2QJYC

Crystal structure of rhodobacter sphaeroides double mutant with stigmatellin and uq2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
179
structure length
179
Chain Sequence
b'GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCSPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed Structures of the Cytochrome bc1 from the Photosynthetic Bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 55
structure length 179
sequence length 179
chains with identical sequence F, I, L, O, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2007-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qjyC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qjyC02
1SQBE 1UUVA 1BCCE 2HMKA 4H13B 2B1XA 1NYKA 3AZCA 4HM7A 5AEWA 3LW5J 2E76D 4QDCA 3GOBA 1VM9A 3GTSA 3L73E 3N0QA 2QIWA 4AIVA 2HMNA 4H44D 4PV1D 2YFLA 5KLVE 3H1IE 4NB9D 1NTZE 3H1KE 4KT0J 4NBHD 3GZXA 2D2CD 2HMMA 2E76B 4NBFD 3C8VA 4NBCD 5BOKA 2WSEJ 3DQYA 4H44B 4PV1B 1EZVE 2DE6D 2QSIA 4HKVA 3GZYA 1SQXE 1O7MA 2E4PA 2NVGA 3EQQA 2D2CB 3L70E 1NTKE 2DE5D 2Q3WA 2XR8A 3CX5E 2E74B 4I7ZB 2DE7D 1O7WA 4H0LD 2NUKA 4NBAD 3GCEA 2YFJA 4HM2A 1NDOA 1RFSA 2BCCE 4QURA 4QCKA 1RIEA 1SQPE 1SJGA 2XSOA 2NVFA 4HM3A 3EN1A 1L0LE 1WQLA 2K9YA 4H0LB 2GBWA 2JO6A 3H1JE 4NBDD 4QDFB 1NTME 3L75E 1ULIA 4QDDA 1G8JB 2E74D 1PP9E 1BE3E 4P1CH 3VMID 2CKFA 1S5LX 1NU1E 4NBBD 4HJLA 2NWFA 2JZAA 2WSFJ 1P84E 2WSCJ 3CXHE 4EMJB 3TGUE 2HMLA 3VMHD 3GL0A 2B24A 3D89A 1JM1A 2I7FA 2QPZA 4Y28J 1VCKA 3H1HE 3GKEA 3CWBE 2BMRA 2QJPC 2IBZE 4IL6X 5AEUA 2HMJA 4QDFA 2GBXA 1JB0J 2ZYLA 1UUWA 1L0NE 1O7GA 1FQTA 1KB9E 5HL4A 2BMOA 1VF5D 1Q90C 2ZT9D 4RKUJ 1G8KB 2A06E 2O01J 3GB4A 4HM0A 1SQQE 4HM4A 5KLIC 4NB8D 3VMGD 2E4QA 1SQVE 1VF5B 3L71E 2ZT9B 4OGQB 4P1BH 2FYNC 3GTEA 3FOUA 2QJKC 2E75D 4HM5A 3L72E 3BCCE 3VCAA 2NUMA 2YIUC 4QUQA 2WPVB 2BMQA 2QJYC 4NBGD 4NBED 3H1LE 5CXMA 2HMOA 5L8RJ 2E75B 1O7PA 1O7NA 2XSHA 4HM6A 1O7HA 2YFIA 1PPJE 1ULJA 1Q90D 1KYOE 5KKZC 3L74E 4H13D 4OGQD 4HM1A 2YVJB 4U3FE 4AAYB 4QUPA 3VCPA 1EG9A 2NVEA 4HM8A 3C0DA 1ZRTE 4PD4E 3GL2A 2XRXA 2FYUE
chains in the Genus database with same CATH superfamily
4EI2A 5CBOA 1NYKA 2OARA 3TNUB 3LW5J 1BSNA 4PV1D 3H1KE 2YMYA 2OYHA 2N1TB 4U3FD 4D6TG 1ZMEC 1DIPA 2IZ1A 2DE6D 4HKVA 4IOIH 1OVUA 2ZXXA 3CCEP 2WWWA 2G8YA 3Q5SA 3O6QA 4R4MA 3W68A 3OAKA 2BCCG 4NPFX 4HM3A 2NPSD 4AUWA 2K9YA 3CLQA 5E79H 1JY3P 1P84E 5GTIH 3AECC 2B24A 1JY3N 5K5GB 4Y28J 3D6YA 3C1LA 3PJSK 3CWBG 2GBXA 2C9LY 1L0NE 1PP9J 1YJWP 1LWUC 2O01J 1WMKA 5APUA 2AEFA 1KORA 1NU1G 3FOUA 2E75D 2YIUC 2GUVA 1KB9D 2WPSA 2Z5HA 2HMOA 1PIXA 1QL1A 1NO4A 2CPSA 2WPRA 2XU6A 5AW7B 3R2PA 4L74A 1E79H 2BEZF 2KNCA 3VP8A 2VRSA 3L73E 1DEBA 2N9YB 1RF0C 2NPSC 3H1IG 2J58A 1M1JB 3L71J 1LWUA 4DCKA 1FDOA 1O7MA 1JMMA 3IAOA 3CX5E 3CCJP 2DE7D 1RHZB 1WT6A 2NUKA 3H1ID 2YFJA 4HM2A 2KK7A 3VTPC 3IFMA 1OXZA 1BDCA 3EN1A 3F89A 1GL2B 1EZVD 2R3CA 1Q82Q 4OH8B 1FJKA 5CCHC 4QDDA 4UB8E 3U1AA 1PV3A 2FYUK 5AW4B 3WUUA 1K05A 2FFDB 1ZLLA 4JF7A 2E75C 3AEEC 3WU2H 1N7SB 3KYQA 1YBKA 3Q5PA 2H43A 1RF0A 2NPSA 1CSBA 4Y99C 3MZWB 3Q5RA 1G1IA 4P1BH 4QMAA 5B66E 2ZJSE 2P67A 3KQGA 3MD0A 2JEEA 2ZYAA 1NTMJ 2KXPB 2J5UA 5B5EH 5AW1B 5TJHA 4Z1MH 2Z4EA 1GZLA 1Q90D 2QG4A 1PPJG 4H13D 2E74C 1W5CE 4HM1A 3TGUJ 2GA1A 3P8CD 5CCHA 1EG9A 3C0DA 3RK3D 3II6A 1RE3A 2XRXA 2O1JA 1H88A 1SQBG 1BCCG 1JY3O 3KZIE 1BGYJ 1KQSO 3E1IA 4H44D 4NB9D 2W6JH 4I1LA 1JNMA 2JDIH 3L70D 3KDPB 3FX0A 2JO1A 5H2FH 1KQLA 1YITP 3PHLA 3JSVC 1JY2N 5AVRB 3AEBC 1SFCC 1SQPE 2NVFA 3GHGB 3H1JG 4ZKPA 3CMAP 3RL0D 3AE9C 2NWFA 2QPZA 3GKEA 1T3UA 1JO5A 2ZXEB 5KLVK 2HMJA 1RH5B 1O7GA 3H25A 1VF5D 1Q90C 2XNXA 4H13C 2A06E 3G6EP 3VMGD 3U59A 5KJ7C 3SSUA 1H0TB 3CXHH 2FYNC 3TK1A 3HUSA 2IBZD 4MN4C 3H1HG 4JYBA 4M3LA 1HJBA 5L8RJ 3AEGC 1SFCA 5AW0B 3IF4A 3R4YA 1BDDA 2FYUD 2JJLA 1ZRTE 3BCCJ 4WWIA 2HMKA 3AZCA 2XV5A 4HM7A 3HE5B 2KOGA 1GK6A 2I8DA 3L35A 1OW7A 3LW5H 2ZT9C 4OVNF 3P7KA 3Q1MA 1KYOH 5CJ0A 4I6MC 4PD4D 3I55P 2POHA 3L74G 2KSEA 3GZYA 2P7JA 2D2CB 3RL0C 2DE5D 3S1KA 4AQRD 5KJ7A 4NBAD 3HD7D 1R8EA 3H1KD 4K35A 1NJIQ 3P32A 1VF5C 4NBDD 1SQXJ 4OGQC 2HYNA 4BWNA 1NTKJ 1ULIA 1LTJB 1LGHB 1J1EB 1W2EA 1FAVA 3FWNA 3VMID 1W2BO 1T6AA 2AXCA 3CCUP 2I1KA 3I5CA 1N7LA 2IBZI 1VCKA 2BMRA 2OTJP 1L0NG 2B87B 3HE4B 4KJMA 3A0BH 4L75A 3GB4A 3L75G 1IK9A 4LLHA 3M0DC 3L71E 1R5SA 2O01H 1HBWA 2WITA 1FJPA 4I2LC 4EIJA 1L0ND 2LKMA 2NUMA 1KMIZ 1JCCA 1T2KC 2P10A 5KAIE 4L73A 1QVFO 1L0LK 1SQQJ 2ZAEB 4GIFA 1BE3J 1EC5A 1ULJA 5AVQB 1LTAC 1S1CX 2K1AA 4PJ0E 2YXRB 1R5LA 3TYYA 1MV8A 1JMBA 3HD7C 1LNQA 1VM9A 1OZHA 1X79B 1IFMA 3L73G 2B88A 1SQPK 2PFXA 2E76B 1M57D 2QJPB 1GMJA 3L70E 5AVYB 1H89A 4RESB 3M0DA 3L73D 1NTZJ 2W6BA 1OVRA 1VQPP 1PGJA 1PGPA 2O3JA 1S5LE 1ZR4A 1PZQA 1HVVA 1NTME 1JUNA 3CX5D 4BRYA 3TGUE 2QM8A 2A45H 3VMHD 2JP3A 5APSA 1U57A 1LT9C 3ITKA 3HD7A 1Q2NA 2AXTH 4WB4A 1HGZA 3TDKA 1XTCC 3RK2B 1OW8A 2JR8A 3KXDA 3BATA 2W6AA 4HM4A 1FZEA 4WVZA 3FXEA 3MUDC 2WT7B 4GOFA 1IFDA 2QJKC 5AW2B 2K3RA 3H1LD 2FY8A 1PGQA 2WPQA 1QVGO 2KIKA 4N78E 1K73Q 3SWFA 1SQVJ 2OYHB 1A02F 3NMDA 4IL6H 2FYUE 4HYTB 2QIWA 2QEXP 1LT9A 2E43A 4U3FJ 3O6QB 3V2QA 3NXSA 3AE1C 1M56D 2Z5IA 3QH9A 3P8MC 1M90Q 5E79E 3AE8C 5GTIE 2R44A 2Y0DA 3MUDA 1S3JA 1IFJA 1L2PA 2WSCH 1L0LD 4D6TJ 4JQ0D 1FOSE 1RFSA 3V2RA 3D71A 1JM0A 1Q81Q 3BRTB 4A7PA 5AW5B 4HB1A 2BCCJ 1LTTC 4NPEA 1SQPD 4OWFA 3WUVA 5GTHH 5AVZB 1IK7A 1AA0A 2HODA 4JBZA 1AJYA 4NB8D 2H8PD 3PRJA 4C7RA 2Q9IA 2IYOA 2KS1A 3CWBJ 1JCDA 3L72D 1S72P 2ZYGA 1NYHA 4U7JA 2KNCB 3ZDMA 2YKQA 1FS0E 4NBED 1KYOD 2A06D 5CBNA 5APYA 2K88A 1KD1Q 1NU1J 5CCHD 3VCPA 4XE5B 1LWUB 2O01N 5KLVE 3SFDC 2XKMA 3EWKA 1NTMK 2YIUB 1ZRTD 4PV1B 3HRNA 4JPZB 2XR8A 2W90A 1DEEG 3G71P 3H1IJ 3M91A 4IFDK 3V4QA 3S4RA 1S2EA 1SJGA 1J1DC 3VMAA 1PP9D 2OYOA 3FGAD 1VQKP 1J2JB 2E74D 1ZR2A 1BE3E 2IX7C 2WQYC 2JKVA 2NPSB 1YIJP 1EZVG 1VQ8P 3CPWO 1ZP0C 2OYIC 2NZ2A 2KLVA 2NRGA 3LIEA 2Y0EA 3V4WA 2V4HA 4QDFA 2JWDA 1KYOI 1PFIA 2ZYLA 3VOPA 1RF1C 4RKUJ 2YXQB 1QL2A 5C39A 1ZV8A 1D7MA 3RGUA 1KTMA 5KLIC 3Q2YA 1Y9BA 1GU4A 3S9OA 4YTPC 1Q86Q 2QJYC 2KB7P 3H1LE 1SFCD 2E75B 3A0HH 2FFDC 5KKZC 1AVOA 3L71D 3VMZA 5TISH 1X9VA 1N7SC 1YYCA 2WSEH 1VQNP 4TLFA 3RBXA 5H2FE 3CCQP 3V5BA 3V6IA 3T97A 2OYIA 3N0QA 2HMNA 4XA4A 4UB6H 2AEMA 4GOEA 4ASVA 1YI2P 4NBCD 2E5YA 1HTLC 1SQBJ 1BCCJ 1RF1A 2QVAA 2NVGA 1X22A 3L36A 4WY4D 1GD2E 3L70G 5M1BA 5KJ7D 2E74B 1YTZI 4H0LD 3NFQA 1CZQA 1NDOA 2W8ZA 3JCUH 1GK4A 1QGKB 1L0LE 2W27A 1RE4C 1FZGA 1KILC 2FFDA 4UB8H 2HFED 1NKNA 1E5WA 3BRVB 1N7SA 3CXHE 2WSCJ 4EMJB 3B5NC 1LTGC 1VDFA 2J59M 3A5TA 1JM1A 4XFJA 1S4XA 1MZ9A 2R3SA 1N2DC 3E7KA 4AYCA 3HUSB 3H1JJ 4IFMA 5AEUA 3G3ZA 1JB0J 1NTMD 2PP6A 2ZT9D 1SFCB 1USEA 3TGUD 1SQXK 1NTKK 1USDA 1JTHA 3CCRP 3CL3D 3L72E 3RL0g 1BGYD 4RO0A 2IBZG 1GTWA 4D6TE 1O7HA 1NWQA 1KYOE 4OGQD 4I7ZC 1RE4A 2H7HA 2A45I 1KILA 1FDMA 1LTIC 2NVEA 4WY4C 3H1HJ 1Z56A 1RQUA 2FYUG 4H13B 2M8RA 3M06A 1LP1A 3B5NA 4H0LC 4CPGA 3FXDA 2UWJE 3RK3B 1IFIA 2FYNB 4EDFA 4N78D 1KFNA 3GZXA 1OW6A 1UIIA 1EQ7A 4RJTA 1SQQK 4H44B 3PLNA 5AVTB 1KV4A 3EQQA 2BEQD 2CPBA 2V7QH 5AVVB 2WSFH 1T2KD 3L74J 2HPCA 2K37A 2FXPA 3H1KG 3GLMA 1PP9E 1KFMA 1AQTA 1NU1E 2JZAA 4WY4A 3BVHA 2IFNA 1M7LA 3PH0A 4GODA 1SS1A 5KAFH 1LJ2A 3RL0B 1NTZK 2LR2A 2KZIA 1CW5A 1EDLA 1AV1A 1KILE 3AEAC 1VF5B 4YXDC 3G4SP 4OGQB 3BASA 3FWLA 1L0NJ 3VYIA 3MP7B 2OTLP 2WPVB 3L75J 2GUSA 1KB9H 2P1JA 4AAYB 2KP8A 2Q3EA 1GU5A 4LGDE 3GTEA 3CCSP 3CCLP 4QDCA 2HR3A 3GOBA 1QX8A 2M0BA 5KLVG 4KT0J 1URQD 2P58A 5AW6B 2XDJA 4DZOA 2WSEJ 2QA4P 1JOCA 3HTKA 1NTKD 2FYZA 2ZVNB 1VQLP 1SP4A 1SQVK 1N73C 1G2CA 2WZ7A 4BRYB 1NGMB 1FZCC 3N7NA 5KLVD 1IO4A 3GMAA 2M5AA 2AXTE 1GDTA 5AVSB 3HD7B 3IN6A 3M0AA 1G8JB 1YQ3C 2H89C 1CI6A 3D6ZA 4YPCA 2FKWB 2E76C 1QLED 4ZNCA 2L91A 2QJPC 3CC7P 2SPZA 1AQ5A 2YO3A 1SQQD 2YKOA 3QWOC 1BE3D 5CCGD 4HM0A 1L4AD 5AVWB 4IL6E 2QRXA 2KZJA 3W67A 4EOTA 1OVVA 1N73A 3GG2A 4R4LA 1FZCA 1KC8Q 1BGYE 1URQC 3H1LG 2H88C 1LT9B 1X0TA 2K9JA 1K8AQ 1ZOYC 2YVJB 3F5HA 2HG5D 2N1TD 2Q6QA 1DD3A 4C7NA 3O8ZA 4AIVA 4K3AA 1HGVA 3SWYA 2O1KA 1FOSF 1NU1K 3MHVA 3OW2O 3V2PA 2E42A 2C0XA 1BSHA 3GCEA 2MJZA 2PGDA 4QURA 3N4XA 1QEXA 5DJTB 5GTHE 3KHUA 2YNYA 1L0LG 2R5DA 5CCGC 1URQA 4GKGA 2V7QJ 1IZNB 1L4AC 1FBMA 4P1CH 2HODB 2WSFJ 3GL0A 2I7FA 3H1HE 2KS1B 4GT1A 3G9RA 2OGUA 3EFGA 1EXIA 1KN7A 3H32A 2P2UA 1SQPG 2YMKA 1N86A 1KZUB 3M9HA 1SQVD 1H8AA 1VL2A 3CXHD 2G3AA 5APQA 3AE2C 2B9BA 3M9BA 1HJ0A 2N1TC 2OQQA 5APTA 1NKZB 3BCCE 3L72G 2BMQA 3JC22 1S9KE 3AE6C 3L74E 1AVYA 5CCGA 2A06G 1MFTA 1VQ6P 4EYYQ 1L4AA 2IDBA 3L4FA 2JWAA 4BXLA 3GTSA 1NOHA 2FXMA 5CJ4A 4D6TD 1YJ9P 1OX3A 4W80A 1YTZT 3B4SA 4KHXA 1M8OB 3VMXA 1T3JA 2IZ0A 2QSIA 1SQXE 3TNUA 4PD4H 1NTKE 1PGOA 2Q3WA 1DX7A 2BCCD 2Y9ZA 1O7WA 1NH4A 1GL2D 2ITAA 5AW9B 2B89A 2N1TA 3U1CA 2YO2A 2WTYA 5AW3B 1FDIA 4QDFB 1X8YA 3KPEA 3L75E 3VP9A 3CXHI 1ZXGA 3NTNA 1PP9G 1N7SD 1SQBK 3CWBD 2M3EA 3A7OA 4PV1C 3WU2E 3AE7C 3A0HE 5HL4A 1ZW0A 2IYPA 3CC2P 1SQQE 1NU1D 5TISE 2QE7H 1J1DB 1P84H 1M1JC 4UB6E 3PP5A 4NBGD 3T97B 2E5TA 1IFNA 2OYIB 1LT1A 1RQVA 4C46A 1NHLA 5B5EE 4HM6A 2YFIA 1KILD 1FZAA 1Y47A 4HJGH 1EDJA 1RF1B 3AEFC 3L71G 3B5ND 1GL2C 3MIWA 5KLIB 2R32A 5BU8B 3AEDC 3AE4C 3JCUE 1NTZE 2OTKE 3OJAB 4N6JA 1RE3C 2QJYB 1HF9A 5AW8B 2E4PA 3CCMP 5KKZB 2A45G 4Y99B 5CHXA 1KB9I 1OMIA 1SVFA 2DW3A 2ZVOB 1M1JA 1YJNP 2GBWA 1LTBC 2KUBA 3L70J 3C9IA 1VQOP 2WSSH 2WVRA 2ZYDA 4HH2A 3CX5H 2WMMA 4WBAA 3D89A 1JTHB 3GF7A 3A2AA 1GL2A 1DD4A 1OIPA 1NTMG 2XZRA 1SQVE 1FU1A 4W7ZA 5BU5A 1KILB 3TGUG 3E1RA 3VMYA 4LC1A 2XNDH 1LP1B 1PPJD 3B5NB 2W83C 1O7PA 1EZVI 1O7NA 1BGYG 4U3FE 1SQBD 3CMEP 1BCCD 3HUSC 3K5BA 2BASA 3GL2A 1JY2P 1IC2A 1MKMA 1UUVA 5B66H 3GHGC 1WRGA 1M1KQ 1TU3F 1L0NK 2YFLA 2YKPA 1K9MQ 1VQMP 2D2CD 3CCVP 4NBFD 2PAJA 3C8VA 5BOKA 1FC2C 1IJDB 2FYUJ 3DQYA 2HPCB 1YHQP 2FXOA 4I7ZB 3KZIH 5KAFE 3Q3DA 4WY4B 2BCCE 3H1JD 2HLOA 4H0LB 2JO6A 3TSIA 4HKZH 3AE3C 5APWA 1VPCA 2Q1KA 1Y8AA 5BVZA 1Q7YQ 3RK3C 5APXA 3CWBE 3H1KJ 4H44C 3GHGA 4GDOA 1A02J 3EQ2A 2KYVA 2M3BA 1SLQA 1KB9E 1PL5A 5EFWB 4DOJA 1NVOA 3A0BE 3RBZA 4IFFA 4DT0A 3PTZA 3H1HD 2ZT9B 3VN0A 1EXJA 2LXCB 3BCCG 2Q7CA 3MTUE 4QUQA 4YXWH 1HH0A 2D2CC 5APVA 2R5BA 1OFCX 4ASWA 1H0TA 1KQGB 4NPDA 4HM8A 4ZMDA 2MKVA 3HTKB 2RKLA 3I56P 3BCCD 5AEWA 2E76D 2I1JA 1G2CB 1S9KD 1LTJC 3H1IE 1J1EC 3L74D 4NBHD 1EDIA 2HMMA 2M5AB 4B86A 3ABVC 1EZVE 5AVUB 3HE5A 1DH3A 1SQXG 1NTKG 5KLVJ 1CI6B 3GW6A 2PRRA 3IR9A 1VQ4P 3EFFK 5KTBA 4QCKA 1RIEA 1IFPA 2XSOA 1T8ZA 3OA7A 1MFZA 3V2NA 4DJGA 2GM4A 5AVXB 1SQXD 1P84D 1YQ4C 3L73J 2C0WA 2HMLA 3CD6P 3H6PA 1JY2O 2Q3IA 4N3YB 3RK2D 3B8EB 1N73B 5DJUB 2QM7A 1LTJA 3L75D 1FQTA 1RY3A 2RN0A 1FZCB 4PD4I 1G8KB 1SQQG 1BE3G 2K9JB 2N9BA 3P8CE 2AEJA 2IFMA 2KLUA 2RH0A 2L5GB 3RK3E 1VQ9P 1OWAA 3A3YB 3MGNA 4TT3H 2B87A 3HE4A 4C7NB 4W7YA 1ZN5A 2Y9YA 2ZFCA 1HUCA 1PPJE 1U7JA 4QUPA 2Q5UA 2KSJA 3CC4P 1K04A 3TF5A 1SQBE 1BCCE 2RMZA 3M9QA 2B1XA 3H1LJ 3CI9A 5KAIH 1U7MA 1NTZG 1NAFA 3SWKA 1UIXA 1P84I 3GF3A 4JYCA 1URQB 3L37A 4PJ0H 3LIDA 3UIAA 4ZKUA 3RK2C 1NTZD 1LTSC 1JEKA 1FZBA 2QJKB 1VQ5P 1WQLA 3H1JE 3WUTA 2C9NY 3H32B 3AE5C 2FBWC 2CKFA 1S5LX 4NBBD 4L76A 1MUUA 2KI7B 2Y0CA 1AFOA 2IPPA 1L0LJ 1HWTC 2IBZE 4IL6X 2OYHC 1UUWA 1NAYA 1S5LH 1GW4A 2BMOA 2LXBA 3SFEC 1N8RQ 1FE6A 2E4QA 1GW3A 1SQVG 1XTGB 1L4AB 4HM5A 1G1JA 1SQPJ 5CMZA 1VQ7P 3VCAA 3D70A 1FZFA 3USSA 5CXMA 2CK3H 2XSHA 3WMM0 1EDKA 3CX5I 2WT7A 4U3FG 3B71A 4O9BA 4PD4E 3L72J 1KQFB 4HJLA
chains in the Genus database with same CATH topology
1RQUA 4H13B 3AEFC 1NYKA 4H0LC 3LW5J 1VM9A 4PV1D 3AEDC 3AE4C 1NTZE 3H1KE 3GZXA 1OW6A 2E76B 1ZMEC 4H44B 1DIPA 1HF9A 1GMJA 2DE6D 4HKVA 3EQQA 2E4PA 2BEQD 3L70E 2G8YA 3Q5SA 3O6QA 1OMIA 4R4MA 4HM3A 2FXPA 2K9YA 2GBWA 3GLMA 1NTME 1PP9E 1NU1E 2JZAA 3TGUE 1P84E 3AECC 3VMHD 2B24A 3D89A 4Y28J 2JP3A 3D6YA 1U57A 3GF7A 2GBXA 1L0NE 1DD4A 1OW8A 2O01J 1WMKA 4HM4A 1KILE 3AEAC 1VF5B 4YXDC 1SQVE 4OGQB 1KORA 3FOUA 2QJKC 2E75D 2YIUC 2WPVB 2HMOA 1O7PA 1O7NA 1PIXA 4U3FE 4AAYB 3GL2A 3GTEA 2FYUE 1MKMA 1UUVA 2BEZF 4QDCA 3GOBA 1TU3F 3L73E 2QIWA 2YFLA 4KT0J 3AE1C 2D2CD 4NBFD 3C8VA 5BOKA 2WSEJ 3DQYA 3AE8C 1FDOA 1O7MA 3IAOA 3CX5E 4I7ZB 2DE7D 1NGMB 2NUKA 2YFJA 3GMAA 3Q3DA 4HM2A 1RFSA 2BCCE 3D71A 3EN1A 4H0LB 2JO6A 3AE3C 3IN6A 4QDDA 1G8JB 1YQ3C 1PV3A 2H89C 3D6ZA 1K05A 2E75C 2E76C 3AEEC 3CWBE 4H44C 2QJPC 4GDOA 3Q5PA 1KB9E 1IK7A 1PL5A 4HM0A 1AJYA 4NB8D 3Q5RA 2ZT9B 4P1BH 1NYHA 1EXJA 4U7JA 4R4LA 4QUQA 4NBED 2J5UA 2D2CC 2H88C 4Z1MH 1Q90D 4H13D 2E74C 1ZOYC 4HM1A 2YVJB 1KQGB 3VCPA 1EG9A 4HM8A 3C0DA 2XRXA 2MKVA 5AEWA 1DD3A 2E76D 4AIVA 4H44D 5KLVE 3H1IE 4NB9D 3SFDC 4NBHD 2HMMA 3EWKA 4PV1B 3ABVC 1EZVE 2JO1A 2XR8A 3GCEA 3AEBC 4QURA 4QCKA 1RIEA 1SQPE 1SJGA 2XSOA 2NVFA 3FGAD 2V7QJ 2E74D 1YQ4C 1BE3E 4P1CH 2WQYC 2NWFA 3AE9C 2WSFJ 1ZP0C 2HMLA 3GL0A 2NZ2A 2I7FA 2QPZA 3H1HE 3GKEA 3G9RA 1EXIA 2HMJA 4QDFA 2ZYLA 1O7GA 1FQTA 2YMKA 3H25A 1VF5D 1Q90C 4H13C 4RKUJ 1G8KB 2A06E 1VL2A 1KTMA 5KLIC 2G3AA 3Q2YA 3VMGD 1Y9BA 3S9OA 3AE2C 2FYNC 3RK3E 4YTPC 1HJ0A 2OQQA 3BCCE 2BMQA 4TT3H 2QJYC 3H1LE 5L8RJ 2E75B 3AEGC 1PPJE 3R4YA 3AE6C 5KKZC 3L74E 4QUPA 1K04A 1ZRTE 1SQBE 1BCCE 2HMKA 2B1XA 2IDBA 3AZCA 4HM7A 3GTSA 3N0QA 2HMNA 1OW7A 2ZT9C 4NBCD 3Q1MA 1UIXA 3GF3A 2QSIA 3GZYA 1SQXE 2NVGA 2D2CB 1NTKE 2DE5D 2Q3WA 5M1BA 2E74B 1O7WA 4H0LD 4NBAD 1R8EA 1NDOA 1L0LE 1FDIA 1WQLA 1VF5C 3H1JE 4NBDD 4QDFB 4OGQC 3L75E 3AE5C 1ULIA 2FBWC 3VMID 2CKFA 1S5LX 4NBBD 3CXHE 2WSCJ 4EMJB 1JM1A 4XFJA 1VCKA 2BMRA 4PV1C 2IBZE 4IL6X 5AEUA 1JB0J 1UUWA 3AE7C 5HL4A 2BMOA 2ZT9D 3GB4A 1SQQE 3SFEC 2E4QA 3L71E 4HM5A 3L72E 3RL0g 3VCAA 2NUMA 1KMIZ 3D70A 2P10A 4NBGD 3T97B 5CXMA 1RQVA 2XSHA 4HM6A 1O7HA 2YFIA 1ULJA 1KYOE 4OGQD 4I7ZC 1S1CX 2NVEA 3B71A 4PD4E 1KQFB 4HJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQB E;  1UUV A;  1BCC E;  2HMK A;  4H13 B;  2B1X A;  1NYK A;  3AZC A;  4HM7 A;  5AEW A;  3LW5 J;  2E76 D;  4QDC A;  3GOB A;  1VM9 A;  3GTS A;  3L73 E;  3N0Q A;  2QIW A;  4AIV A;  2HMN A;  4H44 D;  4PV1 D;  2YFL A;  5KLV E;  3H1I E;  4NB9 D;  1NTZ E;  3H1K E;  4KT0 J;  4NBH D;  3GZX A;  2D2C D;  2HMM A;  2E76 B;  4NBF D;  3C8V A;  4NBC D;  5BOK A;  2WSE J;  3DQY A;  4H44 B;  4PV1 B;  1EZV E;  2DE6 D;  2QSI A;  4HKV A;  3GZY A;  1SQX E;  1O7M A;  2E4P A;  2NVG A;  3EQQ A;  2D2C B;  3L70 E;  1NTK E;  2DE5 D;  2Q3W A;  2XR8 A;  3CX5 E;  2E74 B;  4I7Z B;  2DE7 D;  1O7W A;  4H0L D;  2NUK A;  4NBA D;  3GCE A;  2YFJ A;  4HM2 A;  1NDO A;  1RFS A;  2BCC E;  4QUR A;  4QCK A;  1RIE A;  1SQP E;  1SJG A;  2XSO A;  2NVF A;  4HM3 A;  3EN1 A;  1L0L E;  1WQL A;  2K9Y A;  4H0L B;  2GBW A;  2JO6 A;  3H1J E;  4NBD D;  4QDF B;  1NTM E;  3L75 E;  1ULI A;  4QDD A;  1G8J B;  2E74 D;  1PP9 E;  1BE3 E;  4P1C H;  3VMI D;  2CKF A;  1S5L X;  1NU1 E;  4NBB D;  4HJL A;  2NWF A;  2JZA A;  2WSF J;  1P84 E;  2WSC J;  3CXH E;  4EMJ B;  3TGU E;  2HML A;  3VMH D;  3GL0 A;  2B24 A;  3D89 A;  1JM1 A;  2I7F A;  2QPZ A;  4Y28 J;  1VCK A;  3H1H E;  3GKE A;  3CWB E;  2BMR A;  2QJP C;  2IBZ E;  4IL6 X;  5AEU A;  2HMJ A;  4QDF A;  2GBX A;  1JB0 J;  2ZYL A;  1UUW A;  1L0N E;  1O7G A;  1FQT A;  1KB9 E;  5HL4 A;  2BMO A;  1VF5 D;  1Q90 C;  2ZT9 D;  4RKU J;  1G8K B;  2A06 E;  2O01 J;  3GB4 A;  4HM0 A;  1SQQ E;  4HM4 A;  5KLI C;  4NB8 D;  3VMG D;  2E4Q A;  1SQV E;  1VF5 B;  3L71 E;  2ZT9 B;  4OGQ B;  4P1B H;  2FYN C;  3GTE A;  3FOU A;  2QJK C;  2E75 D;  4HM5 A;  3L72 E;  3BCC E;  3VCA A;  2NUM A;  2YIU C;  4QUQ A;  2WPV B;  2BMQ A;  2QJY C;  4NBG D;  4NBE D;  3H1L E;  5CXM A;  2HMO A;  5L8R J;  2E75 B;  1O7P A;  1O7N A;  2XSH A;  4HM6 A;  1O7H A;  2YFI A;  1PPJ E;  1ULJ A;  1Q90 D;  1KYO E;  5KKZ C;  3L74 E;  4H13 D;  4OGQ D;  4HM1 A;  2YVJ B;  4U3F E;  4AAY B;  4QUP A;  3VCP A;  1EG9 A;  2NVE A;  4HM8 A;  3C0D A;  1ZRT E;  4PD4 E;  3GL2 A;  2XRX A;  2FYU E; 
#chains in the Genus database with same CATH topology
 4EI2 A;  5CBO A;  1NYK A;  2OAR A;  3TNU B;  3LW5 J;  1BSN A;  4PV1 D;  3H1K E;  2YMY A;  2OYH A;  2N1T B;  4U3F D;  4D6T G;  1ZME C;  1DIP A;  2IZ1 A;  2DE6 D;  4HKV A;  4IOI H;  1OVU A;  2ZXX A;  3CCE P;  2WWW A;  2G8Y A;  3Q5S A;  3O6Q A;  4R4M A;  3W68 A;  3OAK A;  2BCC G;  4NPF X;  4HM3 A;  2NPS D;  4AUW A;  2K9Y A;  3CLQ A;  5E79 H;  1JY3 P;  1P84 E;  5GTI H;  3AEC C;  2B24 A;  1JY3 N;  5K5G B;  4Y28 J;  3D6Y A;  3C1L A;  3PJS K;  3CWB G;  2GBX A;  2C9L Y;  1L0N E;  1PP9 J;  1YJW P;  1LWU C;  2O01 J;  1WMK A;  5APU A;  2AEF A;  1KOR A;  1NU1 G;  3FOU A;  2E75 D;  2YIU C;  2GUV A;  1KB9 D;  2WPS A;  2Z5H A;  2HMO A;  1PIX A;  1QL1 A;  1NO4 A;  2CPS A;  2WPR A;  2XU6 A;  5AW7 B;  3R2P A;  4L74 A;  1E79 H;  2BEZ F;  2KNC A;  3VP8 A;  2VRS A;  3L73 E;  1DEB A;  2N9Y B;  1RF0 C;  2NPS C;  3H1I G;  2J58 A;  1M1J B;  3L71 J;  1LWU A;  4DCK A;  1FDO A;  1O7M A;  1JMM A;  3IAO A;  3CX5 E;  3CCJ P;  2DE7 D;  1RHZ B;  1WT6 A;  2NUK A;  3H1I D;  2YFJ A;  4HM2 A;  2KK7 A;  3VTP C;  3IFM A;  1OXZ A;  1BDC A;  3EN1 A;  3F89 A;  1GL2 B;  1EZV D;  2R3C A;  1Q82 Q;  4OH8 B;  1FJK A;  5CCH C;  4QDD A;  4UB8 E;  3U1A A;  1PV3 A;  2FYU K;  5AW4 B;  3WUU A;  1K05 A;  2FFD B;  1ZLL A;  4JF7 A;  2E75 C;  3AEE C;  3WU2 H;  1N7S B;  3KYQ A;  1YBK A;  3Q5P A;  2H43 A;  1RF0 A;  2NPS A;  1CSB A;  4Y99 C;  3MZW B;  3Q5R A;  1G1I A;  4P1B H;  4QMA A;  5B66 E;  2ZJS E;  2P67 A;  3KQG A;  3MD0 A;  2JEE A;  2ZYA A;  1NTM J;  2KXP B;  2J5U A;  5B5E H;  5AW1 B;  5TJH A;  4Z1M H;  2Z4E A;  1GZL A;  1Q90 D;  2QG4 A;  1PPJ G;  4H13 D;  2E74 C;  1W5C E;  4HM1 A;  3TGU J;  2GA1 A;  3P8C D;  5CCH A;  1EG9 A;  3C0D A;  3RK3 D;  3II6 A;  1RE3 A;  2XRX A;  2O1J A;  1H88 A;  1SQB G;  1BCC G;  1JY3 O;  3KZI E;  1BGY J;  1KQS O;  3E1I A;  4H44 D;  4NB9 D;  2W6J H;  4I1L A;  1JNM A;  2JDI H;  3L70 D;  3KDP B;  3FX0 A;  2JO1 A;  5H2F H;  1KQL A;  1YIT P;  3PHL A;  3JSV C;  1JY2 N;  5AVR B;  3AEB C;  1SFC C;  1SQP E;  2NVF A;  3GHG B;  3H1J G;  4ZKP A;  3CMA P;  3RL0 D;  3AE9 C;  2NWF A;  2QPZ A;  3GKE A;  1T3U A;  1JO5 A;  2ZXE B;  5KLV K;  2HMJ A;  1RH5 B;  1O7G A;  3H25 A;  1VF5 D;  1Q90 C;  2XNX A;  4H13 C;  2A06 E;  3G6E P;  3VMG D;  3U59 A;  5KJ7 C;  3SSU A;  1H0T B;  3CXH H;  2FYN C;  3TK1 A;  3HUS A;  2IBZ D;  4MN4 C;  3H1H G;  4JYB A;  4M3L A;  1HJB A;  5L8R J;  3AEG C;  1SFC A;  5AW0 B;  3IF4 A;  3R4Y A;  1BDD A;  2FYU D;  2JJL A;  1ZRT E;  3BCC J;  4WWI A;  2HMK A;  3AZC A;  2XV5 A;  4HM7 A;  3HE5 B;  2KOG A;  1GK6 A;  2I8D A;  3L35 A;  1OW7 A;  3LW5 H;  2ZT9 C;  4OVN F;  3P7K A;  3Q1M A;  1KYO H;  5CJ0 A;  4I6M C;  4PD4 D;  3I55 P;  2POH A;  3L74 G;  2KSE A;  3GZY A;  2P7J A;  2D2C B;  3RL0 C;  2DE5 D;  3S1K A;  4AQR D;  5KJ7 A;  4NBA D;  3HD7 D;  1R8E A;  3H1K D;  4K35 A;  1NJI Q;  3P32 A;  1VF5 C;  4NBD D;  1SQX J;  4OGQ C;  2HYN A;  4BWN A;  1NTK J;  1ULI A;  1LTJ B;  1LGH B;  1J1E B;  1W2E A;  1FAV A;  3FWN A;  3VMI D;  1W2B O;  1T6A A;  2AXC A;  3CCU P;  2I1K A;  3I5C A;  1N7L A;  2IBZ I;  1VCK A;  2BMR A;  2OTJ P;  1L0N G;  2B87 B;  3HE4 B;  4KJM A;  3A0B H;  4L75 A;  3GB4 A;  3L75 G;  1IK9 A;  4LLH A;  3M0D C;  3L71 E;  1R5S A;  2O01 H;  1HBW A;  2WIT A;  1FJP A;  4I2L C;  4EIJ A;  1L0N D;  2LKM A;  2NUM A;  1KMI Z;  1JCC A;  1T2K C;  2P10 A;  5KAI E;  4L73 A;  1QVF O;  1L0L K;  1SQQ J;  2ZAE B;  4GIF A;  1BE3 J;  1EC5 A;  1ULJ A;  5AVQ B;  1LTA C;  1S1C X;  2K1A A;  4PJ0 E;  2YXR B;  1R5L A;  3TYY A;  1MV8 A;  1JMB A;  3HD7 C;  1LNQ A;  1VM9 A;  1OZH A;  1X79 B;  1IFM A;  3L73 G;  2B88 A;  1SQP K;  2PFX A;  2E76 B;  1M57 D;  2QJP B;  1GMJ A;  3L70 E;  5AVY B;  1H89 A;  4RES B;  3M0D A;  3L73 D;  1NTZ J;  2W6B A;  1OVR A;  1VQP P;  1PGJ A;  1PGP A;  2O3J A;  1S5L E;  1ZR4 A;  1PZQ A;  1HVV A;  1NTM E;  1JUN A;  3CX5 D;  4BRY A;  3TGU E;  2QM8 A;  2A45 H;  3VMH D;  2JP3 A;  5APS A;  1U57 A;  1LT9 C;  3ITK A;  3HD7 A;  1Q2N A;  2AXT H;  4WB4 A;  1HGZ A;  3TDK A;  1XTC C;  3RK2 B;  1OW8 A;  2JR8 A;  3KXD A;  3BAT A;  2W6A A;  4HM4 A;  1FZE A;  4WVZ A;  3FXE A;  3MUD C;  2WT7 B;  4GOF A;  1IFD A;  2QJK C;  5AW2 B;  2K3R A;  3H1L D;  2FY8 A;  1PGQ A;  2WPQ A;  1QVG O;  2KIK A;  4N78 E;  1K73 Q;  3SWF A;  1SQV J;  2OYH B;  1A02 F;  3NMD A;  4IL6 H;  2FYU E;  4HYT B;  2QIW A;  2QEX P;  1LT9 A;  2E43 A;  4U3F J;  3O6Q B;  3V2Q A;  3NXS A;  3AE1 C;  1M56 D;  2Z5I A;  3QH9 A;  3P8M C;  1M90 Q;  5E79 E;  3AE8 C;  5GTI E;  2R44 A;  2Y0D A;  3MUD A;  1S3J A;  1IFJ A;  1L2P A;  2WSC H;  1L0L D;  4D6T J;  4JQ0 D;  1FOS E;  1RFS A;  3V2R A;  3D71 A;  1JM0 A;  1Q81 Q;  3BRT B;  4A7P A;  5AW5 B;  4HB1 A;  2BCC J;  1LTT C;  4NPE A;  1SQP D;  4OWF A;  3WUV A;  5GTH H;  5AVZ B;  1IK7 A;  1AA0 A;  2HOD A;  4JBZ A;  1AJY A;  4NB8 D;  2H8P D;  3PRJ A;  4C7R A;  2Q9I A;  2IYO A;  2KS1 A;  3CWB J;  1JCD A;  3L72 D;  1S72 P;  2ZYG A;  1NYH A;  4U7J A;  2KNC B;  3ZDM A;  2YKQ A;  1FS0 E;  4NBE D;  1KYO D;  2A06 D;  5CBN A;  5APY A;  2K88 A;  1KD1 Q;  1NU1 J;  5CCH D;  3VCP A;  4XE5 B;  1LWU B;  2O01 N;  5KLV E;  3SFD C;  2XKM A;  3EWK A;  1NTM K;  2YIU B;  1ZRT D;  4PV1 B;  3HRN A;  4JPZ B;  2XR8 A;  2W90 A;  1DEE G;  3G71 P;  3H1I J;  3M91 A;  4IFD K;  3V4Q A;  3S4R A;  1S2E A;  1SJG A;  1J1D C;  3VMA A;  1PP9 D;  2OYO A;  3FGA D;  1VQK P;  1J2J B;  2E74 D;  1ZR2 A;  1BE3 E;  2IX7 C;  2WQY C;  2JKV A;  2NPS B;  1YIJ P;  1EZV G;  1VQ8 P;  3CPW O;  1ZP0 C;  2OYI C;  2NZ2 A;  2KLV A;  2NRG A;  3LIE A;  2Y0E A;  3V4W A;  2V4H A;  4QDF A;  2JWD A;  1KYO I;  1PFI A;  2ZYL A;  3VOP A;  1RF1 C;  4RKU J;  2YXQ B;  1QL2 A;  5C39 A;  1ZV8 A;  1D7M A;  3RGU A;  1KTM A;  5KLI C;  3Q2Y A;  1Y9B A;  1GU4 A;  3S9O A;  4YTP C;  1Q86 Q;  2QJY C;  2KB7 P;  3H1L E;  1SFC D;  2E75 B;  3A0H H;  2FFD C;  5KKZ C;  1AVO A;  3L71 D;  3VMZ A;  5TIS H;  1X9V A;  1N7S C;  1YYC A;  2WSE H;  1VQN P;  4TLF A;  3RBX A;  5H2F E;  3CCQ P;  3V5B A;  3V6I A;  3T97 A;  2OYI A;  3N0Q A;  2HMN A;  4XA4 A;  4UB6 H;  2AEM A;  4GOE A;  4ASV A;  1YI2 P;  4NBC D;  2E5Y A;  1HTL C;  1SQB J;  1BCC J;  1RF1 A;  2QVA A;  2NVG A;  1X22 A;  3L36 A;  4WY4 D;  1GD2 E;  3L70 G;  5M1B A;  5KJ7 D;  2E74 B;  1YTZ I;  4H0L D;  3NFQ A;  1CZQ A;  1NDO A;  2W8Z A;  3JCU H;  1GK4 A;  1QGK B;  1L0L E;  2W27 A;  1RE4 C;  1FZG A;  1KIL C;  2FFD A;  4UB8 H;  2HFE D;  1NKN A;  1E5W A;  3BRV B;  1N7S A;  3CXH E;  2WSC J;  4EMJ B;  3B5N C;  1LTG C;  1VDF A;  2J59 M;  3A5T A;  1JM1 A;  4XFJ A;  1S4X A;  1MZ9 A;  2R3S A;  1N2D C;  3E7K A;  4AYC A;  3HUS B;  3H1J J;  4IFM A;  5AEU A;  3G3Z A;  1JB0 J;  1NTM D;  2PP6 A;  2ZT9 D;  1SFC B;  1USE A;  3TGU D;  1SQX K;  1NTK K;  1USD A;  1JTH A;  3CCR P;  3CL3 D;  3L72 E;  3RL0 g;  1BGY D;  4RO0 A;  2IBZ G;  1GTW A;  4D6T E;  1O7H A;  1NWQ A;  1KYO E;  4OGQ D;  4I7Z C;  1RE4 A;  2H7H A;  2A45 I;  1KIL A;  1FDM A;  1LTI C;  2NVE A;  4WY4 C;  3H1H J;  1Z56 A;  1RQU A;  2FYU G;  4H13 B;  2M8R A;  3M06 A;  1LP1 A;  3B5N A;  4H0L C;  4CPG A;  3FXD A;  2UWJ E;  3RK3 B;  1IFI A;  2FYN B;  4EDF A;  4N78 D;  1KFN A;  3GZX A;  1OW6 A;  1UII A;  1EQ7 A;  4RJT A;  1SQQ K;  4H44 B;  3PLN A;  5AVT B;  1KV4 A;  3EQQ A;  2BEQ D;  2CPB A;  2V7Q H;  5AVV B;  2WSF H;  1T2K D;  3L74 J;  2HPC A;  2K37 A;  2FXP A;  3H1K G;  3GLM A;  1PP9 E;  1KFM A;  1AQT A;  1NU1 E;  2JZA A;  4WY4 A;  3BVH A;  2IFN A;  1M7L A;  3PH0 A;  4GOD A;  1SS1 A;  5KAF H;  1LJ2 A;  3RL0 B;  1NTZ K;  2LR2 A;  2KZI A;  1CW5 A;  1EDL A;  1AV1 A;  1KIL E;  3AEA C;  1VF5 B;  4YXD C;  3G4S P;  4OGQ B;  3BAS A;  3FWL A;  1L0N J;  3VYI A;  3MP7 B;  2OTL P;  2WPV B;  3L75 J;  2GUS A;  1KB9 H;  2P1J A;  4AAY B;  2KP8 A;  2Q3E A;  1GU5 A;  4LGD E;  3GTE A;  3CCS P;  3CCL P;  4QDC A;  2HR3 A;  3GOB A;  1QX8 A;  2M0B A;  5KLV G;  4KT0 J;  1URQ D;  2P58 A;  5AW6 B;  2XDJ A;  4DZO A;  2WSE J;  2QA4 P;  1JOC A;  3HTK A;  1NTK D;  2FYZ A;  2ZVN B;  1VQL P;  1SP4 A;  1SQV K;  1N73 C;  1G2C A;  2WZ7 A;  4BRY B;  1NGM B;  1FZC C;  3N7N A;  5KLV D;  1IO4 A;  3GMA A;  2M5A A;  2AXT E;  1GDT A;  5AVS B;  3HD7 B;  3IN6 A;  3M0A A;  1G8J B;  1YQ3 C;  2H89 C;  1CI6 A;  3D6Z A;  4YPC A;  2FKW B;  2E76 C;  1QLE D;  4ZNC A;  2L91 A;  2QJP C;  3CC7 P;  2SPZ A;  1AQ5 A;  2YO3 A;  1SQQ D;  2YKO A;  3QWO C;  1BE3 D;  5CCG D;  4HM0 A;  1L4A D;  5AVW B;  4IL6 E;  2QRX A;  2KZJ A;  3W67 A;  4EOT A;  1OVV A;  1N73 A;  3GG2 A;  4R4L A;  1FZC A;  1KC8 Q;  1BGY E;  1URQ C;  3H1L G;  2H88 C;  1LT9 B;  1X0T A;  2K9J A;  1K8A Q;  1ZOY C;  2YVJ B;  3F5H A;  2HG5 D;  2N1T D;  2Q6Q A;  1DD3 A;  4C7N A;  3O8Z A;  4AIV A;  4K3A A;  1HGV A;  3SWY A;  2O1K A;  1FOS F;  1NU1 K;  3MHV A;  3OW2 O;  3V2P A;  2E42 A;  2C0X A;  1BSH A;  3GCE A;  2MJZ A;  2PGD A;  4QUR A;  3N4X A;  1QEX A;  5DJT B;  5GTH E;  3KHU A;  2YNY A;  1L0L G;  2R5D A;  5CCG C;  1URQ A;  4GKG A;  2V7Q J;  1IZN B;  1L4A C;  1FBM A;  4P1C H;  2HOD B;  2WSF J;  3GL0 A;  2I7F A;  3H1H E;  2KS1 B;  4GT1 A;  3G9R A;  2OGU A;  3EFG A;  1EXI A;  1KN7 A;  3H32 A;  2P2U A;  1SQP G;  2YMK A;  1N86 A;  1KZU B;  3M9H A;  1SQV D;  1H8A A;  1VL2 A;  3CXH D;  2G3A A;  5APQ A;  3AE2 C;  2B9B A;  3M9B A;  1HJ0 A;  2N1T C;  2OQQ A;  5APT A;  1NKZ B;  3BCC E;  3L72 G;  2BMQ A;  3JC2 2;  1S9K E;  3AE6 C;  3L74 E;  1AVY A;  5CCG A;  2A06 G;  1MFT A;  1VQ6 P;  4EYY Q;  1L4A A;  2IDB A;  3L4F A;  2JWA A;  4BXL A;  3GTS A;  1NOH A;  2FXM A;  5CJ4 A;  4D6T D;  1YJ9 P;  1OX3 A;  4W80 A;  1YTZ T;  3B4S A;  4KHX A;  1M8O B;  3VMX A;  1T3J A;  2IZ0 A;  2QSI A;  1SQX E;  3TNU A;  4PD4 H;  1NTK E;  1PGO A;  2Q3W A;  1DX7 A;  2BCC D;  2Y9Z A;  1O7W A;  1NH4 A;  1GL2 D;  2ITA A;  5AW9 B;  2B89 A;  2N1T A;  3U1C A;  2YO2 A;  2WTY A;  5AW3 B;  1FDI A;  4QDF B;  1X8Y A;  3KPE A;  3L75 E;  3VP9 A;  3CXH I;  1ZXG A;  3NTN A;  1PP9 G;  1N7S D;  1SQB K;  3CWB D;  2M3E A;  3A7O A;  4PV1 C;  3WU2 E;  3AE7 C;  3A0H E;  5HL4 A;  1ZW0 A;  2IYP A;  3CC2 P;  1SQQ E;  1NU1 D;  5TIS E;  2QE7 H;  1J1D B;  1P84 H;  1M1J C;  4UB6 E;  3PP5 A;  4NBG D;  3T97 B;  2E5T A;  1IFN A;  2OYI B;  1LT1 A;  1RQV A;  4C46 A;  1NHL A;  5B5E E;  4HM6 A;  2YFI A;  1KIL D;  1FZA A;  1Y47 A;  4HJG H;  1EDJ A;  1RF1 B;  3AEF C;  3L71 G;  3B5N D;  1GL2 C;  3MIW A;  5KLI B;  2R32 A;  5BU8 B;  3AED C;  3AE4 C;  3JCU E;  1NTZ E;  2OTK E;  3OJA B;  4N6J A;  1RE3 C;  2QJY B;  1HF9 A;  5AW8 B;  2E4P A;  3CCM P;  5KKZ B;  2A45 G;  4Y99 B;  5CHX A;  1KB9 I;  1OMI A;  1SVF A;  2DW3 A;  2ZVO B;  1M1J A;  1YJN P;  2GBW A;  1LTB C;  2KUB A;  3L70 J;  3C9I A;  1VQO P;  2WSS H;  2WVR A;  2ZYD A;  4HH2 A;  3CX5 H;  2WMM A;  4WBA A;  3D89 A;  1JTH B;  3GF7 A;  3A2A A;  1GL2 A;  1DD4 A;  1OIP A;  1NTM G;  2XZR A;  1SQV E;  1FU1 A;  4W7Z A;  5BU5 A;  1KIL B;  3TGU G;  3E1R A;  3VMY A;  4LC1 A;  2XND H;  1LP1 B;  1PPJ D;  3B5N B;  2W83 C;  1O7P A;  1EZV I;  1O7N A;  1BGY G;  4U3F E;  1SQB D;  3CME P;  1BCC D;  3HUS C;  3K5B A;  2BAS A;  3GL2 A;  1JY2 P;  1IC2 A;  1MKM A;  1UUV A;  5B66 H;  3GHG C;  1WRG A;  1M1K Q;  1TU3 F;  1L0N K;  2YFL A;  2YKP A;  1K9M Q;  1VQM P;  2D2C D;  3CCV P;  4NBF D;  2PAJ A;  3C8V A;  5BOK A;  1FC2 C;  1IJD B;  2FYU J;  3DQY A;  2HPC B;  1YHQ P;  2FXO A;  4I7Z B;  3KZI H;  5KAF E;  3Q3D A;  4WY4 B;  2BCC E;  3H1J D;  2HLO A;  4H0L B;  2JO6 A;  3TSI A;  4HKZ H;  3AE3 C;  5APW A;  1VPC A;  2Q1K A;  1Y8A A;  5BVZ A;  1Q7Y Q;  3RK3 C;  5APX A;  3CWB E;  3H1K J;  4H44 C;  3GHG A;  4GDO A;  1A02 J;  3EQ2 A;  2KYV A;  2M3B A;  1SLQ A;  1KB9 E;  1PL5 A;  5EFW B;  4DOJ A;  1NVO A;  3A0B E;  3RBZ A;  4IFF A;  4DT0 A;  3PTZ A;  3H1H D;  2ZT9 B;  3VN0 A;  1EXJ A;  2LXC B;  3BCC G;  2Q7C A;  3MTU E;  4QUQ A;  4YXW H;  1HH0 A;  2D2C C;  5APV A;  2R5B A;  1OFC X;  4ASW A;  1H0T A;  1KQG B;  4NPD A;  4HM8 A;  4ZMD A;  2MKV A;  3HTK B;  2RKL A;  3I56 P;  3BCC D;  5AEW A;  2E76 D;  2I1J A;  1G2C B;  1S9K D;  1LTJ C;  3H1I E;  1J1E C;  3L74 D;  4NBH D;  1EDI A;  2HMM A;  2M5A B;  4B86 A;  3ABV C;  1EZV E;  5AVU B;  3HE5 A;  1DH3 A;  1SQX G;  1NTK G;  5KLV J;  1CI6 B;  3GW6 A;  2PRR A;  3IR9 A;  1VQ4 P;  3EFF K;  5KTB A;  4QCK A;  1RIE A;  1IFP A;  2XSO A;  1T8Z A;  3OA7 A;  1MFZ A;  3V2N A;  4DJG A;  2GM4 A;  5AVX B;  1SQX D;  1P84 D;  1YQ4 C;  3L73 J;  2C0W A;  2HML A;  3CD6 P;  3H6P A;  1JY2 O;  2Q3I A;  4N3Y B;  3RK2 D;  3B8E B;  1N73 B;  5DJU B;  2QM7 A;  1LTJ A;  3L75 D;  1FQT A;  1RY3 A;  2RN0 A;  1FZC B;  4PD4 I;  1G8K B;  1SQQ G;  1BE3 G;  2K9J B;  2N9B A;  3P8C E;  2AEJ A;  2IFM A;  2KLU A;  2RH0 A;  2L5G B;  3RK3 E;  1VQ9 P;  1OWA A;  3A3Y B;  3MGN A;  4TT3 H;  2B87 A;  3HE4 A;  4C7N B;  4W7Y A;  1ZN5 A;  2Y9Y A;  2ZFC A;  1HUC A;  1PPJ E;  1U7J A;  4QUP A;  2Q5U A;  2KSJ A;  3CC4 P;  1K04 A;  3TF5 A;  1SQB E;  1BCC E;  2RMZ A;  3M9Q A;  2B1X A;  3H1L J;  3CI9 A;  5KAI H;  1U7M A;  1NTZ G;  1NAF A;  3SWK A;  1UIX A;  1P84 I;  3GF3 A;  4JYC A;  1URQ B;  3L37 A;  4PJ0 H;  3LID A;  3UIA A;  4ZKU A;  3RK2 C;  1NTZ D;  1LTS C;  1JEK A;  1FZB A;  2QJK B;  1VQ5 P;  1WQL A;  3H1J E;  3WUT A;  2C9N Y;  3H32 B;  3AE5 C;  2FBW C;  2CKF A;  1S5L X;  4NBB D;  4L76 A;  1MUU A;  2KI7 B;  2Y0C A;  1AFO A;  2IPP A;  1L0L J;  1HWT C;  2IBZ E;  4IL6 X;  2OYH C;  1UUW A;  1NAY A;  1S5L H;  1GW4 A;  2BMO A;  2LXB A;  3SFE C;  1N8R Q;  1FE6 A;  2E4Q A;  1GW3 A;  1SQV G;  1XTG B;  1L4A B;  4HM5 A;  1G1J A;  1SQP J;  5CMZ A;  1VQ7 P;  3VCA A;  3D70 A;  1FZF A;  3USS A;  5CXM A;  2CK3 H;  2XSH A;  3WMM 0;  1EDK A;  3CX5 I;  2WT7 A;  4U3F G;  3B71 A;  4O9B A;  4PD4 E;  3L72 J;  1KQF B;  4HJL A; 
#chains in the Genus database with same CATH homology
 1RQU A;  4H13 B;  3AEF C;  1NYK A;  4H0L C;  3LW5 J;  1VM9 A;  4PV1 D;  3AED C;  3AE4 C;  1NTZ E;  3H1K E;  3GZX A;  1OW6 A;  2E76 B;  1ZME C;  4H44 B;  1DIP A;  1HF9 A;  1GMJ A;  2DE6 D;  4HKV A;  3EQQ A;  2E4P A;  2BEQ D;  3L70 E;  2G8Y A;  3Q5S A;  3O6Q A;  1OMI A;  4R4M A;  4HM3 A;  2FXP A;  2K9Y A;  2GBW A;  3GLM A;  1NTM E;  1PP9 E;  1NU1 E;  2JZA A;  3TGU E;  1P84 E;  3AEC C;  3VMH D;  2B24 A;  3D89 A;  4Y28 J;  2JP3 A;  3D6Y A;  1U57 A;  3GF7 A;  2GBX A;  1L0N E;  1DD4 A;  1OW8 A;  2O01 J;  1WMK A;  4HM4 A;  1KIL E;  3AEA C;  1VF5 B;  4YXD C;  1SQV E;  4OGQ B;  1KOR A;  3FOU A;  2QJK C;  2E75 D;  2YIU C;  2WPV B;  2HMO A;  1O7P A;  1O7N A;  1PIX A;  4U3F E;  4AAY B;  3GL2 A;  3GTE A;  2FYU E;  1MKM A;  1UUV A;  2BEZ F;  4QDC A;  3GOB A;  1TU3 F;  3L73 E;  2QIW A;  2YFL A;  4KT0 J;  3AE1 C;  2D2C D;  4NBF D;  3C8V A;  5BOK A;  2WSE J;  3DQY A;  3AE8 C;  1FDO A;  1O7M A;  3IAO A;  3CX5 E;  4I7Z B;  2DE7 D;  1NGM B;  2NUK A;  2YFJ A;  3GMA A;  3Q3D A;  4HM2 A;  1RFS A;  2BCC E;  3D71 A;  3EN1 A;  4H0L B;  2JO6 A;  3AE3 C;  3IN6 A;  4QDD A;  1G8J B;  1YQ3 C;  1PV3 A;  2H89 C;  3D6Z A;  1K05 A;  2E75 C;  2E76 C;  3AEE C;  3CWB E;  4H44 C;  2QJP C;  4GDO A;  3Q5P A;  1KB9 E;  1IK7 A;  1PL5 A;  4HM0 A;  1AJY A;  4NB8 D;  3Q5R A;  2ZT9 B;  4P1B H;  1NYH A;  1EXJ A;  4U7J A;  4R4L A;  4QUQ A;  4NBE D;  2J5U A;  2D2C C;  2H88 C;  4Z1M H;  1Q90 D;  4H13 D;  2E74 C;  1ZOY C;  4HM1 A;  2YVJ B;  1KQG B;  3VCP A;  1EG9 A;  4HM8 A;  3C0D A;  2XRX A;  2MKV A;  5AEW A;  1DD3 A;  2E76 D;  4AIV A;  4H44 D;  5KLV E;  3H1I E;  4NB9 D;  3SFD C;  4NBH D;  2HMM A;  3EWK A;  4PV1 B;  3ABV C;  1EZV E;  2JO1 A;  2XR8 A;  3GCE A;  3AEB C;  4QUR A;  4QCK A;  1RIE A;  1SQP E;  1SJG A;  2XSO A;  2NVF A;  3FGA D;  2V7Q J;  2E74 D;  1YQ4 C;  1BE3 E;  4P1C H;  2WQY C;  2NWF A;  3AE9 C;  2WSF J;  1ZP0 C;  2HML A;  3GL0 A;  2NZ2 A;  2I7F A;  2QPZ A;  3H1H E;  3GKE A;  3G9R A;  1EXI A;  2HMJ A;  4QDF A;  2ZYL A;  1O7G A;  1FQT A;  2YMK A;  3H25 A;  1VF5 D;  1Q90 C;  4H13 C;  4RKU J;  1G8K B;  2A06 E;  1VL2 A;  1KTM A;  5KLI C;  2G3A A;  3Q2Y A;  3VMG D;  1Y9B A;  3S9O A;  3AE2 C;  2FYN C;  3RK3 E;  4YTP C;  1HJ0 A;  2OQQ A;  3BCC E;  2BMQ A;  4TT3 H;  2QJY C;  3H1L E;  5L8R J;  2E75 B;  3AEG C;  1PPJ E;  3R4Y A;  3AE6 C;  5KKZ C;  3L74 E;  4QUP A;  1K04 A;  1ZRT E;  1SQB E;  1BCC E;  2HMK A;  2B1X A;  2IDB A;  3AZC A;  4HM7 A;  3GTS A;  3N0Q A;  2HMN A;  1OW7 A;  2ZT9 C;  4NBC D;  3Q1M A;  1UIX A;  3GF3 A;  2QSI A;  3GZY A;  1SQX E;  2NVG A;  2D2C B;  1NTK E;  2DE5 D;  2Q3W A;  5M1B A;  2E74 B;  1O7W A;  4H0L D;  4NBA D;  1R8E A;  1NDO A;  1L0L E;  1FDI A;  1WQL A;  1VF5 C;  3H1J E;  4NBD D;  4QDF B;  4OGQ C;  3L75 E;  3AE5 C;  1ULI A;  2FBW C;  3VMI D;  2CKF A;  1S5L X;  4NBB D;  3CXH E;  2WSC J;  4EMJ B;  1JM1 A;  4XFJ A;  1VCK A;  2BMR A;  4PV1 C;  2IBZ E;  4IL6 X;  5AEU A;  1JB0 J;  1UUW A;  3AE7 C;  5HL4 A;  2BMO A;  2ZT9 D;  3GB4 A;  1SQQ E;  3SFE C;  2E4Q A;  3L71 E;  4HM5 A;  3L72 E;  3RL0 g;  3VCA A;  2NUM A;  1KMI Z;  3D70 A;  2P10 A;  4NBG D;  3T97 B;  5CXM A;  1RQV A;  2XSH A;  4HM6 A;  1O7H A;  2YFI A;  1ULJ A;  1KYO E;  4OGQ D;  4I7Z C;  1S1C X;  2NVE A;  3B71 A;  4PD4 E;  1KQF B;  4HJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...