2QJPC

Crystal structure of wild type rhodobacter sphaeroides with stigmatellin and antimycin inhibited
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
179
structure length
179
Chain Sequence
b'GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
molecule tags Electron transport
source organism Rhodobacter sphaeroides
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
total genus 46
structure length 179
sequence length 179
chains with identical sequence F, I, L
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qjpC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qjpC02
3EN1A 3GL0A 2QJPC 3L75E 3H1IE 2JZAA 1SQBE 1RFSA 2E4PA 2HMKA 1O7HA 3C8VA 4EMJB 1G8JB 3VCAA 4NBDD 4H44B 4AAYB 5KLVE 3H1HE 4HM1A 2YFLA 1NYKA 4NBED 3VMHD 2QSIA 3H1JE 2NVFA 3L72E 4QUQA 4HM7A 1SJGA 1KB9E 3VMGD 1BE3E 3C0DA 3L71E 4NBFD 3GTEA 1L0LE 3VMID 1O7PA 2A06E 2WSFJ 3L73E 2FYUE 4NBAD 4NBCD 4H0LD 4HM8A 2I7FA 2E76D 2D2CD 3CXHE 2E74B 4HM6A 4HKVA 4H13B 1O7WA 4PV1B 4NBBD 2BCCE 3CX5E 2WSCJ 2GBXA 4HM0A 4HJLA 1ZRTE 4HM5A 4QDCA 2Q3WA 4PD4E 1SQVE 1SQQE 2YVJB 1NU1E 3GTSA 5CXMA 2IBZE 2DE7D 1ULIA 2YFIA 3DQYA 4Y28J 4QCKA 2HMMA 4H0LB 1WQLA 1VCKA 1L0NE 2YFJA 1NTZE 3N0QA 1SQXE 3GCEA 5L8RJ 2BMRA 4H13D 4NBHD 2FYNC 1P84E 2E75B 2YIUC 4QDDA 5AEUA 1O7MA 3GB4A 2NUMA 1Q90D 1NTME 3VCPA 2NVGA 1JM1A 3GL2A 2ZT9D 1O7GA 3L74E 2B1XA 4NB8D 1S5LX 2WSEJ 1JB0J 4I7ZB 1EG9A 1NTKE 2QJYC 4HM4A 2B24A 3D89A 5HL4A 4QUPA 4RKUJ 1G8KB 2GBWA 4QDFA 4H44D 4QDFB 1ULJA 5AEWA 1O7NA 1Q90C 2E74D 3GKEA 1UUWA 2E4QA 2E75D 3LW5J 2XSOA 4U3FE 2XR8A 3AZCA 2HMNA 3H1KE 2O01J 2BMOA 2ZT9B 1UUVA 1EZVE 4AIVA 1SQPE 2E76B 2NVEA 3BCCE 2WPVB 4KT0J 2NWFA 4HM3A 2CKFA 4OGQD 5KLIC 4NBGD 4P1CH 1FQTA 5KKZC 1VM9A 2JO6A 4NB9D 4PV1D 4OGQB 3GOBA 1RIEA 5BOKA 3L70E 2QJKC 2D2CB 1VF5B 1BCCE 2DE6D 2QPZA 1KYOE 2K9YA 3EQQA 1VF5D 2ZYLA 4P1BH 2QIWA 1PP9E 2BMQA 1NDOA 2DE5D 2NUKA 2XRXA 2HMOA 2XSHA 3GZYA 3H1LE 2HMLA 2HMJA 4IL6X 3FOUA 3GZXA 4HM2A 3TGUE 4QURA 1PPJE 3CWBE
chains in the Genus database with same CATH superfamily
3L72D 1EZVG 3A2AA 1FZGA 3VCAA 1RF1B 2YO2A 1NTMD 1L0LE 3L73E 1OMIA 1JOCA 3V6IA 4JPZB 2SPZA 1L4AA 1SQBJ 4HM0A 2QM7A 1X9VA 2YMYA 2R3CA 4ZNCA 1YI2P 1JM0A 2ZXXA 1L4AD 4C7NA 1P84E 2IBZI 3U1CA 2A45I 1KFMA 3RL0C 2HODB 3C1LA 3VMYA 4BRYB 3L73D 4RO0A 3M0DC 2OTKE 3A0HE 1PP9D 3ZDMA 2YXQB 3D71A 5AVRB 2IBZD 1M8OB 1PGPA 1YITP 1N7LA 4OWFA 2O3JA 3CCLP 2BEQD 2XR8A 3VMAA 3D6ZA 5APVA 2N1TC 2BMOA 1LT9A 1AJYA 1SFCC 3SSUA 3PJSK 4MN4C 3AEAC 2GA1A 3E7KA 1RY3A 2ZYLA 3P8MC 4WY4B 3H1LE 1JY3O 3KYQA 3RK2C 1IFPA 2J59M 3RK3B 3CWBE 1G1JA 2Q1KA 2W83C 3Q1MA 2C0WA 3W68A 4EIJA 3QH9A 2QRXA 5KAIH 4QUQA 4HM7A 3A0HH 3C0DA 4KJMA 1NTZK 3L74D 1NU1D 1RHZB 4NBAD 4H0LD 5AVWB 2I7FA 1IFJA 4HM6A 3UIAA 4W7YA 3FXEA 2BCCE 2Y9YA 1NO4A 1LTJA 5KLVG 2JKVA 3PLNA 2YFIA 2OTLP 3FWLA 1NTZE 3JCUH 1ZR4A 1NHLA 2PP6A 2BMRA 4H13D 4H0LC 3PHLA 5APSA 1Q90D 2FY8A 2IZ0A 2KXPB 4LGDE 1XTCC 4UB6E 2B24A 2FFDA 1HGVA 3Q2YA 2GBWA 1SQQD 4D6TJ 1Q90C 1NWQA 2GM4A 2QVAA 4IFFA 1RH5B 3P7KA 4NPFX 2P67A 1E5WA 1SQPE 3TF5A 2QJYB 4H44C 2HLOA 3H1KD 2AXCA 2Q7CA 2WT7B 3H32B 4AUWA 4PD4H 1BGYE 2QPZA 2K37A 1LWUB 3TYYA 2BMQA 4L75A 1USDA 1GL2A 3II6A 2KNCA 1M1JB 1PL5A 1VPCA 3G6EP 3CCRP 1GK6A 2B87A 2B89A 3L72E 3F5HA 3M9QA 1O7PA 2A06E 2WSFJ 1YQ4C 3NXSA 1L0NJ 1KILC 2YXRB 1KFNA 2M3BA 2ZJSE 3W67A 1LTJC 2IBZE 2Z4EA 4C7RA 2FYUK 3H1LJ 3GCEA 2JJLA 4QDDA 5KLVK 1FOSE 2WSFH 1AA0A 1P84H 1M1JC 1OVRA 1LTBC 4NB8D 2WSEJ 4GT1A 3D89A 2Y0DA 1KTMA 2KK7A 1SQQK 3HE4B 3G4SP 2XNXA 1HWTC 1JEKA 1KILB 2C0XA 2HMNA 1CI6A 1MFZA 2QEXP 3PTZA 3WU2H 2PRRA 2G8YA 4Y99B 3GMAA 3D6YA 4NBGD 5KKZC 2WT7A 5APYA 3V2RA 3BATA 2V7QH 1PP9G 1ZOYC 3N7NA 1YIJP 3MTUE 1CSBA 3ABVC 1VF5D 3E1RA 1AFOA 3EFGA 1PPJE 1LP1A 2IYPA 3HUSA 4DZOA 1SQBE 2E43A 2K9JA 1G8JB 1FE6A 3H1HE 1VF5C 2V7QJ 1QLED 3L73J 3L75D 4GIFA 1NGMB 3RK3D 1QGKB 1VQLP 2ZYAA 1ZXGA 5GTHH 1S4XA 4HM8A 3CXHE 1NU1K 4M3LA 4N6JA 1SQVE 1VQMP 2WVRA 2YVJB 3H1HJ 1GTWA 4H0LB 1GZLA 2KB7P 1VCKA 5KTBA 3AEEC 1ZRTD 1GD2E 1MKMA 1SQBD 3M06A 3RBXA 1X8YA 1GL2C 2W8ZA 4ZKUA 1RF0A 2FYUJ 3S9OA 3CCVP 3L75J 1U7JA 3H6PA 5AW3B 1VQOP 1G8KB 2PFXA 1N73C 3MZWB 3WU2E 2OTJP 2E42A 4U3FE 3HD7D 1PGQA 2C9NY 3O6QA 3LIDA 2JP3A 1FQTA 1W2BO 1PZQA 5KJ7A 2KLUA 1BSNA 1FDOA 5KKZB 1IC2A 3RBZA 1BCCG 3HE4A 1NDOA 2V4HA 1JO5A 2CK3H 2HMLA 1LWUA 1SQQG 3R2PA 5AW6B 3FOUA 1SFCD 2XU6A 2E76C 3LIEA 3R4YA 3C8VA 4AYCA 5KLVE 4NBED 3VOPA 1VQ4P 4XA4A 2ZFCA 2FYUE 2AXTE 2Q5UA 1RE4C 1DD4A 2D2CD 3GF3A 1O7WA 4PV1B 4RJTA 1ZRTE 3H1IJ 1OW8A 5AW5B 3B8EB 1NTKK 2LXCB 2BEZF 1S3JA 3I55P 3EFFK 1L0ND 3CCUP 5CCHD 2KOGA 1PPJG 1URQC 1FJPA 1WMKA 5AW7B 1EDIA 1FZFA 1QVFO 1HJBA 4QDFA 2KYVA 1KV4A 1ZR2A 3RL0B 1U57A 1W2EA 4Y99C 1SQPK 3KZIE 1A02J 4XE5B 1EC5A 5KAIE 1SVFA 1Q7YQ 4PV1D 1IFNA 1J1DB 1DIPA 5CCHA 1VQ5P 5AVVB 1S5LE 2XNDH 2Y0EA 3OAKA 1JCCA 1GW4A 1GMJA 2KP8A 2YO3A 1KYOD 1RE3A 4D6TD 1H0TA 1FOSF 5AW1B 1K8AQ 5DJTB 5TISE 4HJGH 2P58A 2OYHB 1KB9E 1VQNP 1L4AC 4GKGA 2XV5A 1EDJA 3VMXA 2CPSA 2Q3EA 5GTHE 2FXOA 4HM5A 2Q3WA 1LT1A 3CXHH 2QJKB 1VDFA 4QCKA 2LKMA 5APQA 2YNYA 1VQ9P 2JR8A 1JY3N 2E5YA 2G3AA 3GL2A 2IPPA 2ZT9D 2DW3A 2N1TD 1G1IA 3V4WA 3S1KA 1XTGB 1IK9A 4EYYQ 3QWOC 4QUPA 3CX5D 1RF0C 5H2FE 1K9MQ 3GW6A 2CPBA 3IFMA 2IDBA 2YKQA 4D6TG 2M5AB 2PGDA 2WTYA 5KLVD 2NVEA 3GHGA 1WRGA 3IN6A 1JMBA 1JY2N 1BE3D 2H88C 3L70E 1EZVD 2ZYGA 2FXPA 3TDKA 1KYOE 2OARA 1JY2P 3CCJP 1JTHB 1PP9E 2DE5D 1SQVD 3SWKA 4WY4A 1S1CX 3OA7A 5KLVJ 3AE6C 2B87B 4XFJA 1KN7A 1KB9I 2HPCB 2M3EA 1O7HA 4EMJB 1JY2O 5AVXB 1GU4A 1N7SC 5CMZA 2XKMA 3U59A 2HFED 3L71E 3GF7A 3CLQA 3A3YB 1EDKA 3CWBG 1N7SA 4QDCA 3KDPB 1OFCX 4I6MC 1K73Q 1WQLA 2B9BA 4KHXA 4OVNF 4U7JA 5AW4B 1CZQA 1X79B 2YIUC 3AE4C 2R5BA 1IFIA 2KI7B 3L71G 1UIXA 1L0LD 3MUDA 2WMMA 3F89A 3TNUB 1NTMJ 2FXMA 2R5DA 3T97A 3WUTA 5K5GB 2OYHA 3B71A 1AQ5A 2E74D 4AQRD 3ITKA 5BU5A 1PFIA 1FBMA 4GDOA 4Z1MH 1YJNP 5KAFE 2LR2A 1L0LK 1IK7A 1J1DC 3VMZA 1CI6B 2H7HA 1ZLLA 2JO6A 3V2PA 1QL2A 3CX5I 4HKZH 2DE6D 1QX8A 3HD7C 4BRYA 2OQQA 1U7MA 2ZVNB 3CCMP 3Q5SA 1NTMG 2HMOA 3GZYA 5CHXA 1NAFA 2LXBA 1RQUA 1T6AA 2Q9IA 3H1IE 1KQGB 4A7PA 2JWAA 3CCQP 1Q86Q 1HUCA 3P8CD 1GK4A 4NBFD 3VMID 4L74A 3HRNA 1N8RQ 2O1JA 3BVHA 5B5EE 2E74B 2Q6QA 3CX5E 1TU3F 1Y8AA 2KLVA 4BWNA 1ULIA 1RF1C 1RE3C 5AW8B 5AW0B 5AVYB 3PH0A 1T3UA 1FZEA 1NTKG 1KQFB 1SQBK 2E75C 5CCGD 4N3YB 3O8ZA 3CXHI 1S5LX 1GW3A 1BCCD 3Q3DA 1E79H 3L71J 3FXDA 1LWUC 5CJ4A 2OYOA 2ZVOB 2XSOA 3M9HA 1A02F 1G2CA 3A5TA 1NYHA 2ZAEB 4HH2A 4HM3A 4EI2A 4PJ0E 1YTZI 3TSIA 3EWKA 3M91A 2QJKC 3CWBJ 3KQGA 1BCCE 3TGUD 2VRSA 1OX3A 3AEGC 3H32A 1N73A 5GTIH 3M9BA 3B5NC 1PV3A 3JCUE 4PD4I 3VP8A 2K9JB 1SQPD 4HM1A 1NYKA 3VMHD 4GOFA 3D70A 1L2PA 2BASA 2KZIA 1FZBA 5KJ7D 1YTZT 1BGYJ 3B5ND 4HKVA 1VQPP 2GBXA 4JYBA 1AVOA 3WUVA 5CBOA 2FYUD 1ZN5A 5E79E 1J2JB 4Y28J 2A06G 2BCCD 3L36A 2YIUB 2FYNC 5AEUA 1W5CE 1J1EB 1NTME 2E5TA 2FYUG 2B88A 2J5UA 3H1JD 2NVGA 2QA4P 1JM1A 3BRTB 1LTSC 3L70D 4YXWH 1SQXK 3L4FA 1L0NK 1JB0J 5AVZB 2QJPB 5GTIE 2N9YB 2HPCA 2Y0CA 4K35A 1VQ6P 4HB1A 1VQ7P 1BDCA 1N7SB 3RL0D 3GKEA 1RF1A 3BCCJ 4R4LA 2HG5D 1KB9H 2O01J 3MUDC 2WPVB 2QM8A 2Z5HA 3AE2C 4KT0J 1KD1Q 4U3FD 3GOBA 5BOKA 4HYTB 2I8DA 1NH4A 5E79H 1LP1B 1J1EC 1DH3A 1LTIC 1BE3J 1QEXA 2M0BA 3T97B 2WSSH 3EQ2A 2RN0A 1R5SA 2QJPC 3L75E 3L71D 3MIWA 1PP9J 3AEFC 4GOEA 3I56P 4AAYB 2N1TA 2YFLA 1SQVG 2K3RA 3PP5A 3V5BA 2O1KA 3TGUG 1BE3E 1GL2B 3H1IG 1ZW0A 4NBBD 1FZCC 1SLQA 5CCHC 5CXMA 2L5GB 2HR3A 2OYHC 2A45G 1DD3A 4UB6H 2FKWB 2E75B 1QL1A 1YJ9P 3HE5A 1KYOH 1EDLA 3WUUA 1LTTC 1BGYD 3CXHD 3H1LG 2MKVA 4WY4D 2OYIA 2Z5IA 5APTA 1IO4A 1HGZA 1P84I 1S72P 4H44D 1UUWA 1URQA 3K5BA 1NTZD 2XZRA 1UUVA 2E76B 3RK2B 5AVQB 3CC2P 1LTAC 2W6JH 3N4XA 3M0AA 1M7LA 2NPSD 2IYOA 1IFMA 1BGYG 2K9YA 3SWFA 2HODA 1NKNA 5BU8B 3KZIH 1NTZJ 1VL2A 3L75G 3RL0g 3HTKA 1KILD 1KMIZ 2JZAA 2XDJA 1SQQJ 2FYZA 3H1JE 1KC8Q 3GTEA 3H1HG 1NVOA 1BCCJ 1VQ8P 2AEJA 1ZV8A 1RQVA 2DE7D 3DQYA 3NMDA 3H25A 4NPDA 1L0NE 1ZP0C 1QVGO 1SQXE 3AE9C 3MP7B 5KAFH 2NPSB 1JCDA 3KXDA 5DJUB 1YHQP 2NUMA 4N78D 1HVVA 5AVUB 4BXLA 2B1XA 1HTLC 3C9IA 3V2NA 3AE1C 1S9KE 2QJYC 4HM4A 4LLHA 4OH8B 4OGQC 1K05A 5C39A 1OIPA 1ZMEC 1SQPG 2E75D 3CL3D 1VQKP 3BRVB 5AVTB 2QG4A 2OYIB 1GDTA 2R44A 4OGQD 5CJ0A 3NFQA 1VM9A 3RK3E 1EZVI 1PIXA 2NZ2A 3CC4P 3V2QA 1KILE 2QIWA 3BASA 1FDMA 3L73G 2JEEA 3H1JG 1KB9D 3P32A 1SFCB 1P84D 3S4RA 3HD7B 2KUBA 4JQ0D 2RH0A 2QSIA 2M8RA 1DX7A 1SJGA 1G2CB 3KHUA 4NBCD 1SP4A 3L37A 5CBNA 3IF4A 1KILA 1DEEG 3AE5C 3V4QA 2ZYDA 2WSCJ 3USSA 3SFEC 1MFTA 4QMAA 2BCCJ 1NU1E 3GTSA 2I1JA 1PPJD 5L8RJ 1Z56A 5KJ7C 3H1HD 4WWIA 2E74C 3VCPA 3E1IA 3VP9A 3CCEP 1LGHB 1KQLA 2HYNA 2WSCH 1PGJA 5HL4A 1GL2D 2WPQA 2E4QA 1R5LA 3L70G 3RGUA 2W27A 2MJZA 4IL6E 3AE3C 4I1LA 4EOTA 1URQB 1EZVE 4RESB 3G71P 1FAVA 1RE4A 4TT3H 3P8CE 5AW2B 2OYIC 5APUA 4NB9D 5KLIB 3GLMA 2YKOA 3AE8C 1HJ0A 3SWYA 3AECC 3JSVC 3LW5H 4U3FJ 2KS1B 2AXTH 1H0TB 2BCCG 2IZ1A 2WQYC 4ZMDA 5M1BA 1KORA 4YTPC 2AEFA 3NTNA 4H44B 3BCCD 4TLFA 1SS1A 2H43A 1X0TA 1JMMA 2OGUA 3GG2A 3CMEP 1M57D 4JF7A 1EQ7A 2E76D 1Y9BA 3L70J 1N86A 1SQQE 1OVUA 3H1JJ 1H8AA 4W7ZA 5CCGA 1FDIA 2KIKA 3N0QA 1M1KQ 4DCKA 3H1ID 5B5EH 4NBHD 2KZJA 2P10A 3CMAP 1IJDB 1M90Q 4UB8E 1JNMA 1T8ZA 5APWA 1LTJB 1EXIA 4RKUJ 2FFDC 4I7ZC 1NOHA 5AVSB 4WB4A 2Y9ZA 4PD4D 2UWJE 2P7JA 1OW6A 2WSEH 2FYNB 1O7NA 3Q5RA 1SQPJ 1NAYA 2O01N 2WPRA 3AZCA 4C46A 2J58A 4I2LC 1Q82Q 5AW9B 3VYIA 4JBZA 2CKFA 4P1CH 1YBKA 3Q5PA 2ZXEB 3AEBC 2D2CB 1Q81Q 1FJKA 2JO1A 1LTGC 3CWBD 2IFNA 1FZCA 2R3SA 1FS0E 2N9BA 3HUSC 2NPSA 4ASWA 4HM2A 4YPCA 4PV1C 2FFDB 2E4PA 3OJAB 2ITAA 3TNUA 4N78E 1S5LH 4IFDK 1AVYA 1WT6A 2H8PD 1UIIA 2Q3IA 3OW2O 5EFWB 1YYCA 3KPEA 4IOIH 2I1KA 1T2KD 2KSEA 2WITA 1SQXJ 1IZNB 2AEMA 2K1AA 3IAOA 3A0BE 4R4MA 4JYCA 4D6TE 3MGNA 4WVZA 1AQTA 1HH0A 2IFMA 1T2KC 1LT9C 4UB8H 1GU5A 4EDFA 1USEA 1M1JA 2GUSA 1O7GA 1KQSO 1NKZB 4NPEA 1NU1J 3G9RA 1Y47A 1MZ9A 4QDFB 1ULJA 1HF9A 3VN0A 2ZT9C 2WWWA 1S2EA 4AIVA 3BCCE 4L73A 3PRJA 3B5NB 3TK1A 2NWFA 3RK2D 5H2FH 5KLIC 4C7NB 1DEBA 2GUVA 1RIEA 1SQBG 1OWAA 2W90A 3SFDC 3O6QB 1L4AB 1LT9B 1X22A 1N7SD 1IFDA 4ASVA 3FX0A 2NUKA 1FC2C 2JDIH 3HUSB 3EN1A 2YKPA 3AE7C 2HMKA 1RFSA 1NTMK 2WZ7A 4NBDD 3MD0A 2QE7H 2KNCB 4W80A 3VTPC 4DT0A 3B5NA 4YXDC 3H1KG 4H13C 4DOJA 2RMZA 3IR9A 4CPGA 4IFMA 1L0LJ 2W6BA 3FWNA 4HJLA 2POHA 4GODA 4PD4E 5APXA 3G3ZA 3H1LD 5B66H 1R8EA 1N2DC 4WBAA 3U1AA 2HMMA 1NU1G 4DJGA 1BE3G 4WY4C 1YJWP 2JWDA 4L76A 5TJHA 4PJ0H 1SQXD 1KZUB 1LNQA 2P2UA 3HD7A 4I7ZB 1NTKE 3GHGC 4O9BA 3L74G 1MUUA 5AEWA 2NPSC 3BCCG 1SQXG 1LJ2A 2M5AA 3I5CA 1CW5A 3L72J 2FBWC 2W6AA 2ZT9B 3HTKB 1AV1A 3L72G 3TGUJ 1OZHA 1SQVJ 2A45H 4OGQB 3L35A 1VF5B 1T3JA 1NTKD 3EQQA 1M56D 1BDDA 2IX7C 3FGAD 1FZCB 3TGUE 2L91A 2O01H 3GL0A 2K88A 4LC1A 3WMM0 1H88A 2NVFA 2R32A 3VMGD 1YQ3C 1SFCA 3AEDC 2IBZG 3B4SA 3JC22 1SQVK 4H13B 5B66E 1NJIQ 1OVVA 3CI9A 5CCGC 1FZAA 2C9LY 3CC7P 2YFJA 1JTHA 2NRGA 1EXJA 4IL6H 3A0BH 1FU1A 1N73B 2D2CC 3CCSP 3M0DA 1O7MA 3CX5H 3GB4A 2RKLA 1MV8A 3L74J 4B86A 1K04A 2A06D 3L74E 1NTZG 4ZKPA 1EG9A 1JY3P 3HE5B 1HBWA 1D7MA 4K3AA 3GHGB 2P1JA 1OW7A 2N1TB 2PAJA 3LW5J 1S9KD 1KYOI 1URQD 3H1KE 3CPWO 2WPSA 1JUNA 3CD6P 1PGOA 1H89A 1NTKJ 1L0LG 1BSHA 5BVZA 2KSJA 2YMKA 1OXZA 3A7OA 3MHVA 2KS1A 1L0NG 4P1BH 3H1KJ 5TISH 2XRXA 2XSHA 2H89C 4U3FG 3RK3C 2HMJA 1Q2NA 4IL6X 3GZXA 4QURA
chains in the Genus database with same CATH topology
2E76C 2WQYC 5M1BA 1PV3A 1KORA 3R4YA 4YTPC 3C8VA 3VCAA 4H44B 5KLVE 4HM1A 1NYKA 4NBED 3VMHD 3D70A 1L0LE 3L73E 2FYUE 1OMIA 1DD4A 2E76D 2D2CD 4HKVA 3GF3A 1O7WA 1Y9BA 4PV1B 2GBXA 4HM0A 1ZRTE 1SQQE 1OW8A 1FDIA 4Y28J 3N0QA 4NBHD 2FYNC 2BEZF 1P84E 5AEUA 1NTME 2J5UA 2NVGA 2P10A 1JM1A 1JB0J 1WMKA 1EXIA 4RKUJ 4I7ZC 4QDFA 3D71A 1OW6A 3Q5RA 1O7NA 3GKEA 4R4LA 2BEQD 2XR8A 3AZCA 3D6ZA 1U57A 2O01J 2BMOA 1AJYA 2WPVB 3AE2C 4KT0J 2CKFA 4P1CH 4PV1D 3GOBA 5BOKA 3Q5PA 1DIPA 3AEBC 2D2CB 3AEAC 2JO1A 2ZYLA 3T97B 3H1LE 1GMJA 4HM2A 3CWBE 4PV1C 2QJPC 3L75E 2E4PA 3Q1MA 3AEFC 4AAYB 2YFLA 4QUQA 4HM7A 1KB9E 1BE3E 3C0DA 4NBAD 4H0LD 2I7FA 4HM6A 4NBBD 2BCCE 4HM5A 2Q3WA 5CXMA 3IAOA 2YFIA 4R4MA 4QCKA 1NTZE 2BMRA 1DD3A 4H13D 4H0LC 2E75B 1Q90D 2G3AA 3GL2A 2ZT9D 1O7GA 3G9RA 2B24A 4QUPA 2MKVA 3Q2YA 2GBWA 4H44D 4QDFB 1ULJA 2IDBA 1Q90C 1UUWA 1HF9A 2ZT9C 1UUVA 4AIVA 2E76B 1SQPE 2NVEA 3BCCE 3IN6A 2NWFA 5KLIC 4H44C 2H88C 1RIEA 3L70E 3SFDC 2QPZA 2FXPA 1KYOE 2K9YA 1PP9E 2BMQA 2DE5D 2NUKA 1S1CX 1VL2A 3RL0g 3AE6C 3EN1A 4XFJA 3AE7C 1PL5A 1KMIZ 2JZAA 2HMKA 1RFSA 1O7HA 4EMJB 4NBDD 3H1JE 3L72E 4YXDC 3L71E 3GTEA 1O7PA 2A06E 2WSFJ 1YQ4C 4H13C 3GF7A 1RQVA 4HJLA 4QDCA 4PD4E 1R8EA 2IBZE 2DE7D 3DQYA 3H25A 2HMMA 1WQLA 1L0NE 1ZP0C 4U7JA 1SQXE 3AE9C 3GCEA 4QDDA 2YIUC 3AE4C 2NUMA 1UIXA 2B1XA 4NB8D 2WSEJ 3AE1C 4I7ZB 1NTKE 2QJYC 4HM4A 3D89A 4OGQC 1K05A 1KTMA 1ZMEC 3B71A 5AEWA 2E74D 2E75D 4GDOA 4Z1MH 2HMNA 2FBWC 2ZT9B 2G8YA 1IK7A 3GMAA 4OGQD 3D6YA 4NBGD 1VM9A 5KKZC 3RK3E 2JO6A 4OGQB 1PIXA 2NZ2A 1ZOYC 1VF5B 2DE6D 2OQQA 3ABVC 1KILE 3EQQA 1VF5D 2QIWA 3Q5SA 2HMOA 3GZYA 3FGAD 1RQUA 3TGUE 1PPJE 3GL0A 3H1IE 1SQBE 1KQGB 1G8JB 3H1HE 1VF5C 2V7QJ 2QSIA 2NVFA 1SJGA 1NGMB 3VMGD 4NBFD 1YQ3C 3VMID 4NBCD 3AEDC 4HM8A 3AE5C 3CXHE 2E74B 4H13B 3CX5E 2WSCJ 1TU3F 3SFEC 1SQVE 2YVJB 1NU1E 3GTSA 1ULIA 4H0LB 1VCKA 2YFJA 1EXJA 3AEEC 5L8RJ 1MKMA 2D2CC 1O7MA 3GB4A 2E74C 3S9OA 1KQFB 3VCPA 2E75C 1K04A 3L74E 1S5LX 1EG9A 5HL4A 3Q3DA 1G8KB 1OW7A 2E4QA 3LW5J 2XSOA 4U3FE 3H1KE 3AE3C 1EZVE 1NYHA 3O6QA 4HM3A 2JP3A 4TT3H 1FQTA 4NB9D 3EWKA 2QJKC 1FDOA 3GLMA 2YMKA 3AE8C 1BCCE 1HJ0A 4P1BH 3AECC 3AEGC 1NDOA 2XRXA 2XSHA 2H89C 2HMLA 2HMJA 4IL6X 3FOUA 3GZXA 4QURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EN1 A;  3GL0 A;  2QJP C;  3L75 E;  3H1I E;  2JZA A;  1SQB E;  1RFS A;  2E4P A;  2HMK A;  1O7H A;  3C8V A;  4EMJ B;  1G8J B;  3VCA A;  4NBD D;  4H44 B;  4AAY B;  5KLV E;  3H1H E;  4HM1 A;  2YFL A;  1NYK A;  4NBE D;  3VMH D;  2QSI A;  3H1J E;  2NVF A;  3L72 E;  4QUQ A;  4HM7 A;  1SJG A;  1KB9 E;  3VMG D;  1BE3 E;  3C0D A;  3L71 E;  4NBF D;  3GTE A;  1L0L E;  3VMI D;  1O7P A;  2A06 E;  2WSF J;  3L73 E;  2FYU E;  4NBA D;  4NBC D;  4H0L D;  4HM8 A;  2I7F A;  2E76 D;  2D2C D;  3CXH E;  2E74 B;  4HM6 A;  4HKV A;  4H13 B;  1O7W A;  4PV1 B;  4NBB D;  2BCC E;  3CX5 E;  2WSC J;  2GBX A;  4HM0 A;  4HJL A;  1ZRT E;  4HM5 A;  4QDC A;  2Q3W A;  4PD4 E;  1SQV E;  1SQQ E;  2YVJ B;  1NU1 E;  3GTS A;  5CXM A;  2IBZ E;  2DE7 D;  1ULI A;  2YFI A;  3DQY A;  4Y28 J;  4QCK A;  2HMM A;  4H0L B;  1WQL A;  1VCK A;  1L0N E;  2YFJ A;  1NTZ E;  3N0Q A;  1SQX E;  3GCE A;  5L8R J;  2BMR A;  4H13 D;  4NBH D;  2FYN C;  1P84 E;  2E75 B;  2YIU C;  4QDD A;  5AEU A;  1O7M A;  3GB4 A;  2NUM A;  1Q90 D;  1NTM E;  3VCP A;  2NVG A;  1JM1 A;  3GL2 A;  2ZT9 D;  1O7G A;  3L74 E;  2B1X A;  4NB8 D;  1S5L X;  2WSE J;  1JB0 J;  4I7Z B;  1EG9 A;  1NTK E;  2QJY C;  4HM4 A;  2B24 A;  3D89 A;  5HL4 A;  4QUP A;  4RKU J;  1G8K B;  2GBW A;  4QDF A;  4H44 D;  4QDF B;  1ULJ A;  5AEW A;  1O7N A;  1Q90 C;  2E74 D;  3GKE A;  1UUW A;  2E4Q A;  2E75 D;  3LW5 J;  2XSO A;  4U3F E;  2XR8 A;  3AZC A;  2HMN A;  3H1K E;  2O01 J;  2BMO A;  2ZT9 B;  1UUV A;  1EZV E;  4AIV A;  1SQP E;  2E76 B;  2NVE A;  3BCC E;  2WPV B;  4KT0 J;  2NWF A;  4HM3 A;  2CKF A;  4OGQ D;  5KLI C;  4NBG D;  4P1C H;  1FQT A;  5KKZ C;  1VM9 A;  2JO6 A;  4NB9 D;  4PV1 D;  4OGQ B;  3GOB A;  1RIE A;  5BOK A;  3L70 E;  2QJK C;  2D2C B;  1VF5 B;  1BCC E;  2DE6 D;  2QPZ A;  1KYO E;  2K9Y A;  3EQQ A;  1VF5 D;  2ZYL A;  4P1B H;  2QIW A;  1PP9 E;  2BMQ A;  1NDO A;  2DE5 D;  2NUK A;  2XRX A;  2HMO A;  2XSH A;  3GZY A;  3H1L E;  2HML A;  2HMJ A;  4IL6 X;  3FOU A;  3GZX A;  4HM2 A;  3TGU E;  4QUR A;  1PPJ E;  3CWB E; 
#chains in the Genus database with same CATH topology
 3L72 D;  1EZV G;  3A2A A;  1FZG A;  3VCA A;  1RF1 B;  2YO2 A;  1NTM D;  1L0L E;  3L73 E;  1OMI A;  1JOC A;  3V6I A;  4JPZ B;  2SPZ A;  1L4A A;  1SQB J;  4HM0 A;  2QM7 A;  1X9V A;  2YMY A;  2R3C A;  4ZNC A;  1YI2 P;  1JM0 A;  2ZXX A;  1L4A D;  4C7N A;  1P84 E;  2IBZ I;  3U1C A;  2A45 I;  1KFM A;  3RL0 C;  2HOD B;  3C1L A;  3VMY A;  4BRY B;  3L73 D;  4RO0 A;  3M0D C;  2OTK E;  3A0H E;  1PP9 D;  3ZDM A;  2YXQ B;  3D71 A;  5AVR B;  2IBZ D;  1M8O B;  1PGP A;  1YIT P;  1N7L A;  4OWF A;  2O3J A;  3CCL P;  2BEQ D;  2XR8 A;  3VMA A;  3D6Z A;  5APV A;  2N1T C;  2BMO A;  1LT9 A;  1AJY A;  1SFC C;  3SSU A;  3PJS K;  4MN4 C;  3AEA C;  2GA1 A;  3E7K A;  1RY3 A;  2ZYL A;  3P8M C;  4WY4 B;  3H1L E;  1JY3 O;  3KYQ A;  3RK2 C;  1IFP A;  2J59 M;  3RK3 B;  3CWB E;  1G1J A;  2Q1K A;  2W83 C;  3Q1M A;  2C0W A;  3W68 A;  4EIJ A;  3QH9 A;  2QRX A;  5KAI H;  4QUQ A;  4HM7 A;  3A0H H;  3C0D A;  4KJM A;  1NTZ K;  3L74 D;  1NU1 D;  1RHZ B;  4NBA D;  4H0L D;  5AVW B;  2I7F A;  1IFJ A;  4HM6 A;  3UIA A;  4W7Y A;  3FXE A;  2BCC E;  2Y9Y A;  1NO4 A;  1LTJ A;  5KLV G;  2JKV A;  3PLN A;  2YFI A;  2OTL P;  3FWL A;  1NTZ E;  3JCU H;  1ZR4 A;  1NHL A;  2PP6 A;  2BMR A;  4H13 D;  4H0L C;  3PHL A;  5APS A;  1Q90 D;  2FY8 A;  2IZ0 A;  2KXP B;  4LGD E;  1XTC C;  4UB6 E;  2B24 A;  2FFD A;  1HGV A;  3Q2Y A;  2GBW A;  1SQQ D;  4D6T J;  1Q90 C;  1NWQ A;  2GM4 A;  2QVA A;  4IFF A;  1RH5 B;  3P7K A;  4NPF X;  2P67 A;  1E5W A;  1SQP E;  3TF5 A;  2QJY B;  4H44 C;  2HLO A;  3H1K D;  2AXC A;  2Q7C A;  2WT7 B;  3H32 B;  4AUW A;  4PD4 H;  1BGY E;  2QPZ A;  2K37 A;  1LWU B;  3TYY A;  2BMQ A;  4L75 A;  1USD A;  1GL2 A;  3II6 A;  2KNC A;  1M1J B;  1PL5 A;  1VPC A;  3G6E P;  3CCR P;  1GK6 A;  2B87 A;  2B89 A;  3L72 E;  3F5H A;  3M9Q A;  1O7P A;  2A06 E;  2WSF J;  1YQ4 C;  3NXS A;  1L0N J;  1KIL C;  2YXR B;  1KFN A;  2M3B A;  2ZJS E;  3W67 A;  1LTJ C;  2IBZ E;  2Z4E A;  4C7R A;  2FYU K;  3H1L J;  3GCE A;  2JJL A;  4QDD A;  5KLV K;  1FOS E;  2WSF H;  1AA0 A;  1P84 H;  1M1J C;  1OVR A;  1LTB C;  4NB8 D;  2WSE J;  4GT1 A;  3D89 A;  2Y0D A;  1KTM A;  2KK7 A;  1SQQ K;  3HE4 B;  3G4S P;  2XNX A;  1HWT C;  1JEK A;  1KIL B;  2C0X A;  2HMN A;  1CI6 A;  1MFZ A;  2QEX P;  3PTZ A;  3WU2 H;  2PRR A;  2G8Y A;  4Y99 B;  3GMA A;  3D6Y A;  4NBG D;  5KKZ C;  2WT7 A;  5APY A;  3V2R A;  3BAT A;  2V7Q H;  1PP9 G;  1ZOY C;  3N7N A;  1YIJ P;  3MTU E;  1CSB A;  3ABV C;  1VF5 D;  3E1R A;  1AFO A;  3EFG A;  1PPJ E;  1LP1 A;  2IYP A;  3HUS A;  4DZO A;  1SQB E;  2E43 A;  2K9J A;  1G8J B;  1FE6 A;  3H1H E;  1VF5 C;  2V7Q J;  1QLE D;  3L73 J;  3L75 D;  4GIF A;  1NGM B;  3RK3 D;  1QGK B;  1VQL P;  2ZYA A;  1ZXG A;  5GTH H;  1S4X A;  4HM8 A;  3CXH E;  1NU1 K;  4M3L A;  4N6J A;  1SQV E;  1VQM P;  2WVR A;  2YVJ B;  3H1H J;  1GTW A;  4H0L B;  1GZL A;  2KB7 P;  1VCK A;  5KTB A;  3AEE C;  1ZRT D;  1GD2 E;  1MKM A;  1SQB D;  3M06 A;  3RBX A;  1X8Y A;  1GL2 C;  2W8Z A;  4ZKU A;  1RF0 A;  2FYU J;  3S9O A;  3CCV P;  3L75 J;  1U7J A;  3H6P A;  5AW3 B;  1VQO P;  1G8K B;  2PFX A;  1N73 C;  3MZW B;  3WU2 E;  2OTJ P;  2E42 A;  4U3F E;  3HD7 D;  1PGQ A;  2C9N Y;  3O6Q A;  3LID A;  2JP3 A;  1FQT A;  1W2B O;  1PZQ A;  5KJ7 A;  2KLU A;  1BSN A;  1FDO A;  5KKZ B;  1IC2 A;  3RBZ A;  1BCC G;  3HE4 A;  1NDO A;  2V4H A;  1JO5 A;  2CK3 H;  2HML A;  1LWU A;  1SQQ G;  3R2P A;  5AW6 B;  3FOU A;  1SFC D;  2XU6 A;  2E76 C;  3LIE A;  3R4Y A;  3C8V A;  4AYC A;  5KLV E;  4NBE D;  3VOP A;  1VQ4 P;  4XA4 A;  2ZFC A;  2FYU E;  2AXT E;  2Q5U A;  1RE4 C;  1DD4 A;  2D2C D;  3GF3 A;  1O7W A;  4PV1 B;  4RJT A;  1ZRT E;  3H1I J;  1OW8 A;  5AW5 B;  3B8E B;  1NTK K;  2LXC B;  2BEZ F;  1S3J A;  3I55 P;  3EFF K;  1L0N D;  3CCU P;  5CCH D;  2KOG A;  1PPJ G;  1URQ C;  1FJP A;  1WMK A;  5AW7 B;  1EDI A;  1FZF A;  1QVF O;  1HJB A;  4QDF A;  2KYV A;  1KV4 A;  1ZR2 A;  3RL0 B;  1U57 A;  1W2E A;  4Y99 C;  1SQP K;  3KZI E;  1A02 J;  4XE5 B;  1EC5 A;  5KAI E;  1SVF A;  1Q7Y Q;  4PV1 D;  1IFN A;  1J1D B;  1DIP A;  5CCH A;  1VQ5 P;  5AVV B;  1S5L E;  2XND H;  2Y0E A;  3OAK A;  1JCC A;  1GW4 A;  1GMJ A;  2KP8 A;  2YO3 A;  1KYO D;  1RE3 A;  4D6T D;  1H0T A;  1FOS F;  5AW1 B;  1K8A Q;  5DJT B;  5TIS E;  4HJG H;  2P58 A;  2OYH B;  1KB9 E;  1VQN P;  1L4A C;  4GKG A;  2XV5 A;  1EDJ A;  3VMX A;  2CPS A;  2Q3E A;  5GTH E;  2FXO A;  4HM5 A;  2Q3W A;  1LT1 A;  3CXH H;  2QJK B;  1VDF A;  4QCK A;  2LKM A;  5APQ A;  2YNY A;  1VQ9 P;  2JR8 A;  1JY3 N;  2E5Y A;  2G3A A;  3GL2 A;  2IPP A;  2ZT9 D;  2DW3 A;  2N1T D;  1G1I A;  3V4W A;  3S1K A;  1XTG B;  1IK9 A;  4EYY Q;  3QWO C;  4QUP A;  3CX5 D;  1RF0 C;  5H2F E;  1K9M Q;  3GW6 A;  2CPB A;  3IFM A;  2IDB A;  2YKQ A;  4D6T G;  2M5A B;  2PGD A;  2WTY A;  5KLV D;  2NVE A;  3GHG A;  1WRG A;  3IN6 A;  1JMB A;  1JY2 N;  1BE3 D;  2H88 C;  3L70 E;  1EZV D;  2ZYG A;  2FXP A;  3TDK A;  1KYO E;  2OAR A;  1JY2 P;  3CCJ P;  1JTH B;  1PP9 E;  2DE5 D;  1SQV D;  3SWK A;  4WY4 A;  1S1C X;  3OA7 A;  5KLV J;  3AE6 C;  2B87 B;  4XFJ A;  1KN7 A;  1KB9 I;  2HPC B;  2M3E A;  1O7H A;  4EMJ B;  1JY2 O;  5AVX B;  1GU4 A;  1N7S C;  5CMZ A;  2XKM A;  3U59 A;  2HFE D;  3L71 E;  3GF7 A;  3CLQ A;  3A3Y B;  1EDK A;  3CWB G;  1N7S A;  4QDC A;  3KDP B;  1OFC X;  4I6M C;  1K73 Q;  1WQL A;  2B9B A;  4KHX A;  4OVN F;  4U7J A;  5AW4 B;  1CZQ A;  1X79 B;  2YIU C;  3AE4 C;  2R5B A;  1IFI A;  2KI7 B;  3L71 G;  1UIX A;  1L0L D;  3MUD A;  2WMM A;  3F89 A;  3TNU B;  1NTM J;  2FXM A;  2R5D A;  3T97 A;  3WUT A;  5K5G B;  2OYH A;  3B71 A;  1AQ5 A;  2E74 D;  4AQR D;  3ITK A;  5BU5 A;  1PFI A;  1FBM A;  4GDO A;  4Z1M H;  1YJN P;  5KAF E;  2LR2 A;  1L0L K;  1IK7 A;  1J1D C;  3VMZ A;  1CI6 B;  2H7H A;  1ZLL A;  2JO6 A;  3V2P A;  1QL2 A;  3CX5 I;  4HKZ H;  2DE6 D;  1QX8 A;  3HD7 C;  4BRY A;  2OQQ A;  1U7M A;  2ZVN B;  3CCM P;  3Q5S A;  1NTM G;  2HMO A;  3GZY A;  5CHX A;  1NAF A;  2LXB A;  1RQU A;  1T6A A;  2Q9I A;  3H1I E;  1KQG B;  4A7P A;  2JWA A;  3CCQ P;  1Q86 Q;  1HUC A;  3P8C D;  1GK4 A;  4NBF D;  3VMI D;  4L74 A;  3HRN A;  1N8R Q;  2O1J A;  3BVH A;  5B5E E;  2E74 B;  2Q6Q A;  3CX5 E;  1TU3 F;  1Y8A A;  2KLV A;  4BWN A;  1ULI A;  1RF1 C;  1RE3 C;  5AW8 B;  5AW0 B;  5AVY B;  3PH0 A;  1T3U A;  1FZE A;  1NTK G;  1KQF B;  1SQB K;  2E75 C;  5CCG D;  4N3Y B;  3O8Z A;  3CXH I;  1S5L X;  1GW3 A;  1BCC D;  3Q3D A;  1E79 H;  3L71 J;  3FXD A;  1LWU C;  5CJ4 A;  2OYO A;  2ZVO B;  2XSO A;  3M9H A;  1A02 F;  1G2C A;  3A5T A;  1NYH A;  2ZAE B;  4HH2 A;  4HM3 A;  4EI2 A;  4PJ0 E;  1YTZ I;  3TSI A;  3EWK A;  3M91 A;  2QJK C;  3CWB J;  3KQG A;  1BCC E;  3TGU D;  2VRS A;  1OX3 A;  3AEG C;  3H32 A;  1N73 A;  5GTI H;  3M9B A;  3B5N C;  1PV3 A;  3JCU E;  4PD4 I;  3VP8 A;  2K9J B;  1SQP D;  4HM1 A;  1NYK A;  3VMH D;  4GOF A;  3D70 A;  1L2P A;  2BAS A;  2KZI A;  1FZB A;  5KJ7 D;  1YTZ T;  1BGY J;  3B5N D;  4HKV A;  1VQP P;  2GBX A;  4JYB A;  1AVO A;  3WUV A;  5CBO A;  2FYU D;  1ZN5 A;  5E79 E;  1J2J B;  4Y28 J;  2A06 G;  2BCC D;  3L36 A;  2YIU B;  2FYN C;  5AEU A;  1W5C E;  1J1E B;  1NTM E;  2E5T A;  2FYU G;  2B88 A;  2J5U A;  3H1J D;  2NVG A;  2QA4 P;  1JM1 A;  3BRT B;  1LTS C;  3L70 D;  4YXW H;  1SQX K;  3L4F A;  1L0N K;  1JB0 J;  5AVZ B;  2QJP B;  5GTI E;  2N9Y B;  2HPC A;  2Y0C A;  4K35 A;  1VQ6 P;  4HB1 A;  1VQ7 P;  1BDC A;  1N7S B;  3RL0 D;  3GKE A;  1RF1 A;  3BCC J;  4R4L A;  2HG5 D;  1KB9 H;  2O01 J;  3MUD C;  2WPV B;  2QM8 A;  2Z5H A;  3AE2 C;  4KT0 J;  1KD1 Q;  4U3F D;  3GOB A;  5BOK A;  4HYT B;  2I8D A;  1NH4 A;  5E79 H;  1LP1 B;  1J1E C;  1DH3 A;  1LTI C;  1BE3 J;  1QEX A;  2M0B A;  3T97 B;  2WSS H;  3EQ2 A;  2RN0 A;  1R5S A;  2QJP C;  3L75 E;  3L71 D;  3MIW A;  1PP9 J;  3AEF C;  4GOE A;  3I56 P;  4AAY B;  2N1T A;  2YFL A;  1SQV G;  2K3R A;  3PP5 A;  3V5B A;  2O1K A;  3TGU G;  1BE3 E;  1GL2 B;  3H1I G;  1ZW0 A;  4NBB D;  1FZC C;  1SLQ A;  5CCH C;  5CXM A;  2L5G B;  2HR3 A;  2OYH C;  2A45 G;  1DD3 A;  4UB6 H;  2FKW B;  2E75 B;  1QL1 A;  1YJ9 P;  3HE5 A;  1KYO H;  1EDL A;  3WUU A;  1LTT C;  1BGY D;  3CXH D;  3H1L G;  2MKV A;  4WY4 D;  2OYI A;  2Z5I A;  5APT A;  1IO4 A;  1HGZ A;  1P84 I;  1S72 P;  4H44 D;  1UUW A;  1URQ A;  3K5B A;  1NTZ D;  2XZR A;  1UUV A;  2E76 B;  3RK2 B;  5AVQ B;  3CC2 P;  1LTA C;  2W6J H;  3N4X A;  3M0A A;  1M7L A;  2NPS D;  2IYO A;  1IFM A;  1BGY G;  2K9Y A;  3SWF A;  2HOD A;  1NKN A;  5BU8 B;  3KZI H;  1NTZ J;  1VL2 A;  3L75 G;  3RL0 g;  3HTK A;  1KIL D;  1KMI Z;  2JZA A;  2XDJ A;  1SQQ J;  2FYZ A;  3H1J E;  1KC8 Q;  3GTE A;  3H1H G;  1NVO A;  1BCC J;  1VQ8 P;  2AEJ A;  1ZV8 A;  1RQV A;  2DE7 D;  3DQY A;  3NMD A;  3H25 A;  4NPD A;  1L0N E;  1ZP0 C;  1QVG O;  1SQX E;  3AE9 C;  3MP7 B;  5KAF H;  2NPS B;  1JCD A;  3KXD A;  5DJU B;  1YHQ P;  2NUM A;  4N78 D;  1HVV A;  5AVU B;  4BXL A;  2B1X A;  1HTL C;  3C9I A;  3V2N A;  3AE1 C;  1S9K E;  2QJY C;  4HM4 A;  4LLH A;  4OH8 B;  4OGQ C;  1K05 A;  5C39 A;  1OIP A;  1ZME C;  1SQP G;  2E75 D;  3CL3 D;  1VQK P;  3BRV B;  5AVT B;  2QG4 A;  2OYI B;  1GDT A;  2R44 A;  4OGQ D;  5CJ0 A;  3NFQ A;  1VM9 A;  3RK3 E;  1EZV I;  1PIX A;  2NZ2 A;  3CC4 P;  3V2Q A;  1KIL E;  2QIW A;  3BAS A;  1FDM A;  3L73 G;  2JEE A;  3H1J G;  1KB9 D;  3P32 A;  1SFC B;  1P84 D;  3S4R A;  3HD7 B;  2KUB A;  4JQ0 D;  2RH0 A;  2QSI A;  2M8R A;  1DX7 A;  1SJG A;  1G2C B;  3KHU A;  4NBC D;  1SP4 A;  3L37 A;  5CBN A;  3IF4 A;  1KIL A;  1DEE G;  3AE5 C;  3V4Q A;  2ZYD A;  2WSC J;  3USS A;  3SFE C;  1MFT A;  4QMA A;  2BCC J;  1NU1 E;  3GTS A;  2I1J A;  1PPJ D;  5L8R J;  1Z56 A;  5KJ7 C;  3H1H D;  4WWI A;  2E74 C;  3VCP A;  3E1I A;  3VP9 A;  3CCE P;  1LGH B;  1KQL A;  2HYN A;  2WSC H;  1PGJ A;  5HL4 A;  1GL2 D;  2WPQ A;  2E4Q A;  1R5L A;  3L70 G;  3RGU A;  2W27 A;  2MJZ A;  4IL6 E;  3AE3 C;  4I1L A;  4EOT A;  1URQ B;  1EZV E;  4RES B;  3G71 P;  1FAV A;  1RE4 A;  4TT3 H;  3P8C E;  5AW2 B;  2OYI C;  5APU A;  4NB9 D;  5KLI B;  3GLM A;  2YKO A;  3AE8 C;  1HJ0 A;  3SWY A;  3AEC C;  3JSV C;  3LW5 H;  4U3F J;  2KS1 B;  2AXT H;  1H0T B;  2BCC G;  2IZ1 A;  2WQY C;  4ZMD A;  5M1B A;  1KOR A;  4YTP C;  2AEF A;  3NTN A;  4H44 B;  3BCC D;  4TLF A;  1SS1 A;  2H43 A;  1X0T A;  1JMM A;  2OGU A;  3GG2 A;  3CME P;  1M57 D;  4JF7 A;  1EQ7 A;  2E76 D;  1Y9B A;  3L70 J;  1N86 A;  1SQQ E;  1OVU A;  3H1J J;  1H8A A;  4W7Z A;  5CCG A;  1FDI A;  2KIK A;  3N0Q A;  1M1K Q;  4DCK A;  3H1I D;  5B5E H;  4NBH D;  2KZJ A;  2P10 A;  3CMA P;  1IJD B;  1M90 Q;  4UB8 E;  1JNM A;  1T8Z A;  5APW A;  1LTJ B;  1EXI A;  4RKU J;  2FFD C;  4I7Z C;  1NOH A;  5AVS B;  4WB4 A;  2Y9Z A;  4PD4 D;  2UWJ E;  2P7J A;  1OW6 A;  2WSE H;  2FYN B;  1O7N A;  3Q5R A;  1SQP J;  1NAY A;  2O01 N;  2WPR A;  3AZC A;  4C46 A;  2J58 A;  4I2L C;  1Q82 Q;  5AW9 B;  3VYI A;  4JBZ A;  2CKF A;  4P1C H;  1YBK A;  3Q5P A;  2ZXE B;  3AEB C;  2D2C B;  1Q81 Q;  1FJK A;  2JO1 A;  1LTG C;  3CWB D;  2IFN A;  1FZC A;  2R3S A;  1FS0 E;  2N9B A;  3HUS C;  2NPS A;  4ASW A;  4HM2 A;  4YPC A;  4PV1 C;  2FFD B;  2E4P A;  3OJA B;  2ITA A;  3TNU A;  4N78 E;  1S5L H;  4IFD K;  1AVY A;  1WT6 A;  2H8P D;  1UII A;  2Q3I A;  3OW2 O;  5EFW B;  1YYC A;  3KPE A;  4IOI H;  2I1K A;  1T2K D;  2KSE A;  2WIT A;  1SQX J;  1IZN B;  2AEM A;  2K1A A;  3IAO A;  3A0B E;  4R4M A;  4JYC A;  4D6T E;  3MGN A;  4WVZ A;  1AQT A;  1HH0 A;  2IFM A;  1T2K C;  1LT9 C;  4UB8 H;  1GU5 A;  4EDF A;  1USE A;  1M1J A;  2GUS A;  1O7G A;  1KQS O;  1NKZ B;  4NPE A;  1NU1 J;  3G9R A;  1Y47 A;  1MZ9 A;  4QDF B;  1ULJ A;  1HF9 A;  3VN0 A;  2ZT9 C;  2WWW A;  1S2E A;  4AIV A;  3BCC E;  4L73 A;  3PRJ A;  3B5N B;  3TK1 A;  2NWF A;  3RK2 D;  5H2F H;  5KLI C;  4C7N B;  1DEB A;  2GUV A;  1RIE A;  1SQB G;  1OWA A;  2W90 A;  3SFD C;  3O6Q B;  1L4A B;  1LT9 B;  1X22 A;  1N7S D;  1IFD A;  4ASV A;  3FX0 A;  2NUK A;  1FC2 C;  2JDI H;  3HUS B;  3EN1 A;  2YKP A;  3AE7 C;  2HMK A;  1RFS A;  1NTM K;  2WZ7 A;  4NBD D;  3MD0 A;  2QE7 H;  2KNC B;  4W80 A;  3VTP C;  4DT0 A;  3B5N A;  4YXD C;  3H1K G;  4H13 C;  4DOJ A;  2RMZ A;  3IR9 A;  4CPG A;  4IFM A;  1L0L J;  2W6B A;  3FWN A;  4HJL A;  2POH A;  4GOD A;  4PD4 E;  5APX A;  3G3Z A;  3H1L D;  5B66 H;  1R8E A;  1N2D C;  4WBA A;  3U1A A;  2HMM A;  1NU1 G;  4DJG A;  1BE3 G;  4WY4 C;  1YJW P;  2JWD A;  4L76 A;  5TJH A;  4PJ0 H;  1SQX D;  1KZU B;  1LNQ A;  2P2U A;  3HD7 A;  4I7Z B;  1NTK E;  3GHG C;  4O9B A;  3L74 G;  1MUU A;  5AEW A;  2NPS C;  3BCC G;  1SQX G;  1LJ2 A;  2M5A A;  3I5C A;  1CW5 A;  3L72 J;  2FBW C;  2W6A A;  2ZT9 B;  3HTK B;  1AV1 A;  3L72 G;  3TGU J;  1OZH A;  1SQV J;  2A45 H;  4OGQ B;  3L35 A;  1VF5 B;  1T3J A;  1NTK D;  3EQQ A;  1M56 D;  1BDD A;  2IX7 C;  3FGA D;  1FZC B;  3TGU E;  2L91 A;  2O01 H;  3GL0 A;  2K88 A;  4LC1 A;  3WMM 0;  1H88 A;  2NVF A;  2R32 A;  3VMG D;  1YQ3 C;  1SFC A;  3AED C;  2IBZ G;  3B4S A;  3JC2 2;  1SQV K;  4H13 B;  5B66 E;  1NJI Q;  1OVV A;  3CI9 A;  5CCG C;  1FZA A;  2C9L Y;  3CC7 P;  2YFJ A;  1JTH A;  2NRG A;  1EXJ A;  4IL6 H;  3A0B H;  1FU1 A;  1N73 B;  2D2C C;  3CCS P;  3M0D A;  1O7M A;  3CX5 H;  3GB4 A;  2RKL A;  1MV8 A;  3L74 J;  4B86 A;  1K04 A;  2A06 D;  3L74 E;  1NTZ G;  4ZKP A;  1EG9 A;  1JY3 P;  3HE5 B;  1HBW A;  1D7M A;  4K3A A;  3GHG B;  2P1J A;  1OW7 A;  2N1T B;  2PAJ A;  3LW5 J;  1S9K D;  1KYO I;  1URQ D;  3H1K E;  3CPW O;  2WPS A;  1JUN A;  3CD6 P;  1PGO A;  1H89 A;  1NTK J;  1L0L G;  1BSH A;  5BVZ A;  2KSJ A;  2YMK A;  1OXZ A;  3A7O A;  3MHV A;  2KS1 A;  1L0N G;  4P1B H;  3H1K J;  5TIS H;  2XRX A;  2XSH A;  2H89 C;  4U3F G;  3RK3 C;  2HMJ A;  1Q2N A;  4IL6 X;  3GZX A;  4QUR A; 
#chains in the Genus database with same CATH homology
 2E76 C;  2WQY C;  5M1B A;  1PV3 A;  1KOR A;  3R4Y A;  4YTP C;  3C8V A;  3VCA A;  4H44 B;  5KLV E;  4HM1 A;  1NYK A;  4NBE D;  3VMH D;  3D70 A;  1L0L E;  3L73 E;  2FYU E;  1OMI A;  1DD4 A;  2E76 D;  2D2C D;  4HKV A;  3GF3 A;  1O7W A;  1Y9B A;  4PV1 B;  2GBX A;  4HM0 A;  1ZRT E;  1SQQ E;  1OW8 A;  1FDI A;  4Y28 J;  3N0Q A;  4NBH D;  2FYN C;  2BEZ F;  1P84 E;  5AEU A;  1NTM E;  2J5U A;  2NVG A;  2P10 A;  1JM1 A;  1JB0 J;  1WMK A;  1EXI A;  4RKU J;  4I7Z C;  4QDF A;  3D71 A;  1OW6 A;  3Q5R A;  1O7N A;  3GKE A;  4R4L A;  2BEQ D;  2XR8 A;  3AZC A;  3D6Z A;  1U57 A;  2O01 J;  2BMO A;  1AJY A;  2WPV B;  3AE2 C;  4KT0 J;  2CKF A;  4P1C H;  4PV1 D;  3GOB A;  5BOK A;  3Q5P A;  1DIP A;  3AEB C;  2D2C B;  3AEA C;  2JO1 A;  2ZYL A;  3T97 B;  3H1L E;  1GMJ A;  4HM2 A;  3CWB E;  4PV1 C;  2QJP C;  3L75 E;  2E4P A;  3Q1M A;  3AEF C;  4AAY B;  2YFL A;  4QUQ A;  4HM7 A;  1KB9 E;  1BE3 E;  3C0D A;  4NBA D;  4H0L D;  2I7F A;  4HM6 A;  4NBB D;  2BCC E;  4HM5 A;  2Q3W A;  5CXM A;  3IAO A;  2YFI A;  4R4M A;  4QCK A;  1NTZ E;  2BMR A;  1DD3 A;  4H13 D;  4H0L C;  2E75 B;  1Q90 D;  2G3A A;  3GL2 A;  2ZT9 D;  1O7G A;  3G9R A;  2B24 A;  4QUP A;  2MKV A;  3Q2Y A;  2GBW A;  4H44 D;  4QDF B;  1ULJ A;  2IDB A;  1Q90 C;  1UUW A;  1HF9 A;  2ZT9 C;  1UUV A;  4AIV A;  2E76 B;  1SQP E;  2NVE A;  3BCC E;  3IN6 A;  2NWF A;  5KLI C;  4H44 C;  2H88 C;  1RIE A;  3L70 E;  3SFD C;  2QPZ A;  2FXP A;  1KYO E;  2K9Y A;  1PP9 E;  2BMQ A;  2DE5 D;  2NUK A;  1S1C X;  1VL2 A;  3RL0 g;  3AE6 C;  3EN1 A;  4XFJ A;  3AE7 C;  1PL5 A;  1KMI Z;  2JZA A;  2HMK A;  1RFS A;  1O7H A;  4EMJ B;  4NBD D;  3H1J E;  3L72 E;  4YXD C;  3L71 E;  3GTE A;  1O7P A;  2A06 E;  2WSF J;  1YQ4 C;  4H13 C;  3GF7 A;  1RQV A;  4HJL A;  4QDC A;  4PD4 E;  1R8E A;  2IBZ E;  2DE7 D;  3DQY A;  3H25 A;  2HMM A;  1WQL A;  1L0N E;  1ZP0 C;  4U7J A;  1SQX E;  3AE9 C;  3GCE A;  4QDD A;  2YIU C;  3AE4 C;  2NUM A;  1UIX A;  2B1X A;  4NB8 D;  2WSE J;  3AE1 C;  4I7Z B;  1NTK E;  2QJY C;  4HM4 A;  3D89 A;  4OGQ C;  1K05 A;  1KTM A;  1ZME C;  3B71 A;  5AEW A;  2E74 D;  2E75 D;  4GDO A;  4Z1M H;  2HMN A;  2FBW C;  2ZT9 B;  2G8Y A;  1IK7 A;  3GMA A;  4OGQ D;  3D6Y A;  4NBG D;  1VM9 A;  5KKZ C;  3RK3 E;  2JO6 A;  4OGQ B;  1PIX A;  2NZ2 A;  1ZOY C;  1VF5 B;  2DE6 D;  2OQQ A;  3ABV C;  1KIL E;  3EQQ A;  1VF5 D;  2QIW A;  3Q5S A;  2HMO A;  3GZY A;  3FGA D;  1RQU A;  3TGU E;  1PPJ E;  3GL0 A;  3H1I E;  1SQB E;  1KQG B;  1G8J B;  3H1H E;  1VF5 C;  2V7Q J;  2QSI A;  2NVF A;  1SJG A;  1NGM B;  3VMG D;  4NBF D;  1YQ3 C;  3VMI D;  4NBC D;  3AED C;  4HM8 A;  3AE5 C;  3CXH E;  2E74 B;  4H13 B;  3CX5 E;  2WSC J;  1TU3 F;  3SFE C;  1SQV E;  2YVJ B;  1NU1 E;  3GTS A;  1ULI A;  4H0L B;  1VCK A;  2YFJ A;  1EXJ A;  3AEE C;  5L8R J;  1MKM A;  2D2C C;  1O7M A;  3GB4 A;  2E74 C;  3S9O A;  1KQF B;  3VCP A;  2E75 C;  1K04 A;  3L74 E;  1S5L X;  1EG9 A;  5HL4 A;  3Q3D A;  1G8K B;  1OW7 A;  2E4Q A;  3LW5 J;  2XSO A;  4U3F E;  3H1K E;  3AE3 C;  1EZV E;  1NYH A;  3O6Q A;  4HM3 A;  2JP3 A;  4TT3 H;  1FQT A;  4NB9 D;  3EWK A;  2QJK C;  1FDO A;  3GLM A;  2YMK A;  3AE8 C;  1BCC E;  1HJ0 A;  4P1B H;  3AEC C;  3AEG C;  1NDO A;  2XRX A;  2XSH A;  2H89 C;  2HML A;  2HMJ A;  4IL6 X;  3FOU A;  3GZX A;  4QUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...