2QJYC

Crystal structure of rhodobacter sphaeroides double mutant with stigmatellin and uq2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCSPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor-complexed Structures of the Cytochrome bc1 from the Photosynthetic Bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Cytochrome b
total genus 55
structure length 179
sequence length 179
chains with identical sequence F, I, L, O, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2007-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qjyC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qjyC02
1RIEA 4QDFA 4H0LB 3GZYA 3BCCE 5KKZC 3C0DA 4QUPA 4RKUJ 2QPZA 3AZCA 1VCKA 1SQBE 1UUWA 3L74E 2HMKA 4QDFB 3GB4A 4NBDD 1VF5D 1ULIA 2NWFA 3GTSA 4NBAD 2NUKA 3VCPA 5BOKA 1NTZE 3H1KE 1SQVE 1JM1A 4OGQD 2E74D 4HKVA 2GBWA 4NBCD 1S5LX 2DE5D 2WSEJ 4HM8A 4QDCA 1L0NE 1NYKA 4H0LD 1SQPE 2YFLA 4HM3A 3CXHE 1VM9A 2D2CD 4Y28J 2HMOA 2E75D 2E4QA 1ZRTE 2QJPC 4H44D 5KLIC 4P1BH 2YIUC 1BCCE 5AEWA 4H13D 2B1XA 2IBZE 4NBBD 3GL0A 4PD4E 3GL2A 4NBFD 2GBXA 2WSFJ 2FYNC 1EG9A 2NUMA 2NVGA 2ZYLA 2A06E 2DE7D 3FOUA 4HM0A 3VMHD 2ZT9B 4IL6X 1FQTA 2DE6D 1SQXE 2E4PA 5CXMA 4QCKA 2XSHA 3L70E 1PPJE 2XR8A 3GKEA 4U3FE 4NBGD 3EQQA 4OGQB 3GCEA 3L72E 1SJGA 4H44B 2Q3WA 3GOBA 2O01J 4NBED 4H13B 1NTME 2HMMA 4QURA 4EMJB 2HMNA 3L73E 1JB0J 3L75E 3N0QA 4NB9D 2E75B 3VMGD 3CWBE 4AAYB 2NVFA 3H1HE 4HM7A 2E76B 4NBHD 3GTEA 4PV1B 2ZT9D 1WQLA 3GZXA 1KB9E 3H1JE 1L0LE 4HM6A 5AEUA 2XSOA 3D89A 3EN1A 5HL4A 2QJYC 4NB8D 2I7FA 2CKFA 3H1IE 3L71E 2QIWA 1NTKE 3DQYA 3C8VA 1G8JB 1Q90C 2B24A 3TGUE 3VCAA 5KLVE 1Q90D 2QSIA 1BE3E 1G8KB 2YFJA 4QUQA 4AIVA 2JO6A 1O7GA 2BCCE 2BMOA 2WSCJ 4HM5A 1EZVE 5L8RJ 4HM2A 1ULJA 3CX5E 1KYOE 4KT0J 1O7MA 1O7PA 2HMLA 4PV1D 2YVJB 4HM4A 4QDDA 1SQQE 1O7WA 2JZAA 2BMQA 3VMID 1UUVA 2HMJA 2E76D 1P84E 1PP9E 3H1LE 2XRXA 2YFIA 1NDOA 4HM1A 1VF5B 1RFSA 4P1CH 2D2CB 1NU1E 2E74B 2FYUE 2NVEA 1O7NA 1O7HA 3LW5J 4HJLA 4I7ZB 2QJKC 2BMRA 2K9YA 2WPVB
chains in the Genus database with same CATH superfamily
1YITP 3BCCE 1LT9A 3P7KA 4QUPA 5CBNA 3KDPB 1Y9BA 1VF5D 5CCHA 1JM0A 1ZW0A 1NU1K 5AVRB 1K9MQ 1IFNA 5KLVD 2KP8A 2A45G 4IL6E 3AE3C 2KZIA 2C0WA 4L73A 1A02J 4H0LC 3HD7B 2Y9YA 1LTIC 1N8RQ 2IBZE 2ZAEB 3RBZA 1KQFB 3H32A 1KYOH 4GT1A 2M8RA 2B87B 4YXWH 5GTIH 2NZ2A 2GUVA 4W80A 3C9IA 4TLFA 4ASVA 2KZJA 2ZYAA 3FX0A 3Q5PA 3A0HE 1X79B 3CPWO 1N73C 1NTMK 3AE4C 4PJ0E 2IBZG 2V7QJ 3L74G 2W6JH 1XTGB 1SLQA 4HM5A 3H1JJ 2N9BA 2QA4P 4RO0A 3G6EP 1UUVA 1G2CB 2XRXA 1S3JA 1H8AA 3P8CD 1AQ5A 1GU4A 1DEEG 1JY3P 1SQVK 1S5LE 2NVEA 3PJSK 1O7HA 2FKWB 5CCHD 3AE6C 2C0XA 4D6TG 1JO5A 5AVWB 1SQBE 2H8PD 5BOKA 1NTZE 3H1KE 2RH0A 1RE3C 2H43A 1VQLP 2E74D 2E43A 2OTKE 2VRSA 1NYKA 1L2PA 4C7NB 3OW2O 5AW4B 4H44C 2BCCD 5APTA 3USSA 2N9YB 5KLVK 2DE7D 4TT3H 2Q3EA 2DE6D 1Q7YQ 2KSJA 4R4LA 1JCDA 1J1DC 1RE4C 1FZCC 1Q82Q 4H44B 1K8AQ 4JYBA 2BEZF 4K35A 4LLHA 2E42A 3L74D 3V6IA 1GMJA 3OA7A 1L0LE 2P67A 1H0TA 4LC1A 2ZXEB 3L71E 1NH4A 4ZMDA 3SWYA 5EFWB 1GW3A 2YFJA 1PFIA 3H1ID 5AVYB 1O7GA 1N86A 1S9KE 3WUVA 1GL2B 3H1JD 4U3FJ 1ZXGA 2JEEA 2KI7B 4IL6H 1U7JA 3N7NA 2YFIA 1M57D 1YQ3C 2YXQB 2FYUK 4OWFA 2WMMA 3G9RA 5TJHA 4QDFA 3RK2B 5H2FE 2YIUB 1GDTA 1PGQA 1HH0A 2PRRA 3U59A 2NRGA 1NTZK 3EQ2A 4OGQD 2HYNA 1JOCA 2GBWA 3PP5A 1VQ8P 1PGOA 1GZLA 1L0NE 4GOEA 1N7SA 3CXHE 3L75J 3P8CE 2D2CD 1ZRTE 3TNUA 1L0NK 1AJYA 2DW3A 1U57A 5TISH 2Y9ZA 4U3FG 1JY2N 4JQ0D 1LTGC 4YTPC 3BRTB 2H88C 3CCSP 3SFDC 2M3BA 1CW5A 3GOBA 4Y99C 1JB0J 1OIPA 3CCEP 1HF9A 4HM7A 1J1EC 2A45H 3M06A 1IO4A 1KB9E 3H1IG 3H1JE 3JCUE 4NPFX 1SQPK 1BGYD 2FYNB 3S9OA 3M0DC 3WU2H 1P84I 3L71G 4WY4C 4AUWA 2JWDA 4ASWA 4PV1D 1T2KD 1SQQK 1YYCA 2FYUJ 1Q2NA 3H1HG 2HODB 3M9HA 1OX3A 1L0LG 2R32A 5C39A 2K9YA 3PLNA 2WSFH 2JKVA 3WUUA 2KLUA 1JTHA 2M5AB 1Y47A 3GTSA 4NBAD 4W7ZA 2CPSA 3MTUE 2FXOA 2O3JA 1S5LX 3B5NB 5AW8B 2OTJP 2WQYC 1K04A 1MKMA 2AEJA 5GTHH 2QJPC 2XNDH 2QJKB 2JDIH 1RH5B 1RF1B 1SQBG 3FWNA 4OVNF 1AVOA 1EG9A 3PRJA 1RY3A 1FOSE 1M56D 3H1HJ 4QCKA 1IFMA 3AE2C 5CJ0A 2FXPA 4C7NA 1QL1A 2AEFA 3VMGD 1N7SD 2NVFA 1VQ6P 3CCQP 5AVXB 1ZRTD 2LXBA 3RL0C 2FBWC 2NPSA 1LT9C 2Y0DA 2YMYA 5AVQB 3E1RA 5APWA 3TGUG 1IFDA 2YO3A 1YHQP 1SVFA 3I55P 2K9JA 1USDA 2FFDB 5KKZB 1LWUC 2JR8A 3BVHA 1EC5A 3GHGC 1FDOA 2GA1A 2JZAA 2B87A 5KAFE 5APXA 2KXPB 2PP6A 3Q2YA 4GKGA 5BVZA 3A0BE 2E74B 4ZKUA 5KKZC 1UUWA 2K9JB 1FOSF 1SFCC 4IFFA 2R5DA 3CWBD 2QG4A 3D6ZA 3CX5D 4A7PA 4KHXA 2NPSB 1LP1A 1KZUB 1OW6A 4H44D 2YIUC 4N6JA 1EDLA 2JO1A 1S2EA 4L75A 1LTSC 1FAVA 1AQTA 2HR3A 3HUSA 1YTZI 1RQVA 5KJ7D 1M7LA 3FXEA 2E76B 5CCGA 2R44A 4IFDK 2FYUD 1SQVG 2WVRA 3LW5H 2ZYDA 3PHLA 1NTKE 2IBZI 1SQBD 5DJTB 3CC2P 5AVZB 2WT7B 4DOJA 1EZVE 1URQD 3CMAP 4ZKPA 3T97A 1JTHB 1KILC 3MHVA 1Z56A 3Q5SA 2A06D 1M8OB 2KS1B 1CZQA 1MFTA 4HM1A 3TGUJ 3FXDA 2Q7CA 3G4SP 4EOTA 1FU1A 3KHUA 3VP9A 3RL0B 2ZXXA 2J58A 5AW6B 3RK3B 3W67A 1OFCX 1IFPA 5KLVG 2HMKA 4NBDD 2WITA 1OW8A 1SQQD 3AEBC 1LTJA 3V4QA 1A02F 2YFLA 1BCCD 2E75D 3CC7P 3RL0g 3MD0A 1Q81Q 4NBBD 2N1TA 2RMZA 4HM0A 2IYPA 1LT1A 4WY4B 2XSHA 2XR8A 5AW0B 1BGYG 2IX7C 4YXDC 5E79H 5KAFH 2KB7P 3GMAA 1SQVD 4GODA 3CWBE 1T6AA 1LTAC 2QM7A 2IBZD 3L71D 1ZMEC 2V7QH 1KYOI 4NB8D 2I7FA 1IC2A 1VQ9P 4U3FD 2LR2A 2OYHA 1EDKA 1PPJD 1OWAA 3R4YA 5APVA 1RF0C 2BCCE 4JYCA 3NMDA 1SQXJ 2ZYGA 4BRYA 2KIKA 1NTMD 1NTZG 5DJUB 2KNCA 3L74J 1N7LA 2XV5A 3V2PA 3L37A 3R2PA 3V2RA 2AEMA 4D6TE 3KZIH 1S5LH 2W6AA 3B5ND 4I7ZB 4N78D 4UB8H 1GU5A 3GZYA 2FFDC 4GOFA 1S4XA 1GL2D 1VCKA 5APQA 3BRVB 4U7JA 2YKQA 1KB9I 1FE6A 2J5UA 1ZR4A 2QM8A 3RGUA 3CC4P 1H0TB 1PP9D 3H1LD 4P1BH 1URQA 2Q1KA 3CXHD 1ZV8A 4PD4E 3A3YB 1NVOA 2POHA 4NBFD 2GBXA 1HTLC 2OYHC 1SQPG 1NAYA 3AE8C 1FZFA 1L0NJ 1NKNA 1SQXE 3L4FA 3BATA 3I5CA 3AEGC 4OGQB 1SJGA 1KD1Q 4EMJB 4CPGA 2HMNA 2K88A 1NTKJ 2O01H 1LTTC 3A0HH 1NU1D 1N7SC 4OH8B 1BE3J 2XSOA 2N1TD 3AEFC 3DQYA 1SQXK 3H6PA 1Q90C 2RN0A 1WMKA 1S1CX 1JY3O 4WBAA 2XDJA 1QLED 3CX5E 2M5AA 1YQ4C 4HKZH 1R5SA 2OQQA 4C46A 3HUSC 3L73D 1P84E 1VF5B 1HVVA 3BCCG 4EI2A 2XKMA 1ZLLA 1WRGA 1EZVI 2WPVB 5TISE 1H89A 1EXIA 5AW7B 1SQBK 5CCGC 3L72D 3GB4A 3B8EB 3AEDC 3A5TA 1XTCC 1YJ9P 4NPEA 2PGDA 1L4AD 4JPZB 4H0LD 4HM3A 1VM9A 1K05A 2QRXA 5KLVJ 2FYZA 4AQRD 3AECC 3JCUH 1BE3D 2KOGA 3GLMA 2B9BA 3D70A 2FYNC 3AEAC 3TSIA 1W2EA 3H1KD 1BDCA 2R3CA 1NTKK 3SWFA 1PPJE 5B66H 3OJAB 2BEQD 3L72E 3D6YA 3CMEP 1KILB 3PTZA 1KYOD 3TYYA 1CI6A 1FBMA 3B4SA 2ZFCA 1L0ND 2BASA 1LWUB 1EQ7A 4I2LC 1X0TA 1SQPD 3CX5H 1SS1A 4BRYB 1GK6A 3O6QB 3G71P 3NTNA 4R4MA 2BMOA 1LGHB 2PAJA 1KN7A 1RHZB 4D6TJ 4QDDA 3C1LA 2CPBA 3S1KA 1U7MA 1DX7A 1JUNA 1NU1E 4ZNCA 2WPSA 3LW5J 5CMZA 3H1IE 2QJKC 2BMRA 2NPSC 4PD4D 2WPQA 1FZGA 1JY3N 2QPZA 2IDBA 1PV3A 3BASA 3MP7B 2KSEA 2KK7A 1K73Q 1RE3A 3IAOA 3KYQA 4WY4D 4GIFA 3G3ZA 4Y28J 2E4QA 4H13C 1NTMG 2L5GB 1E79H 3L71J 4XFJA 1JEKA 1S72P 2O01J 4H13B 1NTME 1VDFA 1X8YA 4L74A 4EIJA 2ZT9D 2UWJE 2OYIC 1HJ0A 2KS1A 3D89A 1KQGB 3KXDA 1HGVA 1YJNP 1QEXA 2QIWA 1BCCJ 1VL2A 2QSIA 4EDFA 4Y99B 2WSCJ 2WT7A 3HE4B 3L70J 1EDJA 3GW6A 1NYHA 1QL2A 1KFMA 4BXLA 1NDOA 3CLQA 3P32A 4AYCA 3U1CA 2CK3H 3HD7C 2Q9IA 2QJYB 1BGYE 3FGAD 1UIXA 2YKOA 3UIAA 3VN0A 1NHLA 3HUSB 1GL2C 2OYOA 3VCPA 1EXJA 1VF5C 3CCLP 1CI6B 3BCCJ 1KILA 2C9LY 5H2FH 4HM8A 2W8ZA 2IFNA 3CXHH 4JBZA 1S9KD 1NTZJ 1NTZD 5KLIC 1J2JB 1BCCE 4PJ0H 2IZ1A 2WTYA 1GD2E 1G1IA 2WZ7A 4RESB 3GG2A 3VYIA 3IN6A 3HE5B 3RBXA 3Q3DA 1DD3A 1ZOYC 1M1KQ 1KORA 1OVVA 3EQQA 2OYIA 2FY8A 3E1IA 1P84H 1IFJA 1PZQA 4HH2A 1Y8AA 1OZHA 1D7MA 1PPJG 4NBHD 4PV1B 3CD6P 3HD7A 2K1AA 4DCKA 2FYUG 3AE5C 3VMXA 1H88A 5KAIH 3K5BA 4N3YB 3RK3C 2FFDA 3M9BA 1ZR2A 3F89A 1GL2A 1ULJA 2E75C 1KYOE 5APYA 2WSCH 2R5BA 2JJLA 3MGNA 4PD4H 3CCVP 1VPCA 1GTWA 3GF3A 3E7KA 1NKZB 1YBKA 2KUBA 4WB4A 1PGJA 1DD4A 2E5YA 1O7NA 1SFCA 2I1JA 4LGDE 1L4AB 4H0LB 1FS0E 3GHGB 3MZWB 4RKUJ 3L74E 1PP9G 3H1LG 5CCGD 2NWFA 2O01N 2GM4A 4W7YA 2LXCB 4HKVA 2Y0CA 2O1KA 3F5HA 4QMAA 3Q1MA 2WWWA 1L4AC 2Q6QA 3KPEA 1KILD 3M91A 5KTBA 5KAIE 2M3EA 3RK2D 3RK3E 4C7RA 1NWQA 5CJ4A 3FOUA 1SQXG 2P10A 1P84D 3L75G 3GKEA 2QVAA 3GCEA 4IOIH 5CBOA 2W83C 2V4HA 2P7JA 3V2QA 1HGZA 3TDKA 1QVFO 1KMIZ 1L0LK 2CKFA 4O9BA 3TGUE 1KQSO 4KT0J 5GTIE 4UB6E 3QH9A 3P8MC 3AE9C 4GDOA 1O7WA 2RKLA 1DEBA 3L35A 2W27A 5B5EE 3WMM0 3TF5A 2FYUE 4HJLA 3D71A 2R3SA 1RIEA 4Z1MH 4D6TD 3V2NA 3A2AA 2HPCA 1BE3G 1FJPA 3AZCA 3ITKA 2HFED 4XA4A 3EFGA 1SFCD 1BCCG 3ABVC 1SQQG 4HB1A 2FXMA 2LKMA 1FZEA 3PH0A 3H32B 2N1TC 1PL5A 2WSEJ 3QWOC 4HJGH 1N7SB 2D2CC 2OYIB 3JC22 4H13D 3GL2A 4WVZA 5KJ7A 1BSNA 3L70G 2ZYLA 1FJKA 2IFMA 4IL6X 3H1KJ 1HUCA 4DT0A 3LIDA 3CCJP 2G3AA 3CCRP 5AW1B 4NBED 2SPZA 4NB9D 2QEXP 3H1HE 1RF0A 1WQLA 2W90A 4EYYQ 3VMZA 4DJGA 1LJ2A 3CI9A 2QJYC 3W68A 3L73J 3L75D 4WY4A 2B24A 1JMMA 5KLVE 3MIWA 1T8ZA 1URQC 3HRNA 3L72J 1FDIA 2G8YA 1UIIA 2E5TA 5L8RJ 5GTHE 1KC8Q 1MFZA 1TU3F 3AE1C 4I1LA 2ZVOB 1T2KC 5AW3B 1SQQE 2O1JA 1NJIQ 3SWKA 3LIEA 1N73B 3GF7A 2XU6A 1LTJB 5KLIB 3HE4A 3CCUP 5AVSB 1EZVG 3VOPA 2AXCA 4BWNA 3N4XA 2P2UA 2K3RA 1SQVE 4PD4I 4NBCD 3H1IJ 2DE5D 3IR9A 4I7ZC 2P58A 2PFXA 4N78E 1NU1J 1AA0A 4WWIA 1PP9J 3H1LJ 4K3AA 2Z5HA 1NTKD 1LNQA 2OARA 3B71A 2W6BA 1J1EB 2NUMA 2XNXA 4L76A 1LP1B 3A0BH 5CXMA 2J59M 1E5WA 2YKPA 1HBWA 1WT6A 1NU1G 5CCHC 2B89A 1MZ9A 5APSA 3MUDA 2YO2A 5BU8B 2NPSD 1DIPA 3L75E 3S4RA 3N0QA 1ZP0C 1KILE 2B88A 1EDIA 1G2CA 5HL4A 2E74C 4MN4C 2BCCJ 1LWUA 1NTMJ 2HLOA 3VCAA 4NPDA 3IFMA 1G8KB 4QUQA 4AIVA 1SQXD 1VQMP 2ZJSE 1FZCB 4HM2A 1VQ7P 1O7MA 1YJWP 2H7HA 2YVJB 2KLVA 1JMBA 2BMQA 3M0DA 2HMJA 2E76D 3V5BA 1NOHA 1PP9E 3H1LE 1BSHA 1M90Q 1OVRA 1QGKB 2JWAA 4XE5B 4P1CH 2Z5IA 3L72G 3B5NC 2WPRA 1LTBC 4M3LA 4DZOA 3O6QA 1KQLA 2M0BA 1JY2P 1SQVJ 1KFNA 3EFFK 3IF4A 5M1BA 1FZCA 1ULIA 3TK1A 1N2DC 5K5GB 2YNYA 1X9VA 3Q5RA 3L73G 1AV1A 1HJBA 1IFIA 1FZBA 2K37A 2OGUA 3CX5I 2B1XA 1VQNP 3GL0A 3EWKA 2WSSH 3RK2C 1USEA 2NVGA 2A06E 1RE4A 2E4PA 2A06G 1IK7A 4UB6H 4NBGD 3KQGA 1LT9B 1VQOP 3SSUA 3HD7D 1MV8A 1OVUA 3CL3D 5KJ7C 3H25A 3L73E 2E75B 3GTEA 1OW7A 4KJMA 3GZXA 2IPPA 2HG5D 2ITAA 3HTKA 5BU5A 3TGUD 4YPCA 5AW2B 5AVUB 2MKVA 5E79E 1SQQJ 2YXRB 1M1JB 3JSVC 1CSBA 1AVYA 4JF7A 5B66E 1RF1A 1M1JA 1JY2O 1SP4A 1ZN5A 1GW4A 3HTKB 1L4AA 1SFCB 2L91A 3B5NA 4B86A 2D2CB 1URQB 3II6A 2WSFJ 1T3JA 3VP8A 1IJDB 2AXTE 3C0DA 1QX8A 1W2BO 1IZNB 1NAFA 2KYVA 2ZT9C 5AVVB 1AFOA 2YMKA 1T3UA 1SQBJ 2WSEH 1JNMA 1L0LD 1JM1A 1DH3A 3RL0D 1X22A 4QDCA 1W5CE 3RK3D 3WU2E 1SQPE 1GK4A 1VQPP 3OAKA 3SFEC 2MJZA 1VQ4P 2HODA 4PV1C 1VQ5P 5AEWA 2ZVNB 3FWLA 3BCCD 5APUA 3H1JG 2C9NY 1Q86Q 3TNUB 5AW5B 3VMHD 4U3FE 3NXSA 1OMIA 2Q3WA 1VQKP 3ZDMA 4QURA 3HE5A 2XZRA 3AE7C 2QJPB 3VTPC 1L0NG 3V4WA 1PIXA 4HM6A 1RF1C 3CWBJ 3L70D 1OXZA 5AW9B 3C8VA 1G8JB 1QVGO 1KV4A 1R5LA 1BDDA 1O7PA 2HMLA 2QE7H 4HM4A 2HPCB 1KB9H 2BCCG 1FC2C 3CWBG 2KNCB 3A7OA 3VMID 2IZ0A 3AEEC 2N1TB 2Q3IA 1KTMA 5B5EH 2OYHB 1KB9D 3MUDC 3VMYA 2AXTH 3L36A 2Q5UA 4QDFB 3U1AA 3VMAA 3NFQA 2NUKA 3M9QA 4OGQC 1FDMA 2OTLP 4IFMA 1J1DB 3O8ZA 1FZAA 3KZIE 1IK9A 2HMOA 1G1JA 4UB8E 1YIJP 3WUTA 4RJTA 2Y0EA 1EZVD 1NGMB 2Z4EA 1MUUA 5AVTB 3CXHI 3CCMP 2ZT9B 1FQTA 3H1HD 3L70E 3T97B 2HMMA 1JCCA 5CHXA 2I1KA 4AAYB 1RQUA 1N73A 1HWTC 5AEUA 3EN1A 3M0AA 2GUSA 4HYTB 2IYOA 1LTJC 1Q90D 1NTKG 1BE3E 1YTZT 2JO6A 1L0LJ 1R8EA 1SQPJ 3GHGA 2A45I 2I8DA 1NO4A 1YI2P 3H1KG 1BGYJ 2E76C 1RFSA 2H89C 3I56P 1M1JC 1PGPA 2P1JA 4I6MC 2JP3A
chains in the Genus database with same CATH topology
3BCCE 5KKZC 4QUPA 2QPZA 1Y9BA 1UUWA 2IDBA 1PV3A 1VF5D 1SQVE 4NBCD 3IAOA 2DE5D 3D6ZA 4I7ZC 3AE3C 4Y28J 1OW6A 4H0LC 2E4QA 4H44D 4H13C 2YIUC 2IBZE 2JO1A 3B71A 4XFJA 1KQFB 2NUMA 5CXMA 1RQVA 2NZ2A 2O01J 4H13B 1NTME 1DIPA 3L75E 3N0QA 1ZP0C 3Q5PA 1KILE 2E76B 2ZT9D 1HJ0A 3AE4C 3D89A 5HL4A 1KQGB 2E74C 2V7QJ 3H1IE 2QIWA 1NTKE 1VL2A 3VCAA 2QSIA 1G8KB 4QUQA 4AIVA 4HM5A 2WSCJ 1EZVE 4HM2A 1O7MA 2YVJB 1NYHA 3Q5SA 2BMQA 1UUVA 2HMJA 2E76D 1PP9E 3H1LE 2XRXA 4HM1A 1NDOA 4P1CH 2NVEA 3FGAD 1O7HA 1UIXA 3AE6C 3O6QA 5M1BA 1SQBE 2HMKA 4NBDD 3VCPA 1EXJA 1ULIA 5BOKA 1OW8A 1NTZE 3H1KE 1VF5C 3AEBC 2E74D 4HM8A 1NYKA 2YFLA 3Q5RA 4H44C 2E75D 5KLIC 3RL0g 1BCCE 2B1XA 4NBBD 3GL0A 3EWKA 3IN6A 4HM0A 2NVGA 2A06E 2DE7D 4TT3H 3Q3DA 1DD3A 1ZOYC 2DE6D 4R4LA 2E4PA 1IK7A 2XSHA 2XR8A 1KORA 4NBGD 3EQQA 4YXDC 4H44B 3GMAA 3H25A 2BEZF 3L73E 2E75B 3CWBE 1GMJA 4NBHD 3GTEA 4PV1B 1OW7A 3GZXA 1ZMEC 1L0LE 3AE5C 4NB8D 2I7FA 3L71E 2MKVA 3R4YA 2YFJA 1O7GA 2BCCE 1ULJA 2E75C 1KYOE 2YFIA 3GF3A 1YQ3C 2D2CB 1DD4A 1O7NA 3G9RA 2WSFJ 4I7ZB 4QDFA 4H0LB 3GZYA 3C0DA 4RKUJ 2ZT9C 1VCKA 3L74E 4U7JA 2YMKA 2NWFA 2J5UA 1JM1A 4OGQD 4HKVA 2GBWA 4QDCA 1L0NE 3Q1MA 1SQPE 3CXHE 2D2CD 3SFEC 1ZRTE 4PV1C 4P1BH 1AJYA 5AEWA 4PD4E 3RK3E 4NBFD 1U57A 2GBXA 3FOUA 3AE8C 2P10A 3VMHD 4YTPC 1SQXE 2H88C 4U3FE 3GKEA 1OMIA 3AEGC 3GCEA 4OGQB 3SFDC 1SJGA 2Q3WA 3GOBA 4QURA 4EMJB 2HMNA 1JB0J 3AE7C 1HF9A 4HM7A 1KB9E 1PIXA 3H1JE 4HM6A 2XSOA 1KMIZ 2CKFA 3AEFC 3DQYA 3S9OA 3C8VA 1G8JB 1Q90C 3TGUE 1WMKA 1S1CX 3CX5E 1O7PA 4KT0J 2HMLA 4PV1D 1YQ4C 4HM4A 2OQQA 3AE9C 4GDOA 1O7WA 3VMID 1P84E 1VF5B 3AEEC 2FYUE 4HJLA 1KTMA 2K9YA 2WPVB 3D71A 1EXIA 4Z1MH 1RIEA 3AZCA 4QDFB 3GB4A 3GTSA 4NBAD 3ABVC 2NUKA 3AEDC 4OGQC 1PL5A 1S5LX 2WSEJ 2WQYC 1K04A 4H0LD 4HM3A 1MKMA 1VM9A 1K05A 2HMOA 2QJPC 2D2CC 3AECC 4H13D 3GLMA 3GL2A 1NGMB 3D70A 2FYNC 3AEAC 1EG9A 2ZYLA 2ZT9B 4IL6X 1FQTA 4QCKA 3L70E 1PPJE 2BEQD 3AE2C 3D6YA 3L72E 2G3AA 3T97B 2FXPA 4NBED 2HMMA 4NB9D 3VMGD 4AAYB 2NVFA 3H1HE 1RQUA 1WQLA 5AEUA 3EN1A 2QJYC 2FBWC 2B24A 5KLVE 1Q90D 1BE3E 4R4MA 2JO6A 2BMOA 1FDIA 2G8YA 5L8RJ 1R8EA 1TU3F 3AE1C 4QDDA 1SQQE 1FDOA 2JZAA 2E76C 1RFSA 3Q2YA 2H89C 3GF7A 1NU1E 2E74B 3LW5J 2JP3A 2QJKC 2BMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RIE A;  4QDF A;  4H0L B;  3GZY A;  3BCC E;  5KKZ C;  3C0D A;  4QUP A;  4RKU J;  2QPZ A;  3AZC A;  1VCK A;  1SQB E;  1UUW A;  3L74 E;  2HMK A;  4QDF B;  3GB4 A;  4NBD D;  1VF5 D;  1ULI A;  2NWF A;  3GTS A;  4NBA D;  2NUK A;  3VCP A;  5BOK A;  1NTZ E;  3H1K E;  1SQV E;  1JM1 A;  4OGQ D;  2E74 D;  4HKV A;  2GBW A;  4NBC D;  1S5L X;  2DE5 D;  2WSE J;  4HM8 A;  4QDC A;  1L0N E;  1NYK A;  4H0L D;  1SQP E;  2YFL A;  4HM3 A;  3CXH E;  1VM9 A;  2D2C D;  4Y28 J;  2HMO A;  2E75 D;  2E4Q A;  1ZRT E;  2QJP C;  4H44 D;  5KLI C;  4P1B H;  2YIU C;  1BCC E;  5AEW A;  4H13 D;  2B1X A;  2IBZ E;  4NBB D;  3GL0 A;  4PD4 E;  3GL2 A;  4NBF D;  2GBX A;  2WSF J;  2FYN C;  1EG9 A;  2NUM A;  2NVG A;  2ZYL A;  2A06 E;  2DE7 D;  3FOU A;  4HM0 A;  3VMH D;  2ZT9 B;  4IL6 X;  1FQT A;  2DE6 D;  1SQX E;  2E4P A;  5CXM A;  4QCK A;  2XSH A;  3L70 E;  1PPJ E;  2XR8 A;  3GKE A;  4U3F E;  4NBG D;  3EQQ A;  4OGQ B;  3GCE A;  3L72 E;  1SJG A;  4H44 B;  2Q3W A;  3GOB A;  2O01 J;  4NBE D;  4H13 B;  1NTM E;  2HMM A;  4QUR A;  4EMJ B;  2HMN A;  3L73 E;  1JB0 J;  3L75 E;  3N0Q A;  4NB9 D;  2E75 B;  3VMG D;  3CWB E;  4AAY B;  2NVF A;  3H1H E;  4HM7 A;  2E76 B;  4NBH D;  3GTE A;  4PV1 B;  2ZT9 D;  1WQL A;  3GZX A;  1KB9 E;  3H1J E;  1L0L E;  4HM6 A;  5AEU A;  2XSO A;  3D89 A;  3EN1 A;  5HL4 A;  2QJY C;  4NB8 D;  2I7F A;  2CKF A;  3H1I E;  3L71 E;  2QIW A;  1NTK E;  3DQY A;  3C8V A;  1G8J B;  1Q90 C;  2B24 A;  3TGU E;  3VCA A;  5KLV E;  1Q90 D;  2QSI A;  1BE3 E;  1G8K B;  2YFJ A;  4QUQ A;  4AIV A;  2JO6 A;  1O7G A;  2BCC E;  2BMO A;  2WSC J;  4HM5 A;  1EZV E;  5L8R J;  4HM2 A;  1ULJ A;  3CX5 E;  1KYO E;  4KT0 J;  1O7M A;  1O7P A;  2HML A;  4PV1 D;  2YVJ B;  4HM4 A;  4QDD A;  1SQQ E;  1O7W A;  2JZA A;  2BMQ A;  3VMI D;  1UUV A;  2HMJ A;  2E76 D;  1P84 E;  1PP9 E;  3H1L E;  2XRX A;  2YFI A;  1NDO A;  4HM1 A;  1VF5 B;  1RFS A;  4P1C H;  2D2C B;  1NU1 E;  2E74 B;  2FYU E;  2NVE A;  1O7N A;  1O7H A;  3LW5 J;  4HJL A;  4I7Z B;  2QJK C;  2BMR A;  2K9Y A;  2WPV B; 
#chains in the Genus database with same CATH topology
 1YIT P;  3BCC E;  1LT9 A;  3P7K A;  4QUP A;  5CBN A;  3KDP B;  1Y9B A;  1VF5 D;  5CCH A;  1JM0 A;  1ZW0 A;  1NU1 K;  5AVR B;  1K9M Q;  1IFN A;  5KLV D;  2KP8 A;  2A45 G;  4IL6 E;  3AE3 C;  2KZI A;  2C0W A;  4L73 A;  1A02 J;  4H0L C;  3HD7 B;  2Y9Y A;  1LTI C;  1N8R Q;  2IBZ E;  2ZAE B;  3RBZ A;  1KQF B;  3H32 A;  1KYO H;  4GT1 A;  2M8R A;  2B87 B;  4YXW H;  5GTI H;  2NZ2 A;  2GUV A;  4W80 A;  3C9I A;  4TLF A;  4ASV A;  2KZJ A;  2ZYA A;  3FX0 A;  3Q5P A;  3A0H E;  1X79 B;  3CPW O;  1N73 C;  1NTM K;  3AE4 C;  4PJ0 E;  2IBZ G;  2V7Q J;  3L74 G;  2W6J H;  1XTG B;  1SLQ A;  4HM5 A;  3H1J J;  2N9B A;  2QA4 P;  4RO0 A;  3G6E P;  1UUV A;  1G2C B;  2XRX A;  1S3J A;  1H8A A;  3P8C D;  1AQ5 A;  1GU4 A;  1DEE G;  1JY3 P;  1SQV K;  1S5L E;  2NVE A;  3PJS K;  1O7H A;  2FKW B;  5CCH D;  3AE6 C;  2C0X A;  4D6T G;  1JO5 A;  5AVW B;  1SQB E;  2H8P D;  5BOK A;  1NTZ E;  3H1K E;  2RH0 A;  1RE3 C;  2H43 A;  1VQL P;  2E74 D;  2E43 A;  2OTK E;  2VRS A;  1NYK A;  1L2P A;  4C7N B;  3OW2 O;  5AW4 B;  4H44 C;  2BCC D;  5APT A;  3USS A;  2N9Y B;  5KLV K;  2DE7 D;  4TT3 H;  2Q3E A;  2DE6 D;  1Q7Y Q;  2KSJ A;  4R4L A;  1JCD A;  1J1D C;  1RE4 C;  1FZC C;  1Q82 Q;  4H44 B;  1K8A Q;  4JYB A;  2BEZ F;  4K35 A;  4LLH A;  2E42 A;  3L74 D;  3V6I A;  1GMJ A;  3OA7 A;  1L0L E;  2P67 A;  1H0T A;  4LC1 A;  2ZXE B;  3L71 E;  1NH4 A;  4ZMD A;  3SWY A;  5EFW B;  1GW3 A;  2YFJ A;  1PFI A;  3H1I D;  5AVY B;  1O7G A;  1N86 A;  1S9K E;  3WUV A;  1GL2 B;  3H1J D;  4U3F J;  1ZXG A;  2JEE A;  2KI7 B;  4IL6 H;  1U7J A;  3N7N A;  2YFI A;  1M57 D;  1YQ3 C;  2YXQ B;  2FYU K;  4OWF A;  2WMM A;  3G9R A;  5TJH A;  4QDF A;  3RK2 B;  5H2F E;  2YIU B;  1GDT A;  1PGQ A;  1HH0 A;  2PRR A;  3U59 A;  2NRG A;  1NTZ K;  3EQ2 A;  4OGQ D;  2HYN A;  1JOC A;  2GBW A;  3PP5 A;  1VQ8 P;  1PGO A;  1GZL A;  1L0N E;  4GOE A;  1N7S A;  3CXH E;  3L75 J;  3P8C E;  2D2C D;  1ZRT E;  3TNU A;  1L0N K;  1AJY A;  2DW3 A;  1U57 A;  5TIS H;  2Y9Z A;  4U3F G;  1JY2 N;  4JQ0 D;  1LTG C;  4YTP C;  3BRT B;  2H88 C;  3CCS P;  3SFD C;  2M3B A;  1CW5 A;  3GOB A;  4Y99 C;  1JB0 J;  1OIP A;  3CCE P;  1HF9 A;  4HM7 A;  1J1E C;  2A45 H;  3M06 A;  1IO4 A;  1KB9 E;  3H1I G;  3H1J E;  3JCU E;  4NPF X;  1SQP K;  1BGY D;  2FYN B;  3S9O A;  3M0D C;  3WU2 H;  1P84 I;  3L71 G;  4WY4 C;  4AUW A;  2JWD A;  4ASW A;  4PV1 D;  1T2K D;  1SQQ K;  1YYC A;  2FYU J;  1Q2N A;  3H1H G;  2HOD B;  3M9H A;  1OX3 A;  1L0L G;  2R32 A;  5C39 A;  2K9Y A;  3PLN A;  2WSF H;  2JKV A;  3WUU A;  2KLU A;  1JTH A;  2M5A B;  1Y47 A;  3GTS A;  4NBA D;  4W7Z A;  2CPS A;  3MTU E;  2FXO A;  2O3J A;  1S5L X;  3B5N B;  5AW8 B;  2OTJ P;  2WQY C;  1K04 A;  1MKM A;  2AEJ A;  5GTH H;  2QJP C;  2XND H;  2QJK B;  2JDI H;  1RH5 B;  1RF1 B;  1SQB G;  3FWN A;  4OVN F;  1AVO A;  1EG9 A;  3PRJ A;  1RY3 A;  1FOS E;  1M56 D;  3H1H J;  4QCK A;  1IFM A;  3AE2 C;  5CJ0 A;  2FXP A;  4C7N A;  1QL1 A;  2AEF A;  3VMG D;  1N7S D;  2NVF A;  1VQ6 P;  3CCQ P;  5AVX B;  1ZRT D;  2LXB A;  3RL0 C;  2FBW C;  2NPS A;  1LT9 C;  2Y0D A;  2YMY A;  5AVQ B;  3E1R A;  5APW A;  3TGU G;  1IFD A;  2YO3 A;  1YHQ P;  1SVF A;  3I55 P;  2K9J A;  1USD A;  2FFD B;  5KKZ B;  1LWU C;  2JR8 A;  3BVH A;  1EC5 A;  3GHG C;  1FDO A;  2GA1 A;  2JZA A;  2B87 A;  5KAF E;  5APX A;  2KXP B;  2PP6 A;  3Q2Y A;  4GKG A;  5BVZ A;  3A0B E;  2E74 B;  4ZKU A;  5KKZ C;  1UUW A;  2K9J B;  1FOS F;  1SFC C;  4IFF A;  2R5D A;  3CWB D;  2QG4 A;  3D6Z A;  3CX5 D;  4A7P A;  4KHX A;  2NPS B;  1LP1 A;  1KZU B;  1OW6 A;  4H44 D;  2YIU C;  4N6J A;  1EDL A;  2JO1 A;  1S2E A;  4L75 A;  1LTS C;  1FAV A;  1AQT A;  2HR3 A;  3HUS A;  1YTZ I;  1RQV A;  5KJ7 D;  1M7L A;  3FXE A;  2E76 B;  5CCG A;  2R44 A;  4IFD K;  2FYU D;  1SQV G;  2WVR A;  3LW5 H;  2ZYD A;  3PHL A;  1NTK E;  2IBZ I;  1SQB D;  5DJT B;  3CC2 P;  5AVZ B;  2WT7 B;  4DOJ A;  1EZV E;  1URQ D;  3CMA P;  4ZKP A;  3T97 A;  1JTH B;  1KIL C;  3MHV A;  1Z56 A;  3Q5S A;  2A06 D;  1M8O B;  2KS1 B;  1CZQ A;  1MFT A;  4HM1 A;  3TGU J;  3FXD A;  2Q7C A;  3G4S P;  4EOT A;  1FU1 A;  3KHU A;  3VP9 A;  3RL0 B;  2ZXX A;  2J58 A;  5AW6 B;  3RK3 B;  3W67 A;  1OFC X;  1IFP A;  5KLV G;  2HMK A;  4NBD D;  2WIT A;  1OW8 A;  1SQQ D;  3AEB C;  1LTJ A;  3V4Q A;  1A02 F;  2YFL A;  1BCC D;  2E75 D;  3CC7 P;  3RL0 g;  3MD0 A;  1Q81 Q;  4NBB D;  2N1T A;  2RMZ A;  4HM0 A;  2IYP A;  1LT1 A;  4WY4 B;  2XSH A;  2XR8 A;  5AW0 B;  1BGY G;  2IX7 C;  4YXD C;  5E79 H;  5KAF H;  2KB7 P;  3GMA A;  1SQV D;  4GOD A;  3CWB E;  1T6A A;  1LTA C;  2QM7 A;  2IBZ D;  3L71 D;  1ZME C;  2V7Q H;  1KYO I;  4NB8 D;  2I7F A;  1IC2 A;  1VQ9 P;  4U3F D;  2LR2 A;  2OYH A;  1EDK A;  1PPJ D;  1OWA A;  3R4Y A;  5APV A;  1RF0 C;  2BCC E;  4JYC A;  3NMD A;  1SQX J;  2ZYG A;  4BRY A;  2KIK A;  1NTM D;  1NTZ G;  5DJU B;  2KNC A;  3L74 J;  1N7L A;  2XV5 A;  3V2P A;  3L37 A;  3R2P A;  3V2R A;  2AEM A;  4D6T E;  3KZI H;  1S5L H;  2W6A A;  3B5N D;  4I7Z B;  4N78 D;  4UB8 H;  1GU5 A;  3GZY A;  2FFD C;  4GOF A;  1S4X A;  1GL2 D;  1VCK A;  5APQ A;  3BRV B;  4U7J A;  2YKQ A;  1KB9 I;  1FE6 A;  2J5U A;  1ZR4 A;  2QM8 A;  3RGU A;  3CC4 P;  1H0T B;  1PP9 D;  3H1L D;  4P1B H;  1URQ A;  2Q1K A;  3CXH D;  1ZV8 A;  4PD4 E;  3A3Y B;  1NVO A;  2POH A;  4NBF D;  2GBX A;  1HTL C;  2OYH C;  1SQP G;  1NAY A;  3AE8 C;  1FZF A;  1L0N J;  1NKN A;  1SQX E;  3L4F A;  3BAT A;  3I5C A;  3AEG C;  4OGQ B;  1SJG A;  1KD1 Q;  4EMJ B;  4CPG A;  2HMN A;  2K88 A;  1NTK J;  2O01 H;  1LTT C;  3A0H H;  1NU1 D;  1N7S C;  4OH8 B;  1BE3 J;  2XSO A;  2N1T D;  3AEF C;  3DQY A;  1SQX K;  3H6P A;  1Q90 C;  2RN0 A;  1WMK A;  1S1C X;  1JY3 O;  4WBA A;  2XDJ A;  1QLE D;  3CX5 E;  2M5A A;  1YQ4 C;  4HKZ H;  1R5S A;  2OQQ A;  4C46 A;  3HUS C;  3L73 D;  1P84 E;  1VF5 B;  1HVV A;  3BCC G;  4EI2 A;  2XKM A;  1ZLL A;  1WRG A;  1EZV I;  2WPV B;  5TIS E;  1H89 A;  1EXI A;  5AW7 B;  1SQB K;  5CCG C;  3L72 D;  3GB4 A;  3B8E B;  3AED C;  3A5T A;  1XTC C;  1YJ9 P;  4NPE A;  2PGD A;  1L4A D;  4JPZ B;  4H0L D;  4HM3 A;  1VM9 A;  1K05 A;  2QRX A;  5KLV J;  2FYZ A;  4AQR D;  3AEC C;  3JCU H;  1BE3 D;  2KOG A;  3GLM A;  2B9B A;  3D70 A;  2FYN C;  3AEA C;  3TSI A;  1W2E A;  3H1K D;  1BDC A;  2R3C A;  1NTK K;  3SWF A;  1PPJ E;  5B66 H;  3OJA B;  2BEQ D;  3L72 E;  3D6Y A;  3CME P;  1KIL B;  3PTZ A;  1KYO D;  3TYY A;  1CI6 A;  1FBM A;  3B4S A;  2ZFC A;  1L0N D;  2BAS A;  1LWU B;  1EQ7 A;  4I2L C;  1X0T A;  1SQP D;  3CX5 H;  1SS1 A;  4BRY B;  1GK6 A;  3O6Q B;  3G71 P;  3NTN A;  4R4M A;  2BMO A;  1LGH B;  2PAJ A;  1KN7 A;  1RHZ B;  4D6T J;  4QDD A;  3C1L A;  2CPB A;  3S1K A;  1U7M A;  1DX7 A;  1JUN A;  1NU1 E;  4ZNC A;  2WPS A;  3LW5 J;  5CMZ A;  3H1I E;  2QJK C;  2BMR A;  2NPS C;  4PD4 D;  2WPQ A;  1FZG A;  1JY3 N;  2QPZ A;  2IDB A;  1PV3 A;  3BAS A;  3MP7 B;  2KSE A;  2KK7 A;  1K73 Q;  1RE3 A;  3IAO A;  3KYQ A;  4WY4 D;  4GIF A;  3G3Z A;  4Y28 J;  2E4Q A;  4H13 C;  1NTM G;  2L5G B;  1E79 H;  3L71 J;  4XFJ A;  1JEK A;  1S72 P;  2O01 J;  4H13 B;  1NTM E;  1VDF A;  1X8Y A;  4L74 A;  4EIJ A;  2ZT9 D;  2UWJ E;  2OYI C;  1HJ0 A;  2KS1 A;  3D89 A;  1KQG B;  3KXD A;  1HGV A;  1YJN P;  1QEX A;  2QIW A;  1BCC J;  1VL2 A;  2QSI A;  4EDF A;  4Y99 B;  2WSC J;  2WT7 A;  3HE4 B;  3L70 J;  1EDJ A;  3GW6 A;  1NYH A;  1QL2 A;  1KFM A;  4BXL A;  1NDO A;  3CLQ A;  3P32 A;  4AYC A;  3U1C A;  2CK3 H;  3HD7 C;  2Q9I A;  2QJY B;  1BGY E;  3FGA D;  1UIX A;  2YKO A;  3UIA A;  3VN0 A;  1NHL A;  3HUS B;  1GL2 C;  2OYO A;  3VCP A;  1EXJ A;  1VF5 C;  3CCL P;  1CI6 B;  3BCC J;  1KIL A;  2C9L Y;  5H2F H;  4HM8 A;  2W8Z A;  2IFN A;  3CXH H;  4JBZ A;  1S9K D;  1NTZ J;  1NTZ D;  5KLI C;  1J2J B;  1BCC E;  4PJ0 H;  2IZ1 A;  2WTY A;  1GD2 E;  1G1I A;  2WZ7 A;  4RES B;  3GG2 A;  3VYI A;  3IN6 A;  3HE5 B;  3RBX A;  3Q3D A;  1DD3 A;  1ZOY C;  1M1K Q;  1KOR A;  1OVV A;  3EQQ A;  2OYI A;  2FY8 A;  3E1I A;  1P84 H;  1IFJ A;  1PZQ A;  4HH2 A;  1Y8A A;  1OZH A;  1D7M A;  1PPJ G;  4NBH D;  4PV1 B;  3CD6 P;  3HD7 A;  2K1A A;  4DCK A;  2FYU G;  3AE5 C;  3VMX A;  1H88 A;  5KAI H;  3K5B A;  4N3Y B;  3RK3 C;  2FFD A;  3M9B A;  1ZR2 A;  3F89 A;  1GL2 A;  1ULJ A;  2E75 C;  1KYO E;  5APY A;  2WSC H;  2R5B A;  2JJL A;  3MGN A;  4PD4 H;  3CCV P;  1VPC A;  1GTW A;  3GF3 A;  3E7K A;  1NKZ B;  1YBK A;  2KUB A;  4WB4 A;  1PGJ A;  1DD4 A;  2E5Y A;  1O7N A;  1SFC A;  2I1J A;  4LGD E;  1L4A B;  4H0L B;  1FS0 E;  3GHG B;  3MZW B;  4RKU J;  3L74 E;  1PP9 G;  3H1L G;  5CCG D;  2NWF A;  2O01 N;  2GM4 A;  4W7Y A;  2LXC B;  4HKV A;  2Y0C A;  2O1K A;  3F5H A;  4QMA A;  3Q1M A;  2WWW A;  1L4A C;  2Q6Q A;  3KPE A;  1KIL D;  3M91 A;  5KTB A;  5KAI E;  2M3E A;  3RK2 D;  3RK3 E;  4C7R A;  1NWQ A;  5CJ4 A;  3FOU A;  1SQX G;  2P10 A;  1P84 D;  3L75 G;  3GKE A;  2QVA A;  3GCE A;  4IOI H;  5CBO A;  2W83 C;  2V4H A;  2P7J A;  3V2Q A;  1HGZ A;  3TDK A;  1QVF O;  1KMI Z;  1L0L K;  2CKF A;  4O9B A;  3TGU E;  1KQS O;  4KT0 J;  5GTI E;  4UB6 E;  3QH9 A;  3P8M C;  3AE9 C;  4GDO A;  1O7W A;  2RKL A;  1DEB A;  3L35 A;  2W27 A;  5B5E E;  3WMM 0;  3TF5 A;  2FYU E;  4HJL A;  3D71 A;  2R3S A;  1RIE A;  4Z1M H;  4D6T D;  3V2N A;  3A2A A;  2HPC A;  1BE3 G;  1FJP A;  3AZC A;  3ITK A;  2HFE D;  4XA4 A;  3EFG A;  1SFC D;  1BCC G;  3ABV C;  1SQQ G;  4HB1 A;  2FXM A;  2LKM A;  1FZE A;  3PH0 A;  3H32 B;  2N1T C;  1PL5 A;  2WSE J;  3QWO C;  4HJG H;  1N7S B;  2D2C C;  2OYI B;  3JC2 2;  4H13 D;  3GL2 A;  4WVZ A;  5KJ7 A;  1BSN A;  3L70 G;  2ZYL A;  1FJK A;  2IFM A;  4IL6 X;  3H1K J;  1HUC A;  4DT0 A;  3LID A;  3CCJ P;  2G3A A;  3CCR P;  5AW1 B;  4NBE D;  2SPZ A;  4NB9 D;  2QEX P;  3H1H E;  1RF0 A;  1WQL A;  2W90 A;  4EYY Q;  3VMZ A;  4DJG A;  1LJ2 A;  3CI9 A;  2QJY C;  3W68 A;  3L73 J;  3L75 D;  4WY4 A;  2B24 A;  1JMM A;  5KLV E;  3MIW A;  1T8Z A;  1URQ C;  3HRN A;  3L72 J;  1FDI A;  2G8Y A;  1UII A;  2E5T A;  5L8R J;  5GTH E;  1KC8 Q;  1MFZ A;  1TU3 F;  3AE1 C;  4I1L A;  2ZVO B;  1T2K C;  5AW3 B;  1SQQ E;  2O1J A;  1NJI Q;  3SWK A;  3LIE A;  1N73 B;  3GF7 A;  2XU6 A;  1LTJ B;  5KLI B;  3HE4 A;  3CCU P;  5AVS B;  1EZV G;  3VOP A;  2AXC A;  4BWN A;  3N4X A;  2P2U A;  2K3R A;  1SQV E;  4PD4 I;  4NBC D;  3H1I J;  2DE5 D;  3IR9 A;  4I7Z C;  2P58 A;  2PFX A;  4N78 E;  1NU1 J;  1AA0 A;  4WWI A;  1PP9 J;  3H1L J;  4K3A A;  2Z5H A;  1NTK D;  1LNQ A;  2OAR A;  3B71 A;  2W6B A;  1J1E B;  2NUM A;  2XNX A;  4L76 A;  1LP1 B;  3A0B H;  5CXM A;  2J59 M;  1E5W A;  2YKP A;  1HBW A;  1WT6 A;  1NU1 G;  5CCH C;  2B89 A;  1MZ9 A;  5APS A;  3MUD A;  2YO2 A;  5BU8 B;  2NPS D;  1DIP A;  3L75 E;  3S4R A;  3N0Q A;  1ZP0 C;  1KIL E;  2B88 A;  1EDI A;  1G2C A;  5HL4 A;  2E74 C;  4MN4 C;  2BCC J;  1LWU A;  1NTM J;  2HLO A;  3VCA A;  4NPD A;  3IFM A;  1G8K B;  4QUQ A;  4AIV A;  1SQX D;  1VQM P;  2ZJS E;  1FZC B;  4HM2 A;  1VQ7 P;  1O7M A;  1YJW P;  2H7H A;  2YVJ B;  2KLV A;  1JMB A;  2BMQ A;  3M0D A;  2HMJ A;  2E76 D;  3V5B A;  1NOH A;  1PP9 E;  3H1L E;  1BSH A;  1M90 Q;  1OVR A;  1QGK B;  2JWA A;  4XE5 B;  4P1C H;  2Z5I A;  3L72 G;  3B5N C;  2WPR A;  1LTB C;  4M3L A;  4DZO A;  3O6Q A;  1KQL A;  2M0B A;  1JY2 P;  1SQV J;  1KFN A;  3EFF K;  3IF4 A;  5M1B A;  1FZC A;  1ULI A;  3TK1 A;  1N2D C;  5K5G B;  2YNY A;  1X9V A;  3Q5R A;  3L73 G;  1AV1 A;  1HJB A;  1IFI A;  1FZB A;  2K37 A;  2OGU A;  3CX5 I;  2B1X A;  1VQN P;  3GL0 A;  3EWK A;  2WSS H;  3RK2 C;  1USE A;  2NVG A;  2A06 E;  1RE4 A;  2E4P A;  2A06 G;  1IK7 A;  4UB6 H;  4NBG D;  3KQG A;  1LT9 B;  1VQO P;  3SSU A;  3HD7 D;  1MV8 A;  1OVU A;  3CL3 D;  5KJ7 C;  3H25 A;  3L73 E;  2E75 B;  3GTE A;  1OW7 A;  4KJM A;  3GZX A;  2IPP A;  2HG5 D;  2ITA A;  3HTK A;  5BU5 A;  3TGU D;  4YPC A;  5AW2 B;  5AVU B;  2MKV A;  5E79 E;  1SQQ J;  2YXR B;  1M1J B;  3JSV C;  1CSB A;  1AVY A;  4JF7 A;  5B66 E;  1RF1 A;  1M1J A;  1JY2 O;  1SP4 A;  1ZN5 A;  1GW4 A;  3HTK B;  1L4A A;  1SFC B;  2L91 A;  3B5N A;  4B86 A;  2D2C B;  1URQ B;  3II6 A;  2WSF J;  1T3J A;  3VP8 A;  1IJD B;  2AXT E;  3C0D A;  1QX8 A;  1W2B O;  1IZN B;  1NAF A;  2KYV A;  2ZT9 C;  5AVV B;  1AFO A;  2YMK A;  1T3U A;  1SQB J;  2WSE H;  1JNM A;  1L0L D;  1JM1 A;  1DH3 A;  3RL0 D;  1X22 A;  4QDC A;  1W5C E;  3RK3 D;  3WU2 E;  1SQP E;  1GK4 A;  1VQP P;  3OAK A;  3SFE C;  2MJZ A;  1VQ4 P;  2HOD A;  4PV1 C;  1VQ5 P;  5AEW A;  2ZVN B;  3FWL A;  3BCC D;  5APU A;  3H1J G;  2C9N Y;  1Q86 Q;  3TNU B;  5AW5 B;  3VMH D;  4U3F E;  3NXS A;  1OMI A;  2Q3W A;  1VQK P;  3ZDM A;  4QUR A;  3HE5 A;  2XZR A;  3AE7 C;  2QJP B;  3VTP C;  1L0N G;  3V4W A;  1PIX A;  4HM6 A;  1RF1 C;  3CWB J;  3L70 D;  1OXZ A;  5AW9 B;  3C8V A;  1G8J B;  1QVG O;  1KV4 A;  1R5L A;  1BDD A;  1O7P A;  2HML A;  2QE7 H;  4HM4 A;  2HPC B;  1KB9 H;  2BCC G;  1FC2 C;  3CWB G;  2KNC B;  3A7O A;  3VMI D;  2IZ0 A;  3AEE C;  2N1T B;  2Q3I A;  1KTM A;  5B5E H;  2OYH B;  1KB9 D;  3MUD C;  3VMY A;  2AXT H;  3L36 A;  2Q5U A;  4QDF B;  3U1A A;  3VMA A;  3NFQ A;  2NUK A;  3M9Q A;  4OGQ C;  1FDM A;  2OTL P;  4IFM A;  1J1D B;  3O8Z A;  1FZA A;  3KZI E;  1IK9 A;  2HMO A;  1G1J A;  4UB8 E;  1YIJ P;  3WUT A;  4RJT A;  2Y0E A;  1EZV D;  1NGM B;  2Z4E A;  1MUU A;  5AVT B;  3CXH I;  3CCM P;  2ZT9 B;  1FQT A;  3H1H D;  3L70 E;  3T97 B;  2HMM A;  1JCC A;  5CHX A;  2I1K A;  4AAY B;  1RQU A;  1N73 A;  1HWT C;  5AEU A;  3EN1 A;  3M0A A;  2GUS A;  4HYT B;  2IYO A;  1LTJ C;  1Q90 D;  1NTK G;  1BE3 E;  1YTZ T;  2JO6 A;  1L0L J;  1R8E A;  1SQP J;  3GHG A;  2A45 I;  2I8D A;  1NO4 A;  1YI2 P;  3H1K G;  1BGY J;  2E76 C;  1RFS A;  2H89 C;  3I56 P;  1M1J C;  1PGP A;  2P1J A;  4I6M C;  2JP3 A; 
#chains in the Genus database with same CATH homology
 3BCC E;  5KKZ C;  4QUP A;  2QPZ A;  1Y9B A;  1UUW A;  2IDB A;  1PV3 A;  1VF5 D;  1SQV E;  4NBC D;  3IAO A;  2DE5 D;  3D6Z A;  4I7Z C;  3AE3 C;  4Y28 J;  1OW6 A;  4H0L C;  2E4Q A;  4H44 D;  4H13 C;  2YIU C;  2IBZ E;  2JO1 A;  3B71 A;  4XFJ A;  1KQF B;  2NUM A;  5CXM A;  1RQV A;  2NZ2 A;  2O01 J;  4H13 B;  1NTM E;  1DIP A;  3L75 E;  3N0Q A;  1ZP0 C;  3Q5P A;  1KIL E;  2E76 B;  2ZT9 D;  1HJ0 A;  3AE4 C;  3D89 A;  5HL4 A;  1KQG B;  2E74 C;  2V7Q J;  3H1I E;  2QIW A;  1NTK E;  1VL2 A;  3VCA A;  2QSI A;  1G8K B;  4QUQ A;  4AIV A;  4HM5 A;  2WSC J;  1EZV E;  4HM2 A;  1O7M A;  2YVJ B;  1NYH A;  3Q5S A;  2BMQ A;  1UUV A;  2HMJ A;  2E76 D;  1PP9 E;  3H1L E;  2XRX A;  4HM1 A;  1NDO A;  4P1C H;  2NVE A;  3FGA D;  1O7H A;  1UIX A;  3AE6 C;  3O6Q A;  5M1B A;  1SQB E;  2HMK A;  4NBD D;  3VCP A;  1EXJ A;  1ULI A;  5BOK A;  1OW8 A;  1NTZ E;  3H1K E;  1VF5 C;  3AEB C;  2E74 D;  4HM8 A;  1NYK A;  2YFL A;  3Q5R A;  4H44 C;  2E75 D;  5KLI C;  3RL0 g;  1BCC E;  2B1X A;  4NBB D;  3GL0 A;  3EWK A;  3IN6 A;  4HM0 A;  2NVG A;  2A06 E;  2DE7 D;  4TT3 H;  3Q3D A;  1DD3 A;  1ZOY C;  2DE6 D;  4R4L A;  2E4P A;  1IK7 A;  2XSH A;  2XR8 A;  1KOR A;  4NBG D;  3EQQ A;  4YXD C;  4H44 B;  3GMA A;  3H25 A;  2BEZ F;  3L73 E;  2E75 B;  3CWB E;  1GMJ A;  4NBH D;  3GTE A;  4PV1 B;  1OW7 A;  3GZX A;  1ZME C;  1L0L E;  3AE5 C;  4NB8 D;  2I7F A;  3L71 E;  2MKV A;  3R4Y A;  2YFJ A;  1O7G A;  2BCC E;  1ULJ A;  2E75 C;  1KYO E;  2YFI A;  3GF3 A;  1YQ3 C;  2D2C B;  1DD4 A;  1O7N A;  3G9R A;  2WSF J;  4I7Z B;  4QDF A;  4H0L B;  3GZY A;  3C0D A;  4RKU J;  2ZT9 C;  1VCK A;  3L74 E;  4U7J A;  2YMK A;  2NWF A;  2J5U A;  1JM1 A;  4OGQ D;  4HKV A;  2GBW A;  4QDC A;  1L0N E;  3Q1M A;  1SQP E;  3CXH E;  2D2C D;  3SFE C;  1ZRT E;  4PV1 C;  4P1B H;  1AJY A;  5AEW A;  4PD4 E;  3RK3 E;  4NBF D;  1U57 A;  2GBX A;  3FOU A;  3AE8 C;  2P10 A;  3VMH D;  4YTP C;  1SQX E;  2H88 C;  4U3F E;  3GKE A;  1OMI A;  3AEG C;  3GCE A;  4OGQ B;  3SFD C;  1SJG A;  2Q3W A;  3GOB A;  4QUR A;  4EMJ B;  2HMN A;  1JB0 J;  3AE7 C;  1HF9 A;  4HM7 A;  1KB9 E;  1PIX A;  3H1J E;  4HM6 A;  2XSO A;  1KMI Z;  2CKF A;  3AEF C;  3DQY A;  3S9O A;  3C8V A;  1G8J B;  1Q90 C;  3TGU E;  1WMK A;  1S1C X;  3CX5 E;  1O7P A;  4KT0 J;  2HML A;  4PV1 D;  1YQ4 C;  4HM4 A;  2OQQ A;  3AE9 C;  4GDO A;  1O7W A;  3VMI D;  1P84 E;  1VF5 B;  3AEE C;  2FYU E;  4HJL A;  1KTM A;  2K9Y A;  2WPV B;  3D71 A;  1EXI A;  4Z1M H;  1RIE A;  3AZC A;  4QDF B;  3GB4 A;  3GTS A;  4NBA D;  3ABV C;  2NUK A;  3AED C;  4OGQ C;  1PL5 A;  1S5L X;  2WSE J;  2WQY C;  1K04 A;  4H0L D;  4HM3 A;  1MKM A;  1VM9 A;  1K05 A;  2HMO A;  2QJP C;  2D2C C;  3AEC C;  4H13 D;  3GLM A;  3GL2 A;  1NGM B;  3D70 A;  2FYN C;  3AEA C;  1EG9 A;  2ZYL A;  2ZT9 B;  4IL6 X;  1FQT A;  4QCK A;  3L70 E;  1PPJ E;  2BEQ D;  3AE2 C;  3D6Y A;  3L72 E;  2G3A A;  3T97 B;  2FXP A;  4NBE D;  2HMM A;  4NB9 D;  3VMG D;  4AAY B;  2NVF A;  3H1H E;  1RQU A;  1WQL A;  5AEU A;  3EN1 A;  2QJY C;  2FBW C;  2B24 A;  5KLV E;  1Q90 D;  1BE3 E;  4R4M A;  2JO6 A;  2BMO A;  1FDI A;  2G8Y A;  5L8R J;  1R8E A;  1TU3 F;  3AE1 C;  4QDD A;  1SQQ E;  1FDO A;  2JZA A;  2E76 C;  1RFS A;  3Q2Y A;  2H89 C;  3GF7 A;  1NU1 E;  2E74 B;  3LW5 J;  2JP3 A;  2QJK C;  2BMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...