2QJPC

Crystal structure of wild type rhodobacter sphaeroides with stigmatellin and antimycin inhibited
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
179
structure length
179
Chain Sequence
b'GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
total genus 46
structure length 179
sequence length 179
chains with identical sequence F, I, L
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qjpC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qjpC02
3CWBE 4NBFD 4QCKA 1FQTA 2E74D 4I7ZB 4RKUJ 4PV1D 3BCCE 3D89A 1EZVE 3LW5J 5BOKA 1RIEA 4P1CH 4PD4E 2NWFA 2B24A 2HMNA 2NUMA 3GKEA 4NBED 1NYKA 5AEWA 2I7FA 1VM9A 2YVJB 1Q90D 2XR8A 2QIWA 1O7HA 3C0DA 1VF5B 1O7GA 1KB9E 2HMKA 3L75E 1O7PA 3EN1A 2DE6D 1JB0J 4IL6X 2YIUC 2DE7D 2XSOA 2XRXA 1NU1E 1SQPE 2GBWA 2BMRA 4H13B 2Q3WA 2FYUE 1O7NA 2ZYLA 2E4PA 4NBBD 4H44B 3GZXA 5KLIC 2NVEA 4QURA 1VF5D 3GTEA 2YFLA 1WQLA 1PP9E 5KKZC 4HJLA 4QUQA 1S5LX 1O7WA 3VMGD 2A06E 2B1XA 3H1JE 3DQYA 4NB9D 4QDFA 3GB4A 1JM1A 1UUVA 4NB8D 1SQBE 1UUWA 3CX5E 3L70E 4QUPA 2XSHA 3VMID 2QSIA 3AZCA 1NDOA 2WSEJ 3CXHE 1SJGA 3H1LE 4HM6A 2ZT9B 4EMJB 1BE3E 2E4QA 2NVGA 3H1HE 1SQXE 4HM8A 1ZRTE 2HMMA 3GL2A 4U3FE 5KLVE 3TGUE 4H0LB 1NTME 5AEUA 3GOBA 2JO6A 3C8VA 4AIVA 2D2CB 2YFIA 5HL4A 1ULIA 2NUKA 4NBDD 3VCAA 1EG9A 2HMJA 2HMOA 2QPZA 4HM1A 2E74B 4PV1B 3GL0A 1SQQE 1VCKA 3EQQA 1G8JB 4QDCA 2BMOA 4HM0A 4HM2A 1P84E 2QJYC 1PPJE 2NVFA 4HM7A 2K9YA 5L8RJ 4H13D 1ULJA 3VCPA 4H44D 1RFSA 4Y28J 2BMQA 4HM5A 2JZAA 4KT0J 2QJPC 2WPVB 1G8KB 3GCEA 3H1KE 4NBCD 2DE5D 4OGQB 4HM3A 4AAYB 4NBAD 2WSFJ 2HMLA 1NTKE 3FOUA 1KYOE 2E76B 3L71E 2E75B 2E75D 4HKVA 1O7MA 2FYNC 2GBXA 4HM4A 4NBHD 2ZT9D 2QJKC 1SQVE 2IBZE 1BCCE 4NBGD 3GTSA 4P1BH 2O01J 1L0NE 1Q90C 2YFJA 3H1IE 4OGQD 2WSCJ 3L73E 4QDDA 3L72E 4H0LD 4QDFB 1NTZE 3VMHD 3L74E 3GZYA 2E76D 2CKFA 3N0QA 5CXMA 2D2CD 1L0LE 2BCCE
chains in the Genus database with same CATH superfamily
1RY3A 1SQQJ 2ZYDA 1KQLA 1T2KD 2NPSA 3CCUP 2VRSA 1QL1A 3KZIH 1HTLC 1RIEA 1JMMA 1JCDA 2KP8A 3CWBD 3AEGC 2XR8A 1N7SC 1KB9E 2FXPA 1GK6A 3TDKA 5AVVB 3C1LA 4HKZH 4QMAA 2WITA 3H32B 2Y0CA 2Y9ZA 1KMIZ 2DW3A 2YNYA 3S4RA 1L0LG 2QSIA 3ZDMA 3BASA 2XDJA 2W6BA 2WZ7A 3VYIA 1S5LE 2E4QA 2Q1KA 4WY4C 4R4LA 3KQGA 4IFMA 2C0XA 3PJSK 2ITAA 3CXHD 3GW6A 4K3AA 3H1LD 4N78D 4QDCA 3IFMA 1MUUA 2YMYA 1L0NK 3TSIA 1WT6A 1K04A 2FXMA 1SQPG 2FYUD 3EWKA 4KT0J 3NXSA 1FZCA 2DE5D 1NTKK 3H1JG 3WMM0 3RL0B 1SQBG 1SQVE 3TGUJ 5GTHH 4QDFB 1BE3G 2I1JA 1SQXG 2E76D 3KHUA 4L73A 3LIEA 1RQVA 2YKPA 4I7ZB 4PV1D 3L74J 1FC2C 3SWYA 4YXDC 1SQQG 4EDFA 1RE4C 2NWFA 3Q2YA 1Q90D 2K88A 2PGDA 1X8YA 4LGDE 4N78E 1O7HA 2HMKA 2DE6D 1PGJA 2KS1A 3L72J 2AEJA 5APSA 2FYUE 2ZYLA 1YJNP 2IBZG 2P58A 1JY2O 3A0HE 1FE6A 3V5BA 1QVGO 1JM1A 1PIXA 1JO5A 4NB8D 1IFIA 3O6QB 1RQUA 1NDOA 2LR2A 2ZT9B 2G8YA 1LT9B 1LTTC 1QGKB 2RMZA 3VP9A 1FOSE 3CX5D 4UB6E 1FBMA 3G9RA 2W6JH 1EG9A 3RK3D 3E7KA 5KTBA 3JSVC 3HTKA 2CK3H 5APUA 1PPJE 3M0DC 3P8MC 3MIWA 1U7JA 2KIKA 1EZVG 1SFCA 2QJPC 1FU1A 4NBAD 1LJ2A 1KD1Q 1N73B 2FY8A 1JY3O 1VPCA 3EFGA 3A7OA 1CI6A 3E1IA 2A45I 3TGUG 4IOIH 1RF1C 3VMAA 1YBKA 4Y99C 2ZVNB 4RESB 1S4XA 3TF5A 3CC4P 2GM4A 2I7FA 4BRYB 3KDPB 3VOPA 5KLIB 3RK3E 4I1LA 1SQVJ 3AE3C 4GT1A 1URQD 3TNUB 2Q6QA 1VQLP 2H89C 1UUVA 1PL5A 1EXIA 3L70E 3G71P 4JBZA 2KI7B 1MFTA 1ZRTE 4U3FE 2C9LY 2NPSB 3SFDC 2WVRA 3WUVA 2YKOA 3H1LJ 5CCGA 1OIPA 5AVTB 2HMJA 1L4AD 1LGHB 1YJ9P 3O8ZA 1FZAA 4PV1B 2FYUJ 1RHZB 2NVFA 1LTAC 1J2JB 1YTZI 4TT3H 2BMQA 5TISE 4YXWH 2KOGA 1XTGB 1Y9BA 3VMXA 1DX7A 1KV4A 2HMLA 1HJBA 1O7MA 1IFPA 4NBHD 3CCQP 5KAFH 1KILD 1GMJA 3P32A 3GZYA 3VMZA 4QCKA 1FQTA 1AJYA 3LW5J 1NKNA 2YIUB 1HJ0A 3NFQA 3OW2O 1VQ7P 2WWWA 4I7ZC 3W68A 1O7PA 1M1JA 1P84H 1NTMG 4PD4D 2GUSA 1BDDA 1LNQA 2B87A 1BCCD 1SQVG 5DJTB 1FZCB 2H7HA 3H25A 5GTHE 2I1KA 1S5LH 2A06E 3DQYA 3F5HA 2CPSA 1MZ9A 5CCHA 3M9QA 2Y0EA 2ZYAA 3BCCD 1ZW0A 3LIDA 1PP9D 3PRJA 4W7ZA 1IFDA 2IYOA 5E79H 2R3SA 2M5AA 2AEFA 2ZT9C 5AW8B 1KC8Q 2YKQA 2BMOA 4HM0A 4WWIA 1R5SA 1USDA 1Q7YQ 2YO3A 2QJKB 3JC22 3IR9A 1T2KC 3CL3D 1QL2A 3E1RA 2KS1B 1ZN5A 5BVZA 3B5NA 2W90A 1GL2A 1A02J 1GZLA 1WMKA 2E42A 1BCCE 2O01J 2P7JA 4D6TE 3VMHD 2WSCJ 5CXMA 1N73C 2BCCE 2Y0DA 4RKUJ 3BCCE 3R2PA 3FXEA 3GHGA 4KJMA 1PPJG 3I55P 4TLFA 2NUMA 2KXPB 5CMZA 3HTKB 3USSA 2QIWA 3O6QA 2JKVA 3H1KD 1N7LA 2H43A 2IBZI 1M1KQ 1SFCB 2Q3WA 1LTJB 5KLIC 1EQ7A 5KJ7C 4QUQA 2BEQD 3B8EB 1KORA 1KFMA 4YTPC 3RBXA 3I5CA 1FDOA 1CI6B 2LKMA 1G2CA 3MHVA 3PHLA 2LXCB 4HM6A 2B89A 3SFEC 3H1HE 5KLVK 1OVRA 3GOBA 2R3CA 4AIVA 2WPSA 3AE6C 1NTZG 4W7YA 3Q5PA 5APVA 1EZVI 2NPSC 4HM7A 5KLVD 2ZJSE 4RJTA 3D6YA 3FWNA 3B5ND 1RE3A 2YXRB 1JTHA 4PV1C 4AQRD 3H1KE 2IX7C 2P67A 1E79H 4GIFA 2E75B 1EDIA 3KYQA 4HM4A 4XFJA 3L70G 1E5WA 4NBGD 5CJ4A 2GUVA 1Q90C 2YFJA 3L74E 1EC5A 2KUBA 1SS1A 2JWAA 4U3FG 1AQTA 1NHLA 3CX5H 3MGNA 2XKMA 1NKZB 1N2DC 1S1CX 4BXLA 3AEDC 1NYKA 1U7MA 4WVZA 1CW5A 1KYOI 4ASWA 3I56P 4B86A 1O7GA 1FJPA 1YJWP 3QH9A 1BCCJ 2YIUC 3L71D 2MKVA 3D70A 2DE7D 4D6TJ 1S3JA 1ZR2A 1IFNA 2Q3IA 2BCCJ 5KAFE 4HJLA 1S5LX 3G6EP 3CPWO 3BCCJ 5CHXA 2O01H 2WSCH 1USEA 1FZCC 2J59M 2V4HA 2WSEJ 1K9MQ 1T3JA 3N7NA 1NTMK 4KHXA 1KB9I 5TISH 1KQSO 1PGQA 3L75D 1JOCA 2KLUA 1P84E 2W6AA 4H13D 1X9VA 1ULJA 1NJIQ 1HGVA 2ZXXA 1BDCA 2IZ0A 3PTZA 1L2PA 2JZAA 2I8DA 2WT7A 1M1JB 1BGYD 3GCEA 2B87B 2A06G 1PFIA 2QM8A 3L71E 2GBXA 1W2EA 3H1HJ 5BU8B 1T3UA 2QJKC 4GODA 2HODA 1T6AA 3AECC 4OGQD 1NU1G 5E79E 3CWBE 2P1JA 2N1TD 3FGAD 4EIJA 1L0ND 5BOKA 2WSSH 2M5AB 3H1KJ 2NZ2A 1VQ5P 3HE4A 5KKZB 3L75E 1DEBA 1NTKD 1R8EA 2V7QH 3FWLA 3MTUE 4WBAA 4NPFX 3W67A 4I6MC 1BCCG 1VF5D 3B5NB 1OW6A 4D6TG 2FYZA 1GL2B 3S1KA 3N4XA 1AA0A 3PLNA 2QVAA 2BCCG 1SFCC 4W80A 2QEXP 3BCCG 3CXHE 1SJGA 3H1LE 2YMKA 2L5GB 3A3YB 2FXOA 3GHGB 1URQA 1Y8AA 3VCAA 5KLVJ 1MKMA 2KNCA 4IFDK 3QWOC 2K9YA 1AVOA 5L8RJ 5APTA 2JJLA 3V2QA 5AVYB 1N86A 3AEEC 2OYIA 4YPCA 2W8ZA 5CBNA 1LWUA 1AV1A 1NTKE 1IFJA 2PP6A 3M91A 2N9BA 5APWA 2HPCA 4PJ0E 1NGMB 3Q3DA 1IO4A 4H0LD 1R5LA 3HD7A 3H1HG 1NTZK 5GTIE 2WSEH 1L4AA 4HM1A 2E75C 1G2CB 2E74D 4ZMDA 2NRGA 1LTJA 2HR3A 1NH4A 2LXBA 4O9BA 3L73D 5K5GB 2HMNA 4NBED 1N7SD 3L71J 3C0DA 3H1KG 5CCGC 1NWQA 1J1DB 4M3LA 2XSOA 1KILA 2P2UA 3AEFC 1JTHB 4H13B 3ABVC 1EDLA 3II6A 5AVRB 3CWBJ 1YTZT 1Z56A 1CSBA 3L74G 3BATA 2JDIH 3GB4A 3EQ2A 1YQ4C 3CX5E 2R5DA 1PGOA 4WY4D 1EDJA 1KQFB 1M57D 3L75J 5HL4A 1ULIA 3P7KA 3CMAP 3L72G 3M06A 3EQQA 1DEEG 3UIAA 3SWFA 5KAIE 2XNDH 1HWTC 1HBWA 3V2NA 3Q5RA 2FYNB 1ZMEC 3M0DA 2WPVB 1VQNP 1YIJP 2E76B 1JUNA 5M1BA 3HD7D 2KZIA 1M1JC 3CC7P 2M8RA 2KSEA 3MZWB 1NOHA 3CLQA 1ZR4A 2D2CD 2O01N 1L0LK 1L0NJ 3L4FA 2WQYC 1JNMA 5CCHC 1H89A 3A0BE 1VM9A 1NTKJ 2KSJA 1LP1A 1BSHA 1IK7A 4N6JA 3RL0C 2POHA 3L71G 2WT7B 1NU1K 1SQPK 1FS0E 4GDOA 3IN6A 2J58A 1VQ8P 2CPBA 1WQLA 5KKZC 2FBWC 3M0AA 3MP7B 4DJGA 2HODB 1UUWA 3CWBG 1SQBK 3CCVP 2XSHA 4R4MA 3VMID 3WUTA 4HJGH 3B5NC 3RK3B 1GL2C 2AEMA 2NVGA 2ZFCA 2HMMA 4HM8A 1SQXK 4UB8E 5AW7B 4H0LB 5AEUA 2P10A 5BU5A 2JO6A 1SQBD 2YFIA 1PZQA 4NBDD 2OTJP 1VQKP 2E74B 1SQQK 1KQGB 1SQXD 1ZLLA 3RL0g 2E43A 1D7MA 1RFSA 3GHGC 3HE4B 5AW5B 1KILE 3Q5SA 1GW3A 4WB4A 1S9KD 2RH0A 1LT9C 1NYHA 3H1LG 4OWFA 1GDTA 1HVVA 2ZVOB 1GD2E 5B5EE 2OYHA 1RH5B 3GG2A 2FYUG 4EOTA 2IFNA 2IBZD 2HFED 3MUDA 1GU5A 1DD3A 4PD4E 1URQB 2E5YA 3M9HA 2KNCB 5AW6B 2W27A 3VN0A 3CCSP 3V4WA 2ZYGA 5DJUB 3OAKA 2IPPA 2OYIB 3CXHH 1LWUB 4JQ0D 1NAYA 1PP9E 1K05A 4GOEA 3VMYA 1J1DC 4IL6E 1RE3C 2HPCB 1J1EB 3AZCA 1EZVD 2L91A 3HD7B 1M8OB 1L4AB 3CMEP 1JY2N 4ZNCA 1OXZA 3GL2A 1RF0A 4DCKA 2XNXA 1Q82Q 1VQPP 2D2CB 1DD4A 4L75A 3G3ZA 1H88A 2AXTH 1H8AA 1VCKA 3SSUA 1G8JB 2O3JA 3NTNA 3L36A 2OYOA 3TGUD 2Q7CA 2PFXA 4H44D 3KXDA 5CJ0A 4PJ0H 1YQ3C 1W2BO 3JCUE 3AEBC 3RK2D 5AW3B 5GTIH 1KILB 4AAYB 4RO0A 1NO4A 2R5BA 2FYNC 1S72P 1M90Q 1AQ5A 4EI2A 4GOFA 3CCLP 2PAJA 2KYVA 4GKGA 2E76C 3H6PA 1KYOD 5AVQB 3RBZA 3C9IA 4NBFD 2V7QJ 3U1AA 1EZVE 1FZGA 2ZXEB 3CC2P 1JY3N 4U7JA 3CI9A 4P1CH 3HRNA 1OWAA 2HLOA 5AW4B 2R32A 2B24A 3K5BA 4ZKPA 4DT0A 2YVJB 3AE8C 2HYNA 1MFZA 3WU2E 3EN1A 3CD6P 2BMRA 3AE5C 3GZXA 1S2EA 3H1ID 1YITP 1EDKA 5AW9B 2M0BA 1KB9D 1KN7A 3VMGD 2N1TA 2B1XA 1FOSF 2JR8A 4NB9D 1QLED 2KLVA 1HH0A 3EFFK 1TU3F 2E5TA 2K9JA 5KLVE 5KAIH 3HE5A 4CPGA 3GMAA 2JEEA 1AFOA 5CBOA 3R4YA 4JYBA 1YI2P 2QPZA 2QRXA 3RK3C 3GL0A 2O1JA 2B88A 4H0LC 1PP9J 1LP1B 4HM5A 1GK4A 2E74C 4OVNF 1Q81Q 4NBCD 1VQ4P 3AEAC 2Z5IA 4JF7A 1SQVK 1NAFA 3H1IE 1VQMP 2CKFA 1NTMD 3A0BH 4C7NA 1P84I 3P8CD 1SQVD 1GU4A 3GLMA 2G3AA 1YYCA 3VTPC 5AVUB 2OGUA 4I2LC 3HUSA 2BASA 3BRTB 2XV5A 4MN4C 2FFDA 1Y47A 1YHQP 1URQC 2XRXA 2GBWA 2C9NY 1OFCX 1HGZA 2FYUK 2GA1A 4H44B 1A02F 2NVEA 4QURA 1OVVA 1M7LA 3AE7C 5KJ7D 3CCEP 1O7WA 4UB8H 1QX8A 4HB1A 1AVYA 3RK2B 3A5TA 1KZUB 3IAOA 2OYIC 1LWUC 3V2RA 2OYHB 3L37A 1VQOP 1N7SA 2QJYB 1NTME 1J1EC 3P8CE 3HD7C 1BGYE 1HF9A 2HMOA 1L4AC 2JWDA 3CCJP 2SPZA 2NPSD 1GTWA 1UIIA 3AE1C 1LTJC 2D2CC 5TJHA 1LTIC 1LTGC 1BSNA 1PP9G 1VDFA 5B5EH 1PPJD 3CXHI 3BVHA 1IJDB 4WY4A 2Q3EA 1L0NE 1KILC 5AVZB 4PD4H 5EFWB 4ASVA 4DOJA 2WSFH 1QVFO 2AXTE 3V2PA 3V4QA 4ZKUA 3GKEA 1MV8A 5AEWA 2OTKE 1ZXGA 4IL6H 2XZRA 2KZJA 3H1IJ 3AE4C 4L74A 4NBBD 4AYCA 1H0TA 2YFLA 2XU6A 1NTZD 3G4SP 1JEKA 1RE4A 2QG4A 5AW2B 5B66H 4L76A 1Q2NA 4IFFA 5C39A 4HYTB 3L70D 3JCUH 3CCRP 2W83C 5AVWB 1N8RQ 1OMIA 1ZP0C 1ZRTD 1CZQA 4U3FD 2PRRA 3AE9C 1FZEA 2KK7A 3CX5I 1SP4A 4OGQB 1JCCA 1X0TA 2YXQB 4K35A 3FXDA 2JO1A 1X79B 1NTMJ 2N1TB 2IZ1A 3L73E 4QDDA 1NTZE 2JP3A 5KLVG 1BGYJ 1XTCC 4NPEA 5APYA 2K9JB 3WU2H 3T97A 5H2FE 3HE5B 3TK1A 2H8PD 2Q9IA 2RN0A 2AXCA 2WPRA 4XE5B 3M9BA 3B71A 2K1AA 2R44A 1VF5B 3KZIE 2K37A 3L35A 3BRVB 5APQA 2H88C 1OX3A 3AE2C 1DIPA 1RF1A 1UIXA 3H1IG 1SLQA 1L0LD 1SVFA 1KYOH 2Y9YA 1SFCD 3U1CA 1FDMA 2N9YB 3CCMP 4H44C 4EMJB 1JM0A 5AVXB 2A06D 4C7NB 3RK2C 2Z4EA 1K73Q 3C8VA 2OYHC 2ZAEB 4OH8B 5APXA 1WRGA 3HUSB 2QJYC 3GF3A 2J5UA 1NU1D 1SQPD 1HUCA 3NMDA 4Y28J 2OQQA 3RGUA 3MUDC 5AVSB 2FFDB 3WUUA 1KB9H 4HM3A 3H1JD 3H32A 4LC1A 1ZV8A 1M56D 2YO2A 2IYPA 3Q1MA 1G1JA 1BE3D 2BEZF 3D71A 3L75G 1L0LE 2E75D 4N3YB 1X22A 3U59A 3D89A 1N7SB 1BGYG 1SQQD 4D6TD 1OW7A 2O1KA 3SWKA 2BCCD 2FKWB 2C0WA 1FJKA 1RF0C 4BWNA 1U57A 3GF7A 5CCGD 3TYYA 1JB0J 4HH2A 4IL6X 4XA4A 5AW1B 1NU1E 1SQPE 3L73J 1NTZJ 2E4PA 3GTEA 1L0NG 1IFMA 1LT1A 1OW8A 3H1JE 4WY4B 4QDFA 2HG5D 1FZBA 1VQ9P 1Q86Q 1SQBE 3F89A 4PD4I 1OVUA 2M3EA 2IDBA 1BE3E 1PGPA 1NTKG 1SQXE 3B4SA 3L70J 2NUKA 1K8AQ 1LTBC 4U3FJ 2Z5HA 1SQQE 2QM7A 3H1HD 2K3RA 2KB7P 4H13C 1S9KE 5AW0B 1VL2A 1KTMA 2M3BA 3V6IA 1ZOYC 3PP5A 1H0TB 2IFMA 5B66E 2QA4P 2IBZE 4P1BH 3IF4A 1NVOA 1G1IA 4OGQC 3A0HH 3KPEA 3N0QA 1IK9A 1LT9A 2B9BA 2OTLP 2A45G 2N1TC 4C46A 4C7RA 5CCHD 4LLHA 1DH3A 3L74D 1JMBA 1EXJA 1LTSC 3FX0A 2Q5UA 4UB6H 1VQ6P 4NPDA 3RL0D 1JY2P 1KFNA 3LW5H 1N73A 1QEXA 1O7NA 1L0LJ 3S9OA 1VF5C 3L72D 3L73G 3OJAB 2QE7H 2WMMA 1FDIA 4EYYQ 1PV3A 4QUPA 2A45H 3MD0A 1GL2D 2UWJE 3TGUE 4JYCA 3T97B 2OARA 3VP8A 1T8ZA 2QJPB 4BRYA 1NU1J 1SQPJ 1OZHA 4HM2A 1FAVA 5KJ7A 4JPZB 4DZOA 1IC2A 3VCPA 2WTYA 2MJZA 1W5CE 3TNUA 3H1JJ 3A2AA 1G8KB 2RKLA 1SQBJ 1GW4A 2WPQA 1FZFA 4Z1MH 3HUSC 2WSFJ 3FOUA 1JY3P 1P84D 1KYOE 1BE3J 4HKVA 3OA7A 1RF1B 3PH0A 2ZT9D 1SQXJ 2FFDC 3D6ZA 4Y99B 4A7PA 1IZNB 5H2FH 3GTSA 3L72E 4AUWA 3ITKA
chains in the Genus database with same CATH topology
4RKUJ 3BCCE 2WQYC 1RIEA 2NUMA 3GKEA 5AEWA 3AEGC 1VM9A 2XR8A 2QIWA 3O6QA 1IK7A 1KB9E 2FXPA 2Q3WA 4GDOA 3IN6A 3AE4C 4NBBD 5KLIC 2YFLA 1WQLA 5KKZC 4QUQA 2FBWC 2BEQD 1KMIZ 1KORA 4YTPC 1UUWA 1FDOA 2XSHA 4R4MA 3VMID 2QSIA 4HM6A 3SFEC 2E4QA 2NVGA 3H1HE 4HM8A 2HMMA 4H0LB 5AEUA 4R4LA 2P10A 3GOBA 2JO6A 4AIVA 2YFIA 4NBDD 3AE6C 2E74B 3Q5PA 4QDCA 1OMIA 1ZP0C 1KQGB 4HM7A 3RL0g 1K04A 1RFSA 3EWKA 3D6YA 3AE9C 4KT0J 1KILE 4PV1C 3H1KE 2DE5D 4OGQB 3Q5SA 2E75B 4HM4A 4XFJA 2JO1A 1SQVE 4NBGD 1NYHA 1Q90C 2YFJA 4QDFB 3L73E 4QDDA 1NTZE 2JP3A 3L74E 2E76D 1RQVA 4I7ZB 4PV1D 4YXDC 1DD3A 4PD4E 2NWFA 1S1CX 3AEDC 1NYKA 3Q2YA 3B71A 1Q90D 1O7HA 1VF5B 1O7GA 2HMKA 2DE6D 2YIUC 2DE7D 2MKVA 3D70A 2H88C 2FYUE 3AE2C 2ZYLA 1DIPA 1UIXA 1PP9E 4HJLA 1S5LX 1K05A 1JM1A 1PIXA 4NB8D 3AZCA 1RQUA 4H44C 1NDOA 2WSEJ 2ZT9B 4EMJB 2G8YA 3GL2A 3C8VA 2D2CB 3G9RA 1DD4A 1EG9A 1VCKA 1G8JB 1P84E 2QJYC 1PPJE 3GF3A 2J5UA 4H13D 1ULJA 4H44D 4Y28J 2OQQA 2JZAA 1YQ3C 2QJPC 3AEBC 3GCEA 4HM3A 4AAYB 4NBAD 3L71E 2GBXA 2FYNC 2QJKC 3Q1MA 2BEZF 3D71A 3AECC 4OGQD 2E76C 1L0LE 2E75D 3CWBE 4NBFD 2V7QJ 3D89A 1EZVE 3FGAD 4U7JA 5BOKA 4P1CH 1OW7A 2B24A 2I7FA 2NZ2A 2YVJB 3AE8C 3RK3E 1U57A 3GF7A 3L75E 3EN1A 1R8EA 1JB0J 3AE3C 4IL6X 1NU1E 1SQPE 2BMRA 3AE5C 2E4PA 3GZXA 1VF5D 3GTEA 1OW6A 3VMGD 1OW8A 2B1XA 3H1JE 2H89C 4NB9D 4QDFA 1UUVA 1PL5A 1EXIA 1SQBE 3L70E 2IDBA 3CXHE 1SJGA 3H1LE 1TU3F 2YMKA 1BE3E 1SQXE 5KLVE 1ZRTE 4U3FE 3SFDC 3GMAA 3R4YA 2NUKA 3VCAA 2HMJA 1MKMA 2QPZA 4PV1B 3GL0A 1SQQE 2NVFA 2K9YA 4H0LC 5L8RJ 4H13C 4TT3H 2BMQA 1VL2A 1KTMA 4HM5A 3AEEC 1Y9BA 2E74C 4NBCD 1ZOYC 2HMLA 1NTKE 3AEAC 1O7MA 4NBHD 2IBZE 4P1BH 1NGMB 3H1IE 3Q3DA 4H0LD 1GMJA 4OGQC 3GZYA 2CKFA 3N0QA 4HM1A 2E75C 4QCKA 1FQTA 2E74D 3GLMA 2G3AA 1AJYA 3LW5J 1HJ0A 2HMNA 4NBED 1EXJA 4I7ZC 3C0DA 1O7PA 2XSOA 3AEFC 2XRXA 2GBWA 4H13B 3ABVC 1O7NA 4H44B 4QURA 2NVEA 3H25A 3S9OA 3AE7C 1VF5C 1O7WA 2A06E 3DQYA 3GB4A 3IAOA 1FDIA 1YQ4C 3CX5E 1PV3A 4QUPA 1KQFB 3TGUE 1NTME 3T97B 5HL4A 1ULIA 2ZT9C 1HF9A 2HMOA 3EQQA 2BMOA 4HM0A 4HM2A 3AE1C 3VCPA 2D2CC 3Q5RA 1ZMEC 2WPVB 1G8KB 4Z1MH 2WSFJ 3FOUA 1KYOE 2E76B 4HKVA 5M1BA 2ZT9D 1WMKA 3D6ZA 1BCCE 3GTSA 2O01J 1L0NE 3VMHD 2WSCJ 3L72E 5CXMA 2D2CD 2BCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB E;  4NBF D;  4QCK A;  1FQT A;  2E74 D;  4I7Z B;  4RKU J;  4PV1 D;  3BCC E;  3D89 A;  1EZV E;  3LW5 J;  5BOK A;  1RIE A;  4P1C H;  4PD4 E;  2NWF A;  2B24 A;  2HMN A;  2NUM A;  3GKE A;  4NBE D;  1NYK A;  5AEW A;  2I7F A;  1VM9 A;  2YVJ B;  1Q90 D;  2XR8 A;  2QIW A;  1O7H A;  3C0D A;  1VF5 B;  1O7G A;  1KB9 E;  2HMK A;  3L75 E;  1O7P A;  3EN1 A;  2DE6 D;  1JB0 J;  4IL6 X;  2YIU C;  2DE7 D;  2XSO A;  2XRX A;  1NU1 E;  1SQP E;  2GBW A;  2BMR A;  4H13 B;  2Q3W A;  2FYU E;  1O7N A;  2ZYL A;  2E4P A;  4NBB D;  4H44 B;  3GZX A;  5KLI C;  2NVE A;  4QUR A;  1VF5 D;  3GTE A;  2YFL A;  1WQL A;  1PP9 E;  5KKZ C;  4HJL A;  4QUQ A;  1S5L X;  1O7W A;  3VMG D;  2A06 E;  2B1X A;  3H1J E;  3DQY A;  4NB9 D;  4QDF A;  3GB4 A;  1JM1 A;  1UUV A;  4NB8 D;  1SQB E;  1UUW A;  3CX5 E;  3L70 E;  4QUP A;  2XSH A;  3VMI D;  2QSI A;  3AZC A;  1NDO A;  2WSE J;  3CXH E;  1SJG A;  3H1L E;  4HM6 A;  2ZT9 B;  4EMJ B;  1BE3 E;  2E4Q A;  2NVG A;  3H1H E;  1SQX E;  4HM8 A;  1ZRT E;  2HMM A;  3GL2 A;  4U3F E;  5KLV E;  3TGU E;  4H0L B;  1NTM E;  5AEU A;  3GOB A;  2JO6 A;  3C8V A;  4AIV A;  2D2C B;  2YFI A;  5HL4 A;  1ULI A;  2NUK A;  4NBD D;  3VCA A;  1EG9 A;  2HMJ A;  2HMO A;  2QPZ A;  4HM1 A;  2E74 B;  4PV1 B;  3GL0 A;  1SQQ E;  1VCK A;  3EQQ A;  1G8J B;  4QDC A;  2BMO A;  4HM0 A;  4HM2 A;  1P84 E;  2QJY C;  1PPJ E;  2NVF A;  4HM7 A;  2K9Y A;  5L8R J;  4H13 D;  1ULJ A;  3VCP A;  4H44 D;  1RFS A;  4Y28 J;  2BMQ A;  4HM5 A;  2JZA A;  4KT0 J;  2QJP C;  2WPV B;  1G8K B;  3GCE A;  3H1K E;  4NBC D;  2DE5 D;  4OGQ B;  4HM3 A;  4AAY B;  4NBA D;  2WSF J;  2HML A;  1NTK E;  3FOU A;  1KYO E;  2E76 B;  3L71 E;  2E75 B;  2E75 D;  4HKV A;  1O7M A;  2FYN C;  2GBX A;  4HM4 A;  4NBH D;  2ZT9 D;  2QJK C;  1SQV E;  2IBZ E;  1BCC E;  4NBG D;  3GTS A;  4P1B H;  2O01 J;  1L0N E;  1Q90 C;  2YFJ A;  3H1I E;  4OGQ D;  2WSC J;  3L73 E;  4QDD A;  3L72 E;  4H0L D;  4QDF B;  1NTZ E;  3VMH D;  3L74 E;  3GZY A;  2E76 D;  2CKF A;  3N0Q A;  5CXM A;  2D2C D;  1L0L E;  2BCC E; 
#chains in the Genus database with same CATH topology
 1RY3 A;  1SQQ J;  2ZYD A;  1KQL A;  1T2K D;  2NPS A;  3CCU P;  2VRS A;  1QL1 A;  3KZI H;  1HTL C;  1RIE A;  1JMM A;  1JCD A;  2KP8 A;  3CWB D;  3AEG C;  2XR8 A;  1N7S C;  1KB9 E;  2FXP A;  1GK6 A;  3TDK A;  5AVV B;  3C1L A;  4HKZ H;  4QMA A;  2WIT A;  3H32 B;  2Y0C A;  2Y9Z A;  1KMI Z;  2DW3 A;  2YNY A;  3S4R A;  1L0L G;  2QSI A;  3ZDM A;  3BAS A;  2XDJ A;  2W6B A;  2WZ7 A;  3VYI A;  1S5L E;  2E4Q A;  2Q1K A;  4WY4 C;  4R4L A;  3KQG A;  4IFM A;  2C0X A;  3PJS K;  2ITA A;  3CXH D;  3GW6 A;  4K3A A;  3H1L D;  4N78 D;  4QDC A;  3IFM A;  1MUU A;  2YMY A;  1L0N K;  3TSI A;  1WT6 A;  1K04 A;  2FXM A;  1SQP G;  2FYU D;  3EWK A;  4KT0 J;  3NXS A;  1FZC A;  2DE5 D;  1NTK K;  3H1J G;  3WMM 0;  3RL0 B;  1SQB G;  1SQV E;  3TGU J;  5GTH H;  4QDF B;  1BE3 G;  2I1J A;  1SQX G;  2E76 D;  3KHU A;  4L73 A;  3LIE A;  1RQV A;  2YKP A;  4I7Z B;  4PV1 D;  3L74 J;  1FC2 C;  3SWY A;  4YXD C;  1SQQ G;  4EDF A;  1RE4 C;  2NWF A;  3Q2Y A;  1Q90 D;  2K88 A;  2PGD A;  1X8Y A;  4LGD E;  4N78 E;  1O7H A;  2HMK A;  2DE6 D;  1PGJ A;  2KS1 A;  3L72 J;  2AEJ A;  5APS A;  2FYU E;  2ZYL A;  1YJN P;  2IBZ G;  2P58 A;  1JY2 O;  3A0H E;  1FE6 A;  3V5B A;  1QVG O;  1JM1 A;  1PIX A;  1JO5 A;  4NB8 D;  1IFI A;  3O6Q B;  1RQU A;  1NDO A;  2LR2 A;  2ZT9 B;  2G8Y A;  1LT9 B;  1LTT C;  1QGK B;  2RMZ A;  3VP9 A;  1FOS E;  3CX5 D;  4UB6 E;  1FBM A;  3G9R A;  2W6J H;  1EG9 A;  3RK3 D;  3E7K A;  5KTB A;  3JSV C;  3HTK A;  2CK3 H;  5APU A;  1PPJ E;  3M0D C;  3P8M C;  3MIW A;  1U7J A;  2KIK A;  1EZV G;  1SFC A;  2QJP C;  1FU1 A;  4NBA D;  1LJ2 A;  1KD1 Q;  1N73 B;  2FY8 A;  1JY3 O;  1VPC A;  3EFG A;  3A7O A;  1CI6 A;  3E1I A;  2A45 I;  3TGU G;  4IOI H;  1RF1 C;  3VMA A;  1YBK A;  4Y99 C;  2ZVN B;  4RES B;  1S4X A;  3TF5 A;  3CC4 P;  2GM4 A;  2I7F A;  4BRY B;  3KDP B;  3VOP A;  5KLI B;  3RK3 E;  4I1L A;  1SQV J;  3AE3 C;  4GT1 A;  1URQ D;  3TNU B;  2Q6Q A;  1VQL P;  2H89 C;  1UUV A;  1PL5 A;  1EXI A;  3L70 E;  3G71 P;  4JBZ A;  2KI7 B;  1MFT A;  1ZRT E;  4U3F E;  2C9L Y;  2NPS B;  3SFD C;  2WVR A;  3WUV A;  2YKO A;  3H1L J;  5CCG A;  1OIP A;  5AVT B;  2HMJ A;  1L4A D;  1LGH B;  1YJ9 P;  3O8Z A;  1FZA A;  4PV1 B;  2FYU J;  1RHZ B;  2NVF A;  1LTA C;  1J2J B;  1YTZ I;  4TT3 H;  2BMQ A;  5TIS E;  4YXW H;  2KOG A;  1XTG B;  1Y9B A;  3VMX A;  1DX7 A;  1KV4 A;  2HML A;  1HJB A;  1O7M A;  1IFP A;  4NBH D;  3CCQ P;  5KAF H;  1KIL D;  1GMJ A;  3P32 A;  3GZY A;  3VMZ A;  4QCK A;  1FQT A;  1AJY A;  3LW5 J;  1NKN A;  2YIU B;  1HJ0 A;  3NFQ A;  3OW2 O;  1VQ7 P;  2WWW A;  4I7Z C;  3W68 A;  1O7P A;  1M1J A;  1P84 H;  1NTM G;  4PD4 D;  2GUS A;  1BDD A;  1LNQ A;  2B87 A;  1BCC D;  1SQV G;  5DJT B;  1FZC B;  2H7H A;  3H25 A;  5GTH E;  2I1K A;  1S5L H;  2A06 E;  3DQY A;  3F5H A;  2CPS A;  1MZ9 A;  5CCH A;  3M9Q A;  2Y0E A;  2ZYA A;  3BCC D;  1ZW0 A;  3LID A;  1PP9 D;  3PRJ A;  4W7Z A;  1IFD A;  2IYO A;  5E79 H;  2R3S A;  2M5A A;  2AEF A;  2ZT9 C;  5AW8 B;  1KC8 Q;  2YKQ A;  2BMO A;  4HM0 A;  4WWI A;  1R5S A;  1USD A;  1Q7Y Q;  2YO3 A;  2QJK B;  3JC2 2;  3IR9 A;  1T2K C;  3CL3 D;  1QL2 A;  3E1R A;  2KS1 B;  1ZN5 A;  5BVZ A;  3B5N A;  2W90 A;  1GL2 A;  1A02 J;  1GZL A;  1WMK A;  2E42 A;  1BCC E;  2O01 J;  2P7J A;  4D6T E;  3VMH D;  2WSC J;  5CXM A;  1N73 C;  2BCC E;  2Y0D A;  4RKU J;  3BCC E;  3R2P A;  3FXE A;  3GHG A;  4KJM A;  1PPJ G;  3I55 P;  4TLF A;  2NUM A;  2KXP B;  5CMZ A;  3HTK B;  3USS A;  2QIW A;  3O6Q A;  2JKV A;  3H1K D;  1N7L A;  2H43 A;  2IBZ I;  1M1K Q;  1SFC B;  2Q3W A;  1LTJ B;  5KLI C;  1EQ7 A;  5KJ7 C;  4QUQ A;  2BEQ D;  3B8E B;  1KOR A;  1KFM A;  4YTP C;  3RBX A;  3I5C A;  1FDO A;  1CI6 B;  2LKM A;  1G2C A;  3MHV A;  3PHL A;  2LXC B;  4HM6 A;  2B89 A;  3SFE C;  3H1H E;  5KLV K;  1OVR A;  3GOB A;  2R3C A;  4AIV A;  2WPS A;  3AE6 C;  1NTZ G;  4W7Y A;  3Q5P A;  5APV A;  1EZV I;  2NPS C;  4HM7 A;  5KLV D;  2ZJS E;  4RJT A;  3D6Y A;  3FWN A;  3B5N D;  1RE3 A;  2YXR B;  1JTH A;  4PV1 C;  4AQR D;  3H1K E;  2IX7 C;  2P67 A;  1E79 H;  4GIF A;  2E75 B;  1EDI A;  3KYQ A;  4HM4 A;  4XFJ A;  3L70 G;  1E5W A;  4NBG D;  5CJ4 A;  2GUV A;  1Q90 C;  2YFJ A;  3L74 E;  1EC5 A;  2KUB A;  1SS1 A;  2JWA A;  4U3F G;  1AQT A;  1NHL A;  3CX5 H;  3MGN A;  2XKM A;  1NKZ B;  1N2D C;  1S1C X;  4BXL A;  3AED C;  1NYK A;  1U7M A;  4WVZ A;  1CW5 A;  1KYO I;  4ASW A;  3I56 P;  4B86 A;  1O7G A;  1FJP A;  1YJW P;  3QH9 A;  1BCC J;  2YIU C;  3L71 D;  2MKV A;  3D70 A;  2DE7 D;  4D6T J;  1S3J A;  1ZR2 A;  1IFN A;  2Q3I A;  2BCC J;  5KAF E;  4HJL A;  1S5L X;  3G6E P;  3CPW O;  3BCC J;  5CHX A;  2O01 H;  2WSC H;  1USE A;  1FZC C;  2J59 M;  2V4H A;  2WSE J;  1K9M Q;  1T3J A;  3N7N A;  1NTM K;  4KHX A;  1KB9 I;  5TIS H;  1KQS O;  1PGQ A;  3L75 D;  1JOC A;  2KLU A;  1P84 E;  2W6A A;  4H13 D;  1X9V A;  1ULJ A;  1NJI Q;  1HGV A;  2ZXX A;  1BDC A;  2IZ0 A;  3PTZ A;  1L2P A;  2JZA A;  2I8D A;  2WT7 A;  1M1J B;  1BGY D;  3GCE A;  2B87 B;  2A06 G;  1PFI A;  2QM8 A;  3L71 E;  2GBX A;  1W2E A;  3H1H J;  5BU8 B;  1T3U A;  2QJK C;  4GOD A;  2HOD A;  1T6A A;  3AEC C;  4OGQ D;  1NU1 G;  5E79 E;  3CWB E;  2P1J A;  2N1T D;  3FGA D;  4EIJ A;  1L0N D;  5BOK A;  2WSS H;  2M5A B;  3H1K J;  2NZ2 A;  1VQ5 P;  3HE4 A;  5KKZ B;  3L75 E;  1DEB A;  1NTK D;  1R8E A;  2V7Q H;  3FWL A;  3MTU E;  4WBA A;  4NPF X;  3W67 A;  4I6M C;  1BCC G;  1VF5 D;  3B5N B;  1OW6 A;  4D6T G;  2FYZ A;  1GL2 B;  3S1K A;  3N4X A;  1AA0 A;  3PLN A;  2QVA A;  2BCC G;  1SFC C;  4W80 A;  2QEX P;  3BCC G;  3CXH E;  1SJG A;  3H1L E;  2YMK A;  2L5G B;  3A3Y B;  2FXO A;  3GHG B;  1URQ A;  1Y8A A;  3VCA A;  5KLV J;  1MKM A;  2KNC A;  4IFD K;  3QWO C;  2K9Y A;  1AVO A;  5L8R J;  5APT A;  2JJL A;  3V2Q A;  5AVY B;  1N86 A;  3AEE C;  2OYI A;  4YPC A;  2W8Z A;  5CBN A;  1LWU A;  1AV1 A;  1NTK E;  1IFJ A;  2PP6 A;  3M91 A;  2N9B A;  5APW A;  2HPC A;  4PJ0 E;  1NGM B;  3Q3D A;  1IO4 A;  4H0L D;  1R5L A;  3HD7 A;  3H1H G;  1NTZ K;  5GTI E;  2WSE H;  1L4A A;  4HM1 A;  2E75 C;  1G2C B;  2E74 D;  4ZMD A;  2NRG A;  1LTJ A;  2HR3 A;  1NH4 A;  2LXB A;  4O9B A;  3L73 D;  5K5G B;  2HMN A;  4NBE D;  1N7S D;  3L71 J;  3C0D A;  3H1K G;  5CCG C;  1NWQ A;  1J1D B;  4M3L A;  2XSO A;  1KIL A;  2P2U A;  3AEF C;  1JTH B;  4H13 B;  3ABV C;  1EDL A;  3II6 A;  5AVR B;  3CWB J;  1YTZ T;  1Z56 A;  1CSB A;  3L74 G;  3BAT A;  2JDI H;  3GB4 A;  3EQ2 A;  1YQ4 C;  3CX5 E;  2R5D A;  1PGO A;  4WY4 D;  1EDJ A;  1KQF B;  1M57 D;  3L75 J;  5HL4 A;  1ULI A;  3P7K A;  3CMA P;  3L72 G;  3M06 A;  3EQQ A;  1DEE G;  3UIA A;  3SWF A;  5KAI E;  2XND H;  1HWT C;  1HBW A;  3V2N A;  3Q5R A;  2FYN B;  1ZME C;  3M0D A;  2WPV B;  1VQN P;  1YIJ P;  2E76 B;  1JUN A;  5M1B A;  3HD7 D;  2KZI A;  1M1J C;  3CC7 P;  2M8R A;  2KSE A;  3MZW B;  1NOH A;  3CLQ A;  1ZR4 A;  2D2C D;  2O01 N;  1L0L K;  1L0N J;  3L4F A;  2WQY C;  1JNM A;  5CCH C;  1H89 A;  3A0B E;  1VM9 A;  1NTK J;  2KSJ A;  1LP1 A;  1BSH A;  1IK7 A;  4N6J A;  3RL0 C;  2POH A;  3L71 G;  2WT7 B;  1NU1 K;  1SQP K;  1FS0 E;  4GDO A;  3IN6 A;  2J58 A;  1VQ8 P;  2CPB A;  1WQL A;  5KKZ C;  2FBW C;  3M0A A;  3MP7 B;  4DJG A;  2HOD B;  1UUW A;  3CWB G;  1SQB K;  3CCV P;  2XSH A;  4R4M A;  3VMI D;  3WUT A;  4HJG H;  3B5N C;  3RK3 B;  1GL2 C;  2AEM A;  2NVG A;  2ZFC A;  2HMM A;  4HM8 A;  1SQX K;  4UB8 E;  5AW7 B;  4H0L B;  5AEU A;  2P10 A;  5BU5 A;  2JO6 A;  1SQB D;  2YFI A;  1PZQ A;  4NBD D;  2OTJ P;  1VQK P;  2E74 B;  1SQQ K;  1KQG B;  1SQX D;  1ZLL A;  3RL0 g;  2E43 A;  1D7M A;  1RFS A;  3GHG C;  3HE4 B;  5AW5 B;  1KIL E;  3Q5S A;  1GW3 A;  4WB4 A;  1S9K D;  2RH0 A;  1LT9 C;  1NYH A;  3H1L G;  4OWF A;  1GDT A;  1HVV A;  2ZVO B;  1GD2 E;  5B5E E;  2OYH A;  1RH5 B;  3GG2 A;  2FYU G;  4EOT A;  2IFN A;  2IBZ D;  2HFE D;  3MUD A;  1GU5 A;  1DD3 A;  4PD4 E;  1URQ B;  2E5Y A;  3M9H A;  2KNC B;  5AW6 B;  2W27 A;  3VN0 A;  3CCS P;  3V4W A;  2ZYG A;  5DJU B;  3OAK A;  2IPP A;  2OYI B;  3CXH H;  1LWU B;  4JQ0 D;  1NAY A;  1PP9 E;  1K05 A;  4GOE A;  3VMY A;  1J1D C;  4IL6 E;  1RE3 C;  2HPC B;  1J1E B;  3AZC A;  1EZV D;  2L91 A;  3HD7 B;  1M8O B;  1L4A B;  3CME P;  1JY2 N;  4ZNC A;  1OXZ A;  3GL2 A;  1RF0 A;  4DCK A;  2XNX A;  1Q82 Q;  1VQP P;  2D2C B;  1DD4 A;  4L75 A;  3G3Z A;  1H88 A;  2AXT H;  1H8A A;  1VCK A;  3SSU A;  1G8J B;  2O3J A;  3NTN A;  3L36 A;  2OYO A;  3TGU D;  2Q7C A;  2PFX A;  4H44 D;  3KXD A;  5CJ0 A;  4PJ0 H;  1YQ3 C;  1W2B O;  3JCU E;  3AEB C;  3RK2 D;  5AW3 B;  5GTI H;  1KIL B;  4AAY B;  4RO0 A;  1NO4 A;  2R5B A;  2FYN C;  1S72 P;  1M90 Q;  1AQ5 A;  4EI2 A;  4GOF A;  3CCL P;  2PAJ A;  2KYV A;  4GKG A;  2E76 C;  3H6P A;  1KYO D;  5AVQ B;  3RBZ A;  3C9I A;  4NBF D;  2V7Q J;  3U1A A;  1EZV E;  1FZG A;  2ZXE B;  3CC2 P;  1JY3 N;  4U7J A;  3CI9 A;  4P1C H;  3HRN A;  1OWA A;  2HLO A;  5AW4 B;  2R32 A;  2B24 A;  3K5B A;  4ZKP A;  4DT0 A;  2YVJ B;  3AE8 C;  2HYN A;  1MFZ A;  3WU2 E;  3EN1 A;  3CD6 P;  2BMR A;  3AE5 C;  3GZX A;  1S2E A;  3H1I D;  1YIT P;  1EDK A;  5AW9 B;  2M0B A;  1KB9 D;  1KN7 A;  3VMG D;  2N1T A;  2B1X A;  1FOS F;  2JR8 A;  4NB9 D;  1QLE D;  2KLV A;  1HH0 A;  3EFF K;  1TU3 F;  2E5T A;  2K9J A;  5KLV E;  5KAI H;  3HE5 A;  4CPG A;  3GMA A;  2JEE A;  1AFO A;  5CBO A;  3R4Y A;  4JYB A;  1YI2 P;  2QPZ A;  2QRX A;  3RK3 C;  3GL0 A;  2O1J A;  2B88 A;  4H0L C;  1PP9 J;  1LP1 B;  4HM5 A;  1GK4 A;  2E74 C;  4OVN F;  1Q81 Q;  4NBC D;  1VQ4 P;  3AEA C;  2Z5I A;  4JF7 A;  1SQV K;  1NAF A;  3H1I E;  1VQM P;  2CKF A;  1NTM D;  3A0B H;  4C7N A;  1P84 I;  3P8C D;  1SQV D;  1GU4 A;  3GLM A;  2G3A A;  1YYC A;  3VTP C;  5AVU B;  2OGU A;  4I2L C;  3HUS A;  2BAS A;  3BRT B;  2XV5 A;  4MN4 C;  2FFD A;  1Y47 A;  1YHQ P;  1URQ C;  2XRX A;  2GBW A;  2C9N Y;  1OFC X;  1HGZ A;  2FYU K;  2GA1 A;  4H44 B;  1A02 F;  2NVE A;  4QUR A;  1OVV A;  1M7L A;  3AE7 C;  5KJ7 D;  3CCE P;  1O7W A;  4UB8 H;  1QX8 A;  4HB1 A;  1AVY A;  3RK2 B;  3A5T A;  1KZU B;  3IAO A;  2OYI C;  1LWU C;  3V2R A;  2OYH B;  3L37 A;  1VQO P;  1N7S A;  2QJY B;  1NTM E;  1J1E C;  3P8C E;  3HD7 C;  1BGY E;  1HF9 A;  2HMO A;  1L4A C;  2JWD A;  3CCJ P;  2SPZ A;  2NPS D;  1GTW A;  1UII A;  3AE1 C;  1LTJ C;  2D2C C;  5TJH A;  1LTI C;  1LTG C;  1BSN A;  1PP9 G;  1VDF A;  5B5E H;  1PPJ D;  3CXH I;  3BVH A;  1IJD B;  4WY4 A;  2Q3E A;  1L0N E;  1KIL C;  5AVZ B;  4PD4 H;  5EFW B;  4ASV A;  4DOJ A;  2WSF H;  1QVF O;  2AXT E;  3V2P A;  3V4Q A;  4ZKU A;  3GKE A;  1MV8 A;  5AEW A;  2OTK E;  1ZXG A;  4IL6 H;  2XZR A;  2KZJ A;  3H1I J;  3AE4 C;  4L74 A;  4NBB D;  4AYC A;  1H0T A;  2YFL A;  2XU6 A;  1NTZ D;  3G4S P;  1JEK A;  1RE4 A;  2QG4 A;  5AW2 B;  5B66 H;  4L76 A;  1Q2N A;  4IFF A;  5C39 A;  4HYT B;  3L70 D;  3JCU H;  3CCR P;  2W83 C;  5AVW B;  1N8R Q;  1OMI A;  1ZP0 C;  1ZRT D;  1CZQ A;  4U3F D;  2PRR A;  3AE9 C;  1FZE A;  2KK7 A;  3CX5 I;  1SP4 A;  4OGQ B;  1JCC A;  1X0T A;  2YXQ B;  4K35 A;  3FXD A;  2JO1 A;  1X79 B;  1NTM J;  2N1T B;  2IZ1 A;  3L73 E;  4QDD A;  1NTZ E;  2JP3 A;  5KLV G;  1BGY J;  1XTC C;  4NPE A;  5APY A;  2K9J B;  3WU2 H;  3T97 A;  5H2F E;  3HE5 B;  3TK1 A;  2H8P D;  2Q9I A;  2RN0 A;  2AXC A;  2WPR A;  4XE5 B;  3M9B A;  3B71 A;  2K1A A;  2R44 A;  1VF5 B;  3KZI E;  2K37 A;  3L35 A;  3BRV B;  5APQ A;  2H88 C;  1OX3 A;  3AE2 C;  1DIP A;  1RF1 A;  1UIX A;  3H1I G;  1SLQ A;  1L0L D;  1SVF A;  1KYO H;  2Y9Y A;  1SFC D;  3U1C A;  1FDM A;  2N9Y B;  3CCM P;  4H44 C;  4EMJ B;  1JM0 A;  5AVX B;  2A06 D;  4C7N B;  3RK2 C;  2Z4E A;  1K73 Q;  3C8V A;  2OYH C;  2ZAE B;  4OH8 B;  5APX A;  1WRG A;  3HUS B;  2QJY C;  3GF3 A;  2J5U A;  1NU1 D;  1SQP D;  1HUC A;  3NMD A;  4Y28 J;  2OQQ A;  3RGU A;  3MUD C;  5AVS B;  2FFD B;  3WUU A;  1KB9 H;  4HM3 A;  3H1J D;  3H32 A;  4LC1 A;  1ZV8 A;  1M56 D;  2YO2 A;  2IYP A;  3Q1M A;  1G1J A;  1BE3 D;  2BEZ F;  3D71 A;  3L75 G;  1L0L E;  2E75 D;  4N3Y B;  1X22 A;  3U59 A;  3D89 A;  1N7S B;  1BGY G;  1SQQ D;  4D6T D;  1OW7 A;  2O1K A;  3SWK A;  2BCC D;  2FKW B;  2C0W A;  1FJK A;  1RF0 C;  4BWN A;  1U57 A;  3GF7 A;  5CCG D;  3TYY A;  1JB0 J;  4HH2 A;  4IL6 X;  4XA4 A;  5AW1 B;  1NU1 E;  1SQP E;  3L73 J;  1NTZ J;  2E4P A;  3GTE A;  1L0N G;  1IFM A;  1LT1 A;  1OW8 A;  3H1J E;  4WY4 B;  4QDF A;  2HG5 D;  1FZB A;  1VQ9 P;  1Q86 Q;  1SQB E;  3F89 A;  4PD4 I;  1OVU A;  2M3E A;  2IDB A;  1BE3 E;  1PGP A;  1NTK G;  1SQX E;  3B4S A;  3L70 J;  2NUK A;  1K8A Q;  1LTB C;  4U3F J;  2Z5H A;  1SQQ E;  2QM7 A;  3H1H D;  2K3R A;  2KB7 P;  4H13 C;  1S9K E;  5AW0 B;  1VL2 A;  1KTM A;  2M3B A;  3V6I A;  1ZOY C;  3PP5 A;  1H0T B;  2IFM A;  5B66 E;  2QA4 P;  2IBZ E;  4P1B H;  3IF4 A;  1NVO A;  1G1I A;  4OGQ C;  3A0H H;  3KPE A;  3N0Q A;  1IK9 A;  1LT9 A;  2B9B A;  2OTL P;  2A45 G;  2N1T C;  4C46 A;  4C7R A;  5CCH D;  4LLH A;  1DH3 A;  3L74 D;  1JMB A;  1EXJ A;  1LTS C;  3FX0 A;  2Q5U A;  4UB6 H;  1VQ6 P;  4NPD A;  3RL0 D;  1JY2 P;  1KFN A;  3LW5 H;  1N73 A;  1QEX A;  1O7N A;  1L0L J;  3S9O A;  1VF5 C;  3L72 D;  3L73 G;  3OJA B;  2QE7 H;  2WMM A;  1FDI A;  4EYY Q;  1PV3 A;  4QUP A;  2A45 H;  3MD0 A;  1GL2 D;  2UWJ E;  3TGU E;  4JYC A;  3T97 B;  2OAR A;  3VP8 A;  1T8Z A;  2QJP B;  4BRY A;  1NU1 J;  1SQP J;  1OZH A;  4HM2 A;  1FAV A;  5KJ7 A;  4JPZ B;  4DZO A;  1IC2 A;  3VCP A;  2WTY A;  2MJZ A;  1W5C E;  3TNU A;  3H1J J;  3A2A A;  1G8K B;  2RKL A;  1SQB J;  1GW4 A;  2WPQ A;  1FZF A;  4Z1M H;  3HUS C;  2WSF J;  3FOU A;  1JY3 P;  1P84 D;  1KYO E;  1BE3 J;  4HKV A;  3OA7 A;  1RF1 B;  3PH0 A;  2ZT9 D;  1SQX J;  2FFD C;  3D6Z A;  4Y99 B;  4A7P A;  1IZN B;  5H2F H;  3GTS A;  3L72 E;  4AUW A;  3ITK A; 
#chains in the Genus database with same CATH homology
 4RKU J;  3BCC E;  2WQY C;  1RIE A;  2NUM A;  3GKE A;  5AEW A;  3AEG C;  1VM9 A;  2XR8 A;  2QIW A;  3O6Q A;  1IK7 A;  1KB9 E;  2FXP A;  2Q3W A;  4GDO A;  3IN6 A;  3AE4 C;  4NBB D;  5KLI C;  2YFL A;  1WQL A;  5KKZ C;  4QUQ A;  2FBW C;  2BEQ D;  1KMI Z;  1KOR A;  4YTP C;  1UUW A;  1FDO A;  2XSH A;  4R4M A;  3VMI D;  2QSI A;  4HM6 A;  3SFE C;  2E4Q A;  2NVG A;  3H1H E;  4HM8 A;  2HMM A;  4H0L B;  5AEU A;  4R4L A;  2P10 A;  3GOB A;  2JO6 A;  4AIV A;  2YFI A;  4NBD D;  3AE6 C;  2E74 B;  3Q5P A;  4QDC A;  1OMI A;  1ZP0 C;  1KQG B;  4HM7 A;  3RL0 g;  1K04 A;  1RFS A;  3EWK A;  3D6Y A;  3AE9 C;  4KT0 J;  1KIL E;  4PV1 C;  3H1K E;  2DE5 D;  4OGQ B;  3Q5S A;  2E75 B;  4HM4 A;  4XFJ A;  2JO1 A;  1SQV E;  4NBG D;  1NYH A;  1Q90 C;  2YFJ A;  4QDF B;  3L73 E;  4QDD A;  1NTZ E;  2JP3 A;  3L74 E;  2E76 D;  1RQV A;  4I7Z B;  4PV1 D;  4YXD C;  1DD3 A;  4PD4 E;  2NWF A;  1S1C X;  3AED C;  1NYK A;  3Q2Y A;  3B71 A;  1Q90 D;  1O7H A;  1VF5 B;  1O7G A;  2HMK A;  2DE6 D;  2YIU C;  2DE7 D;  2MKV A;  3D70 A;  2H88 C;  2FYU E;  3AE2 C;  2ZYL A;  1DIP A;  1UIX A;  1PP9 E;  4HJL A;  1S5L X;  1K05 A;  1JM1 A;  1PIX A;  4NB8 D;  3AZC A;  1RQU A;  4H44 C;  1NDO A;  2WSE J;  2ZT9 B;  4EMJ B;  2G8Y A;  3GL2 A;  3C8V A;  2D2C B;  3G9R A;  1DD4 A;  1EG9 A;  1VCK A;  1G8J B;  1P84 E;  2QJY C;  1PPJ E;  3GF3 A;  2J5U A;  4H13 D;  1ULJ A;  4H44 D;  4Y28 J;  2OQQ A;  2JZA A;  1YQ3 C;  2QJP C;  3AEB C;  3GCE A;  4HM3 A;  4AAY B;  4NBA D;  3L71 E;  2GBX A;  2FYN C;  2QJK C;  3Q1M A;  2BEZ F;  3D71 A;  3AEC C;  4OGQ D;  2E76 C;  1L0L E;  2E75 D;  3CWB E;  4NBF D;  2V7Q J;  3D89 A;  1EZV E;  3FGA D;  4U7J A;  5BOK A;  4P1C H;  1OW7 A;  2B24 A;  2I7F A;  2NZ2 A;  2YVJ B;  3AE8 C;  3RK3 E;  1U57 A;  3GF7 A;  3L75 E;  3EN1 A;  1R8E A;  1JB0 J;  3AE3 C;  4IL6 X;  1NU1 E;  1SQP E;  2BMR A;  3AE5 C;  2E4P A;  3GZX A;  1VF5 D;  3GTE A;  1OW6 A;  3VMG D;  1OW8 A;  2B1X A;  3H1J E;  2H89 C;  4NB9 D;  4QDF A;  1UUV A;  1PL5 A;  1EXI A;  1SQB E;  3L70 E;  2IDB A;  3CXH E;  1SJG A;  3H1L E;  1TU3 F;  2YMK A;  1BE3 E;  1SQX E;  5KLV E;  1ZRT E;  4U3F E;  3SFD C;  3GMA A;  3R4Y A;  2NUK A;  3VCA A;  2HMJ A;  1MKM A;  2QPZ A;  4PV1 B;  3GL0 A;  1SQQ E;  2NVF A;  2K9Y A;  4H0L C;  5L8R J;  4H13 C;  4TT3 H;  2BMQ A;  1VL2 A;  1KTM A;  4HM5 A;  3AEE C;  1Y9B A;  2E74 C;  4NBC D;  1ZOY C;  2HML A;  1NTK E;  3AEA C;  1O7M A;  4NBH D;  2IBZ E;  4P1B H;  1NGM B;  3H1I E;  3Q3D A;  4H0L D;  1GMJ A;  4OGQ C;  3GZY A;  2CKF A;  3N0Q A;  4HM1 A;  2E75 C;  4QCK A;  1FQT A;  2E74 D;  3GLM A;  2G3A A;  1AJY A;  3LW5 J;  1HJ0 A;  2HMN A;  4NBE D;  1EXJ A;  4I7Z C;  3C0D A;  1O7P A;  2XSO A;  3AEF C;  2XRX A;  2GBW A;  4H13 B;  3ABV C;  1O7N A;  4H44 B;  4QUR A;  2NVE A;  3H25 A;  3S9O A;  3AE7 C;  1VF5 C;  1O7W A;  2A06 E;  3DQY A;  3GB4 A;  3IAO A;  1FDI A;  1YQ4 C;  3CX5 E;  1PV3 A;  4QUP A;  1KQF B;  3TGU E;  1NTM E;  3T97 B;  5HL4 A;  1ULI A;  2ZT9 C;  1HF9 A;  2HMO A;  3EQQ A;  2BMO A;  4HM0 A;  4HM2 A;  3AE1 C;  3VCP A;  2D2C C;  3Q5R A;  1ZME C;  2WPV B;  1G8K B;  4Z1M H;  2WSF J;  3FOU A;  1KYO E;  2E76 B;  4HKV A;  5M1B A;  2ZT9 D;  1WMK A;  3D6Z A;  1BCC E;  3GTS A;  2O01 J;  1L0N E;  3VMH D;  2WSC J;  3L72 E;  5CXM A;  2D2C D;  2BCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...