2QJYC

Crystal structure of rhodobacter sphaeroides double mutant with stigmatellin and uq2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCSPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed Structures of the Cytochrome bc1 from the Photosynthetic Bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 55
structure length 179
sequence length 179
chains with identical sequence F, I, L, O, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2007-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qjyC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qjyC02
3LW5J 3GTEA 2HMKA 2JO6A 5AEWA 3GKEA 2HMJA 2B24A 2NUKA 2E75B 4QCKA 1PP9E 1O7WA 2E76B 2JZAA 1VCKA 4EMJB 1O7HA 1UUWA 2GBXA 1O7NA 1SQQE 3GZXA 4NBAD 1EG9A 4HM5A 2BCCE 3GCEA 1SJGA 1WQLA 3CX5E 4HM2A 4IL6X 2YFJA 2FYNC 2IBZE 2XSHA 2FYUE 1RIEA 2NWFA 3GL0A 3GTSA 4OGQB 3L71E 2YIUC 3VMGD 4OGQD 4NBED 4QDFA 2QJYC 4QDCA 2A06E 1RFSA 3N0QA 1SQBE 3GZYA 4H13D 4HM4A 2BMRA 2DE6D 2ZYLA 4QURA 1SQPE 2YFLA 1L0LE 4P1BH 2E75D 1KYOE 4HM7A 4RKUJ 2E76D 4AIVA 3C0DA 3L70E 2E4QA 3VCAA 4HM8A 2O01J 4KT0J 2NUMA 2E74B 1BCCE 2WSEJ 4PV1B 2QJKC 1G8KB 2E74D 1ULJA 2BMOA 4NB9D 1O7PA 1PPJE 1O7GA 4Y28J 2Q3WA 4NB8D 4HJLA 2D2CB 2HMOA 3EQQA 2D2CD 4HKVA 3CXHE 3AZCA 2ZT9B 5KLVE 1ULIA 4NBGD 4PD4E 4QDDA 2QJPC 2ZT9D 4HM1A 1VF5B 2DE5D 1VF5D 2WPVB 3DQYA 2YVJB 2GBWA 2QSIA 3EN1A 4HM6A 3GB4A 2NVGA 2XSOA 4QUPA 3GL2A 3H1LE 2QPZA 4NBCD 1KB9E 4NBDD 3H1KE 4I7ZB 1JM1A 3L73E 4QUQA 3H1IE 1VM9A 5HL4A 3VMHD 3L74E 4NBHD 1L0NE 4U3FE 4HM0A 3L72E 4PV1D 2E4PA 2NVEA 4NBFD 2QIWA 1FQTA 3FOUA 3C8VA 5KLIC 1SQXE 4H44B 4P1CH 2I7FA 1JB0J 1NTME 3BCCE 4H44D 4NBBD 2HMLA 1O7MA 1Q90C 1NDOA 2CKFA 1NTKE 1SQVE 1NYKA 2DE7D 5CXMA 5L8RJ 1EZVE 5AEUA 4HM3A 2XR8A 3VMID 2HMMA 2BMQA 3H1HE 2K9YA 1NTZE 5BOKA 3D89A 2NVFA 3CWBE 2HMNA 3GOBA 5KKZC 2B1XA 1S5LX 1UUVA 1Q90D 4QDFB 1ZRTE 3TGUE 1NU1E 4H0LB 2WSCJ 1P84E 3H1JE 4H0LD 1BE3E 3VCPA 1G8JB 4AAYB 2YFIA 2XRXA 2WSFJ 4H13B 3L75E
chains in the Genus database with same CATH superfamily
3I5CA 2C0WA 1QVFO 1LTGC 2JO6A 5AEWA 2WITA 3A0HE 3GZXA 2YMYA 2B89A 2HODA 1KILD 3G4SP 2FYUE 2OARA 2N1TA 2KXPB 4O9BA 5AW9B 1RQVA 2ZJSE 3A5TA 1H0TA 3TF5A 4ZKPA 4AIVA 4NPDA 1LTIC 1JCDA 2E4QA 2ZYGA 3CWBJ 1J1EC 5GTHE 1BCCE 2WSEH 4YXWH 4YPCA 2YO2A 3L73D 2KLUA 4PJ0E 1KMIZ 3L75G 3R2PA 1CZQA 2CK3H 2I1JA 2KYVA 2YO3A 1IK9A 1NTMD 1SQQG 3KZIH 2J5UA 3M9QA 1IZNB 1DEBA 1GL2B 1GL2A 3CLQA 2W6AA 1LP1A 3CC2P 3MUDC 3RK2D 4JPZB 1YJ9P 2HMMA 4IFMA 3B5NA 3CWBE 2Q1KA 3AE1C 1BGYE 1NU1E 3H1JE 4AAYB 2IPPA 2LXBA 1BSHA 4OVNF 2E75B 3NXSA 1HUCA 3HD7C 2E76B 2OTKE 4HM5A 3VN0A 3MD0A 4HM2A 2M5AB 4JQ0D 3EQ2A 2IFNA 3USSA 4ASVA 4LLHA 1OWAA 4HM4A 3PP5A 2DE6D 1YQ3C 2LKMA 3TNUA 3L36A 1PFIA 3I55P 3A0BH 2CPBA 2PFXA 2KOGA 3H1KJ 1WMKA 1U57A 2E74B 1L0LD 1JMBA 1KFMA 1CW5A 3FXEA 4QMAA 3U1AA 5KAFH 1RE3C 1SFCD 2AEMA 2QSIA 3EN1A 4HM6A 2FBWC 5AW6B 4NBCD 2VRSA 3CD6P 1IFPA 2ZYDA 1EZVI 1X79B 2Z5IA 1FZBA 1SQVD 4PV1D 1LJ2A 5BU8B 3CX5H 1PPJG 1VQ7P 4EDFA 3PJSK 1SVFA 2FXOA 2K3RA 2NPSD 1BE3D 2O1JA 2BMQA 3H1KG 1ZRTE 1PZQA 1GTWA 1W2BO 3K5BA 3F5HA 3CL3D 3O6QB 3RBXA 2M8RA 1OW7A 2A45I 1MV8A 4WY4B 2RH0A 4EMJB 1O7HA 4WY4A 3EFGA 1AQTA 3G9RA 2BCCE 1FZGA 3E1IA 4N6JA 1G1JA 4IL6X 2E75C 2XSHA 4W7ZA 2E76C 5KAIH 1UIXA 4OGQB 1FU1A 2QG4A 4NBED 1PIXA 2QE7H 3HE4B 1GW4A 1KILE 1HGVA 3KQGA 1KQGB 1GMJA 2LR2A 3VCAA 1JO5A 2XKMA 4XFJA 3G71P 5BVZA 4Y28J 1S72P 2LXCB 1H89A 3H25A 2FYUK 2P7JA 3HE5B 1Q81Q 2E74C 3L74D 4U7JA 5B66H 1YTZI 2QPZA 4H44C 3RBZA 3VMZA 1IK7A 1EXIA 1NTZJ 3L73E 2K1AA 5CCGD 3VMHD 1JCCA 1L0NE 1VQKP 2ZXEB 2E4PA 3WUTA 3FOUA 2B9BA 1NTME 2E5TA 3CCUP 1QVGO 1NTKE 3QWOC 1QX8A 5AEUA 1KILB 4RJTA 2WT7A 4ASWA 1ZLLA 2N9YB 2MKVA 1UUVA 5GTIH 2HR3A 3L71J 3BRTB 5APQA 5E79E 1L0LJ 1VCKA 2A06D 4Z1MH 1SQBD 5APTA 3CCRP 1OIPA 2NWFA 4R4MA 3EFFK 4D6TG 1NU1K 2GUVA 1HBWA 2QRXA 1SQVJ 2ZVNB 4WVZA 5TJHA 1Y8AA 5KLVD 3HUSB 3AE8C 3HUSA 4L74A 2IBZG 1VQ4P 1OVVA 1BE3J 2ZT9B 3PTZA 3CC4P 2WPVB 3PH0A 5AW7B 2YVJB 2GBWA 1BCCD 3RK2B 1SP4A 1XTCC 1VDFA 1URQA 2IYOA 3B5ND 3JCUE 3H1HJ 2WZ7A 3A0HH 2YXQB 1AV1A 1HTLC 4NBHD 1S9KD 1YITP 4NBFD 3CMEP 1KQLA 1SQXE 2WSCH 3BCCE 3TK1A 4W7YA 2HYNA 1AJYA 1GZLA 1SQVE 1T2KD 1W2EA 4IL6E 3WU2E 1EDLA 3D89A 2BEZF 3GOBA 1CI6B 1LTBC 1M1JA 2H88C 4M3LA 5AVTB 5GTHH 2WPRA 1BE3E 3CI9A 1SQQD 4GODA 1KILC 4GIFA 2C9LY 1JNMA 1FOSF 2FYNB 3IN6A 2IFMA 4PJ0H 1BGYD 2B88A 5AVYB 3L70J 1WQLA 3L74J 4U3FG 3VMGD 2QM7A 4QDFA 5DJTB 3TYYA 1FJPA 2W90A 1SFCB 1U7MA 3RK3E 3A3YB 2OGUA 2Q3IA 4C7RA 3CXHD 1M1KQ 2P67A 4Y99C 3H1IJ 2NUMA 4PV1B 5KJ7D 2O3JA 1VQ5P 2D2CB 1AA0A 3ABVC 4HM1A 1IC2A 5AW2B 2DE5D 2NPSB 3PLNA 1QLED 3V6IA 3CCQP 3L74E 3L72E 3RK2C 1DD4A 3TGUJ 5APYA 2RN0A 3SFDC 2ZAEB 3C8VA 4P1CH 1OW8A 3T97B 3NTNA 4HH2A 1P84D 4RESB 1PGPA 1M57D 3H1IG 2FYUJ 2WSCJ 1JEKA 2OTJP 1IFMA 3GHGB 1D7MA 2KZIA 3MUDA 4NPEA 1RE4C 4JF7A 1RF1B 1TU3F 1NTMK 5AVVB 1H8AA 5B5EE 1LTTC 1FDMA 1EZVG 2W8ZA 3RL0g 3V4QA 4IOIH 1SQPD 3VYIA 1BCCJ 2FYNC 3GL0A 1KYOD 3HD7A 3CCLP 2A06E 3N0QA 1SQBE 2G3AA 2BMRA 2BCCD 2NZ2A 3Q5PA 3FWLA 4P1BH 1VQPP 4EYYQ 1ZP0C 3U59A 2K9JB 3AE3C 1ZW0A 5DJUB 4YTPC 1SFCC 4I1LA 3TSIA 1ULJA 2BMOA 1NTZK 1RY3A 2FYUG 3Q2YA 5KLVE 5AVUB 1YIJP 1KV4A 2A45G 4PV1C 2XSOA 3RL0D 2D2CC 2K37A 2E42A 1LTJB 2KK7A 3BVHA 2NPSC 1FZEA 1Y9BA 1YI2P 1BGYJ 1NU1J 1RE3A 3H1JJ 3KHUA 3M0DC 4JYBA 1S9KE 5KKZB 1L0ND 3LIDA 1NYKA 1NKZB 5CXMA 4HM3A 1PV3A 1L0LK 1AQ5A 2B87B 3KXDA 2Q3EA 1PP9D 3V4WA 1NTKD 3GW6A 3D71A 1YJNP 3L75E 1VQLP 4UB6E 2SPZA 1RQUA 3GHGC 1SQQE 4NBAD 1SQVK 2J59M 5CHXA 1OW6A 1SJGA 5CBNA 3CWBG 1RF1C 2YFJA 2OQQA 3GTSA 4EIJA 5K5GB 3H1JG 5APUA 5BU5A 1VL2A 4QURA 2ZVOB 3FWNA 1QEXA 4WWIA 2PAJA 2JJLA 4L73A 3C0DA 4B86A 3GG2A 1RF0C 3CCJP 1G8KB 4NB8D 3H1LD 3CXHE 2M5AA 1NWQA 2E5YA 5CCGC 3P7KA 3I56P 1FE6A 3Q5SA 1KN7A 2QA4P 5E79H 4DCKA 2ZFCA 1BSNA 1JY2N 1N2DC 3MHVA 3AEAC 2OYOA 3S1KA 1IFNA 1N7SD 1JOCA 1FQTA 4H44B 4HKZH 5AW1B 1SQPJ 1LTJC 1BDCA 1G2CB 3WUVA 2FXMA 1MFZA 3WUUA 1USDA 2FFDB 2Q9IA 1SQXD 3BCCD 2BCCJ 1M8OB 2KSEA 5KKZC 2I8DA 1P84E 1GK4A 1L4AD 3H32B 3IR9A 2NUKA 3N7NA 2YIUB 3W68A 2JR8A 1FAVA 1JTHB 5CCHD 3JCUH 1M90Q 3V2PA 4OWFA 5CMZA 3O6QA 4N3YB 1SQPE 1OX3A 2PRRA 2MJZA 1KYOE 4RKUJ 1Q86Q 4IL6H 2JWAA 4PD4D 3WU2H 1LTAC 2K88A 3L73J 4R4LA 1L0NJ 1M56D 3RK3D 1O7GA 2HMOA 1KB9D 1G1IA 1VF5B 1NTMJ 4W80A 1OZHA 3HE4A 4EI2A 1NTKJ 2NVGA 1SQBK 2HPCB 2Y0CA 2Q6QA 3AEEC 2HPCA 1PL5A 1ZMEC 1T2KC 2XU6A 1VQNP 1YBKA 5AVRB 1WT6A 2QIWA 2P1JA 4NBBD 2QEXP 1JY2P 5KLVK 1NDOA 3CCVP 2NRGA 3HE5A 2PGDA 3LW5H 1VQMP 3CCMP 2JDIH 3L72D 1OFCX 2RMZA 2I1KA 2JP3A 3AECC 2C9NY 2E43A 1N7LA 1MKMA 3L73G 1JUNA 1JY3N 4H0LB 3BRVB 2FFDC 3HTKB 3HTKA 3M91A 1MZ9A 1NTMG 3GKEA 1HVVA 4DZOA 1PP9E 2AEJA 1EG9A 3FGAD 4UB8E 3D6ZA 1KILA 1MUUA 1VQ6P 2O01H 2N1TD 2YIUC 2QJYC 5KJ7C 3CXHI 4ZMDA 3RL0B 1IFDA 3GF7A 2QM8A 1GW3A 1KC8Q 1SQQK 1NTZG 1DD3A 4NB9D 1LGHB 4HJLA 4NBGD 1SQXJ 3BCCJ 4Y99B 2JO1A 3U1CA 1FS0E 3GB4A 1GU4A 1AVYA 3UIAA 3CMAP 3H1LE 1H88A 4HJGH 5B5EH 1VF5C 2H89C 2IZ0A 4D6TE 1GL2D 3CC7P 1P84I 3L71G 4GOEA 2HMLA 4AQRD 1W5CE 3M06A 1EXJA 2OYHC 1L0LG 1PGJA 5L8RJ 1KQSO 1N86A 1LWUC 4BRYB 1X0TA 5APVA 5AVWB 2GM4A 1SS1A 4EOTA 1T3UA 2W27A 2IYPA 2KIKA 1HJBA 3LW5J 3CPWO 2HMKA 2YNYA 1NAFA 2B24A 1JY2O 4H0LC 1SQVG 1JY3P 1KYOI 2R3SA 2O1KA 3L75D 2IX7C 1RE4A 2FXPA 1DEEG 2C0XA 1CI6A 1UIIA 2O01N 1BE3G 2PP6A 4YXDC 3II6A 3M0AA 3OAKA 3W67A 3KPEA 3V5BA 4JBZA 2O01J 1Q82Q 3H1HG 2P10A 2E74D 4DOJA 3MIWA 3SWFA 1LNQA 3RL0C 2WPQA 3L72J 1KQFB 5AVQB 4C7NB 5APWA 1ULIA 4PD4E 1ZR2A 1VPCA 4UB6H 2Q5UA 1Q2NA 3VMXA 1SFCA 3AE7C 2YXRB 1SQPK 2POHA 1KB9E 1M7LA 1FOSE 3IAOA 4U3FE 2WMMA 3R4YA 2FKWB 4HM0A 2AXTE 2NVEA 1L4AB 3GF3A 1JB0J 3MP7B 2Y0EA 1LT9C 3ZDMA 4AUWA 5AW8B 1GDTA 3SFEC 2NPSA 3A7OA 3NFQA 1NKNA 3L70G 3M0DA 1S5LX 1NGMB 3L74G 2OYIB 1VQ9P 5M1BA 3VCPA 1G8JB 3CXHH 1SQBJ 1ZR4A 1JM0A 2KZJA 2JWDA 2HMJA 2AEFA 3T97A 2JZAA 4WY4D 4HB1A 1O7NA 2BEQD 4I6MC 3RK3B 2DW3A 4OGQD 1EC5A 4LGDE 1YQ4C 5KLVJ 1RFSA 1L0NK 2W6JH 3L35A 3GHGA 4H13D 3GZYA 2R32A 2QJKB 2Q7CA 1PPJD 1NAYA 1RF1A 1LT1A 4TLFA 1MFTA 3ITKA 2QJPB 5AW0B 1NTKK 1JY3O 1Y47A 1PGQA 5TISE 2OTLP 1E5WA 1S4XA 3D6YA 3TGUG 3AZCA 2YKQA 2H43A 1P84H 1FDOA 3H1KD 3WMM0 1N7SC 3AE9C 1RF0A 2WPSA 3D70A 4N78E 2WTYA 2K9JA 5CCGA 3KDPB 1HH0A 2KP8A 5KLIC 3L37A 1R5SA 5KLVG 3L75J 2M3EA 4I2LC 5H2FE 1L4AC 5CJ0A 2HODB 1SQQJ 1FZCC 2XR8A 1KYOH 2NVFA 3OW2O 1ZOYC 2N1TB 1Q90D 1BCCG 1K05A 1LTJA 5CCHC 1FZFA 1H0TB 3S4RA 2IDBA 2OYIC 1KFNA 1KZUB 2GBXA 1S3JA 3A2AA 3IF4A 1WRGA 3H6PA 1T8ZA 2GA1A 3VOPA 2B87A 3CCEP 2XDJA 3E7KA 4GDOA 3G6EP 4PD4I 3RK3C 2M0BA 1SQXK 3NMDA 3MGNA 2ZXXA 1KB9I 4K35A 4CPGA 2KI7B 5AVSB 2KSJA 2QJKC 3P8MC 3AEDC 1ZXGA 1BGYG 1NU1G 2QJPC 2ZT9D 4LC1A 1LP1B 1FJKA 1S5LE 3GL2A 3B5NB 1URQD 2WSSH 4QUQA 1IJDB 1EDJA 1DH3A 1S1CX 1K9MQ 2FYZA 4UB8H 3JC22 1AVOA 1NTZD 3JSVC 4D6TD 1OXZA 2KB7P 3SWKA 3VMID 5AW3B 2K9YA 2YKPA 1N8RQ 3E1RA 2H7HA 2Y0DA 2N9BA 4OH8B 5KTBA 3O8ZA 2IZ1A 3TNUB 3CX5D 2IBZD 2N1TC 1ZN5A 1DIPA 1O7WA 3MZWB 3AEFC 3L71D 3BASA 1G2CA 4IFDK 3SWYA 2FFDA 4K3AA 2Z5HA 1VQOP 3S9OA 4L76A 4DJGA 4DT0A 1ZV8A 1X9VA 2XNDH 1OVRA 3H32A 2P58A 4XA4A 1DX7A 1GD2E 1HGZA 2QJYB 1JTHA 4L75A 2WSEJ 5KJ7A 1O7PA 1PPJE 2Q3WA 2D2CD 2W6BA 2JKVA 3DQYA 1T3JA 3VMAA 1T6AA 1SLQA 1SQPG 1GL2C 4QUPA 1JMMA 1KD1Q 1FC2C 1NJIQ 3Q5RA 2YKOA 3H1KE 1R8EA 2KS1B 1JM1A 3VMYA 1VM9A 2KS1A 4KHXA 2BCCG 3V2QA 1NVOA 3RGUA 1S2EA 2R5DA 2Y9YA 2V7QH 3B5NC 3GMAA 1J2JB 3H1HD 1Z56A 1O7MA 3Q1MA 1YYCA 4U3FD 1PP9J 5APXA 3VTPC 3QH9A 5BOKA 4HYTB 1OMIA 3AE5C 2B1XA 2OYHB 2OYHA 1A02J 2HG5D 2WVRA 4H13B 1LWUB 2GUSA 4PD4H 1LWUA 1EQ7A 3M9BA 3KZIE 3P32A 1KB9H 2AXCA 1K04A 1RIEA 1L0NG 3HD7D 4QDCA 1HJ0A 2AXTH 5AW4B 3L70D 2YFLA 3M9HA 2V4HA 3FXDA 2Z4EA 4BWNA 1PP9G 1NTKG 1A02F 3H1LJ 4TT3H 4HM8A 1USEA 2XNXA 1FBMA 2J58A 4D6TJ 3EQQA 3Q3DA 4HKVA 2FY8A 1N73B 1N73A 3PRJA 2ITAA 3H1ID 3F89A 3P8CD 3V2NA 2WT7B 2R5BA 5HL4A 1KTMA 1NHLA 1FDIA 1X8YA 3BATA 2ZYAA 3IFMA 1EZVD 4WBAA 1AFOA 4N78D 3OA7A 2BASA 3N4XA 3AE4C 3A0BE 3TGUD 1NOHA 4GOFA 3H1LG 1NTZE 4C46A 1LT9B 1YTZT 3FX0A 1LT9A 4WY4C 1J1DB 2V7QJ 1XTGB 5TISH 1PGOA 2L5GB 5AVXB 1HF9A 2YFIA 5KAFE 2XRXA 2JEEA 3GLMA 1QGKB 4ZKUA 1YHQP 4OGQC 2FYUD 3CCSP 3VP9A 2KUBA 4H13C 4BRYA 2YMKA 2CPSA 3CX5E 2IBZE 5AVZB 3L71E 1SQXG 3AE6C 3PHLA 2ZYLA 3BCCG 1L0LE 4A7PA 3B71A 1URQB 2E75D 4HM7A 2E76D 1K73Q 5H2FH 4GKGA 4AYCA 5C39A 4U3FJ 1OVUA 1EDKA 4QDDA 2A45H 1IO4A 3TDKA 2H8PD 2G8YA 3B4SA 2Y9ZA 2HLOA 1GU5A 4JYCA 1N73C 4NBDD 4I7ZB 1M1JB 5KAIE 1K8AQ 1N7SB 3KYQA 1N7SA 2I7FA 4H44D 4C7NA 1FZAA 2WSFH 3CWBD 3LIEA 1Q7YQ 1Q90C 1KORA 2DE7D 3C9IA 2KNCB 1NU1D 3H1JD 2KNCA 3H1HE 5KLIB 2P2UA 2HMNA 2W83C 1U7JA 4QDFB 2WQYC 4WB4A 1BDDA 1QL2A 1L4AA 1FZCB 2QVAA 2R44A 5B66E 3GTEA 1FZCA 5CJ4A 4QCKA 1J1DC 1QL1A 3MTUE 4NPFX 1CSBA 1UUWA 1S5LH 5CCHA 3GCEA 2XV5A 1HWTC 2XZRA 3OJAB 4XE5B 3L72G 2OYIA 1J1EB 3HUSC 1R5LA 2L91A 3HRNA 3B8EB 3AEBC 1EDIA 2ZT9C 4IFFA 3C1LA 5AW5B 3L70E 4KT0J 5GTIE 4ZNCA 1VQ8P 1URQC 1GK6A 1NH4A 1IFIA 1VF5D 1E79H 3G3ZA 3AEGC 1YJWP 4GT1A 2WWWA 3H1IE 1X22A 3P8CE 3L4FA 4KJMA 4I7ZC 1M1JC 2A06G 2RKLA 4BXLA 2KLVA 1SQBG 2CKFA 2R3CA 1ZRTD 3VP8A 1RHZB 1L2PA 1EZVE 3EWKA 2HFED 3AE2C 5EFWB 1RH5B 4MN4C 4RO0A 3V2RA 3SSUA 3HD7B 3TGUE 5APSA 1NYHA 3CX5I 1NO4A 4H0LD 2IBZI 5CBOA 1IFJA 2UWJE 2WSFJ 2M3BA 1LTSC
chains in the Genus database with same CATH topology
5AEWA 2JO6A 3GKEA 3IN6A 1PP9E 1DIPA 1O7WA 3AEFC 3GZXA 1EG9A 3FGAD 3D6ZA 1WQLA 3S9OA 2FYUE 2YIUC 3VMGD 4QDFA 2QJYC 1RQVA 3RK3E 3GF7A 4AIVA 2E4QA 2NUMA 1BCCE 2WSEJ 4PV1B 1DD3A 4NB9D 1O7PA 1PPJE 2Q3WA 4HJLA 2D2CB 2D2CD 4NBGD 3ABVC 4HM1A 2DE5D 2JO1A 3DQYA 1KMIZ 3GB4A 4QUPA 3H1LE 3Q5RA 3H1KE 1VF5C 1R8EA 2H89C 1JM1A 1VM9A 2J5UA 3L74E 3L72E 1DD4A 3SFDC 3C8VA 4P1CH 3GMAA 1OW8A 3T97B 2HMLA 1O7MA 3Q1MA 1EXJA 5L8RJ 2HMMA 5BOKA 1OMIA 3CWBE 3AE5C 2B1XA 3AE1C 1NU1E 2WSCJ 3H1JE 4AAYB 4H13B 3LW5J 2HMKA 2B24A 2E75B 1TU3F 2E76B 4H0LC 4HM5A 3RL0g 1K04A 4HM2A 2FYNC 2FXPA 1RIEA 3GL0A 4QDCA 1HJ0A 2A06E 3N0QA 1SQBE 2G3AA 4HM4A 2BMRA 2NZ2A 2DE6D 4YXDC 2YFLA 1YQ3C 3Q5PA 4P1BH 1ZP0C 4TT3H 3AE3C 1WMKA 4HM8A 2O01J 4YTPC 1U57A 2E74B 2P10A 2E74D 1ULJA 2BMOA 1KQFB 3Q2YA 3EQQA 3Q3DA 4HKVA 5KLVE 1ULIA 4PD4E 4PV1C 2QSIA 3EN1A 4HM6A 2FBWC 3AE7C 2XSOA 2D2CC 4NBCD 1KB9E 5HL4A 1KTMA 3IAOA 3R4YA 1FDIA 4U3FE 4HM0A 4PV1D 1Y9BA 2NVEA 3GF3A 1JB0J 3AE4C 1NYKA 5CXMA 3SFEC 1PV3A 4HM3A 2BMQA 1NTZE 1S5LX 2V7QJ 1NGMB 1ZRTE 3D71A 5M1BA 3VCPA 1G8JB 1HF9A 2YFIA 2XRXA 3L75E 1OW7A 3GLMA 2HMJA 2JZAA 4OGQC 4EMJB 1O7HA 1RQUA 1O7NA 2BEQD 1SQQE 4NBAD 4H13C 3G9RA 2BCCE 1OW6A 1SJGA 2YMKA 3CX5E 4IL6X 2YFJA 2E75C 2IBZE 2XSHA 2E76C 2OQQA 1UIXA 3GTSA 4OGQB 3L71E 4OGQD 4NBED 1PIXA 1YQ4C 1RFSA 1KILE 1VL2A 4H13D 3GZYA 3AE6C 4QURA 2ZYLA 1L0LE 1KQGB 3B71A 2E75D 4HM7A 2E76D 1GMJA 3C0DA 3VCAA 4XFJA 1G8KB 4Y28J 4NB8D 3D6YA 3CXHE 3AZCA 4QDDA 3H25A 1FDOA 2E74C 4U7JA 2G8YA 3AE9C 3Q5SA 3D70A 2QPZA 4H44C 1IK7A 4NBDD 4I7ZB 1EXIA 3AEAC 3L73E 3VMHD 1L0NE 2E4PA 1FQTA 3FOUA 5KLIC 4H44B 2I7FA 1NTME 4H44D 1Q90C 1KORA 1NTKE 2DE7D 5AEUA 2XR8A 3H1HE 2NVFA 2HMNA 1ZOYC 5KKZC 2MKVA 1UUVA 1Q90D 4QDFB 2WQYC 1P84E 1K05A 3GTEA 4QCKA 2NUKA 2IDBA 1VCKA 1UUWA 2GBXA 4Z1MH 3GCEA 2NWFA 4R4MA 4GDOA 3O6QA 1SQPE 3AEBC 1KYOE 4RKUJ 2ZT9C 3L70E 4KT0J 2QJKC 4R4LA 3AE8C 1O7GA 3AEDC 2HMOA 2ZT9B 2QJPC 2ZT9D 1VF5B 1VF5D 2WPVB 2YVJB 2GBWA 2NVGA 3GL2A 3AEEC 3AEGC 1PL5A 1ZMEC 4QUQA 3H1IE 1S1CX 4NBHD 4NBFD 2QIWA 1SQXE 3BCCE 4I7ZC 4NBBD 1AJYA 1NDOA 2CKFA 1SQVE 1EZVE 2JP3A 3EWKA 3AECC 3VMID 2K9YA 3D89A 3AE2C 2BEZF 3GOBA 1MKMA 2H88C 3TGUE 4H0LB 1NYHA 4H0LD 1BE3E 2WSFJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LW5 J;  3GTE A;  2HMK A;  2JO6 A;  5AEW A;  3GKE A;  2HMJ A;  2B24 A;  2NUK A;  2E75 B;  4QCK A;  1PP9 E;  1O7W A;  2E76 B;  2JZA A;  1VCK A;  4EMJ B;  1O7H A;  1UUW A;  2GBX A;  1O7N A;  1SQQ E;  3GZX A;  4NBA D;  1EG9 A;  4HM5 A;  2BCC E;  3GCE A;  1SJG A;  1WQL A;  3CX5 E;  4HM2 A;  4IL6 X;  2YFJ A;  2FYN C;  2IBZ E;  2XSH A;  2FYU E;  1RIE A;  2NWF A;  3GL0 A;  3GTS A;  4OGQ B;  3L71 E;  2YIU C;  3VMG D;  4OGQ D;  4NBE D;  4QDF A;  2QJY C;  4QDC A;  2A06 E;  1RFS A;  3N0Q A;  1SQB E;  3GZY A;  4H13 D;  4HM4 A;  2BMR A;  2DE6 D;  2ZYL A;  4QUR A;  1SQP E;  2YFL A;  1L0L E;  4P1B H;  2E75 D;  1KYO E;  4HM7 A;  4RKU J;  2E76 D;  4AIV A;  3C0D A;  3L70 E;  2E4Q A;  3VCA A;  4HM8 A;  2O01 J;  4KT0 J;  2NUM A;  2E74 B;  1BCC E;  2WSE J;  4PV1 B;  2QJK C;  1G8K B;  2E74 D;  1ULJ A;  2BMO A;  4NB9 D;  1O7P A;  1PPJ E;  1O7G A;  4Y28 J;  2Q3W A;  4NB8 D;  4HJL A;  2D2C B;  2HMO A;  3EQQ A;  2D2C D;  4HKV A;  3CXH E;  3AZC A;  2ZT9 B;  5KLV E;  1ULI A;  4NBG D;  4PD4 E;  4QDD A;  2QJP C;  2ZT9 D;  4HM1 A;  1VF5 B;  2DE5 D;  1VF5 D;  2WPV B;  3DQY A;  2YVJ B;  2GBW A;  2QSI A;  3EN1 A;  4HM6 A;  3GB4 A;  2NVG A;  2XSO A;  4QUP A;  3GL2 A;  3H1L E;  2QPZ A;  4NBC D;  1KB9 E;  4NBD D;  3H1K E;  4I7Z B;  1JM1 A;  3L73 E;  4QUQ A;  3H1I E;  1VM9 A;  5HL4 A;  3VMH D;  3L74 E;  4NBH D;  1L0N E;  4U3F E;  4HM0 A;  3L72 E;  4PV1 D;  2E4P A;  2NVE A;  4NBF D;  2QIW A;  1FQT A;  3FOU A;  3C8V A;  5KLI C;  1SQX E;  4H44 B;  4P1C H;  2I7F A;  1JB0 J;  1NTM E;  3BCC E;  4H44 D;  4NBB D;  2HML A;  1O7M A;  1Q90 C;  1NDO A;  2CKF A;  1NTK E;  1SQV E;  1NYK A;  2DE7 D;  5CXM A;  5L8R J;  1EZV E;  5AEU A;  4HM3 A;  2XR8 A;  3VMI D;  2HMM A;  2BMQ A;  3H1H E;  2K9Y A;  1NTZ E;  5BOK A;  3D89 A;  2NVF A;  3CWB E;  2HMN A;  3GOB A;  5KKZ C;  2B1X A;  1S5L X;  1UUV A;  1Q90 D;  4QDF B;  1ZRT E;  3TGU E;  1NU1 E;  4H0L B;  2WSC J;  1P84 E;  3H1J E;  4H0L D;  1BE3 E;  3VCP A;  1G8J B;  4AAY B;  2YFI A;  2XRX A;  2WSF J;  4H13 B;  3L75 E; 
#chains in the Genus database with same CATH topology
 3I5C A;  2C0W A;  1QVF O;  1LTG C;  2JO6 A;  5AEW A;  2WIT A;  3A0H E;  3GZX A;  2YMY A;  2B89 A;  2HOD A;  1KIL D;  3G4S P;  2FYU E;  2OAR A;  2N1T A;  2KXP B;  4O9B A;  5AW9 B;  1RQV A;  2ZJS E;  3A5T A;  1H0T A;  3TF5 A;  4ZKP A;  4AIV A;  4NPD A;  1LTI C;  1JCD A;  2E4Q A;  2ZYG A;  3CWB J;  1J1E C;  5GTH E;  1BCC E;  2WSE H;  4YXW H;  4YPC A;  2YO2 A;  3L73 D;  2KLU A;  4PJ0 E;  1KMI Z;  3L75 G;  3R2P A;  1CZQ A;  2CK3 H;  2I1J A;  2KYV A;  2YO3 A;  1IK9 A;  1NTM D;  1SQQ G;  3KZI H;  2J5U A;  3M9Q A;  1IZN B;  1DEB A;  1GL2 B;  1GL2 A;  3CLQ A;  2W6A A;  1LP1 A;  3CC2 P;  3MUD C;  3RK2 D;  4JPZ B;  1YJ9 P;  2HMM A;  4IFM A;  3B5N A;  3CWB E;  2Q1K A;  3AE1 C;  1BGY E;  1NU1 E;  3H1J E;  4AAY B;  2IPP A;  2LXB A;  1BSH A;  4OVN F;  2E75 B;  3NXS A;  1HUC A;  3HD7 C;  2E76 B;  2OTK E;  4HM5 A;  3VN0 A;  3MD0 A;  4HM2 A;  2M5A B;  4JQ0 D;  3EQ2 A;  2IFN A;  3USS A;  4ASV A;  4LLH A;  1OWA A;  4HM4 A;  3PP5 A;  2DE6 D;  1YQ3 C;  2LKM A;  3TNU A;  3L36 A;  1PFI A;  3I55 P;  3A0B H;  2CPB A;  2PFX A;  2KOG A;  3H1K J;  1WMK A;  1U57 A;  2E74 B;  1L0L D;  1JMB A;  1KFM A;  1CW5 A;  3FXE A;  4QMA A;  3U1A A;  5KAF H;  1RE3 C;  1SFC D;  2AEM A;  2QSI A;  3EN1 A;  4HM6 A;  2FBW C;  5AW6 B;  4NBC D;  2VRS A;  3CD6 P;  1IFP A;  2ZYD A;  1EZV I;  1X79 B;  2Z5I A;  1FZB A;  1SQV D;  4PV1 D;  1LJ2 A;  5BU8 B;  3CX5 H;  1PPJ G;  1VQ7 P;  4EDF A;  3PJS K;  1SVF A;  2FXO A;  2K3R A;  2NPS D;  1BE3 D;  2O1J A;  2BMQ A;  3H1K G;  1ZRT E;  1PZQ A;  1GTW A;  1W2B O;  3K5B A;  3F5H A;  3CL3 D;  3O6Q B;  3RBX A;  2M8R A;  1OW7 A;  2A45 I;  1MV8 A;  4WY4 B;  2RH0 A;  4EMJ B;  1O7H A;  4WY4 A;  3EFG A;  1AQT A;  3G9R A;  2BCC E;  1FZG A;  3E1I A;  4N6J A;  1G1J A;  4IL6 X;  2E75 C;  2XSH A;  4W7Z A;  2E76 C;  5KAI H;  1UIX A;  4OGQ B;  1FU1 A;  2QG4 A;  4NBE D;  1PIX A;  2QE7 H;  3HE4 B;  1GW4 A;  1KIL E;  1HGV A;  3KQG A;  1KQG B;  1GMJ A;  2LR2 A;  3VCA A;  1JO5 A;  2XKM A;  4XFJ A;  3G71 P;  5BVZ A;  4Y28 J;  1S72 P;  2LXC B;  1H89 A;  3H25 A;  2FYU K;  2P7J A;  3HE5 B;  1Q81 Q;  2E74 C;  3L74 D;  4U7J A;  5B66 H;  1YTZ I;  2QPZ A;  4H44 C;  3RBZ A;  3VMZ A;  1IK7 A;  1EXI A;  1NTZ J;  3L73 E;  2K1A A;  5CCG D;  3VMH D;  1JCC A;  1L0N E;  1VQK P;  2ZXE B;  2E4P A;  3WUT A;  3FOU A;  2B9B A;  1NTM E;  2E5T A;  3CCU P;  1QVG O;  1NTK E;  3QWO C;  1QX8 A;  5AEU A;  1KIL B;  4RJT A;  2WT7 A;  4ASW A;  1ZLL A;  2N9Y B;  2MKV A;  1UUV A;  5GTI H;  2HR3 A;  3L71 J;  3BRT B;  5APQ A;  5E79 E;  1L0L J;  1VCK A;  2A06 D;  4Z1M H;  1SQB D;  5APT A;  3CCR P;  1OIP A;  2NWF A;  4R4M A;  3EFF K;  4D6T G;  1NU1 K;  2GUV A;  1HBW A;  2QRX A;  1SQV J;  2ZVN B;  4WVZ A;  5TJH A;  1Y8A A;  5KLV D;  3HUS B;  3AE8 C;  3HUS A;  4L74 A;  2IBZ G;  1VQ4 P;  1OVV A;  1BE3 J;  2ZT9 B;  3PTZ A;  3CC4 P;  2WPV B;  3PH0 A;  5AW7 B;  2YVJ B;  2GBW A;  1BCC D;  3RK2 B;  1SP4 A;  1XTC C;  1VDF A;  1URQ A;  2IYO A;  3B5N D;  3JCU E;  3H1H J;  2WZ7 A;  3A0H H;  2YXQ B;  1AV1 A;  1HTL C;  4NBH D;  1S9K D;  1YIT P;  4NBF D;  3CME P;  1KQL A;  1SQX E;  2WSC H;  3BCC E;  3TK1 A;  4W7Y A;  2HYN A;  1AJY A;  1GZL A;  1SQV E;  1T2K D;  1W2E A;  4IL6 E;  3WU2 E;  1EDL A;  3D89 A;  2BEZ F;  3GOB A;  1CI6 B;  1LTB C;  1M1J A;  2H88 C;  4M3L A;  5AVT B;  5GTH H;  2WPR A;  1BE3 E;  3CI9 A;  1SQQ D;  4GOD A;  1KIL C;  4GIF A;  2C9L Y;  1JNM A;  1FOS F;  2FYN B;  3IN6 A;  2IFM A;  4PJ0 H;  1BGY D;  2B88 A;  5AVY B;  3L70 J;  1WQL A;  3L74 J;  4U3F G;  3VMG D;  2QM7 A;  4QDF A;  5DJT B;  3TYY A;  1FJP A;  2W90 A;  1SFC B;  1U7M A;  3RK3 E;  3A3Y B;  2OGU A;  2Q3I A;  4C7R A;  3CXH D;  1M1K Q;  2P67 A;  4Y99 C;  3H1I J;  2NUM A;  4PV1 B;  5KJ7 D;  2O3J A;  1VQ5 P;  2D2C B;  1AA0 A;  3ABV C;  4HM1 A;  1IC2 A;  5AW2 B;  2DE5 D;  2NPS B;  3PLN A;  1QLE D;  3V6I A;  3CCQ P;  3L74 E;  3L72 E;  3RK2 C;  1DD4 A;  3TGU J;  5APY A;  2RN0 A;  3SFD C;  2ZAE B;  3C8V A;  4P1C H;  1OW8 A;  3T97 B;  3NTN A;  4HH2 A;  1P84 D;  4RES B;  1PGP A;  1M57 D;  3H1I G;  2FYU J;  2WSC J;  1JEK A;  2OTJ P;  1IFM A;  3GHG B;  1D7M A;  2KZI A;  3MUD A;  4NPE A;  1RE4 C;  4JF7 A;  1RF1 B;  1TU3 F;  1NTM K;  5AVV B;  1H8A A;  5B5E E;  1LTT C;  1FDM A;  1EZV G;  2W8Z A;  3RL0 g;  3V4Q A;  4IOI H;  1SQP D;  3VYI A;  1BCC J;  2FYN C;  3GL0 A;  1KYO D;  3HD7 A;  3CCL P;  2A06 E;  3N0Q A;  1SQB E;  2G3A A;  2BMR A;  2BCC D;  2NZ2 A;  3Q5P A;  3FWL A;  4P1B H;  1VQP P;  4EYY Q;  1ZP0 C;  3U59 A;  2K9J B;  3AE3 C;  1ZW0 A;  5DJU B;  4YTP C;  1SFC C;  4I1L A;  3TSI A;  1ULJ A;  2BMO A;  1NTZ K;  1RY3 A;  2FYU G;  3Q2Y A;  5KLV E;  5AVU B;  1YIJ P;  1KV4 A;  2A45 G;  4PV1 C;  2XSO A;  3RL0 D;  2D2C C;  2K37 A;  2E42 A;  1LTJ B;  2KK7 A;  3BVH A;  2NPS C;  1FZE A;  1Y9B A;  1YI2 P;  1BGY J;  1NU1 J;  1RE3 A;  3H1J J;  3KHU A;  3M0D C;  4JYB A;  1S9K E;  5KKZ B;  1L0N D;  3LID A;  1NYK A;  1NKZ B;  5CXM A;  4HM3 A;  1PV3 A;  1L0L K;  1AQ5 A;  2B87 B;  3KXD A;  2Q3E A;  1PP9 D;  3V4W A;  1NTK D;  3GW6 A;  3D71 A;  1YJN P;  3L75 E;  1VQL P;  4UB6 E;  2SPZ A;  1RQU A;  3GHG C;  1SQQ E;  4NBA D;  1SQV K;  2J59 M;  5CHX A;  1OW6 A;  1SJG A;  5CBN A;  3CWB G;  1RF1 C;  2YFJ A;  2OQQ A;  3GTS A;  4EIJ A;  5K5G B;  3H1J G;  5APU A;  5BU5 A;  1VL2 A;  4QUR A;  2ZVO B;  3FWN A;  1QEX A;  4WWI A;  2PAJ A;  2JJL A;  4L73 A;  3C0D A;  4B86 A;  3GG2 A;  1RF0 C;  3CCJ P;  1G8K B;  4NB8 D;  3H1L D;  3CXH E;  2M5A A;  1NWQ A;  2E5Y A;  5CCG C;  3P7K A;  3I56 P;  1FE6 A;  3Q5S A;  1KN7 A;  2QA4 P;  5E79 H;  4DCK A;  2ZFC A;  1BSN A;  1JY2 N;  1N2D C;  3MHV A;  3AEA C;  2OYO A;  3S1K A;  1IFN A;  1N7S D;  1JOC A;  1FQT A;  4H44 B;  4HKZ H;  5AW1 B;  1SQP J;  1LTJ C;  1BDC A;  1G2C B;  3WUV A;  2FXM A;  1MFZ A;  3WUU A;  1USD A;  2FFD B;  2Q9I A;  1SQX D;  3BCC D;  2BCC J;  1M8O B;  2KSE A;  5KKZ C;  2I8D A;  1P84 E;  1GK4 A;  1L4A D;  3H32 B;  3IR9 A;  2NUK A;  3N7N A;  2YIU B;  3W68 A;  2JR8 A;  1FAV A;  1JTH B;  5CCH D;  3JCU H;  1M90 Q;  3V2P A;  4OWF A;  5CMZ A;  3O6Q A;  4N3Y B;  1SQP E;  1OX3 A;  2PRR A;  2MJZ A;  1KYO E;  4RKU J;  1Q86 Q;  4IL6 H;  2JWA A;  4PD4 D;  3WU2 H;  1LTA C;  2K88 A;  3L73 J;  4R4L A;  1L0N J;  1M56 D;  3RK3 D;  1O7G A;  2HMO A;  1KB9 D;  1G1I A;  1VF5 B;  1NTM J;  4W80 A;  1OZH A;  3HE4 A;  4EI2 A;  1NTK J;  2NVG A;  1SQB K;  2HPC B;  2Y0C A;  2Q6Q A;  3AEE C;  2HPC A;  1PL5 A;  1ZME C;  1T2K C;  2XU6 A;  1VQN P;  1YBK A;  5AVR B;  1WT6 A;  2QIW A;  2P1J A;  4NBB D;  2QEX P;  1JY2 P;  5KLV K;  1NDO A;  3CCV P;  2NRG A;  3HE5 A;  2PGD A;  3LW5 H;  1VQM P;  3CCM P;  2JDI H;  3L72 D;  1OFC X;  2RMZ A;  2I1K A;  2JP3 A;  3AEC C;  2C9N Y;  2E43 A;  1N7L A;  1MKM A;  3L73 G;  1JUN A;  1JY3 N;  4H0L B;  3BRV B;  2FFD C;  3HTK B;  3HTK A;  3M91 A;  1MZ9 A;  1NTM G;  3GKE A;  1HVV A;  4DZO A;  1PP9 E;  2AEJ A;  1EG9 A;  3FGA D;  4UB8 E;  3D6Z A;  1KIL A;  1MUU A;  1VQ6 P;  2O01 H;  2N1T D;  2YIU C;  2QJY C;  5KJ7 C;  3CXH I;  4ZMD A;  3RL0 B;  1IFD A;  3GF7 A;  2QM8 A;  1GW3 A;  1KC8 Q;  1SQQ K;  1NTZ G;  1DD3 A;  4NB9 D;  1LGH B;  4HJL A;  4NBG D;  1SQX J;  3BCC J;  4Y99 B;  2JO1 A;  3U1C A;  1FS0 E;  3GB4 A;  1GU4 A;  1AVY A;  3UIA A;  3CMA P;  3H1L E;  1H88 A;  4HJG H;  5B5E H;  1VF5 C;  2H89 C;  2IZ0 A;  4D6T E;  1GL2 D;  3CC7 P;  1P84 I;  3L71 G;  4GOE A;  2HML A;  4AQR D;  1W5C E;  3M06 A;  1EXJ A;  2OYH C;  1L0L G;  1PGJ A;  5L8R J;  1KQS O;  1N86 A;  1LWU C;  4BRY B;  1X0T A;  5APV A;  5AVW B;  2GM4 A;  1SS1 A;  4EOT A;  1T3U A;  2W27 A;  2IYP A;  2KIK A;  1HJB A;  3LW5 J;  3CPW O;  2HMK A;  2YNY A;  1NAF A;  2B24 A;  1JY2 O;  4H0L C;  1SQV G;  1JY3 P;  1KYO I;  2R3S A;  2O1K A;  3L75 D;  2IX7 C;  1RE4 A;  2FXP A;  1DEE G;  2C0X A;  1CI6 A;  1UII A;  2O01 N;  1BE3 G;  2PP6 A;  4YXD C;  3II6 A;  3M0A A;  3OAK A;  3W67 A;  3KPE A;  3V5B A;  4JBZ A;  2O01 J;  1Q82 Q;  3H1H G;  2P10 A;  2E74 D;  4DOJ A;  3MIW A;  3SWF A;  1LNQ A;  3RL0 C;  2WPQ A;  3L72 J;  1KQF B;  5AVQ B;  4C7N B;  5APW A;  1ULI A;  4PD4 E;  1ZR2 A;  1VPC A;  4UB6 H;  2Q5U A;  1Q2N A;  3VMX A;  1SFC A;  3AE7 C;  2YXR B;  1SQP K;  2POH A;  1KB9 E;  1M7L A;  1FOS E;  3IAO A;  4U3F E;  2WMM A;  3R4Y A;  2FKW B;  4HM0 A;  2AXT E;  2NVE A;  1L4A B;  3GF3 A;  1JB0 J;  3MP7 B;  2Y0E A;  1LT9 C;  3ZDM A;  4AUW A;  5AW8 B;  1GDT A;  3SFE C;  2NPS A;  3A7O A;  3NFQ A;  1NKN A;  3L70 G;  3M0D A;  1S5L X;  1NGM B;  3L74 G;  2OYI B;  1VQ9 P;  5M1B A;  3VCP A;  1G8J B;  3CXH H;  1SQB J;  1ZR4 A;  1JM0 A;  2KZJ A;  2JWD A;  2HMJ A;  2AEF A;  3T97 A;  2JZA A;  4WY4 D;  4HB1 A;  1O7N A;  2BEQ D;  4I6M C;  3RK3 B;  2DW3 A;  4OGQ D;  1EC5 A;  4LGD E;  1YQ4 C;  5KLV J;  1RFS A;  1L0N K;  2W6J H;  3L35 A;  3GHG A;  4H13 D;  3GZY A;  2R32 A;  2QJK B;  2Q7C A;  1PPJ D;  1NAY A;  1RF1 A;  1LT1 A;  4TLF A;  1MFT A;  3ITK A;  2QJP B;  5AW0 B;  1NTK K;  1JY3 O;  1Y47 A;  1PGQ A;  5TIS E;  2OTL P;  1E5W A;  1S4X A;  3D6Y A;  3TGU G;  3AZC A;  2YKQ A;  2H43 A;  1P84 H;  1FDO A;  3H1K D;  3WMM 0;  1N7S C;  3AE9 C;  1RF0 A;  2WPS A;  3D70 A;  4N78 E;  2WTY A;  2K9J A;  5CCG A;  3KDP B;  1HH0 A;  2KP8 A;  5KLI C;  3L37 A;  1R5S A;  5KLV G;  3L75 J;  2M3E A;  4I2L C;  5H2F E;  1L4A C;  5CJ0 A;  2HOD B;  1SQQ J;  1FZC C;  2XR8 A;  1KYO H;  2NVF A;  3OW2 O;  1ZOY C;  2N1T B;  1Q90 D;  1BCC G;  1K05 A;  1LTJ A;  5CCH C;  1FZF A;  1H0T B;  3S4R A;  2IDB A;  2OYI C;  1KFN A;  1KZU B;  2GBX A;  1S3J A;  3A2A A;  3IF4 A;  1WRG A;  3H6P A;  1T8Z A;  2GA1 A;  3VOP A;  2B87 A;  3CCE P;  2XDJ A;  3E7K A;  4GDO A;  3G6E P;  4PD4 I;  3RK3 C;  2M0B A;  1SQX K;  3NMD A;  3MGN A;  2ZXX A;  1KB9 I;  4K35 A;  4CPG A;  2KI7 B;  5AVS B;  2KSJ A;  2QJK C;  3P8M C;  3AED C;  1ZXG A;  1BGY G;  1NU1 G;  2QJP C;  2ZT9 D;  4LC1 A;  1LP1 B;  1FJK A;  1S5L E;  3GL2 A;  3B5N B;  1URQ D;  2WSS H;  4QUQ A;  1IJD B;  1EDJ A;  1DH3 A;  1S1C X;  1K9M Q;  2FYZ A;  4UB8 H;  3JC2 2;  1AVO A;  1NTZ D;  3JSV C;  4D6T D;  1OXZ A;  2KB7 P;  3SWK A;  3VMI D;  5AW3 B;  2K9Y A;  2YKP A;  1N8R Q;  3E1R A;  2H7H A;  2Y0D A;  2N9B A;  4OH8 B;  5KTB A;  3O8Z A;  2IZ1 A;  3TNU B;  3CX5 D;  2IBZ D;  2N1T C;  1ZN5 A;  1DIP A;  1O7W A;  3MZW B;  3AEF C;  3L71 D;  3BAS A;  1G2C A;  4IFD K;  3SWY A;  2FFD A;  4K3A A;  2Z5H A;  1VQO P;  3S9O A;  4L76 A;  4DJG A;  4DT0 A;  1ZV8 A;  1X9V A;  2XND H;  1OVR A;  3H32 A;  2P58 A;  4XA4 A;  1DX7 A;  1GD2 E;  1HGZ A;  2QJY B;  1JTH A;  4L75 A;  2WSE J;  5KJ7 A;  1O7P A;  1PPJ E;  2Q3W A;  2D2C D;  2W6B A;  2JKV A;  3DQY A;  1T3J A;  3VMA A;  1T6A A;  1SLQ A;  1SQP G;  1GL2 C;  4QUP A;  1JMM A;  1KD1 Q;  1FC2 C;  1NJI Q;  3Q5R A;  2YKO A;  3H1K E;  1R8E A;  2KS1 B;  1JM1 A;  3VMY A;  1VM9 A;  2KS1 A;  4KHX A;  2BCC G;  3V2Q A;  1NVO A;  3RGU A;  1S2E A;  2R5D A;  2Y9Y A;  2V7Q H;  3B5N C;  3GMA A;  1J2J B;  3H1H D;  1Z56 A;  1O7M A;  3Q1M A;  1YYC A;  4U3F D;  1PP9 J;  5APX A;  3VTP C;  3QH9 A;  5BOK A;  4HYT B;  1OMI A;  3AE5 C;  2B1X A;  2OYH B;  2OYH A;  1A02 J;  2HG5 D;  2WVR A;  4H13 B;  1LWU B;  2GUS A;  4PD4 H;  1LWU A;  1EQ7 A;  3M9B A;  3KZI E;  3P32 A;  1KB9 H;  2AXC A;  1K04 A;  1RIE A;  1L0N G;  3HD7 D;  4QDC A;  1HJ0 A;  2AXT H;  5AW4 B;  3L70 D;  2YFL A;  3M9H A;  2V4H A;  3FXD A;  2Z4E A;  4BWN A;  1PP9 G;  1NTK G;  1A02 F;  3H1L J;  4TT3 H;  4HM8 A;  1USE A;  2XNX A;  1FBM A;  2J58 A;  4D6T J;  3EQQ A;  3Q3D A;  4HKV A;  2FY8 A;  1N73 B;  1N73 A;  3PRJ A;  2ITA A;  3H1I D;  3F89 A;  3P8C D;  3V2N A;  2WT7 B;  2R5B A;  5HL4 A;  1KTM A;  1NHL A;  1FDI A;  1X8Y A;  3BAT A;  2ZYA A;  3IFM A;  1EZV D;  4WBA A;  1AFO A;  4N78 D;  3OA7 A;  2BAS A;  3N4X A;  3AE4 C;  3A0B E;  3TGU D;  1NOH A;  4GOF A;  3H1L G;  1NTZ E;  4C46 A;  1LT9 B;  1YTZ T;  3FX0 A;  1LT9 A;  4WY4 C;  1J1D B;  2V7Q J;  1XTG B;  5TIS H;  1PGO A;  2L5G B;  5AVX B;  1HF9 A;  2YFI A;  5KAF E;  2XRX A;  2JEE A;  3GLM A;  1QGK B;  4ZKU A;  1YHQ P;  4OGQ C;  2FYU D;  3CCS P;  3VP9 A;  2KUB A;  4H13 C;  4BRY A;  2YMK A;  2CPS A;  3CX5 E;  2IBZ E;  5AVZ B;  3L71 E;  1SQX G;  3AE6 C;  3PHL A;  2ZYL A;  3BCC G;  1L0L E;  4A7P A;  3B71 A;  1URQ B;  2E75 D;  4HM7 A;  2E76 D;  1K73 Q;  5H2F H;  4GKG A;  4AYC A;  5C39 A;  4U3F J;  1OVU A;  1EDK A;  4QDD A;  2A45 H;  1IO4 A;  3TDK A;  2H8P D;  2G8Y A;  3B4S A;  2Y9Z A;  2HLO A;  1GU5 A;  4JYC A;  1N73 C;  4NBD D;  4I7Z B;  1M1J B;  5KAI E;  1K8A Q;  1N7S B;  3KYQ A;  1N7S A;  2I7F A;  4H44 D;  4C7N A;  1FZA A;  2WSF H;  3CWB D;  3LIE A;  1Q7Y Q;  1Q90 C;  1KOR A;  2DE7 D;  3C9I A;  2KNC B;  1NU1 D;  3H1J D;  2KNC A;  3H1H E;  5KLI B;  2P2U A;  2HMN A;  2W83 C;  1U7J A;  4QDF B;  2WQY C;  4WB4 A;  1BDD A;  1QL2 A;  1L4A A;  1FZC B;  2QVA A;  2R44 A;  5B66 E;  3GTE A;  1FZC A;  5CJ4 A;  4QCK A;  1J1D C;  1QL1 A;  3MTU E;  4NPF X;  1CSB A;  1UUW A;  1S5L H;  5CCH A;  3GCE A;  2XV5 A;  1HWT C;  2XZR A;  3OJA B;  4XE5 B;  3L72 G;  2OYI A;  1J1E B;  3HUS C;  1R5L A;  2L91 A;  3HRN A;  3B8E B;  3AEB C;  1EDI A;  2ZT9 C;  4IFF A;  3C1L A;  5AW5 B;  3L70 E;  4KT0 J;  5GTI E;  4ZNC A;  1VQ8 P;  1URQ C;  1GK6 A;  1NH4 A;  1IFI A;  1VF5 D;  1E79 H;  3G3Z A;  3AEG C;  1YJW P;  4GT1 A;  2WWW A;  3H1I E;  1X22 A;  3P8C E;  3L4F A;  4KJM A;  4I7Z C;  1M1J C;  2A06 G;  2RKL A;  4BXL A;  2KLV A;  1SQB G;  2CKF A;  2R3C A;  1ZRT D;  3VP8 A;  1RHZ B;  1L2P A;  1EZV E;  3EWK A;  2HFE D;  3AE2 C;  5EFW B;  1RH5 B;  4MN4 C;  4RO0 A;  3V2R A;  3SSU A;  3HD7 B;  3TGU E;  5APS A;  1NYH A;  3CX5 I;  1NO4 A;  4H0L D;  2IBZ I;  5CBO A;  1IFJ A;  2UWJ E;  2WSF J;  2M3B A;  1LTS C; 
#chains in the Genus database with same CATH homology
 5AEW A;  2JO6 A;  3GKE A;  3IN6 A;  1PP9 E;  1DIP A;  1O7W A;  3AEF C;  3GZX A;  1EG9 A;  3FGA D;  3D6Z A;  1WQL A;  3S9O A;  2FYU E;  2YIU C;  3VMG D;  4QDF A;  2QJY C;  1RQV A;  3RK3 E;  3GF7 A;  4AIV A;  2E4Q A;  2NUM A;  1BCC E;  2WSE J;  4PV1 B;  1DD3 A;  4NB9 D;  1O7P A;  1PPJ E;  2Q3W A;  4HJL A;  2D2C B;  2D2C D;  4NBG D;  3ABV C;  4HM1 A;  2DE5 D;  2JO1 A;  3DQY A;  1KMI Z;  3GB4 A;  4QUP A;  3H1L E;  3Q5R A;  3H1K E;  1VF5 C;  1R8E A;  2H89 C;  1JM1 A;  1VM9 A;  2J5U A;  3L74 E;  3L72 E;  1DD4 A;  3SFD C;  3C8V A;  4P1C H;  3GMA A;  1OW8 A;  3T97 B;  2HML A;  1O7M A;  3Q1M A;  1EXJ A;  5L8R J;  2HMM A;  5BOK A;  1OMI A;  3CWB E;  3AE5 C;  2B1X A;  3AE1 C;  1NU1 E;  2WSC J;  3H1J E;  4AAY B;  4H13 B;  3LW5 J;  2HMK A;  2B24 A;  2E75 B;  1TU3 F;  2E76 B;  4H0L C;  4HM5 A;  3RL0 g;  1K04 A;  4HM2 A;  2FYN C;  2FXP A;  1RIE A;  3GL0 A;  4QDC A;  1HJ0 A;  2A06 E;  3N0Q A;  1SQB E;  2G3A A;  4HM4 A;  2BMR A;  2NZ2 A;  2DE6 D;  4YXD C;  2YFL A;  1YQ3 C;  3Q5P A;  4P1B H;  1ZP0 C;  4TT3 H;  3AE3 C;  1WMK A;  4HM8 A;  2O01 J;  4YTP C;  1U57 A;  2E74 B;  2P10 A;  2E74 D;  1ULJ A;  2BMO A;  1KQF B;  3Q2Y A;  3EQQ A;  3Q3D A;  4HKV A;  5KLV E;  1ULI A;  4PD4 E;  4PV1 C;  2QSI A;  3EN1 A;  4HM6 A;  2FBW C;  3AE7 C;  2XSO A;  2D2C C;  4NBC D;  1KB9 E;  5HL4 A;  1KTM A;  3IAO A;  3R4Y A;  1FDI A;  4U3F E;  4HM0 A;  4PV1 D;  1Y9B A;  2NVE A;  3GF3 A;  1JB0 J;  3AE4 C;  1NYK A;  5CXM A;  3SFE C;  1PV3 A;  4HM3 A;  2BMQ A;  1NTZ E;  1S5L X;  2V7Q J;  1NGM B;  1ZRT E;  3D71 A;  5M1B A;  3VCP A;  1G8J B;  1HF9 A;  2YFI A;  2XRX A;  3L75 E;  1OW7 A;  3GLM A;  2HMJ A;  2JZA A;  4OGQ C;  4EMJ B;  1O7H A;  1RQU A;  1O7N A;  2BEQ D;  1SQQ E;  4NBA D;  4H13 C;  3G9R A;  2BCC E;  1OW6 A;  1SJG A;  2YMK A;  3CX5 E;  4IL6 X;  2YFJ A;  2E75 C;  2IBZ E;  2XSH A;  2E76 C;  2OQQ A;  1UIX A;  3GTS A;  4OGQ B;  3L71 E;  4OGQ D;  4NBE D;  1PIX A;  1YQ4 C;  1RFS A;  1KIL E;  1VL2 A;  4H13 D;  3GZY A;  3AE6 C;  4QUR A;  2ZYL A;  1L0L E;  1KQG B;  3B71 A;  2E75 D;  4HM7 A;  2E76 D;  1GMJ A;  3C0D A;  3VCA A;  4XFJ A;  1G8K B;  4Y28 J;  4NB8 D;  3D6Y A;  3CXH E;  3AZC A;  4QDD A;  3H25 A;  1FDO A;  2E74 C;  4U7J A;  2G8Y A;  3AE9 C;  3Q5S A;  3D70 A;  2QPZ A;  4H44 C;  1IK7 A;  4NBD D;  4I7Z B;  1EXI A;  3AEA C;  3L73 E;  3VMH D;  1L0N E;  2E4P A;  1FQT A;  3FOU A;  5KLI C;  4H44 B;  2I7F A;  1NTM E;  4H44 D;  1Q90 C;  1KOR A;  1NTK E;  2DE7 D;  5AEU A;  2XR8 A;  3H1H E;  2NVF A;  2HMN A;  1ZOY C;  5KKZ C;  2MKV A;  1UUV A;  1Q90 D;  4QDF B;  2WQY C;  1P84 E;  1K05 A;  3GTE A;  4QCK A;  2NUK A;  2IDB A;  1VCK A;  1UUW A;  2GBX A;  4Z1M H;  3GCE A;  2NWF A;  4R4M A;  4GDO A;  3O6Q A;  1SQP E;  3AEB C;  1KYO E;  4RKU J;  2ZT9 C;  3L70 E;  4KT0 J;  2QJK C;  4R4L A;  3AE8 C;  1O7G A;  3AED C;  2HMO A;  2ZT9 B;  2QJP C;  2ZT9 D;  1VF5 B;  1VF5 D;  2WPV B;  2YVJ B;  2GBW A;  2NVG A;  3GL2 A;  3AEE C;  3AEG C;  1PL5 A;  1ZME C;  4QUQ A;  3H1I E;  1S1C X;  4NBH D;  4NBF D;  2QIW A;  1SQX E;  3BCC E;  4I7Z C;  4NBB D;  1AJY A;  1NDO A;  2CKF A;  1SQV E;  1EZV E;  2JP3 A;  3EWK A;  3AEC C;  3VMI D;  2K9Y A;  3D89 A;  3AE2 C;  2BEZ F;  3GOB A;  1MKM A;  2H88 C;  3TGU E;  4H0L B;  1NYH A;  4H0L D;  1BE3 E;  2WSF J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...