2QJYC

Crystal structure of rhodobacter sphaeroides double mutant with stigmatellin and uq2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
179
structure length
179
Chain Sequence
b'GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCSPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
molecule tags Oxidoreductase
source organism Rhodobacter sphaeroides
publication title Inhibitor-complexed Structures of the Cytochrome bc1 from the Photosynthetic Bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
total genus 55
structure length 179
sequence length 179
chains with identical sequence F, I, L, O, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2007-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qjyC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qjyC02
4QDDA 2NWFA 1G8JB 2QJPC 3GOBA 2HMLA 2NVFA 2HMMA 1P84E 1NU1E 2BMOA 1NYKA 2DE5D 2FYUE 2I7FA 2E74B 3GL2A 1BE3E 1FQTA 2XSOA 1VM9A 2WSCJ 1L0NE 3CX5E 2ZYLA 5AEUA 2K9YA 1Q90C 2QSIA 1G8KB 1EZVE 1SQXE 2JO6A 3L73E 4QUPA 3LW5J 3CWBE 4QDFA 4P1BH 2QJYC 4H0LD 4PV1D 4QURA 2YFIA 4HM1A 1SQQE 2D2CD 4HM0A 2NVGA 4HM4A 3AZCA 2CKFA 3VCPA 1VF5D 2ZT9D 3L75E 4NBED 3VCAA 4PV1B 3C8VA 3L72E 3VMHD 3FOUA 2DE7D 2DE6D 1ZRTE 2B1XA 2HMJA 2E74D 1SQVE 1O7GA 3H1IE 2E76B 3VMID 1SQBE 4U3FE 3H1LE 2XR8A 1O7WA 1SQPE 4HM3A 1NTME 1PP9E 1UUVA 2GBWA 3H1JE 4OGQD 3GL0A 3D89A 1NDOA 5KLVE 1EG9A 4QDCA 1O7PA 4OGQB 1SJGA 4Y28J 3DQYA 1S5LX 2WSFJ 1RFSA 4HJLA 2E75D 3GCEA 4H44D 4NBCD 3EQQA 2IBZE 3L70E 4H44B 2BMRA 2GBXA 4PD4E 4HM6A 4I7ZB 2Q3WA 4H0LB 4HM8A 2XSHA 4AIVA 2QPZA 5HL4A 1ULJA 4NBGD 2FYNC 4AAYB 4IL6X 2O01J 4H13B 1PPJE 2YVJB 2E75B 3H1KE 5KKZC 1WQLA 4NBFD 1Q90D 4NBDD 4NBBD 3EN1A 1UUWA 2BCCE 2E4PA 2A06E 4QCKA 5CXMA 1JB0J 3TGUE 4QDFB 1O7HA 3GKEA 3N0QA 3L74E 5BOKA 2YFLA 1JM1A 3GTEA 3L71E 1VCKA 4QUQA 3H1HE 4P1CH 4H13D 1O7NA 2BMQA 1NTZE 5KLIC 2YFJA 4HKVA 4KT0J 4HM2A 3VMGD 4EMJB 2NUKA 2D2CB 2B24A 4NBHD 1BCCE 2WPVB 2WSEJ 2E76D 2YIUC 1VF5B 2ZT9B 2HMKA 3GZXA 3CXHE 4NB8D 2NUMA 2NVEA 2HMOA 2E4QA 1L0LE 3C0DA 4HM7A 1KYOE 1NTKE 2HMNA 3GTSA 2QIWA 5AEWA 3BCCE 1O7MA 4RKUJ 1ULIA 5L8RJ 4HM5A 2JZAA 3GB4A 4NBAD 2XRXA 1KB9E 4NB9D 3GZYA 2QJKC 1RIEA
chains in the Genus database with same CATH superfamily
3TGUJ 1USDA 3QWOC 4I2LC 3HD7C 3SSUA 3GOBA 3FXEA 1EDLA 2ITAA 2Z4EA 5CBOA 1VQ9P 1SQXE 1N8RQ 4PV1D 5APTA 4AUWA 1OX3A 4U3FG 2H8PD 3M0DA 3VCPA 1G2CB 4ZMDA 3L72E 2FYNB 1KFNA 1SQBK 1OWAA 2JWDA 3L74D 3B5NB 3U1CA 3Q2YA 3TGUD 2GUSA 3V5BA 1NKZB 3WMM0 3VMID 1NTZJ 2B87A 1SQPE 4OGQD 2BEZF 2Y0DA 1NDOA 5KLVE 1EG9A 1SJGA 3H1KG 3W68A 2A45I 3K5BA 3B5NA 1FDMA 2JWAA 1IFDA 4IL6X 3PTZA 2L91A 1YJ9P 4HH2A 1NGMB 1URQB 1LJ2A 2Q1KA 2IFNA 3TGUE 3SWKA 4C46A 1X0TA 3CCUP 5KAIH 5BOKA 1LNQA 1OW7A 3L73G 3H1HE 3RBXA 3WUUA 2WZ7A 1BGYD 2FXOA 2ZVOB 2ZT9B 2NPSC 1FZBA 4NB8D 4C7RA 2RMZA 3CCSP 1L4AC 4NPEA 4B86A 2WSCH 4IFMA 3MIWA 1NTKJ 2R3SA 2BMOA 1NYKA 3SFEC 1NAYA 5C39A 1G1IA 3R2PA 4QMAA 1S5LE 1KTMA 2JO6A 2KIKA 1J1EC 3T97A 3MP7B 3E1RA 4WY4C 4ASWA 5AVQB 2YXRB 2JKVA 5APWA 1N7SA 3I55P 2QM7A 3CWBJ 3H1IE 1ZOYC 4IOIH 2C0XA 1VL2A 2WSFJ 2P2UA 1ZP0C 4N78D 1GL2C 4WB4A 3U59A 5DJTB 3Q5PA 3A3YB 5AVYB 5KAIE 1SQQD 3N4XA 2E43A 1IFJA 1NTMJ 3RK2B 4U3FJ 1YYCA 1VCKA 3H1JJ 1EXIA 1SQXJ 2D2CB 3KYQA 4MN4C 4GOEA 1LP1A 1YQ4C 3TGUG 2FYUD 1Q86Q 1YI2P 5L8RJ 2Q7CA 1HTLC 2QJKC 3H1KD 3TDKA 3Q1MA 3H1JD 3VOPA 1FZCB 1NU1E 3H25A 2OYHA 2I7FA 1AFOA 2AEMA 1KC8Q 2VRSA 3L73E 3HD7D 2XU6A 4ASVA 2YFIA 1NOHA 3RK3B 1VF5D 3L75E 1OZHA 1S72P 3L73D 1M8OB 4HYTB 3GF7A 2B1XA 3H32B 2QEXP 3Q5SA 1AJYA 1LWUB 1ZLLA 2KLVA 3HUSB 1RY3A 3AEEC 1O7WA 4HM3A 3H1JE 4ZKPA 1Z56A 1N73A 3OJAB 3G6EP 2JDIH 4UB6H 1LT9C 3HUSC 3C1LA 1SP4A 1W2EA 5APVA 1LTAC 4PD4E 4AIVA 4Y99B 4AAYB 1JMBA 1W2BO 1NTZG 3D71A 1JMMA 1SQBD 3V4QA 2W90A 5CCHA 2E42A 1EZVD 3BASA 1NTMG 2KZJA 2YKOA 1A02J 1O7HA 3HD7B 2FYZA 5APYA 3GTEA 1N7SD 4I6MC 1PP9J 4KT0J 3JCUE 1NWQA 2OARA 4L75A 5AVRB 2CPBA 1H89A 1Y9BA 4WWIA 4HM7A 4JF7A 3GTSA 3AEGC 3HRNA 4N78E 4PV1C 2E76C 1ZR2A 2IX7C 2E5YA 1LTBC 2JP3A 3S4RA 2N1TD 3H1IG 4QDDA 2YKQA 1PGPA 2R3CA 5CCHC 2XNDH 1PP9D 2NVFA 3H1ID 1WT6A 1GL2A 2XDJA 3HE4A 4CPGA 3U1AA 2AEJA 3D6YA 3CCLP 1KQGB 4H0LD 5K5GB 1FJPA 3F89A 3M9QA 1SQQK 1Q2NA 1N7SB 2HLOA 2LXBA 2LXCB 2DE6D 2WITA 2QRXA 4OWFA 1T3UA 3JSVC 3DQYA 1UIXA 2WSEH 1NKNA 1VQ8P 1FDIA 3JC22 1LTJC 2IYOA 2OYIB 2IBZE 3CD6P 4XA4A 1S1CX 2R5DA 5AVXB 3WU2E 1PGQA 3V2QA 2OGUA 2O01J 2PP6A 3TYYA 2YVJB 2PFXA 4PD4I 1KILC 4QDFB 2NZ2A 1DD3A 2WPQA 3CCQP 2QG4A 4XFJA 2WT7A 4P1CH 3SWFA 3VMGD 3WUVA 3G3ZA 5AVTB 1GTWA 2BASA 3CXHE 3IAOA 1L0ND 1T2KC 2E4QA 1J2JB 2M8RA 2XNXA 3PRJA 3GB4A 3M0DC 1SQPG 1RIEA 1M1JC 1KORA 3BCCD 1GW3A 1YIJP 2WVRA 3AE2C 2NPSD 1QGKB 3CL3D 2WSCJ 1HVVA 1OVUA 1OVRA 3L72D 3VMZA 3OA7A 5AW9B 1SS1A 2D2CD 2BCCG 1RE3A 1SQXG 3P8CD 3P7KA 4N6JA 1KZUB 3T97B 2POHA 1RF0C 3C8VA 2ZYDA 3GMAA 3TF5A 1ZRTE 2HG5D 1BGYG 1SQBE 2NPSB 4UB8E 4L73A 3FWNA 3CLQA 1JCCA 4DCKA 2RN0A 3H1LJ 4HM6A 4I7ZB 2ZFCA 1KV4A 2FYNC 3S9OA 4TT3H 2DW3A 4W7ZA 3IFMA 4A7PA 1NU1J 2P58A 4QCKA 1NTZD 2Q9IA 1DH3A 1MZ9A 1HBWA 4GDOA 3G9RA 2W83C 2P1JA 1IZNB 3P8MC 4Z1MH 2B24A 5APQA 1LTIC 3NXSA 2R32A 3CC4P 1GDTA 1MFTA 1GMJA 1NTKE 1NU1D 2Y0EA 2MKVA 1VQOP 4RKUJ 3KZIE 3KDPB 5CCGA 3P32A 1AA0A 1G8JB 2XZRA 4PJ0E 2B87B 1ZV8A 2FYUE 1FQTA 1QL1A 5KLVJ 3O6QB 3L70D 1GU4A 1LGHB 2ZYLA 3M06A 4LC1A 3AEDC 4P1BH 4QURA 3M91A 1WMKA 2N9YB 3V4WA 4H13C 1HJ0A 3CC7P 3AE5C 2YXQB 2KLUA 2PAJA 3L71G 1XTCC 1NYHA 1X22A 1ZN5A 1IO4A 3VN0A 4C7NA 3VMAA 1AQTA 2FYUG 1NTZK 2LR2A 2QE7H 2W6JH 1EZVI 5AVUB 3CCJP 3I5CA 4H0LB 1YTZT 3GLMA 2IBZG 3AECC 1KD1Q 1LTTC 1N7LA 1WQLA 3EFFK 3RK2D 5M1BA 3RL0g 4NBBD 1JY2N 3CXHH 2OYHC 1NAFA 2I1KA 1LTJB 4I7ZC 1VQ5P 1PPJG 1LWUC 1FZCC 4IFDK 1PPJD 4OGQC 1NTKD 2NUMA 1SQQJ 1BCCJ 3B5NC 3L36A 4EYYQ 3A2AA 5BU8B 2Q3EA 3PJSK 1NJIQ 3GZYA 1SFCC 3L4FA 1T2KD 3CC2P 2M3BA 2FXMA 2KNCB 1EDJA 1GL2B 1JO5A 1Q7YQ 4WBAA 2KP8A 3Q3DA 2IBZI 2QSIA 3A5TA 1W5CE 1N73B 2CPSA 3S1KA 2LKMA 2CKFA 4R4LA 3VCAA 2OYIC 3CI9A 3CWBD 5DJUB 1M7LA 1ZRTD 1KQSO 2WPSA 1KMIZ 5B5EE 1CW5A 2ZJSE 3VP8A 2XV5A 2KSJA 1NTME 3GL0A 1JOCA 2QM8A 1O7PA 2IYPA 1RFSA 2J58A 1IK7A 3EQQA 1K04A 5TISH 3BVHA 2OYHB 2WMMA 1T8ZA 3NTNA 2HODB 1CSBA 1VQMP 5H2FE 2E75B 1GL2D 1GW4A 4U3FD 4NBDD 1EXJA 2BCCE 2XKMA 3I56P 1KB9H 3L74E 3GHGA 3N7NA 4GIFA 3W67A 2WQYC 1KFMA 1L0LK 3JCUH 1BE3G 2KNCA 4D6TJ 1YBKA 2K1AA 3PLNA 1LWUA 3EFGA 2G3AA 1FC2C 3OW2O 1FZAA 3H1KJ 1LT1A 1TU3F 3WUTA 1O7MA 3CCRP 5GTIH 1YQ3C 4NB9D 1NU1G 3IN6A 3MD0A 4D6TD 1N73C 1SQVK 2IBZD 5BVZA 4HM0A 2L5GB 2WSFH 3A0BE 2Z5HA 3USSA 2E74D 1SQVE 1M90Q 2Y9YA 4NPDA 1HH0A 1VF5C 4HKZH 4OVNF 1JNMA 3A0HH 3IR9A 4OGQB 1CI6B 1NTKG 3WU2H 2Z5IA 4BWNA 1SQBJ 2KOGA 1FOSE 3M9HA 1Q90D 1N2DC 2K3RA 2K9JB 1HF9A 3N0QA 1MUUA 4NPFX 1P84H 2V7QJ 1S3JA 4HKVA 1RH5B 1L4AD 1MKMA 4JYCA 3SFDC 2SPZA 2WPRA 2FYUK 1KYOD 1FZGA 1P84D 4JBZA 3KPEA 5AVVB 1KB9E 1VQLP 1S9KD 3LW5H 2NWFA 3SWYA 1URQC 1SQPK 4PJ0H 2N1TC 1EZVE 1QEXA 1H0TA 2NVGA 3RL0C 3M0AA 3A0BH 2NRGA 2QVAA 2J59M 4AYCA 1DD4A 3FOUA 1L0NK 4H0LC 2A06D 2C0WA 2N1TA 1LT9B 3D89A 2YNYA 5AW4B 4Y28J 1UIIA 2HPCA 1GU5A 1JUNA 3V2NA 4HJLA 2I8DA 3GCEA 3CX5I 1J1DB 2KB7P 3B8EB 3HTKB 4NBGD 3L75D 1HJBA 3H6PA 4UB6E 4H13B 1KQLA 3H1KE 4JYBA 1FZEA 3TK1A 4D6TG 4RESB 1M1JB 4YXWH 3V2PA 2OYIA 1A02F 5APUA 2FBWC 4HM2A 2NUKA 1S9KE 2M5AB 2K88A 3GZXA 3L75J 2QA4P 1ZXGA 2Q5UA 2W27A 3CX5D 2ZYAA 2NVEA 1KYOE 1JY2O 4N3YB 2XRXA 2C9LY 1NHLA 1PP9G 4YPCA 4ZNCA 1AV1A 4WVZA 4WY4B 3GF3A 2FFDB 2DE5D 1L0LD 1RQVA 1WRGA 1VQNP 2HR3A 2KSEA 1X9VA 3TNUA 1SQQE 2WSSH 3RGUA 2A45G 3PHLA 2H88C 1FDOA 4H44C 1GK4A 2B89A 1E5WA 1L4AA 3H1HJ 3O8ZA 1UUVA 4IFFA 2YMYA 2NPSA 2E75D 4NBCD 1SQVD 2AXCA 1JTHA 2WT7B 3CXHI 2YO3A 3HD7A 2GBXA 1ULJA 3TSIA 2CK3H 2C9NY 2GA1A 1MFZA 3A0HE 3VMXA 3EN1A 4KJMA 5CXMA 3GKEA 1BGYJ 5AW1B 2FKWB 1HWTC 3MTUE 1SFCA 1NTZE 1SQVJ 1PFIA 1X8YA 4NBHD 3KHUA 2E76D 4DZOA 1BDCA 5CBNA 2BCCJ 1IC2A 4D6TE 2HMOA 5B66E 2QIWA 2O01N 4HJGH 1BSHA 2JZAA 3D6ZA 2E75C 4EOTA 3H1JG 1RHZB 2KYVA 1VPCA 2HMMA 1VQPP 3HE4B 2IZ0A 1GZLA 1EDIA 5APSA 1QX8A 5AVSB 3L75G 1JTHB 3H1HG 5AEUA 1G8KB 2BCCD 3CX5H 2HFED 2QJYC 1J1DC 4KHXA 2QJKB 1IFPA 1LTJA 3FGAD 1PIXA 1R5SA 1IFMA 1BDDA 2DE7D 2O1KA 1OMIA 1Y47A 2UWJE 2E76B 4U3FE 2XR8A 1OIPA 1BE3J 4YTPC 1SQPD 3GW6A 1YJNP 4W7YA 2Q3IA 5B66H 1SFCD 5HL4A 1LTSC 3L72G 1RQUA 1ZR4A 3VP9A 1NTMD 4LGDE 2O3JA 1G1JA 2OYOA 3KQGA 1SQXD 2OTJP 4TLFA 2WTYA 1SQPJ 3BRVB 2O01H 3RK3D 1ZW0A 1OFCX 2BEQD 1VQ6P 5APXA 1H88A 3MGNA 2WPVB 4L74A 2YIUC 2Y9ZA 4HB1A 3RBZA 3O6QA 2OQQA 2M3EA 1NU1K 1JY3P 1Q81Q 2IPPA 1RE4A 1JY3N 4DT0A 1P84I 2D2CC 1FOSF 3B4SA 3QH9A 3CCVP 1EDKA 3L70G 3HE5B 2E5TA 2E74B 1XTGB 2K9YA 3BCCJ 2KUBA 1L0LG 4UB8H 1SQQG 1URQD 2HPCB 2B88A 2IFMA 3AZCA 1OW8A 2ZT9D 3L71D 2ZXXA 3AEFC 1T3JA 5CHXA 3LIEA 3L74J 1PP9E 1QVGO 2JO1A 5KJ7D 1R8EA 5KTBA 1KN7A 1U7JA 1RE4C 4HM8A 2KS1A 2QJPB 3KXDA 4XE5B 1VQKP 2KI7B 4YXDC 1RF1B 2AXTH 1U7MA 3L71E 4QUQA 5AVWB 3FX0A 1FZCA 1CZQA 1OW6A 1IK9A 4BXLA 5KAFH 1NTKK 2KXPB 3L74G 3PH0A 4I1LA 3CMEP 2A06G 4PD4D 1JY3O 2HMNA 1DEBA 2OTLP 3V6IA 5KLVG 1YHQP 1G2CA 2YMKA 5AW5B 2QJPC 3G4SP 2M0BA 3MUDA 3V2RA 1DIPA 5CJ4A 1JY2P 1BE3E 1EQ7A 1KB9I 3BCCG 2FFDC 4PD4H 1Q90C 1J1EB 3BRTB 5TJHA 4QUPA 5GTHE 1CI6A 1U57A 3AE6C 2P10A 1NH4A 3L70J 1RF0A 1RF1C 4HM4A 2P7JA 3R4YA 1EZVG 1YJWP 4JPZB 3ABVC 2AEFA 4PV1B 3II6A 4DOJA 1PL5A 2HMJA 2FFDA 2W6AA 4QDCA 3MHVA 2N9BA 1YITP 2GM4A 5CJ0A 3ZDMA 1OVVA 1SVFA 3EWKA 1HGZA 1Q82Q 3HE5A 5AW2B 4EDFA 3P8CE 1URQA 5CCGC 5KKZB 1NTMK 2ZXEB 1RF1A 3L37A 1PV3A 4Y99C 1UUWA 2M5AA 1KB9D 2E4PA 1IJDB 3B5ND 1GD2E 2R44A 1SQBG 4EIJA 3CWBG 2WWWA 3AE1C 3NFQA 1M1JA 5E79H 4OH8B 5KLIC 2H7HA 4JQ0D 2HMKA 2GUVA 1EC5A 4GOFA 3GHGB 2Q6QA 5AEWA 3BCCE 4EI2A 3Q5RA 1YTZI 1PZQA 2V4HA 2FYUJ 1BSNA 1BCCD 2ZAEB 4GKGA 1SQVG 2KS1B 1E79H 1KYOI 1BCCG 1PGJA 2N1TB 5CCGD 2W8ZA 3GL2A 2XSOA 1FJKA 1AVOA 1VM9A 1L0NE 4K35A 3CXHD 1KILA 1DX7A 3LW5J 4W80A 4QDFA 4R4MA 3MUDC 4HM1A 2K37A 2YKPA 3VMHD 3ITKA 1K9MQ 4GODA 5AW7B 3AEBC 3H1LE 5GTHH 4IL6H 1VQ7P 1S4XA 1L0NG 3H1LD 3IF4A 3RL0B 2IDBA 1FS0E 2HYNA 4H44D 3RK2C 3LIDA 1FZFA 2V7QH 2Q3WA 3FXDA 5KJ7C 3MZWB 1NO4A 1HUCA 1IFIA 1K73Q 2PRRA 2JEEA 2H89C 2B9BA 4NBFD 3H32A 4IL6E 1LTGC 1JB0J 1FU1A 5AVZB 1H8AA 3H1HD 5GTIE 2YFLA 1NVOA 3RL0D 1JM1A 2W6BA 3M9BA 4AQRD 3AE9C 1O7NA 2BMQA 3AE7C 2K9JA 2G8YA 1PGOA 1BCCE 4M3LA 1VF5B 4RJTA 3OAKA 1M57D 2RH0A 1M1KQ 5TISE 1L0LE 2A45H 3CMAP 2FY8A 2RKLA 3L73J 1L0LJ 3RK3C 5KLVD 3UIAA 3VTPC 1KQFB 1AQ5A 1LP1B 3CX5E 4BRYB 3CWBE 3H1IJ 3D70A 5AW8B 3GHGC 2KK7A 5E79E 4GT1A 1T6AA 4K3AA 5B5EH 3E1IA 1O7GA 3GG2A 2KZIA 5KLIB 2ZT9C 4EMJB 1USEA 3C9IA 1VDFA 3VYIA 4RO0A 5AW0B 2Y0CA 3PP5A 1HGVA 1SLQA 3BATA 4H44B 4WY4D 2JJLA 1M56D 2QPZA 1KILD 2O1JA 5KAFE 3CCMP 3A7OA 1VQ4P 1PPJE 3EQ2A 5KJ7A 4DJGA 1QVFO 3AE3C 2A06E 1FBMA 5EFWB 2PGDA 1JEKA 3B71A 5CMZA 1BE3D 2JR8A 1GK6A 2AXTE 2OTKE 2YFJA 3AE4C 5KLVK 1RE3C 1L4AB 5AW3B 1SFCB 1Y8AA 2HODA 3L35A 2I1JA 2ZVNB 5CCHD 2J5UA 3F5HA 2H43A 1ZMEC 1ULIA 4HM5A 4NBAD 1QL2A 3H1LG 2IZ1A 3CPWO 2QJYB 2HMLA 3AEAC 2ZYGA 1FE6A 1P84E 3HUSA 1KILB 1SQXK 3AE8C 2R5BA 2E74C 1L2PA 1JM0A 3L72J 4U7JA 4NBED 1X79B 2FXPA 5H2FH 1FAVA 3NMDA 1AVYA 1KYOH 2YO2A 3FWLA 2GBWA 3TNUB 4L76A 1S5LX 3G71P 3KZIH 2YIUB 1N7SC 1DEEG 1S2EA 3L70E 2BMRA 2P67A 1OXZA 2XSHA 4WY4A 4ZKUA 1K8AQ 1L0NJ 3L71J 1JCDA 5BU5A 5KKZC 1S5LH 4BRYA 1R5LA 1K05A 3HTKA 3VMYA 2MJZA 1MV8A 4H13D 1QLED 3E7KA 4LLHA 4O9BA 2WSEJ 1IFNA 1LT9A 3RK3E 1N86A 1KILE 3C0DA 3CCEP 1D7MA 5AW6B 4C7NB 1H0TB 1BGYE
chains in the Genus database with same CATH topology
2NWFA 2QJPC 3GOBA 1DIPA 1KORA 3AE2C 1BE3E 2WSCJ 1Q90C 1EZVE 1SQXE 4QUPA 1U57A 3AE6C 2P10A 4PV1D 2D2CD 4HM4A 2NVGA 3R4YA 3VCPA 3ABVC 4PV1B 3T97B 3C8VA 3L72E 1DD4A 3FOUA 3GMAA 1PL5A 4H0LC 3Q2YA 1ZRTE 2HMJA 3VMID 1SQBE 4OGQD 1SQPE 2BEZF 3D89A 1NDOA 5KLVE 1EG9A 4QDCA 1SJGA 4Y28J 4HJLA 3GCEA 3EWKA 4HM6A 4I7ZB 4NBGD 2FYNC 3S9OA 4IL6X 4TT3H 4H13B 3H1KE 1NGMB 1PV3A 1UUWA 2E4PA 4QCKA 3TGUE 5BOKA 3AE1C 4GDOA 1OW7A 3H1HE 3G9RA 2FBWC 5KLIC 4Z1MH 4HM2A 2NUKA 2B24A 2ZT9B 2HMKA 3GZXA 4NB8D 2NVEA 1GMJA 1KYOE 1NTKE 5AEWA 2MKVA 3BCCE 4RKUJ 3Q5RA 2XRXA 1G8JB 3GF3A 2BMOA 1NYKA 3SFEC 2DE5D 2FYUE 3GL2A 1FQTA 2XSOA 1VM9A 1RQVA 1L0NE 2ZYLA 1KTMA 2JO6A 3LW5J 4QDFA 3AEDC 4P1BH 4R4MA 4QURA 4HM1A 1WMKA 1SQQE 4H13C 1HJ0A 3VMHD 2H88C 3AE5C 1FDOA 4H44C 3AEBC 3H1IE 1NYHA 3H1LE 1ZOYC 1UUVA 1VL2A 2WSFJ 2IDBA 2E75D 4H44D 4NBCD 1ZP0C 2GBXA 3Q5PA 2Q3WA 4H0LB 1ULJA 3GLMA 3AECC 2H89C 1WQLA 4NBFD 5M1BA 3RL0g 4NBBD 3EN1A 5CXMA 1JB0J 3GKEA 2YFLA 1JM1A 1VCKA 3AE9C 1EXIA 1O7NA 2BMQA 3AE7C 4I7ZC 1NTZE 2G8YA 2D2CB 4NBHD 1BCCE 2E76D 1VF5B 4OGQC 1YQ4C 2NUMA 2HMOA 1L0LE 2QIWA 5L8RJ 2JZAA 3D6ZA 2E75C 3GZYA 2QJKC 3Q1MA 2HMMA 1NU1E 3H25A 2I7FA 1KQFB 3Q3DA 3CX5E 5AEUA 3L73E 2QSIA 1G8KB 3CWBE 2QJYC 2YFIA 3D70A 2CKFA 4R4LA 1VF5D 3VCAA 3FGAD 3L75E 1PIXA 2DE7D 3GF7A 2B1XA 1OMIA 1O7GA 1KMIZ 3Q5SA 1AJYA 2E76B 4U3FE 2ZT9C 2XR8A 3AEEC 1O7WA 4HM3A 1NTME 3H1JE 4EMJB 3GL0A 4YTPC 1O7PA 1RFSA 1IK7A 3EQQA 1K04A 4H44B 4PD4E 5HL4A 4AIVA 2QPZA 4AAYB 1RQUA 1PPJE 3D71A 2E75B 4NBDD 1EXJA 3AE3C 2BCCE 2A06E 1O7HA 3L74E 3B71A 3GTEA 2WQYC 2YFJA 2BEQD 4KT0J 3AE4C 2WPVB 2YIUC 3O6QA 2OQQA 2G3AA 1Y9BA 4HM7A 3GTSA 3AEGC 2J5UA 4PV1C 1TU3F 2E76C 1O7MA 1ZMEC 4HM5A 2D2CC 1ULIA 4NBAD 1YQ3C 4NB9D 2JP3A 4QDDA 3IN6A 2HMLA 3AEAC 2NVFA 1P84E 2E74B 2K9YA 3AE8C 3D6YA 1KQGB 4H0LD 2E74C 4HM0A 3AZCA 1OW8A 4U7JA 2ZT9D 4NBED 2FXPA 2DE6D 3AEFC 2E74D 1SQVE 1VF5C 2GBWA 1PP9E 3DQYA 2JO1A 4OGQB 1S5LX 1UIXA 1FDIA 1R8EA 2IBZE 3L70E 2BMRA 1S1CX 4HM8A 2XSHA 2O01J 2YVJB 4YXDC 5KKZC 1Q90D 4QDFB 1HF9A 1K05A 3N0QA 2NZ2A 1DD3A 4XFJA 2V7QJ 4QUQA 3L71E 4P1CH 4H13D 4HKVA 3VMGD 1OW6A 1MKMA 2WSEJ 3SFDC 3CXHE 3IAOA 3RK3E 1KILE 2E4QA 3C0DA 2HMNA 3GB4A 1KB9E 2YMKA 1RIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QDD A;  2NWF A;  1G8J B;  2QJP C;  3GOB A;  2HML A;  2NVF A;  2HMM A;  1P84 E;  1NU1 E;  2BMO A;  1NYK A;  2DE5 D;  2FYU E;  2I7F A;  2E74 B;  3GL2 A;  1BE3 E;  1FQT A;  2XSO A;  1VM9 A;  2WSC J;  1L0N E;  3CX5 E;  2ZYL A;  5AEU A;  2K9Y A;  1Q90 C;  2QSI A;  1G8K B;  1EZV E;  1SQX E;  2JO6 A;  3L73 E;  4QUP A;  3LW5 J;  3CWB E;  4QDF A;  4P1B H;  2QJY C;  4H0L D;  4PV1 D;  4QUR A;  2YFI A;  4HM1 A;  1SQQ E;  2D2C D;  4HM0 A;  2NVG A;  4HM4 A;  3AZC A;  2CKF A;  3VCP A;  1VF5 D;  2ZT9 D;  3L75 E;  4NBE D;  3VCA A;  4PV1 B;  3C8V A;  3L72 E;  3VMH D;  3FOU A;  2DE7 D;  2DE6 D;  1ZRT E;  2B1X A;  2HMJ A;  2E74 D;  1SQV E;  1O7G A;  3H1I E;  2E76 B;  3VMI D;  1SQB E;  4U3F E;  3H1L E;  2XR8 A;  1O7W A;  1SQP E;  4HM3 A;  1NTM E;  1PP9 E;  1UUV A;  2GBW A;  3H1J E;  4OGQ D;  3GL0 A;  3D89 A;  1NDO A;  5KLV E;  1EG9 A;  4QDC A;  1O7P A;  4OGQ B;  1SJG A;  4Y28 J;  3DQY A;  1S5L X;  2WSF J;  1RFS A;  4HJL A;  2E75 D;  3GCE A;  4H44 D;  4NBC D;  3EQQ A;  2IBZ E;  3L70 E;  4H44 B;  2BMR A;  2GBX A;  4PD4 E;  4HM6 A;  4I7Z B;  2Q3W A;  4H0L B;  4HM8 A;  2XSH A;  4AIV A;  2QPZ A;  5HL4 A;  1ULJ A;  4NBG D;  2FYN C;  4AAY B;  4IL6 X;  2O01 J;  4H13 B;  1PPJ E;  2YVJ B;  2E75 B;  3H1K E;  5KKZ C;  1WQL A;  4NBF D;  1Q90 D;  4NBD D;  4NBB D;  3EN1 A;  1UUW A;  2BCC E;  2E4P A;  2A06 E;  4QCK A;  5CXM A;  1JB0 J;  3TGU E;  4QDF B;  1O7H A;  3GKE A;  3N0Q A;  3L74 E;  5BOK A;  2YFL A;  1JM1 A;  3GTE A;  3L71 E;  1VCK A;  4QUQ A;  3H1H E;  4P1C H;  4H13 D;  1O7N A;  2BMQ A;  1NTZ E;  5KLI C;  2YFJ A;  4HKV A;  4KT0 J;  4HM2 A;  3VMG D;  4EMJ B;  2NUK A;  2D2C B;  2B24 A;  4NBH D;  1BCC E;  2WPV B;  2WSE J;  2E76 D;  2YIU C;  1VF5 B;  2ZT9 B;  2HMK A;  3GZX A;  3CXH E;  4NB8 D;  2NUM A;  2NVE A;  2HMO A;  2E4Q A;  1L0L E;  3C0D A;  4HM7 A;  1KYO E;  1NTK E;  2HMN A;  3GTS A;  2QIW A;  5AEW A;  3BCC E;  1O7M A;  4RKU J;  1ULI A;  5L8R J;  4HM5 A;  2JZA A;  3GB4 A;  4NBA D;  2XRX A;  1KB9 E;  4NB9 D;  3GZY A;  2QJK C;  1RIE A; 
#chains in the Genus database with same CATH topology
 3TGU J;  1USD A;  3QWO C;  4I2L C;  3HD7 C;  3SSU A;  3GOB A;  3FXE A;  1EDL A;  2ITA A;  2Z4E A;  5CBO A;  1VQ9 P;  1SQX E;  1N8R Q;  4PV1 D;  5APT A;  4AUW A;  1OX3 A;  4U3F G;  2H8P D;  3M0D A;  3VCP A;  1G2C B;  4ZMD A;  3L72 E;  2FYN B;  1KFN A;  1SQB K;  1OWA A;  2JWD A;  3L74 D;  3B5N B;  3U1C A;  3Q2Y A;  3TGU D;  2GUS A;  3V5B A;  1NKZ B;  3WMM 0;  3VMI D;  1NTZ J;  2B87 A;  1SQP E;  4OGQ D;  2BEZ F;  2Y0D A;  1NDO A;  5KLV E;  1EG9 A;  1SJG A;  3H1K G;  3W68 A;  2A45 I;  3K5B A;  3B5N A;  1FDM A;  2JWA A;  1IFD A;  4IL6 X;  3PTZ A;  2L91 A;  1YJ9 P;  4HH2 A;  1NGM B;  1URQ B;  1LJ2 A;  2Q1K A;  2IFN A;  3TGU E;  3SWK A;  4C46 A;  1X0T A;  3CCU P;  5KAI H;  5BOK A;  1LNQ A;  1OW7 A;  3L73 G;  3H1H E;  3RBX A;  3WUU A;  2WZ7 A;  1BGY D;  2FXO A;  2ZVO B;  2ZT9 B;  2NPS C;  1FZB A;  4NB8 D;  4C7R A;  2RMZ A;  3CCS P;  1L4A C;  4NPE A;  4B86 A;  2WSC H;  4IFM A;  3MIW A;  1NTK J;  2R3S A;  2BMO A;  1NYK A;  3SFE C;  1NAY A;  5C39 A;  1G1I A;  3R2P A;  4QMA A;  1S5L E;  1KTM A;  2JO6 A;  2KIK A;  1J1E C;  3T97 A;  3MP7 B;  3E1R A;  4WY4 C;  4ASW A;  5AVQ B;  2YXR B;  2JKV A;  5APW A;  1N7S A;  3I55 P;  2QM7 A;  3CWB J;  3H1I E;  1ZOY C;  4IOI H;  2C0X A;  1VL2 A;  2WSF J;  2P2U A;  1ZP0 C;  4N78 D;  1GL2 C;  4WB4 A;  3U59 A;  5DJT B;  3Q5P A;  3A3Y B;  5AVY B;  5KAI E;  1SQQ D;  3N4X A;  2E43 A;  1IFJ A;  1NTM J;  3RK2 B;  4U3F J;  1YYC A;  1VCK A;  3H1J J;  1EXI A;  1SQX J;  2D2C B;  3KYQ A;  4MN4 C;  4GOE A;  1LP1 A;  1YQ4 C;  3TGU G;  2FYU D;  1Q86 Q;  1YI2 P;  5L8R J;  2Q7C A;  1HTL C;  2QJK C;  3H1K D;  3TDK A;  3Q1M A;  3H1J D;  3VOP A;  1FZC B;  1NU1 E;  3H25 A;  2OYH A;  2I7F A;  1AFO A;  2AEM A;  1KC8 Q;  2VRS A;  3L73 E;  3HD7 D;  2XU6 A;  4ASV A;  2YFI A;  1NOH A;  3RK3 B;  1VF5 D;  3L75 E;  1OZH A;  1S72 P;  3L73 D;  1M8O B;  4HYT B;  3GF7 A;  2B1X A;  3H32 B;  2QEX P;  3Q5S A;  1AJY A;  1LWU B;  1ZLL A;  2KLV A;  3HUS B;  1RY3 A;  3AEE C;  1O7W A;  4HM3 A;  3H1J E;  4ZKP A;  1Z56 A;  1N73 A;  3OJA B;  3G6E P;  2JDI H;  4UB6 H;  1LT9 C;  3HUS C;  3C1L A;  1SP4 A;  1W2E A;  5APV A;  1LTA C;  4PD4 E;  4AIV A;  4Y99 B;  4AAY B;  1JMB A;  1W2B O;  1NTZ G;  3D71 A;  1JMM A;  1SQB D;  3V4Q A;  2W90 A;  5CCH A;  2E42 A;  1EZV D;  3BAS A;  1NTM G;  2KZJ A;  2YKO A;  1A02 J;  1O7H A;  3HD7 B;  2FYZ A;  5APY A;  3GTE A;  1N7S D;  4I6M C;  1PP9 J;  4KT0 J;  3JCU E;  1NWQ A;  2OAR A;  4L75 A;  5AVR B;  2CPB A;  1H89 A;  1Y9B A;  4WWI A;  4HM7 A;  4JF7 A;  3GTS A;  3AEG C;  3HRN A;  4N78 E;  4PV1 C;  2E76 C;  1ZR2 A;  2IX7 C;  2E5Y A;  1LTB C;  2JP3 A;  3S4R A;  2N1T D;  3H1I G;  4QDD A;  2YKQ A;  1PGP A;  2R3C A;  5CCH C;  2XND H;  1PP9 D;  2NVF A;  3H1I D;  1WT6 A;  1GL2 A;  2XDJ A;  3HE4 A;  4CPG A;  3U1A A;  2AEJ A;  3D6Y A;  3CCL P;  1KQG B;  4H0L D;  5K5G B;  1FJP A;  3F89 A;  3M9Q A;  1SQQ K;  1Q2N A;  1N7S B;  2HLO A;  2LXB A;  2LXC B;  2DE6 D;  2WIT A;  2QRX A;  4OWF A;  1T3U A;  3JSV C;  3DQY A;  1UIX A;  2WSE H;  1NKN A;  1VQ8 P;  1FDI A;  3JC2 2;  1LTJ C;  2IYO A;  2OYI B;  2IBZ E;  3CD6 P;  4XA4 A;  1S1C X;  2R5D A;  5AVX B;  3WU2 E;  1PGQ A;  3V2Q A;  2OGU A;  2O01 J;  2PP6 A;  3TYY A;  2YVJ B;  2PFX A;  4PD4 I;  1KIL C;  4QDF B;  2NZ2 A;  1DD3 A;  2WPQ A;  3CCQ P;  2QG4 A;  4XFJ A;  2WT7 A;  4P1C H;  3SWF A;  3VMG D;  3WUV A;  3G3Z A;  5AVT B;  1GTW A;  2BAS A;  3CXH E;  3IAO A;  1L0N D;  1T2K C;  2E4Q A;  1J2J B;  2M8R A;  2XNX A;  3PRJ A;  3GB4 A;  3M0D C;  1SQP G;  1RIE A;  1M1J C;  1KOR A;  3BCC D;  1GW3 A;  1YIJ P;  2WVR A;  3AE2 C;  2NPS D;  1QGK B;  3CL3 D;  2WSC J;  1HVV A;  1OVU A;  1OVR A;  3L72 D;  3VMZ A;  3OA7 A;  5AW9 B;  1SS1 A;  2D2C D;  2BCC G;  1RE3 A;  1SQX G;  3P8C D;  3P7K A;  4N6J A;  1KZU B;  3T97 B;  2POH A;  1RF0 C;  3C8V A;  2ZYD A;  3GMA A;  3TF5 A;  1ZRT E;  2HG5 D;  1BGY G;  1SQB E;  2NPS B;  4UB8 E;  4L73 A;  3FWN A;  3CLQ A;  1JCC A;  4DCK A;  2RN0 A;  3H1L J;  4HM6 A;  4I7Z B;  2ZFC A;  1KV4 A;  2FYN C;  3S9O A;  4TT3 H;  2DW3 A;  4W7Z A;  3IFM A;  4A7P A;  1NU1 J;  2P58 A;  4QCK A;  1NTZ D;  2Q9I A;  1DH3 A;  1MZ9 A;  1HBW A;  4GDO A;  3G9R A;  2W83 C;  2P1J A;  1IZN B;  3P8M C;  4Z1M H;  2B24 A;  5APQ A;  1LTI C;  3NXS A;  2R32 A;  3CC4 P;  1GDT A;  1MFT A;  1GMJ A;  1NTK E;  1NU1 D;  2Y0E A;  2MKV A;  1VQO P;  4RKU J;  3KZI E;  3KDP B;  5CCG A;  3P32 A;  1AA0 A;  1G8J B;  2XZR A;  4PJ0 E;  2B87 B;  1ZV8 A;  2FYU E;  1FQT A;  1QL1 A;  5KLV J;  3O6Q B;  3L70 D;  1GU4 A;  1LGH B;  2ZYL A;  3M06 A;  4LC1 A;  3AED C;  4P1B H;  4QUR A;  3M91 A;  1WMK A;  2N9Y B;  3V4W A;  4H13 C;  1HJ0 A;  3CC7 P;  3AE5 C;  2YXQ B;  2KLU A;  2PAJ A;  3L71 G;  1XTC C;  1NYH A;  1X22 A;  1ZN5 A;  1IO4 A;  3VN0 A;  4C7N A;  3VMA A;  1AQT A;  2FYU G;  1NTZ K;  2LR2 A;  2QE7 H;  2W6J H;  1EZV I;  5AVU B;  3CCJ P;  3I5C A;  4H0L B;  1YTZ T;  3GLM A;  2IBZ G;  3AEC C;  1KD1 Q;  1LTT C;  1N7L A;  1WQL A;  3EFF K;  3RK2 D;  5M1B A;  3RL0 g;  4NBB D;  1JY2 N;  3CXH H;  2OYH C;  1NAF A;  2I1K A;  1LTJ B;  4I7Z C;  1VQ5 P;  1PPJ G;  1LWU C;  1FZC C;  4IFD K;  1PPJ D;  4OGQ C;  1NTK D;  2NUM A;  1SQQ J;  1BCC J;  3B5N C;  3L36 A;  4EYY Q;  3A2A A;  5BU8 B;  2Q3E A;  3PJS K;  1NJI Q;  3GZY A;  1SFC C;  3L4F A;  1T2K D;  3CC2 P;  2M3B A;  2FXM A;  2KNC B;  1EDJ A;  1GL2 B;  1JO5 A;  1Q7Y Q;  4WBA A;  2KP8 A;  3Q3D A;  2IBZ I;  2QSI A;  3A5T A;  1W5C E;  1N73 B;  2CPS A;  3S1K A;  2LKM A;  2CKF A;  4R4L A;  3VCA A;  2OYI C;  3CI9 A;  3CWB D;  5DJU B;  1M7L A;  1ZRT D;  1KQS O;  2WPS A;  1KMI Z;  5B5E E;  1CW5 A;  2ZJS E;  3VP8 A;  2XV5 A;  2KSJ A;  1NTM E;  3GL0 A;  1JOC A;  2QM8 A;  1O7P A;  2IYP A;  1RFS A;  2J58 A;  1IK7 A;  3EQQ A;  1K04 A;  5TIS H;  3BVH A;  2OYH B;  2WMM A;  1T8Z A;  3NTN A;  2HOD B;  1CSB A;  1VQM P;  5H2F E;  2E75 B;  1GL2 D;  1GW4 A;  4U3F D;  4NBD D;  1EXJ A;  2BCC E;  2XKM A;  3I56 P;  1KB9 H;  3L74 E;  3GHG A;  3N7N A;  4GIF A;  3W67 A;  2WQY C;  1KFM A;  1L0L K;  3JCU H;  1BE3 G;  2KNC A;  4D6T J;  1YBK A;  2K1A A;  3PLN A;  1LWU A;  3EFG A;  2G3A A;  1FC2 C;  3OW2 O;  1FZA A;  3H1K J;  1LT1 A;  1TU3 F;  3WUT A;  1O7M A;  3CCR P;  5GTI H;  1YQ3 C;  4NB9 D;  1NU1 G;  3IN6 A;  3MD0 A;  4D6T D;  1N73 C;  1SQV K;  2IBZ D;  5BVZ A;  4HM0 A;  2L5G B;  2WSF H;  3A0B E;  2Z5H A;  3USS A;  2E74 D;  1SQV E;  1M90 Q;  2Y9Y A;  4NPD A;  1HH0 A;  1VF5 C;  4HKZ H;  4OVN F;  1JNM A;  3A0H H;  3IR9 A;  4OGQ B;  1CI6 B;  1NTK G;  3WU2 H;  2Z5I A;  4BWN A;  1SQB J;  2KOG A;  1FOS E;  3M9H A;  1Q90 D;  1N2D C;  2K3R A;  2K9J B;  1HF9 A;  3N0Q A;  1MUU A;  4NPF X;  1P84 H;  2V7Q J;  1S3J A;  4HKV A;  1RH5 B;  1L4A D;  1MKM A;  4JYC A;  3SFD C;  2SPZ A;  2WPR A;  2FYU K;  1KYO D;  1FZG A;  1P84 D;  4JBZ A;  3KPE A;  5AVV B;  1KB9 E;  1VQL P;  1S9K D;  3LW5 H;  2NWF A;  3SWY A;  1URQ C;  1SQP K;  4PJ0 H;  2N1T C;  1EZV E;  1QEX A;  1H0T A;  2NVG A;  3RL0 C;  3M0A A;  3A0B H;  2NRG A;  2QVA A;  2J59 M;  4AYC A;  1DD4 A;  3FOU A;  1L0N K;  4H0L C;  2A06 D;  2C0W A;  2N1T A;  1LT9 B;  3D89 A;  2YNY A;  5AW4 B;  4Y28 J;  1UII A;  2HPC A;  1GU5 A;  1JUN A;  3V2N A;  4HJL A;  2I8D A;  3GCE A;  3CX5 I;  1J1D B;  2KB7 P;  3B8E B;  3HTK B;  4NBG D;  3L75 D;  1HJB A;  3H6P A;  4UB6 E;  4H13 B;  1KQL A;  3H1K E;  4JYB A;  1FZE A;  3TK1 A;  4D6T G;  4RES B;  1M1J B;  4YXW H;  3V2P A;  2OYI A;  1A02 F;  5APU A;  2FBW C;  4HM2 A;  2NUK A;  1S9K E;  2M5A B;  2K88 A;  3GZX A;  3L75 J;  2QA4 P;  1ZXG A;  2Q5U A;  2W27 A;  3CX5 D;  2ZYA A;  2NVE A;  1KYO E;  1JY2 O;  4N3Y B;  2XRX A;  2C9L Y;  1NHL A;  1PP9 G;  4YPC A;  4ZNC A;  1AV1 A;  4WVZ A;  4WY4 B;  3GF3 A;  2FFD B;  2DE5 D;  1L0L D;  1RQV A;  1WRG A;  1VQN P;  2HR3 A;  2KSE A;  1X9V A;  3TNU A;  1SQQ E;  2WSS H;  3RGU A;  2A45 G;  3PHL A;  2H88 C;  1FDO A;  4H44 C;  1GK4 A;  2B89 A;  1E5W A;  1L4A A;  3H1H J;  3O8Z A;  1UUV A;  4IFF A;  2YMY A;  2NPS A;  2E75 D;  4NBC D;  1SQV D;  2AXC A;  1JTH A;  2WT7 B;  3CXH I;  2YO3 A;  3HD7 A;  2GBX A;  1ULJ A;  3TSI A;  2CK3 H;  2C9N Y;  2GA1 A;  1MFZ A;  3A0H E;  3VMX A;  3EN1 A;  4KJM A;  5CXM A;  3GKE A;  1BGY J;  5AW1 B;  2FKW B;  1HWT C;  3MTU E;  1SFC A;  1NTZ E;  1SQV J;  1PFI A;  1X8Y A;  4NBH D;  3KHU A;  2E76 D;  4DZO A;  1BDC A;  5CBN A;  2BCC J;  1IC2 A;  4D6T E;  2HMO A;  5B66 E;  2QIW A;  2O01 N;  4HJG H;  1BSH A;  2JZA A;  3D6Z A;  2E75 C;  4EOT A;  3H1J G;  1RHZ B;  2KYV A;  1VPC A;  2HMM A;  1VQP P;  3HE4 B;  2IZ0 A;  1GZL A;  1EDI A;  5APS A;  1QX8 A;  5AVS B;  3L75 G;  1JTH B;  3H1H G;  5AEU A;  1G8K B;  2BCC D;  3CX5 H;  2HFE D;  2QJY C;  1J1D C;  4KHX A;  2QJK B;  1IFP A;  1LTJ A;  3FGA D;  1PIX A;  1R5S A;  1IFM A;  1BDD A;  2DE7 D;  2O1K A;  1OMI A;  1Y47 A;  2UWJ E;  2E76 B;  4U3F E;  2XR8 A;  1OIP A;  1BE3 J;  4YTP C;  1SQP D;  3GW6 A;  1YJN P;  4W7Y A;  2Q3I A;  5B66 H;  1SFC D;  5HL4 A;  1LTS C;  3L72 G;  1RQU A;  1ZR4 A;  3VP9 A;  1NTM D;  4LGD E;  2O3J A;  1G1J A;  2OYO A;  3KQG A;  1SQX D;  2OTJ P;  4TLF A;  2WTY A;  1SQP J;  3BRV B;  2O01 H;  3RK3 D;  1ZW0 A;  1OFC X;  2BEQ D;  1VQ6 P;  5APX A;  1H88 A;  3MGN A;  2WPV B;  4L74 A;  2YIU C;  2Y9Z A;  4HB1 A;  3RBZ A;  3O6Q A;  2OQQ A;  2M3E A;  1NU1 K;  1JY3 P;  1Q81 Q;  2IPP A;  1RE4 A;  1JY3 N;  4DT0 A;  1P84 I;  2D2C C;  1FOS F;  3B4S A;  3QH9 A;  3CCV P;  1EDK A;  3L70 G;  3HE5 B;  2E5T A;  2E74 B;  1XTG B;  2K9Y A;  3BCC J;  2KUB A;  1L0L G;  4UB8 H;  1SQQ G;  1URQ D;  2HPC B;  2B88 A;  2IFM A;  3AZC A;  1OW8 A;  2ZT9 D;  3L71 D;  2ZXX A;  3AEF C;  1T3J A;  5CHX A;  3LIE A;  3L74 J;  1PP9 E;  1QVG O;  2JO1 A;  5KJ7 D;  1R8E A;  5KTB A;  1KN7 A;  1U7J A;  1RE4 C;  4HM8 A;  2KS1 A;  2QJP B;  3KXD A;  4XE5 B;  1VQK P;  2KI7 B;  4YXD C;  1RF1 B;  2AXT H;  1U7M A;  3L71 E;  4QUQ A;  5AVW B;  3FX0 A;  1FZC A;  1CZQ A;  1OW6 A;  1IK9 A;  4BXL A;  5KAF H;  1NTK K;  2KXP B;  3L74 G;  3PH0 A;  4I1L A;  3CME P;  2A06 G;  4PD4 D;  1JY3 O;  2HMN A;  1DEB A;  2OTL P;  3V6I A;  5KLV G;  1YHQ P;  1G2C A;  2YMK A;  5AW5 B;  2QJP C;  3G4S P;  2M0B A;  3MUD A;  3V2R A;  1DIP A;  5CJ4 A;  1JY2 P;  1BE3 E;  1EQ7 A;  1KB9 I;  3BCC G;  2FFD C;  4PD4 H;  1Q90 C;  1J1E B;  3BRT B;  5TJH A;  4QUP A;  5GTH E;  1CI6 A;  1U57 A;  3AE6 C;  2P10 A;  1NH4 A;  3L70 J;  1RF0 A;  1RF1 C;  4HM4 A;  2P7J A;  3R4Y A;  1EZV G;  1YJW P;  4JPZ B;  3ABV C;  2AEF A;  4PV1 B;  3II6 A;  4DOJ A;  1PL5 A;  2HMJ A;  2FFD A;  2W6A A;  4QDC A;  3MHV A;  2N9B A;  1YIT P;  2GM4 A;  5CJ0 A;  3ZDM A;  1OVV A;  1SVF A;  3EWK A;  1HGZ A;  1Q82 Q;  3HE5 A;  5AW2 B;  4EDF A;  3P8C E;  1URQ A;  5CCG C;  5KKZ B;  1NTM K;  2ZXE B;  1RF1 A;  3L37 A;  1PV3 A;  4Y99 C;  1UUW A;  2M5A A;  1KB9 D;  2E4P A;  1IJD B;  3B5N D;  1GD2 E;  2R44 A;  1SQB G;  4EIJ A;  3CWB G;  2WWW A;  3AE1 C;  3NFQ A;  1M1J A;  5E79 H;  4OH8 B;  5KLI C;  2H7H A;  4JQ0 D;  2HMK A;  2GUV A;  1EC5 A;  4GOF A;  3GHG B;  2Q6Q A;  5AEW A;  3BCC E;  4EI2 A;  3Q5R A;  1YTZ I;  1PZQ A;  2V4H A;  2FYU J;  1BSN A;  1BCC D;  2ZAE B;  4GKG A;  1SQV G;  2KS1 B;  1E79 H;  1KYO I;  1BCC G;  1PGJ A;  2N1T B;  5CCG D;  2W8Z A;  3GL2 A;  2XSO A;  1FJK A;  1AVO A;  1VM9 A;  1L0N E;  4K35 A;  3CXH D;  1KIL A;  1DX7 A;  3LW5 J;  4W80 A;  4QDF A;  4R4M A;  3MUD C;  4HM1 A;  2K37 A;  2YKP A;  3VMH D;  3ITK A;  1K9M Q;  4GOD A;  5AW7 B;  3AEB C;  3H1L E;  5GTH H;  4IL6 H;  1VQ7 P;  1S4X A;  1L0N G;  3H1L D;  3IF4 A;  3RL0 B;  2IDB A;  1FS0 E;  2HYN A;  4H44 D;  3RK2 C;  3LID A;  1FZF A;  2V7Q H;  2Q3W A;  3FXD A;  5KJ7 C;  3MZW B;  1NO4 A;  1HUC A;  1IFI A;  1K73 Q;  2PRR A;  2JEE A;  2H89 C;  2B9B A;  4NBF D;  3H32 A;  4IL6 E;  1LTG C;  1JB0 J;  1FU1 A;  5AVZ B;  1H8A A;  3H1H D;  5GTI E;  2YFL A;  1NVO A;  3RL0 D;  1JM1 A;  2W6B A;  3M9B A;  4AQR D;  3AE9 C;  1O7N A;  2BMQ A;  3AE7 C;  2K9J A;  2G8Y A;  1PGO A;  1BCC E;  4M3L A;  1VF5 B;  4RJT A;  3OAK A;  1M57 D;  2RH0 A;  1M1K Q;  5TIS E;  1L0L E;  2A45 H;  3CMA P;  2FY8 A;  2RKL A;  3L73 J;  1L0L J;  3RK3 C;  5KLV D;  3UIA A;  3VTP C;  1KQF B;  1AQ5 A;  1LP1 B;  3CX5 E;  4BRY B;  3CWB E;  3H1I J;  3D70 A;  5AW8 B;  3GHG C;  2KK7 A;  5E79 E;  4GT1 A;  1T6A A;  4K3A A;  5B5E H;  3E1I A;  1O7G A;  3GG2 A;  2KZI A;  5KLI B;  2ZT9 C;  4EMJ B;  1USE A;  3C9I A;  1VDF A;  3VYI A;  4RO0 A;  5AW0 B;  2Y0C A;  3PP5 A;  1HGV A;  1SLQ A;  3BAT A;  4H44 B;  4WY4 D;  2JJL A;  1M56 D;  2QPZ A;  1KIL D;  2O1J A;  5KAF E;  3CCM P;  3A7O A;  1VQ4 P;  1PPJ E;  3EQ2 A;  5KJ7 A;  4DJG A;  1QVF O;  3AE3 C;  2A06 E;  1FBM A;  5EFW B;  2PGD A;  1JEK A;  3B71 A;  5CMZ A;  1BE3 D;  2JR8 A;  1GK6 A;  2AXT E;  2OTK E;  2YFJ A;  3AE4 C;  5KLV K;  1RE3 C;  1L4A B;  5AW3 B;  1SFC B;  1Y8A A;  2HOD A;  3L35 A;  2I1J A;  2ZVN B;  5CCH D;  2J5U A;  3F5H A;  2H43 A;  1ZME C;  1ULI A;  4HM5 A;  4NBA D;  1QL2 A;  3H1L G;  2IZ1 A;  3CPW O;  2QJY B;  2HML A;  3AEA C;  2ZYG A;  1FE6 A;  1P84 E;  3HUS A;  1KIL B;  1SQX K;  3AE8 C;  2R5B A;  2E74 C;  1L2P A;  1JM0 A;  3L72 J;  4U7J A;  4NBE D;  1X79 B;  2FXP A;  5H2F H;  1FAV A;  3NMD A;  1AVY A;  1KYO H;  2YO2 A;  3FWL A;  2GBW A;  3TNU B;  4L76 A;  1S5L X;  3G71 P;  3KZI H;  2YIU B;  1N7S C;  1DEE G;  1S2E A;  3L70 E;  2BMR A;  2P67 A;  1OXZ A;  2XSH A;  4WY4 A;  4ZKU A;  1K8A Q;  1L0N J;  3L71 J;  1JCD A;  5BU5 A;  5KKZ C;  1S5L H;  4BRY A;  1R5L A;  1K05 A;  3HTK A;  3VMY A;  2MJZ A;  1MV8 A;  4H13 D;  1QLE D;  3E7K A;  4LLH A;  4O9B A;  2WSE J;  1IFN A;  1LT9 A;  3RK3 E;  1N86 A;  1KIL E;  3C0D A;  3CCE P;  1D7M A;  5AW6 B;  4C7N B;  1H0T B;  1BGY E; 
#chains in the Genus database with same CATH homology
 2NWF A;  2QJP C;  3GOB A;  1DIP A;  1KOR A;  3AE2 C;  1BE3 E;  2WSC J;  1Q90 C;  1EZV E;  1SQX E;  4QUP A;  1U57 A;  3AE6 C;  2P10 A;  4PV1 D;  2D2C D;  4HM4 A;  2NVG A;  3R4Y A;  3VCP A;  3ABV C;  4PV1 B;  3T97 B;  3C8V A;  3L72 E;  1DD4 A;  3FOU A;  3GMA A;  1PL5 A;  4H0L C;  3Q2Y A;  1ZRT E;  2HMJ A;  3VMI D;  1SQB E;  4OGQ D;  1SQP E;  2BEZ F;  3D89 A;  1NDO A;  5KLV E;  1EG9 A;  4QDC A;  1SJG A;  4Y28 J;  4HJL A;  3GCE A;  3EWK A;  4HM6 A;  4I7Z B;  4NBG D;  2FYN C;  3S9O A;  4IL6 X;  4TT3 H;  4H13 B;  3H1K E;  1NGM B;  1PV3 A;  1UUW A;  2E4P A;  4QCK A;  3TGU E;  5BOK A;  3AE1 C;  4GDO A;  1OW7 A;  3H1H E;  3G9R A;  2FBW C;  5KLI C;  4Z1M H;  4HM2 A;  2NUK A;  2B24 A;  2ZT9 B;  2HMK A;  3GZX A;  4NB8 D;  2NVE A;  1GMJ A;  1KYO E;  1NTK E;  5AEW A;  2MKV A;  3BCC E;  4RKU J;  3Q5R A;  2XRX A;  1G8J B;  3GF3 A;  2BMO A;  1NYK A;  3SFE C;  2DE5 D;  2FYU E;  3GL2 A;  1FQT A;  2XSO A;  1VM9 A;  1RQV A;  1L0N E;  2ZYL A;  1KTM A;  2JO6 A;  3LW5 J;  4QDF A;  3AED C;  4P1B H;  4R4M A;  4QUR A;  4HM1 A;  1WMK A;  1SQQ E;  4H13 C;  1HJ0 A;  3VMH D;  2H88 C;  3AE5 C;  1FDO A;  4H44 C;  3AEB C;  3H1I E;  1NYH A;  3H1L E;  1ZOY C;  1UUV A;  1VL2 A;  2WSF J;  2IDB A;  2E75 D;  4H44 D;  4NBC D;  1ZP0 C;  2GBX A;  3Q5P A;  2Q3W A;  4H0L B;  1ULJ A;  3GLM A;  3AEC C;  2H89 C;  1WQL A;  4NBF D;  5M1B A;  3RL0 g;  4NBB D;  3EN1 A;  5CXM A;  1JB0 J;  3GKE A;  2YFL A;  1JM1 A;  1VCK A;  3AE9 C;  1EXI A;  1O7N A;  2BMQ A;  3AE7 C;  4I7Z C;  1NTZ E;  2G8Y A;  2D2C B;  4NBH D;  1BCC E;  2E76 D;  1VF5 B;  4OGQ C;  1YQ4 C;  2NUM A;  2HMO A;  1L0L E;  2QIW A;  5L8R J;  2JZA A;  3D6Z A;  2E75 C;  3GZY A;  2QJK C;  3Q1M A;  2HMM A;  1NU1 E;  3H25 A;  2I7F A;  1KQF B;  3Q3D A;  3CX5 E;  5AEU A;  3L73 E;  2QSI A;  1G8K B;  3CWB E;  2QJY C;  2YFI A;  3D70 A;  2CKF A;  4R4L A;  1VF5 D;  3VCA A;  3FGA D;  3L75 E;  1PIX A;  2DE7 D;  3GF7 A;  2B1X A;  1OMI A;  1O7G A;  1KMI Z;  3Q5S A;  1AJY A;  2E76 B;  4U3F E;  2ZT9 C;  2XR8 A;  3AEE C;  1O7W A;  4HM3 A;  1NTM E;  3H1J E;  4EMJ B;  3GL0 A;  4YTP C;  1O7P A;  1RFS A;  1IK7 A;  3EQQ A;  1K04 A;  4H44 B;  4PD4 E;  5HL4 A;  4AIV A;  2QPZ A;  4AAY B;  1RQU A;  1PPJ E;  3D71 A;  2E75 B;  4NBD D;  1EXJ A;  3AE3 C;  2BCC E;  2A06 E;  1O7H A;  3L74 E;  3B71 A;  3GTE A;  2WQY C;  2YFJ A;  2BEQ D;  4KT0 J;  3AE4 C;  2WPV B;  2YIU C;  3O6Q A;  2OQQ A;  2G3A A;  1Y9B A;  4HM7 A;  3GTS A;  3AEG C;  2J5U A;  4PV1 C;  1TU3 F;  2E76 C;  1O7M A;  1ZME C;  4HM5 A;  2D2C C;  1ULI A;  4NBA D;  1YQ3 C;  4NB9 D;  2JP3 A;  4QDD A;  3IN6 A;  2HML A;  3AEA C;  2NVF A;  1P84 E;  2E74 B;  2K9Y A;  3AE8 C;  3D6Y A;  1KQG B;  4H0L D;  2E74 C;  4HM0 A;  3AZC A;  1OW8 A;  4U7J A;  2ZT9 D;  4NBE D;  2FXP A;  2DE6 D;  3AEF C;  2E74 D;  1SQV E;  1VF5 C;  2GBW A;  1PP9 E;  3DQY A;  2JO1 A;  4OGQ B;  1S5L X;  1UIX A;  1FDI A;  1R8E A;  2IBZ E;  3L70 E;  2BMR A;  1S1C X;  4HM8 A;  2XSH A;  2O01 J;  2YVJ B;  4YXD C;  5KKZ C;  1Q90 D;  4QDF B;  1HF9 A;  1K05 A;  3N0Q A;  2NZ2 A;  1DD3 A;  4XFJ A;  2V7Q J;  4QUQ A;  3L71 E;  4P1C H;  4H13 D;  4HKV A;  3VMG D;  1OW6 A;  1MKM A;  2WSE J;  3SFD C;  3CXH E;  3IAO A;  3RK3 E;  1KIL E;  2E4Q A;  3C0D A;  2HMN A;  3GB4 A;  1KB9 E;  2YMK A;  1RIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...