W A;  3EQQ A;  4H0L B;  1EZV E;  2NVG A;  3LW5 J;  4PV1 D;  2O01 J;  2ZT9 B;  1NDO A;  5HL4 A;  4HM7 A;  4NBB D;  1O7W A;  3EN1 A;  1L0L E;  3H1L E;  4QDF A;  2D2C B;  1G8J B;  2HMN A;  4HM5 A;  1Q90 C;  1KB9 E;  2QJK C;  3VMG D;  2BCC E;  2BMR A;  4HM4 A;  4NBE D;  2YVJ B;  2XSH A;  3GTS A;  1SQQ E;  5AEU A;  3CWB E;  4OGQ B;  1G8K B;  4NBC D;  5L8R J;  1BCC E;  2I7F A;  3GB4 A;  2NUK A;  3L71 E;  3L74 E;  4QCK A;  1S5L X;  2XRX A;  1VF5 D;  4HM1 A;  3DQY A;  2E74 D;  4RKU J;  3GKE A;  3CX5 E;  1SQV E;  2QSI A;  1NTZ E;  2HMO A;  2HMJ A;  4H0L D;  4NBG D;  2ZT9 D;  2QPZ A;  3L72 E;  4QDC A;  2HMM A;  2NWF A;  3L75 E;  2JO6 A;  1BE3 E;  5CXM A;  3H1J E;  5BOK A;  4NB8 D;  3VMH D;  2YFL A;  1L0N E;  4H13 D;  4QDF B;  4NBF D;  1NTM E;  2E76 B;  1WQL A;  3AZC A;  2QIW A;  2E75 B;  3D89 A;  3H1K E;  1PPJ E;  4H44 B;  1VCK A;  3TGU E;  3VMI D;  1KYO E;  3FOU A;  2HML A;  1SQB E;  1P84 E;  4PV1 B;  1SJG A;  2ZYL A;  1O7G A;  3H1I E;  1EG9 A;  2NUM A;  4U3F E;  3L70 E;  2DE6 D;  1PP9 E;  4HM2 A;  2WSC J;  5AEW A;  2WSF J;  3N0Q A;  2CKF A;  1SQX E;  3GZX A;  1O7M A;  4HM8 A;  3GCE A;  4P1C H;  1JB0 J;  4I7Z B;  4EMJ B;  2D2C D;  3C8V A;  4KT0 J;  1O7H A;  2YFI A;  5KLV E;  2WPV B;  2GBX A;  4AIV A;  2GBW A;  4PD4 E;  3VCA A;  2FYN C;  2HMK A;  3CXH E;  4P1B H;  4QDD A;  3GL2 A;  2IBZ E;  3H1H E;  4NBA D;  1VF5 B;  2E4P A;  1SQP E;  2JZA A;  4H44 D;  1ULJ A;  1NU1 E;  2XSO A;  2K9Y A;  2FYU E;  3GOB A;  2DE7 D;  4OGQ D;  1ZRT E; 
#chains in the Genus database with same CATH topology
 1T6A A;  3BCC E;  1M1J A;  3C0D A;  2WVR A;  1NVO A;  5M1B A;  2C0W A;  1HGV A;  4QMA A;  2M5A B;  4Y99 C;  2H8P D;  4ASV A;  3CI9 A;  2HPC A;  4C7N A;  1XTG B;  1LTG C;  2I8D A;  1OVV A;  1FZC A;  3GMA A;  2L5G B;  2JWD A;  3L75 G;  2Q3W A;  2O01 J;  2ZT9 B;  1S5L H;  2IZ1 A;  1NDO A;  1Z56 A;  3GHG A;  2HMN A;  2NPS B;  1GDT A;  1QVG O;  3A2A A;  3TGU G;  1KB9 E;  3HD7 B;  1JO5 A;  1K04 A;  4OGQ B;  4HYT B;  2W6J H;  1HH0 A;  2MJZ A;  4U3F G;  1SQP D;  2HG5 D;  1BGY J;  4XA4 A;  4L76 A;  1N7L A;  1DEE G;  4BWN A;  2HMJ A;  1OX3 A;  4NBG D;  2VRS A;  2YO3 A;  1JMB A;  1KOR A;  3LID A;  4A7P A;  1NTZ J;  5CCH D;  1QGK B;  3AZC A;  3S9O A;  3D89 A;  3A3Y B;  1VCK A;  3VP8 A;  1J1D B;  5AVQ B;  1EXI A;  2OGU A;  3CX5 D;  1SQV D;  3F5H A;  1QX8 A;  1IFM A;  2CKF A;  3L4F A;  2SPZ A;  3AE7 C;  5EFW B;  2QA4 P;  4N3Y B;  3VCA A;  3O6Q A;  4P1B H;  3SWK A;  1FDO A;  1USE A;  1L0L G;  2YMK A;  1OZH A;  3AE1 C;  2P2U A;  2NVE A;  4HM3 A;  1AJY A;  2V7Q H;  2Q5U A;  4D6T G;  4H13 B;  1JMM A;  3H1J D;  1SVF A;  2J59 M;  3L73 J;  1TU3 F;  3L71 G;  5E79 H;  2HOD A;  1VQ9 P;  3QH9 A;  2WMM A;  2NPS C;  1QEX A;  2E74 B;  3FWN A;  3TF5 A;  1VL2 A;  2R5B A;  3FXD A;  4ZNC A;  5KAF H;  3H1I D;  1CI6 A;  4RES B;  4OGQ C;  1L0N G;  1S4X A;  3AEC C;  1OXZ A;  2AXC A;  2J5U A;  3CL3 D;  3RL0 D;  1OVU A;  3AE4 C;  1PIX A;  4I7Z C;  4AUW A;  1VF5 D;  2NZ2 A;  1ZOY C;  1SQX G;  1L0L K;  3Q1M A;  2E5Y A;  1HWT C;  4QDC A;  5KJ7 A;  3D70 A;  3H25 A;  2HFE D;  1HBW A;  1KIL E;  3KYQ A;  3OW2 O;  1H0T A;  1AA0 A;  2A06 D;  2GA1 A;  2IFN A;  5AVR B;  3TDK A;  2GM4 A;  1K9M Q;  5AVT B;  4HM2 A;  2IYP A;  3GW6 A;  4HKZ H;  3GZX A;  3GCE A;  4NPF X;  1M90 Q;  4N6J A;  3WU2 H;  4PD4 I;  4H13 C;  1ZW0 A;  2XSO A;  3SFD C;  1IJD B;  1ZRT E;  5KLV J;  3A0B H;  1JM0 A;  3EQ2 A;  2QM8 A;  1Q90 D;  2G8Y A;  3HE4 B;  4QUQ A;  2KLU A;  3JC2 2;  3M9H A;  1L4A D;  1KD1 Q;  1NAF A;  1NTK E;  4BXL A;  1YHQ P;  2QJY B;  2UWJ E;  3II6 A;  1YTZ T;  1LTJ B;  2NRG A;  1VQP P;  2B1X A;  1N7S A;  4GT1 A;  1IFD A;  1EZV E;  3LW5 J;  2K9J B;  3RK3 D;  2KLV A;  1KIL A;  3B5N A;  1X9V A;  3AE8 C;  4M3L A;  1OW6 A;  5APY A;  2J58 A;  1Q82 Q;  4NBE D;  1W2E A;  3RBZ A;  3H1L J;  1JY2 O;  1G8K B;  1GL2 C;  3L70 G;  3N7N A;  2WT7 A;  2FY8 A;  2BEZ F;  1EC5 A;  4HM1 A;  1FS0 E;  3S4R A;  3BCC D;  1EZV I;  1OWA A;  2HYN A;  2ZT9 D;  2NWF A;  3V5B A;  1DH3 A;  1NTK K;  2YXR B;  3HTK B;  1NU1 G;  2KI7 B;  3HD7 D;  3VMZ A;  1VDF A;  1X0T A;  1NH4 A;  2E43 A;  5BU8 B;  4LC1 A;  1RF0 C;  1FOS E;  4ZMD A;  1SJG A;  2E42 A;  2Q6Q A;  1M57 D;  1U7M A;  3NXS A;  3IFM A;  3P7K A;  1FJP A;  2DW3 A;  1O7M A;  1T2K C;  2JP3 A;  4OWF A;  1KB9 D;  2WPV B;  1PGP A;  2YXQ B;  3HUS C;  1WMK A;  1KQF B;  2AXT H;  3B8E B;  5H2F H;  4HKV A;  2QJP C;  2QJY C;  4IL6 X;  1SQP J;  2ZYA A;  3IAO A;  3KXD A;  3E1R A;  5KTB A;  1SFC A;  1EDI A;  1LTJ C;  3S1K A;  1NYK A;  4HJL A;  1FAV A;  5B66 H;  1NU1 K;  5KLI B;  1LGH B;  4TT3 H;  2RMZ A;  2BCC J;  1O7P A;  2KZJ A;  2IPP A;  1U7J A;  2KXP B;  2KS1 A;  4PV1 D;  2B89 A;  1M56 D;  4GOF A;  4KJM A;  5BU5 A;  1O7W A;  1JY2 P;  3PP5 A;  1SQV J;  4MN4 C;  1GZL A;  3G9R A;  5AW6 B;  2BCC E;  2BMR A;  3D6Y A;  3F89 A;  2XSH A;  1BE3 J;  1FJK A;  3MZW B;  3H32 A;  1OW7 A;  1S5L X;  2E74 D;  3CX5 E;  1SQV E;  3P8M C;  2QPZ A;  4L73 A;  1BE3 E;  2R44 A;  1LT1 A;  1L2P A;  4NBF D;  3A7O A;  4YTP C;  3BAS A;  4B86 A;  2OYO A;  1QLE D;  1IK9 A;  2P10 A;  1ZV8 A;  2AEM A;  1W5C E;  1NKN A;  1IFJ A;  5AW2 B;  1H88 A;  1UIX A;  2XZR A;  2WSC J;  2POH A;  3M9Q A;  3C8V A;  3CXH I;  2HMK A;  4NBA D;  2N1T B;  5CCG C;  3VTP C;  1K8A Q;  1EDJ A;  1RIE A;  1RE4 A;  3T97 B;  5KLI C;  4LGD E;  5CCH A;  1RE3 C;  1BCC G;  1KB9 H;  1FBM A;  1PGO A;  2PFX A;  1O7N A;  3L74 G;  1KIL D;  1LTB C;  4PD4 D;  2KNC A;  1OW8 A;  2E75 D;  2W83 C;  2E4Q A;  2YKO A;  2O01 H;  3L72 G;  2WSE J;  1G1I A;  5HL4 A;  1NTM G;  2WWW A;  1G8J B;  3H1K G;  1LWU B;  1IO4 A;  1LWU C;  1LT9 A;  1U57 A;  1DIP A;  5L8R J;  1NAY A;  1M7L A;  4Y99 B;  1ZRT D;  3BAT A;  1S9K D;  1LP1 A;  5CXM A;  3N4X A;  3CC7 P;  1NTK D;  3R2P A;  2HML A;  3HE5 A;  3JCU H;  1EZV D;  2P7J A;  1FDI A;  2IYO A;  1NTM K;  4AQR D;  1A02 J;  3B4S A;  1URQ B;  3KPE A;  3ZDM A;  3AE5 C;  2JZA A;  2OTK E;  3MTU E;  2DE7 D;  1S72 P;  3RBX A;  3A0H E;  1FZA A;  4W7Y A;  3BCC J;  2FFD A;  1N73 A;  4JYB A;  3V2P A;  5TIS E;  2Q1K A;  1QL2 A;  4Z1M H;  2JO1 A;  1GK4 A;  2GUS A;  5AVW B;  3TNU B;  4C7R A;  3EN1 A;  1NHL A;  2QVA A;  2D2C B;  5GTI H;  1SQB G;  4JF7 A;  1PL5 A;  4OVN F;  4WY4 C;  1PP9 G;  3DQY A;  4RJT A;  4RKU J;  3TGU J;  5AW4 B;  1L4A A;  3CCV P;  3L75 E;  3VMH D;  1AV1 A;  4U3F J;  3AE2 C;  4NPD A;  3TGU E;  3RK2 D;  1KYO I;  5GTH E;  1URQ C;  2B87 A;  3Q2Y A;  1KFM A;  4U3F E;  2M5A A;  3W67 A;  1IFI A;  2OTL P;  3FWL A;  1BDD A;  3OAK A;  4H0L C;  3BRV B;  4I7Z B;  4K3A A;  2BCC D;  1ZP0 C;  1PZQ A;  2GBW A;  2FYN C;  1PFI A;  2OAR A;  1YI2 P;  4ASW A;  3MUD A;  2BMO A;  1G2C B;  1M1K Q;  4QUP A;  3PTZ A;  1BGY G;  3HD7 A;  3B71 A;  1BE3 D;  1FZC C;  2ZYD A;  1L0L J;  2D2C C;  1NTZ G;  3LW5 H;  1VQ7 P;  5AW5 B;  3BVH A;  2N1T D;  4D6T J;  2R5D A;  1VPC A;  2O1K A;  4NBH D;  4H44 C;  3I5C A;  5AW9 B;  1L0L E;  5B5E E;  3AE6 C;  3RK3 C;  4I2L C;  4UB8 E;  3IR9 A;  5APU A;  4D6T E;  1EQ7 A;  4NBC D;  3L71 E;  1Y9B A;  2JKV A;  3G71 P;  3C9I A;  1QVF O;  1OIP A;  3P8C E;  2IBZ G;  3H1H G;  1L0N E;  1SLQ A;  4NPE A;  2QIW A;  1S3J A;  3L36 A;  5AVY B;  1RHZ B;  4EIJ A;  1JCC A;  2QEX P;  1J2J B;  3L73 G;  1CSB A;  1P84 E;  4PJ0 E;  3GG2 A;  2M3B A;  1SQX E;  2A45 H;  4I1L A;  1GL2 B;  3CCJ P;  4GIF A;  3NFQ A;  4PD4 E;  4QDD A;  2Y9Z A;  2K9Y A;  4XE5 B;  3GF3 A;  1P84 I;  3WUU A;  4RO0 A;  4K35 A;  3VMX A;  1ULI A;  1PV3 A;  1YJ9 P;  5KKZ C;  1GU5 A;  3CWB G;  1L0N K;  5AW8 B;  1X8Y A;  3U1A A;  3KZI H;  2XR8 A;  1VQ4 P;  1ZN5 A;  1YTZ I;  2KZI A;  1NTK J;  2YIU B;  1LTI C;  2NVG A;  5AVV B;  4HM7 A;  3CX5 H;  3M91 A;  3PH0 A;  3E1I A;  1S9K E;  1SQX K;  1X79 B;  1AQT A;  1PPJ G;  1RH5 B;  3HUS B;  3B5N B;  2QJK C;  2RN0 A;  3WUT A;  5AEU A;  1W2B O;  2E5T A;  3EWK A;  2QJP B;  5KJ7 C;  2LXC B;  2CPB A;  2OYI B;  3V2R A;  2WT7 B;  3GKE A;  1XTC C;  2QSI A;  2HMM A;  5KLV G;  5APX A;  2E76 B;  2K37 A;  3EFG A;  3PRJ A;  4UB6 E;  3CCS P;  1HF9 A;  3VMI D;  2OTJ P;  1JEK A;  5AW0 B;  3UIA A;  2ITA A;  1DX7 A;  3HE4 A;  1GMJ A;  3L70 E;  1NU1 J;  3G4S P;  1YQ3 C;  5AEW A;  3N0Q A;  1JOC A;  2V7Q J;  3ABV C;  1IC2 A;  1Y8A A;  2NPS D;  1DEB A;  1NYH A;  3CCR P;  3AEF C;  1ULJ A;  1NU1 E;  5TJH A;  2K9J A;  3GOB A;  4OGQ D;  2Q9I A;  5AVZ B;  3H1L G;  4QUR A;  3VN0 A;  4NBD D;  3L75 D;  3GLM A;  4DZO A;  1SFC B;  2YIU C;  1CZQ A;  3MIW A;  3CCM P;  4HM6 A;  4GKG A;  1N7S C;  2KB7 P;  5APV A;  1MV8 A;  2WTY A;  2WSE H;  1MFZ A;  3TGU D;  3PJS K;  3R4Y A;  3B5N C;  1JY2 N;  1VQ5 P;  2MKV A;  4U3F D;  1FU1 A;  3HTK A;  1KTM A;  2OYI C;  1LTA C;  4I6M C;  4DCK A;  2I7F A;  2NUK A;  4IFM A;  1JNM A;  2A45 G;  2ZXX A;  2C0X A;  2E76 C;  1VQ6 P;  1SS1 A;  2HMO A;  3SWY A;  2R32 A;  1H89 A;  1SQP G;  2Y9Y A;  4H13 D;  1GU4 A;  2PRR A;  2FYU G;  3P32 A;  4GDO A;  4LLH A;  1BSN A;  5AW1 B;  2Z5H A;  1GW3 A;  3AEG C;  1L0L D;  1QL1 A;  2W6A A;  2Q3I A;  5K5G B;  1O7H A;  4WVZ A;  3Q5R A;  2YFI A;  3CXH E;  4D6T D;  4DOJ A;  3M0D C;  2E4P A;  1FZE A;  1HTL C;  1SFC C;  3OJA B;  5TIS H;  3L71 D;  4DJG A;  1GTW A;  1MKM A;  4JPZ B;  1RF1 B;  3KHU A;  2JJL A;  4GOE A;  1RY3 A;  3P8C D;  1UUW A;  1GL2 D;  1L0N D;  2L91 A;  2KIK A;  2FYU K;  3W68 A;  4N78 E;  2KNC B;  1GW4 A;  1KC8 Q;  2Z5I A;  1P84 D;  3H1J G;  4JQ0 D;  1BCC J;  3VYI A;  1SQX D;  3L72 J;  2B88 A;  3GTS A;  3MHV A;  2H7H A;  3H1I G;  1BCC E;  1NTM J;  3L74 E;  2XDJ A;  3Q5P A;  3H1K J;  2LR2 A;  1X22 A;  4XFJ A;  1T2K D;  3AEA C;  3USS A;  3L72 E;  2IX7 C;  1IFN A;  1RQU A;  2YFL A;  1JY3 O;  1Q2N A;  4QDF B;  1NTM E;  3H6P A;  2XKM A;  4DT0 A;  1FOS F;  2N1T A;  3H1K E;  4IFD K;  1JTH B;  4IOI H;  3AE9 C;  3T97 A;  1O7G A;  1EG9 A;  5KAI E;  3AEB C;  2Q3E A;  1AFO A;  2A06 G;  4WY4 B;  3TSI A;  3JSV C;  2K88 A;  1RF1 C;  3RL0 B;  2OYH A;  1RE4 C;  1J1E B;  1Q7Y Q;  3GL2 A;  1VF5 B;  3SFE C;  3U59 A;  5CCH C;  1EDK A;  2YFJ A;  4W7Z A;  3VOP A;  1JM1 A;  4HM0 A;  2XND H;  1VM9 A;  1LWU A;  2PAJ A;  1SQQ G;  4UB8 H;  2XU6 A;  1R5S A;  2B9B A;  2RH0 A;  3M0A A;  2QG4 A;  2B24 A;  4H0L B;  3V4Q A;  3E7K A;  4BRY B;  4EYY Q;  2FXP A;  2OQQ A;  3L70 D;  1M1J B;  2FYN B;  4HM5 A;  2C9L Y;  3LIE A;  1ZR2 A;  2YO2 A;  1VQN P;  1HVV A;  2HPC B;  4U7J A;  1N8R Q;  2N9B A;  4C7N B;  1NU1 D;  2YKQ A;  1FZC B;  2AEF A;  1VQM P;  4TLF A;  2BAS A;  2JWA A;  1URQ A;  4NB8 D;  1FC2 C;  3I56 P;  1SQQ K;  3WMM 0;  3GHG B;  3HRN A;  1KQG B;  1LTT C;  2W8Z A;  5CCG D;  3L75 J;  1LNQ A;  3BCC G;  4H44 B;  4L75 A;  3IF4 A;  4PD4 H;  2AEJ A;  1KYO E;  3TYY A;  1KFN A;  1SQB E;  2ZYL A;  3VMY A;  3RK3 B;  3RL0 C;  1J1E C;  2B87 B;  1PP9 E;  1VF5 C;  2N9Y B;  1G1J A;  2WSF J;  4YXD C;  1D7M A;  3BRT B;  2GBX A;  1VQO P;  3TNU A;  3CCL P;  5CJ4 A;  1RFS A;  2FFD C;  2ZJS E;  1PGJ A;  1N86 A;  4NB9 D;  5APQ A;  2IDB A;  2K3R A;  1N73 C;  3NTN A;  2XV5 A;  4WB4 A;  1E79 H;  2M0B A;  1KN7 A;  3GF7 A;  1M1J C;  3M06 A;  5APS A;  1SQB K;  4C46 A;  3PHL A;  1IZN B;  2R3S A;  2FYU D;  3O6Q B;  1UUV A;  1HUC A;  2WIT A;  2NPS A;  3VMA A;  1BSH A;  1Q90 C;  1KB9 I;  4JYC A;  3VMG D;  3O8Z A;  1BGY E;  2YVJ B;  2WPQ A;  2JEE A;  1L4A C;  3CXH D;  3EFF K;  4UB6 H;  2HOD B;  5KKZ B;  2Y0C A;  3GHG C;  1FZG A;  3VP9 A;  2FBW C;  1NTZ E;  3MP7 B;  3L71 J;  4HH2 A;  1CI6 B;  1LTS C;  3FXE A;  5APT A;  2QRX A;  3ITK A;  1WQL A;  4IFF A;  1H8A A;  3WUV A;  3KQG A;  1G2C A;  3JCU E;  1L0N J;  4N78 D;  1KZU B;  4PV1 B;  1KV4 A;  3H1H J;  2QJK B;  2HR3 A;  2KSE A;  1AQ5 A;  2I1K A;  4HM8 A;  2ZT9 C;  2H88 C;  3MUD C;  1S1C X;  2IBZ E;  3H1H E;  1SQX J;  1A02 F;  1BCC D;  1H0T B;  3HD7 C;  2WZ7 A;  1LJ2 A;  3L74 D;  3U1C A;  1Q81 Q;  2ZVO B;  1VQK P;  1NTZ K;  2GUV A;  2NVF A;  1YJW P;  5CBN A;  1OMI A;  3L73 E;  2M8R A;  4IL6 E;  2WPS A;  3L72 D;  1USD A;  4Y28 J;  5CMZ A;  1OFC X;  5BVZ A;  1K73 Q;  1NTM D;  4WY4 D;  1NGM B;  2Z4E A;  5DJT B;  3H1K D;  2IBZ I;  1AVO A;  2BMQ A;  3KDP B;  3SWF A;  2KOG A;  3CWB J;  3CCE P;  1J1D C;  5GTI E;  1YIJ P;  1Y47 A;  1OVR A;  4HM4 A;  3CWB E;  4CPG A;  1URQ D;  2HLO A;  4L74 A;  4QCK A;  1S5L E;  2FXO A;  4H0L D;  1N7S B;  2G3A A;  2RKL A;  4OH8 B;  3A5T A;  1GL2 A;  1WT6 A;  1KQS O;  2ZFC A;  4PV1 C;  2JDI H;  4EI2 A;  2KP8 A;  1KIL B;  1SQQ D;  2E75 B;  2Y0D A;  1PPJ E;  2H89 C;  3CXH H;  3FGA D;  3FOU A;  5CBO A;  2JR8 A;  1NTK G;  2E74 C;  1RF0 A;  4P1C H;  3QWO C;  1JB0 J;  3CLQ A;  3V6I A;  4EMJ B;  2D2C D;  2KYV A;  3L70 J;  5KLV E;  1R8E A;  5AW7 B;  1EZV G;  4EDF A;  4H44 D;  4NBB D;  3G6E P;  3FX0 A;  2WSC H;  1R5L A;  1FZB A;  1SP4 A;  1NJI Q;  3GL0 A;  3HUS A;  1MUU A;  2P58 A;  3GZY A;  3MD0 A;  2QM7 A;  1ZXG A;  1LTJ A;  2OYI A;  1KYO D;  1SQB D;  3EQQ A;  4YXW H;  4W80 A;  1PP9 D;  3H1L E;  1N2D C;  3MGN A;  5KLV K;  1NO4 A;  1E5W A;  4WWI A;  2R3C A;  4JBZ A;  5E79 E;  2IFM A;  2Q7C A;  3M9B A;  3RGU A;  3GB4 A;  2YNY A;  1KIL C;  5KAF E;  3NMD A;  2E75 C;  2PGD A;  1VQ8 P;  5CJ0 A;  3CMA P;  1UII A;  5KAI H;  2KS1 B;  2PP6 A;  2H43 A;  2ZYG A;  1S2E A;  1NWQ A;  1ZR4 A;  3H32 B;  2Y0E A;  3M0D A;  2FYU J;  3K5B A;  2BEQ D;  2YMY A;  4EOT A;  2KK7 A;  1IFP A;  3CD6 P;  1YQ4 C;  3Q5S A;  1BGY D;  1NOH A;  1SQP E;  2FYU E;  2IZ0 A;  1CW5 A;  1EXJ A;  4YPC A;  3CCU P;  3A0H H;  2BCC G;  1NTZ D;  2ZAE B;  1AVY A;  5CCG A;  2A45 I;  2WPR A;  1EDL A;  1Q86 Q;  3KZI E;  1FQT A;  3WU2 E;  5KJ7 D;  3RK2 B;  4HB1 A;  3V2N A;  3L35 A;  2QE7 H;  1RE3 A;  3VCP A;  1NKZ B;  1SQV G;  3A0B E;  4AAY B;  1BE3 G;  2FXM A;  5AVS B;  4O9B A;  2W6B A;  1FDM A;  1JUN A;  1ZLL A;  5C39 A;  2P67 A;  4R4L A;  3IN6 A;  3H1J J;  1SQP K;  4ZKP A;  1HJB A;  2IBZ D;  3H1H D;  1DD4 A;  1KYO H;  2XRX A;  5DJU B;  1GK6 A;  2KSJ A;  2WSS H;  1FZF A;  1JCD A;  3CX5 I;  1RQV A;  3L73 D;  2ZVN B;  3L74 J;  3H1J E;  1PGQ A;  3H1I J;  3G3Z A;  2M3E A;  3I55 P;  1BDC A;  4GOD A;  2WQY C;  1WRG A;  1LT9 B;  1DD3 A;  1RF1 A;  1SQV K;  1VQL P;  3V2Q A;  1MZ9 A;  2WSF H;  3H1I E;  5GTH H;  2NUM A;  4AYC A;  1N7S D;  2O1J A;  5AVX B;  3Q3D A;  1LP1 B;  3CME P;  2LKM A;  1T8Z A;  3B5N D;  2V4H A;  3CWB D;  2OYH B;  3AE3 C;  3OA7 A;  1HGZ A;  1MFT A;  5AVU B;  2K1A A;  3TK1 A;  3GTE A;  3RK2 C;  3HE5 B;  2ZXE B;  1FE6 A;  1YIT P;  3PLN A;  2E76 D;  1PPJ D;  1T3U A;  2A06 E;  3V4W A;  3CC4 P;  4WBA A;  2AXT E;  2DE5 D;  1HJ0 A;  1M8O B;  1SQQ J;  1YJN P;  2LXB A;  5H2F E;  2I1J A;  2YKP A;  3D6Z A;  4QDF A;  3CCQ P;  5B66 E;  4HJG H;  3L37 A;  4R4M A;  5B5E H;  5APW A;  3AEE C;  2W90 A;  4ZKU A;  1JTH A;  1SQQ E;  5KLV D;  1ZME C;  2P1J A;  2FFD B;  1JY3 N;  1N73 B;  2O3J A;  2C9N Y;  2FKW B;  2N1T C;  1LT9 C;  4WY4 A;  1T3J A;  2JO6 A;  5BOK A;  5CHX A;  2CK3 H;  1SFC D;  2KUB A;  1GD2 E;  1YBK A;  1KMI Z;  1KQL A;  2FYZ A;  2CPS A;  3SSU A;  2XNX A;  1P84 H;  1JY3 P;  2O01 N;  3RK3 E;  4PJ0 H;  1K05 A;  2OYH C;  2DE6 D;  2W27 A;  1SQB J;  3D71 A;  4IL6 H;  1L4A B;  4KHX A;  3H1L D;  3RL0 g;  4KT0 J;  1PP9 J;  3CC2 P;  4AIV A;  3AED C;  3C1L A;  1IK7 A;  5AW3 B;  1YYC A;  4BRY A;  3CPW O; 
#chains in the Genus database with same CATH homology
 3BCC E;  1RIE A;  3C0D A;  3T97 B;  2NVF A;  4QUR A;  5KLI C;  5M1B A;  1OMI A;  3L73 E;  4NBD D;  3GLM A;  4Y28 J;  2YIU C;  4HM6 A;  1O7N A;  1NGM B;  1OW8 A;  2E75 D;  2BMQ A;  2E4Q A;  3R4Y A;  3GMA A;  2WSE J;  2Q3W A;  5HL4 A;  2O01 J;  2ZT9 B;  1NDO A;  2MKV A;  1KTM A;  1G8J B;  2HMN A;  1KB9 E;  4HM4 A;  1U57 A;  3CWB E;  1DIP A;  1K04 A;  4OGQ B;  5L8R J;  2I7F A;  2NUK A;  4QCK A;  2E76 C;  2HMO A;  4H0L D;  2HMJ A;  2G3A A;  4NBG D;  5CXM A;  4PV1 C;  1KOR A;  4H13 D;  3AZC A;  2E75 B;  3S9O A;  3D89 A;  1PPJ E;  2H89 C;  1VCK A;  3FGA D;  3FOU A;  4GDO A;  2HML A;  1EXI A;  1FDI A;  2E74 C;  3AEG C;  2CKF A;  4P1C H;  3AE7 C;  1JB0 J;  4EMJ B;  2D2C D;  1O7H A;  2YFI A;  3Q5R A;  5KLV E;  1R8E A;  3VCA A;  3CXH E;  3O6Q A;  4P1B H;  1FDO A;  3AE5 C;  2E4P A;  2JZA A;  4H44 D;  4NBB D;  2DE7 D;  2YMK A;  1MKM A;  3AE1 C;  2NVE A;  4HM3 A;  3GL0 A;  1AJY A;  4H13 B;  3GZY A;  1UUW A;  1TU3 F;  2E74 B;  4Z1M H;  2JO1 A;  1VL2 A;  3EQQ A;  4OGQ C;  3EN1 A;  3AEC C;  3H1L E;  2D2C B;  2J5U A;  3GTS A;  1BCC E;  1PL5 A;  3AE4 C;  1PIX A;  4I7Z C;  3GB4 A;  3L74 E;  1VF5 D;  3Q5P A;  3DQY A;  4RKU J;  2NZ2 A;  2E75 C;  1ZOY C;  4XFJ A;  3AEA C;  3Q1M A;  3L72 E;  4QDC A;  3L75 E;  3D70 A;  3H25 A;  3VMH D;  1RQU A;  3AE2 C;  2YFL A;  4QDF B;  1NTM E;  1KIL E;  3H1K E;  3TGU E;  3AE9 C;  1O7G A;  3Q2Y A;  1EG9 A;  4U3F E;  4HM2 A;  3AEB C;  3GZX A;  3GCE A;  2BEQ D;  4H0L C;  4I7Z B;  1YQ4 C;  1ZP0 C;  3Q5S A;  2GBW A;  2FYN C;  3GL2 A;  1VF5 B;  4H13 C;  3SFE C;  1SQP E;  2XSO A;  2FYU E;  3SFD C;  1ZRT E;  2YFJ A;  2BMO A;  4QUP A;  1JM1 A;  4HM0 A;  1EXJ A;  1Q90 D;  1VM9 A;  2G8Y A;  4QUQ A;  3B71 A;  1NTK E;  1FQT A;  3VCP A;  2D2C C;  2B1X A;  4AAY B;  2B24 A;  4NBH D;  4H0L B;  1EZV E;  3LW5 J;  4H44 C;  2FXP A;  2OQQ A;  1L0L E;  3AE6 C;  4HM5 A;  3AE8 C;  1OW6 A;  4R4L A;  4NBE D;  3IN6 A;  4U7J A;  1G8K B;  4NBC D;  1DD4 A;  3L71 E;  2XRX A;  2BEZ F;  4HM1 A;  1Y9B A;  1RQV A;  2ZT9 D;  2NWF A;  3H1J E;  4NB8 D;  1L0N E;  1KQG B;  2QIW A;  2WQY C;  4H44 B;  1KYO E;  1SQB E;  1DD3 A;  1P84 E;  1SJG A;  2ZYL A;  3H1I E;  2NUM A;  1PP9 E;  1VF5 C;  2WSF J;  1SQX E;  4YXD C;  1O7M A;  3Q3D A;  2JP3 A;  2WPV B;  2GBX A;  4PD4 E;  4QDD A;  3AE3 C;  2K9Y A;  1WMK A;  1KQF B;  3GF3 A;  3GTE A;  1RFS A;  1ULI A;  1PV3 A;  4HKV A;  2QJP C;  2QJY C;  4IL6 X;  4NB9 D;  3IAO A;  2IDB A;  5KKZ C;  1NYK A;  4HJL A;  3GF7 A;  2XR8 A;  4TT3 H;  2E76 D;  2A06 E;  1UUV A;  2DE5 D;  1HJ0 A;  1O7P A;  2NVG A;  4PV1 D;  4HM7 A;  1O7W A;  3D6Z A;  4QDF A;  1Q90 C;  3G9R A;  4R4M A;  3VMG D;  2QJK C;  2BCC E;  2BMR A;  3AEE C;  3D6Y A;  2YVJ B;  2XSH A;  5AEU A;  1SQQ E;  1ZME C;  3EWK A;  1OW7 A;  1S5L X;  2E74 D;  3GKE A;  3CX5 E;  1SQV E;  2QSI A;  2FBW C;  1NTZ E;  2QPZ A;  2HMM A;  2JO6 A;  1BE3 E;  5BOK A;  4NBF D;  2E76 B;  1WQL A;  4YTP C;  2P10 A;  1HF9 A;  3VMI D;  1KMI Z;  4PV1 B;  3RK3 E;  1GMJ A;  1UIX A;  1K05 A;  3L70 E;  2DE6 D;  2WSC J;  1YQ3 C;  5AEW A;  3D71 A;  3N0Q A;  4HM8 A;  2V7Q J;  3ABV C;  2ZT9 C;  3RL0 g;  3C8V A;  4KT0 J;  2H88 C;  4AIV A;  3AED C;  1NYH A;  2HMK A;  1S1C X;  1IK7 A;  2IBZ E;  3H1H E;  4NBA D;  3AEF C;  1ULJ A;  1NU1 E;  3GOB A;  4OGQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...