2QKCA

Structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKLNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and kinetic study of differences between human and Escherichia coli manganese superoxide dismutases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 72
structure length 196
sequence length 196
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2qkcA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2qkcA02
3AK3A 1IX9A 1BS3A 1PL4A 1GN6A 2CE4A 1JR9A 4F6EA 1Y67A 1LUWA 4YIOA 5A9GA 1MNGA 1XDCA 1AR5A 1QNMA 1VEWA 1IXBA 3BFRA 2QKCA 3RN4A 3TJTA 1BT8A 1D5NA 3DC5A 1ZLZA 1WB7A 1EN5A 3MDSA 2ADPA 4JZ2A 3KKYA 1LUVA 1BSMA 4X9QA 4E4EA 1XUQA 1AVMA 1KKCA 2P4KA 1XREA 3C3SA 1I08A 1XILA 4C7UA 2GDSA 1PM9A 1ZTEA 1SZXA 2QKAA 3EVKA 3QVNA 1EM1A 3K9SA 3OT7A 1AR4A 1AP5A 1MA1A 3CEIA 1ZUQA 2RCVA 3IC9A 1AP6A 3AK2A 5AG2A 1I0HA 1MMMA 1N0JA 1GN2A 1VARA 3C3TA 1MSDA 4BR6A 4JYYA 2CDYA 2ADQB 3DC6A 1EN4A 1B06A 1WB8A 1P7GA 1EN6A 1N0NA 4FFKA 2AW9A 3AK1A 4GUNA 1JA8A 1GN4A 4JZGA 1IDSA 1GN3A 1ZSPA 3LSUA 4YIPA
chains in the Genus database with same CATH superfamily
4U3JB 2EINC 1XMQO 3SYPA 3JSNA 3NR7A 3WFVA 1XMOO 2LW1A 5LGTA 4WFGA 4NXNB 2YI9A 3J7AU 1VQ6V 2P6JA 3G6BA 4XDJA 1N33B 2EIMC 2ZINA 1YTFD 4UCVA 1WJZA 1GKFA 5IY5C 5LYJB 1HNXB 4B3MB 4GX2A 5KUKA 4DUYO 1CXZB 4XDKA 1VMGA 2ZIMA 1I7FA 4Z1MG 2UU9B 4H33A 2GUZA 1DF4A 1MG1A 3JATB 3H1KH 1IVSA 3L74H 3K08A 2ZIOA 1CPYA 1K4CC 3AG4C 1US6A 5LOVB 4J42A 1Y66A 2NLJC 4C7UA 4R8CA 4X88A 4G27B 2Y69B 2OWOA 4PA6A 1K5SA 2PUSA 1X4TA 2IJJA 5BY1A 3TETA 5KA5A 4H37A 3Q4HB 3QO5A 5JH7A 2DQ3A 1RSOB 4W4LA 1FS0G 3AK2A 2JGDB 4DUYB 1SERA 2JVDA 4TV8B 4JI3O 1VARA 2R72A 2WLLA 3JAWB 4ZBMA 3JAMN 3DC6A 3OEEG 3E35A 3KCYA 2UXBO 3OW2U 4FLWA 1CP9A 1PNLA 3BA8A 4JI2O 5EZYB 1VQKV 1FJGB 3WG7C 1KP3A 3VBBA 4JI1O 4H0LB 3L73H 1J5EO 3DXRA 4DV2O 4DRXB 2L35A 2ZR3A 2QWOB 4DV4B 3AG1C 3OUFA 2B1IA 2KQXA 3MHHC 1E1RG 4MVOA 3APQA 4B7EA 2IJIA 3T4DA 3FB6C 4DR1B 1NKDA 1XMQB 2XHBA 4BAYA 2X7RB 1XNQO 4EKWA 2IH3C 4LNUA 3OMIB 3E83A 3D3QA 3ZS8C 2HJFC 1KD1W 2KSDA 2A0LA 3ABMC 1I94O 1PNMA 4O2AB 3OFNG 1VF5B 1SQQH 2BCCH 5IYZA 2GV9A 3AG4B 1LR1A 2DYRC 2Q9LA 2KKWA 1BGYH 1NI8A 3ASNB 3OR7C 2V7QG 5FLXN 1M56C 4JTAB 1XHXA 5DM6V 5IWAO 1Q5OA 3HKDA 1H2MA 1IBKO 4OPAA 4Q20A 2VQFB 1KKCA 4TV8A 3ETQA 1XREA 5JVDA 2FTKA 4O4JA 2GDSA 4R7CA 2JK5C 3ZHVA 3CS5A 1ZTEA 4MVRA 1IBMB 4HNAA 3RYCB 1FJGO 1XNRO 4AHCA 3H1JH 2FKXA 5JCOA 1RPOA 4OX9B 1W59A 2Q7EA 4G28B 2VWJA 3S3WA 2DYSC 2H94A 3D36A 2MW2B 1YI2V 4O2BA 1EN6A 3ZMUA 2XNDG 4IGGA 4DRXA 1G4YB 2YIBA 2F23A 3F5WC 2X0LA 3O9OA 1XOUA 1ZSPA 3K03A 3OM3B 1FFXA 5IJ9A 2A3QA 1QR9A 4YHHB 2OCCB 4LFCB 1Q3EA 2YI8A 4ZOLB 1YVWA 5BR8O 3LDEA 3VQYA 5GTIZ 5J9PC 3HKBA 1HNXO 3K58A 4B3MO 2BSKA 2HVJC 4UFZA 3HB3B 1E79G 4RO2A 4X1IA 2QWRB 3ZHTA 2FYUH 4QE9A 3TJTA 1KECA 1BT8A 3FAVB 2EBOA 2DMXA 2ILMA 4LR3A 1WB7A 2Y4TA 4MTGA 3OR6C 2CH7A 1OHHG 3MDSA 2ADPA 1QCEA 3G4SV 1VF7A 2ZXWB 1Q82W 4X65B 4DV0O 4K8XA 2F93B 2JIZG 2AHZA 1XHZA 1WN7A 4LNUB 2XT9A 1QLEB 5H6QA 1YJ9V 2ODMA 4DUZO 3LUTB 2RCVA 4J9YB 3T4ZA 2G38A 5CA3A 1QBZA 1ZWIC 1NH2D 3CCUV 5GW7A 5CN0A 4O4LA 1GN2A 3BPZA 3E89A 4PDLA 1G6UA 4I0XA 2AGAA 2ADQB 5LP6B 2E5LO 4FFBB 4LF8B 2A9HA 4EFBA 1DLBA 5J2UA 5L3GA 4DV5B 1RM1B 1OJHA 4X64O 4AQYO 2P22C 1KU9A 4X20A 2QWNB 5GONA 3CCEV 1OCCB 2UXDB 4ZKIA 4I7ZB 2GSMB 3ZRWB 3K5MA 4JI6O 3APOA 4PJ0Z 1B04A 4WBNA 5B1NA 4UCOA 1M57C 1R6TA 5KAIZ 1FXKC 1J5EB 3E8GA 3GVMA 3RBZA 4AQYB 3ZHSA 5BZBA 1THZA 2QKCA 3LDCA 4IHJA 1FAFA 3MHSC 1AJQA 5L3EA 2ZQMA 3OD4A 3IFXA 3FB8C 2ITDC 4LFAO 4B3SB 4QGPA 4CZZA 1Q86W 3F7YC 3BAAA 3R66A 5D5PA 3KKYA 4UVBA 2JEXA 2K1EA 1K4DC 4QPKA 4LF6O 1EFRG 2LP7A 3SYAA 2RQ6A 4DXWA 3ASOB 2UXCB 3HKBB 5EC2C 2QKAA 5GTHZ 3QVNA 1F4NA 3SPJA 1H38A 4EB6A 4GKJO 5ITZB 3CXCU 3K3WA 3K5NA 1QQCA 1MZEA 4B3SO 1URFA 1G8MA 4K8ZA 1P49A 4UB6Z 4GZRB 2E76B 3CCSV 4KHPO 3BRCA 3SPCA 5IDJA 2EILC 3UO2A 1HR0B 2XASA 3EHBB 3OAAG 1JOYA 2P7TC 4TSFG 4DV6B 3QO7A 4LF6B 3JARB 4U7NA 1M1KW 4UV8A 4RWUA 5LMNB 4FM2A 3OMAB 1K73W 1NVPD 1FKAO 4I55B 1GN6A 3U0ZA 5B3SB 3JASA 4PA4A 2WLLB 3BABA 1RFYA 3HKCB 4BW9A 2DW4A 4IYHA 4HBNA 3J81N 1OZ0A 4FVMA 4MVSA 3K57A 4B3RO 5KMGA 1IXBA 3L72H 3CHXA 2CGNA 4D7SA 1AILA 3UQ8A 2BE3A 1XI1A 3ML0A 2R9IA 2HEPA 3SJCC 1HP8A 2Y0PA 1TGOA 4EFEA 5LMUO 4DK1A 1NQTA 4Z1VA 3AG7A 2EZPA 4DYLA 3SJQC 2P06A 4CBCA 1V55C 1NVPB 1ZX3A 5KX5A 3ZN1A 1SRYA 1V55B 1WA8B 5LMUB 5B1BB 1V9PA 2PTMA 4O4JB 4X65O 4DR2B 1BCCH 1MA1A 1KP2A 3L9DA 5AG2A 4DV1O 1K3EA 2DYSB 1R6NA 1U97A 4MT8A 4K35A 4JYYA 5LYJA 1IBLB 4JI6B 2JDIG 3WB2A 2QA4V 2ZM6B 1QHTA 3OTFA 1N36B 4XDLA 4WF9V 3AG2B 2DOSA 2E3CA 4FJCC 2Q6AA 3CXHF 1OCOC 4X1YA 3OE7G 3ZHRA 4CH6A 1JR9A 4J7ZA 1JX9A 4E2LA 1Y67A 5K1PA 1R3KC 2YIBD 3CYOA 4HNAB 4O2AA 3E22B 2UUBO 4P9PA 1VQNV 3ABKB 2UXBB 3G80A 3CRCA 3SJBC 5L3CA 3WG7B 1PD3A 5GONB 4QPJA 3S3XA 1VF6C 3ETGA 3HKCA 4AILC 2YICA 4KFMA 1ZAUA 1HWYA 1FXKA 3AG1B 1S76D 1BE3H 5JWPA 3RYIB 3UO3A 4HAMA 3JAKB 4UCTA 3CSXA 2FB5A 3E8FA 2LGQA 3X2QB 2ZDIA 5LHGA 5KHGA 4JI7B 4J80A 4ABMA 1RSOA 5LGNA 1XILA 2Y48A 4PDVA 3AG2C 3P32A 4PV1B 4NVPA 4HYOA 1Q7YW 1Q6UA 4OPHA 1AP5A 5KAFZ 3B8NA 2ZCEA 3OGIB 2W0FC 1XL6A 2PF4E 5L3BA 3RYHB 3CC4V 1WNSA 1TUEB 3B2EE 4TOIA 4RUFA 3DGEA 4LF5O 1F7YA 4BW5A 3SGIA 5IWAB 1IBKB 1RP3B 4CS2A 1VQ4V 2ZR2A 1Q6IA 4I4TB 1GM8A 1BZKA 1KC8W 2Q67A 4RUEA 4FFKA 4GUNA 2QKSA 1W0KG 4MW3A 3N2GB 2YEVA 1GN4A 4F6RB 2F4VB 4TQDA 4CH5A 4A5UB 4LF9B 2QWQB 1YF2A 4TUYA 1HNWB 4B7KA 1IX9A 1Y74A 3T2MA 2Q68A 4F6EA 3H01A 5EK0A 1YJWV 1LUWA 1GK9A 2PYLA 4FLTA 4X89A 1N34B 4MTXA 5KHJA 5CMUA 1AR5A 1WP8A 1EBOA 2ZNJA 4GKKO 4K0KB 2OTJV 2BSKB 4DR5O 4U3JA 4GLXA 2WA4A 1NR7A 1S3JA 4JV5O 4KXRA 4LFBO 1SC5B 3ZRSA 4UV9A 4ICGA 2QGNA 4JI2B 1MOFA 4MVUA 3CCVV 1IZ3A 5B66Z 5LP6C 4CS3A 2ZD9A 1TVKB 3ASNC 2HG5C 3SPIA 3THOA 4E4EA 1Z5WA 3LNMB 2QDOA 3TXQA 2E74B 4JI3B 2PZSA 2F66C 3C3SA 3KG2A 1UJWB 1VQ8V 5LA6B 1E1QG 2B5UA 2YC0A 2XAHA 3RYHA 2UXXA 4WCEV 3CX5F 3JD2A 1K9MW 3VOUA 4TUYB 2NR5A 3B4SA 4L8JA 2JGUA 5LL6Y 5FPOA 3N2GA 2L6LA 2QM7A 4FZ1A 4JYBA 2HHHO 1WPXA 2OT5A 4JI8O 1GRJA 4FIPC 1IBMO 5BMVA 3GWOA 1JCHA 4JTCB 3JD1A 2CK3G 3LSUA 3T1YO 3ZJZA 1XQ8A 5CB4B 1I5XA 4MVQA 1SETA 1JFFB 1ROPA 1MZFA 3RWRD 5H5NA 2WWWA 3CCRV 2IM9A 4NR1A 1NR1A 1XL4A 4H13B 1H2KA 5DEDA 5JQGA 3AG3B 3UT5A 2Q73A 4FK5C 5A9GA 3ABUA 1BL8A 1LNQA 3AG3C 4I0XB 5LGUA 1XEQA 4WFBV 2JS5A 2QSAA 1RM1C 4FLVA 4JI8B 3G6EV 4NXMO 4U3FH 1FFTB 1SQBH 2ITCC 1VP7A 2JJ2G 3DC5A 4UCRA 1D2DA 1S5JA 3E8HA 3FYIB 3BA9A 3ZHUA 5C8YB 4IIJB 2WLMA 2P90A 2C2AA 1EN5A 2ZE8A 1I5YA 1JJ2U 5IYDO 4DR2O 1AVMA 4GT1A 4I9WA 2P4KA 1I08A 1SQVH 3BVOA 2HJDA 2RJZA 5LA6A 3KZIZ 2D3OW 5JQGB 2B1GA 2ARHA 3F7VC 1N33O 5LBQA 2WLKA 3STLC 3CJHB 4WFFA 2PYJA 5LXTA 2HKOA 2Z0AA 3GB7C 4X8AA 3TGUH 1H2SB 4DR6O 2Y0IA 5BMVB 3EFFK 3K5OA 5KX5B 1DTOA 3JARA 2IJHA 1F51A 1WPBA 1N0NA 1Y4MA 3F5TA 4X1KA 5JJEB 2UXCO 2DWDC 4BIUA 4GX1A 2VRZA 4X20B 1IJGA 3JYCA 4DR1O 4X64B 2QTOA 4OXSA 2YXHA 1QU7A 1NBMG 1H2NA 4PI0A 5LHHA 1JQ0A 4JYCA 3D36C 3P30A 4UVAA 5J2TB 2HVKC 4PA3A 1XNQB 3CC2V 2QEXV 3ABKC 4DUZB 2MK3A 3N2KA 5IT9N 1R73A 3JSLA 4XBFA 4DV7B 2RMKB 4BWAA 2BTOA 3Q4HA 5JH7B 4KHPB 4J7JA 2O57A 3K5LA 3N2KB 4I55A 1R3IC 4MS2A 4MTFA 3FKSG 2VQEB 2R9AA 4ZOLA 3U11A 1ZLZA 4BIZA 3A2FA 3QG5A 1VF6A 2EIKC 1AI4A 1VQOV 1YTFB 4FZ0A 2WA3A 3KDRA 2DQ0A 3MAQA 3MD0A 1KMIZ 1XMOB 5DECA 4RQEA 5KUMA 2KG7A 5LOVA 2CH7B 3CB2A 3EXAA 3CRAA 3GWKC 5JJJB 1WLEA 2GUZB 2DYRB 4H44B 4OGQB 5B5EZ 3ZMVA 4GYCB 4F4LA 2LO1A 3CJHA 2BOCC 2YSUB 2OIGA 4LF7B 1R3LC 1JVMA 3C3TA 4BR6A 3C90A 4IL6Z 5CA1A 4P2ZA 3ZBHA 3M8AA 4JAAA 1YCIA 3T1HO 3H9VA 4KUMA 4MVMA 1HW7A 5FNVB 4YIPA 4DV6O 2UUCO 3P3PA 3ICXA 1SQPH 3LNNA 2F1MA 3R65A 5FNVA 1N34O 1Y6XA 3TK1A 1H2GA 1R3JC 4NYKA 3IGAC 1NS1A 4YIOA 3H1IH 5KHKA 3QTCA 1VQPV 3RT3C 4LFBB 1MNGA 3CE2A 1WA8A 2Q69A 2YEVB 4F6RA 3RFRA 1S5HC 2JS3A 4TQFA 1IXMA 4LC1A 4FLXA 2ZE5A 4QJFB 1J95A 2XOKG 2N04A 5J2TA 4J7KA 2YDEA 2ZE7A 3SPGA 4OX9O 1IBLO 1VQ5V 4MVZA 3E2EA 4JI0B 2Y69C 4PA9A 2DE0X 4X66B 4JZ2A 3HKDB 1BSMA 3FAVA 3PJSK 3G71V 1S0VA 2JJ1G 1F4MA 4LP8A 1M4UA 1ZL8B 4ZI7A 5IYZB 2LGWA 3JATA 3OUSA 5L3FA 2QWPB 1SQGA 3UM7A 4I50A 2RNBA 1HR0O 4DR7O 3WU2Z 1Z2GA 1RPRA 1S77D 1KUQA 2XAJA 1QVFU 1AP6A 5IY5B 2ATKC 4YY3O 1FXKB 1H5WA 3FX7A 3P3NA 1AJPA 4DW0A 2UUAO 2CDYA 4IYIA 1QLNA 3DTUB 2QE7G 1NZ6A 3RVZA 1VQ9V 2YXLA 4DR7B 3SYCA 4JI7O 2UXDO 4JZGA 1GM9A 1GN3A 2GBOA 2LFSA 5B1OA 4GCZA 4G2KA 4X1IB 4UUJC 2QM8A 2VS0A 1VQ7V 1JJOA 1OCOB 4DR3O 2ZDIC 2OCCC 4N21A 4UXNA 1YIJV 3QF7A 2GTSA 4JF3A 3M7MX 1L0LH 3VQXA 1PL0A 1TA8A 2HHHB 1CEZA 1QNMA 1AR1B 1OCCC 3ZRVA 5L3DA 2FMLA 5EBWC 2A06H 1M56B 1R1BA 2NN4A 3W7XA 1NTKH 3H1HH 2CTPA 5BXZA 3K0DA 3SYQA 1U96A 2AHYA 2Q5ZA 4O4IB 5KMGB 5C93A 4QE7A 3CPWU 2EILB 4LH7A 3ZIAG 4X9QA 4YXWG 2Q4PA 1HNWO 4MTOA 2VQEO 1V54B 1NH2B 4P9OA 2AZ0A 2PI4A 4EEQA 3ZMZA 1YXBA 3ZHQA 1AROP 3SYOA 3UKMA 1XNRB 2UU9O 4TWKA 1P84F 5EIBD 4TV9B 3SPHA 4JI5O 3IC9A 4DR6B 4O4IA 2WLHA 3A0RA 5KHIA 2P5OA 4I50B 1T5EA 4WFEA 2M7WA 1Z5VA 3FB5C 4UCSA 3I55V 3B40A 4AI8A 2XAFA 4LF4O 1DGSA 3QNEA 1MSWD 4QNHB 1OCRC 1TVKA 3BCCH 1FYJA 4JTDB 2OTLV 5LP6A 1EZJA 2H3OA 1OCRB 3BEHA 1KKDA 1Y74B 5H2FZ 1PL4A 5EYPA 2CE4A 3E86A 3K04A 1NU1H 3A0BZ 3JD3A 2N05A 4JAUA 1FFXB 4TT3G 5IJ9B 2R9RB 5KLVH 1KQSU 4WFHA 2X6AA 3LSQA 4IHJB 1KYOF 2V4DA 1Q6HA 1XDCA 3VQVA 3K9AA 1DF5A 4O4HA 2UUCB 1OCZC 3RYFB 3SDLA 2RN9A 4LF5B 2WLJA 4NTWA 1BQZA 3RN4A 4LF4B 2KB1A 1K92A 5BR8B 1NTZH 3T1YB 4JYAB 4FLZA 1IURA 2ZNIA 4ZHQA 1UPGA 2PY5A 2EX3A 4X66O 3JCZA 5JJNB 3W7TA 5JVDB 1QLEC 1SESA 3E22A 2CTQA 1K5QA 3W7SA 4X1KB 3CRRA 3RYCA 4YHHO 4FM1A 1N36O 4PDRA 2EJ7A 3ABLC 4DK0A 3ZEDA 3IAYA 4LF7O 1NT2B 1PM9A 1GH6A 3CCQV 1DK1A 3EVKA 4NXMB 3RYIA 2Q0AA 1H8HG 3NXSA 4J41A 1A32A 2W6IG 4KP4A 4O4HB 4X62O 2UUAB 1D5AA 3ZRXA 1MMMA 5CBHA 3IC7A 3W7UA 3JCUZ 1YDXA 3BHPA 3CCJV 1EN4A 5IJ0B 1B06A 2EJRA 1P7GA 1GO3F 2X6CA 1AJNA 2IH1C 2WLIA 1JA8A 2DWEC 3OTOB 1IDSA 3ZX6A 1EZVH 2OIEA 5J2UB 1JFFA 1BS3A 1YZBA 3D8CA 2YIAA 2ETNA 4UCUA 2QR4A 3U10A 4LFCO 2H8PC 1SKVA 4W4KA 4GX5A 4IT5A 3K06A 4DV3O 4DR5B 3JASB 2NNUA 4GKJB 2YXYA 2N74A 4RQFA 1VQMV 3BFRA 5LXTB 2E75B 1PNKA 1D5NA 1JMKC 2YIDA 5D5QA 2KG7B 3B8MA 4JI5B 2UXNA 3I5DA 1LUVA 2Z5UA 1N32O 4PHZA 3QO8A 5H9CA 4JI1B 2BOBC 2IU0A 4LFAB 1GM7A 5CBGA 2LJ2A 1G1XB 4LF9O 1F23A 5IYBO 1K33A 2WSSG 4QIWF 5FPRA 2D2CB 4DR4O 2ZT9B 3N27A 5HFLA 5F2VO 3K9SA 3OT7A 1L8DA 2CTWA 3CCMV 2B9ZA 4B3TO 5EIBC 3K79A 4FFBA 3HKEB 3VQWA 2K9PA 1B6QA 4DV0B 1N32B 1I0HA 5B3SC 1OV9A 5IJ0A 5HFMA 4NXNO 2EZOA 1XBLA 4ASUG 4PELA 5KA6A 3CCLV 1N4CA 5A2QN 3AK1A 3JALB 2ZKOA 5FL7G 4J9ZB 1O9HA 2EIJC 1M90W 1YITV 4J10A 5K1XA 3AK3A 3PN1A 2GTAA 4PD4F 5CA0A 1ZL8A 4ZI7B 2Q7HA 1ENVA 1P4RA 1PPJH 4DW1A 3BY6A 4FLYA 2IBZH 1AI7A 3OEHG 1BHBA 1FPOA 3T1CA 5EBLC 2HLDG 3ZCCA 3ZRWA 3OMNB 4CH4A 4JV5B 2JRIA 4WBNB 3T1HB 2XAQA 5IE9A 1L0NH 4K3AA 1Y76A 2OYQA 1NJIW 2CUGA 3LSSA 4CC5A 1S72V 4I9QA 3AEIA 2LQTA 1H8EG 3JAKA 5CA0B 3STZC 1VIBA 4X1YB 4Z2WA 1XUQA 3SR2C 3ABTA 3CC7V 5E1AC 5CBFA 4YJ2B 1AI6A 1SF9A 2IJKA 2LW7A 2WLNA 1ORQC 1P7BA 3L70H 2BTQB 1WAZA 1WP7A 2EIJB 1KBHA 4MW8A 2DN9A 1M9NA 2W6JG 3CEIA 1Q8IA 3B09A 4NTXA 1Y76B 4DR4B 1BMFG 1QR8A 2YS8A 1FXHA 1K34A 2AXTZ 2BTQA 3DSQA 4U7OA 4GX0A 4JI0O 2HP8A 1Q81W 4WFAV 2ZE6A 3ASOC 1TAEA 4TV9A 3HPLC 4NTYA 1TUBB 4EB6B 1H2LA 3FB7C 1NTMH 5CA1B 3J80N 3OTOO 3DXRB 3CMEV 3TXSA 3WB0A 2QTSA 2ZM6O 5B1AB 4KL1A 1PV0A 3H1LH 4FLUA 1SA0A 4Q6GA 3ZN0A 2R70A 2P4VA 2YUAA 3E8BA 2QM4A 3CRMA 4JGSA 3M99B 5TISZ 4DV3B 4BIOA 5CB4A 2EULA 4MSWC 1VQLV 3I56V 1QVGU 4DO2A 2XTAA 5EC1C 5H6RA 3A0HZ 4DV1B 2GHYA 3OGCC 1VEWA 2A7WA 4DV4O 4YJ3A 3ZMSA 4PA7A 2Z3YA 2RDCA 4JI4B 1AI5A 2IW5A 3RYFA 2E5LB 2X6BA 1COWG 4NKGB 4O2BB 3CWBH 4CS4A 1HNZB 1R6KA 1PP9H 1GTOA 2CGOA 4LCUC 1M5IA 3CP1A 4LF8O 2Q7GA 4J11A 1O9GA 4D6TH 3FFQA 1BHAA 4JASA 4LWSB 2XAGA 4N23A 4R50A 2W0XA 4X62B 1BQ0A 3FD9A 3D3IA 2CAZC 4YJ3B 3CD6V 5LHIA 3W7WA 4UB8Z 3JD4A 3ETDA 4RAIA 3KCXA 1YJNV 3ZMTA 2EIMB 2V1DA 3O65A 4JPRA 1SA0B 4PDMA 4PI2A 4YJ2A 2ZXWC 4O4LB 4YY3B 5EBMC 3LDDA 4DV2B 2VWKA 4LH6A 5B1BC 4HZ3A 1K7DA 1SQXH 1WB8A 2LFRA 1L1FA 2AW9A 2JEUA 1UFIA 4D7TA 4NB5A 3K59A 5LMNO 4FM0A 2M6YA 2WAMA 2EIKB 3JD0A 2AZ2A 3L75H 1V54C 4FMTA 3RVYA 2F4VO 4I4TA 4DV7O 3WB1A 1TUBA 5IYCO 1B3QA 2F95B 1K8AW 1M93A 4R6ZA 3K0GA 2IU3A 4DR3B 3UT5B 5DN6G 3HR0A 1Q43A 2EINB 1YEWA 5C8YA 1K97A 1MABG 4JAVA 5EYPB 3SJAC 3FYEB 2Q8VA 3RGBA 4P30A 4K0KO 4GKKB 3CRQA 4I5SA 5ITZA 2Y4UA 1GAXA 1Q90D 4L87A 2F43G 5B1AC 2HFEC 4ZIBA 3B77A 2A79B 1AB3A 1M57B 3G67A 5KHHA 4CC6A 4B08A 4ZHQB 2JGDA 5EZYA 2PGGA 1S5LZ 3JALA 4IIJA 4B3TB 1SQFA 2FL4A 2WPDG 4CH3A 1KB9F 3IJ4A 3HKEA 4JYAO 3JAWA 1SZXA 4DV5O 1HDJA 4JI4O 1EM1A 1SZTA 3A8TA 2DJVA 3UCSC 1OCZB 3CMAV 1GMGA 1AR4A 1SS3A 3L71H 3X2QC 1FXVA 1ZUQA 2VQFO 1PKXA 5E79Z 2XUMA 1HNZO 2UUBB 4LWSA 2HR3A 1N0JA 1X59A 1MSDA 2PI5A 1JPXA 2QJ1A 1W0JG 4FPPA 2OCHA 3ABMB 3ABLB 4B3RB 1W2BU 2CTRA 2Q0OC 1JNBA 3RW0A 2P67A 3ETEA 5JCOC 2WLIB 4LBEC 1I94B 4UVCA 1N8RW 1FD9A 1FOUA 3TCUA 1YHQV 1YSCA
chains in the Genus database with same CATH topology
3AK3A 1IX9A 1BS3A 1PL4A 1GN6A 2CE4A 1JR9A 4F6EA 1Y67A 1LUWA 4YIOA 5A9GA 1MNGA 1XDCA 1AR5A 1QNMA 1VEWA 1IXBA 3BFRA 2QKCA 3RN4A 3TJTA 1BT8A 1D5NA 3DC5A 1ZLZA 1WB7A 1EN5A 3MDSA 3KDRA 2ADPA 4JZ2A 3KKYA 1LUVA 1BSMA 4X9QA 4E4EA 1XUQA 1AVMA 1KKCA 2P4KA 1XREA 3C3SA 1I08A 1XILA 4C7UA 2GDSA 1PM9A 1ZTEA 1SZXA 2QKAA 3EVKA 3QVNA 1EM1A 3K9SA 3OT7A 1AR4A 1AP5A 1MA1A 3CEIA 1ZUQA 2RCVA 3IC9A 1AP6A 3AK2A 5AG2A 1I0HA 1MMMA 1N0JA 1GN2A 1VARA 3C3TA 1MSDA 4BR6A 4JYYA 2CDYA 2ADQB 3DC6A 1EN4A 1B06A 1WB8A 1P7GA 1EN6A 1N0NA 4FFKA 2AW9A 3AK1A 4GUNA 1JA8A 1GN4A 4JZGA 1IDSA 1GN3A 1ZSPA 3LSUA 4YIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AK3 A;  1IX9 A;  1BS3 A;  1PL4 A;  1GN6 A;  2CE4 A;  1JR9 A;  4F6E A;  1Y67 A;  1LUW A;  4YIO A;  5A9G A;  1MNG A;  1XDC A;  1AR5 A;  1QNM A;  1VEW A;  1IXB A;  3BFR A;  2QKC A;  3RN4 A;  3TJT A;  1BT8 A;  1D5N A;  3DC5 A;  1ZLZ A;  1WB7 A;  1EN5 A;  3MDS A;  2ADP A;  4JZ2 A;  3KKY A;  1LUV A;  1BSM A;  4X9Q A;  4E4E A;  1XUQ A;  1AVM A;  1KKC A;  2P4K A;  1XRE A;  3C3S A;  1I08 A;  1XIL A;  4C7U A;  2GDS A;  1PM9 A;  1ZTE A;  1SZX A;  2QKA A;  3EVK A;  3QVN A;  1EM1 A;  3K9S A;  3OT7 A;  1AR4 A;  1AP5 A;  1MA1 A;  3CEI A;  1ZUQ A;  2RCV A;  3IC9 A;  1AP6 A;  3AK2 A;  5AG2 A;  1I0H A;  1MMM A;  1N0J A;  1GN2 A;  1VAR A;  3C3T A;  1MSD A;  4BR6 A;  4JYY A;  2CDY A;  2ADQ B;  3DC6 A;  1EN4 A;  1B06 A;  1WB8 A;  1P7G A;  1EN6 A;  1N0N A;  4FFK A;  2AW9 A;  3AK1 A;  4GUN A;  1JA8 A;  1GN4 A;  4JZG A;  1IDS A;  1GN3 A;  1ZSP A;  3LSU A;  4YIP A; 
#chains in the Genus database with same CATH topology
 4U3J B;  2EIN C;  1XMQ O;  3SYP A;  3JSN A;  3NR7 A;  3WFV A;  1XMO O;  2LW1 A;  5LGT A;  4WFG A;  4NXN B;  2YI9 A;  3J7A U;  1VQ6 V;  2P6J A;  3G6B A;  4XDJ A;  1N33 B;  2EIM C;  2ZIN A;  1YTF D;  4UCV A;  1WJZ A;  1GKF A;  5IY5 C;  5LYJ B;  1HNX B;  4B3M B;  4GX2 A;  5KUK A;  4DUY O;  1CXZ B;  4XDK A;  1VMG A;  2ZIM A;  1I7F A;  4Z1M G;  2UU9 B;  4H33 A;  2GUZ A;  1DF4 A;  1MG1 A;  3JAT B;  3H1K H;  1IVS A;  3L74 H;  3K08 A;  2ZIO A;  1CPY A;  1K4C C;  3AG4 C;  1US6 A;  5LOV B;  4J42 A;  1Y66 A;  2NLJ C;  4C7U A;  4R8C A;  4X88 A;  4G27 B;  2Y69 B;  2OWO A;  4PA6 A;  1K5S A;  2PUS A;  1X4T A;  2IJJ A;  5BY1 A;  3TET A;  5KA5 A;  4H37 A;  3Q4H B;  3QO5 A;  5JH7 A;  2DQ3 A;  1RSO B;  4W4L A;  1FS0 G;  3AK2 A;  2JGD B;  4DUY B;  1SER A;  2JVD A;  4TV8 B;  4JI3 O;  1VAR A;  2R72 A;  2WLL A;  3JAW B;  4ZBM A;  3JAM N;  3DC6 A;  3OEE G;  3E35 A;  3KCY A;  2UXB O;  3OW2 U;  4FLW A;  1CP9 A;  1PNL A;  3BA8 A;  4JI2 O;  5EZY B;  1VQK V;  1FJG B;  3WG7 C;  1KP3 A;  3VBB A;  4JI1 O;  4H0L B;  3L73 H;  1J5E O;  3DXR A;  4DV2 O;  4DRX B;  2L35 A;  2ZR3 A;  2QWO B;  4DV4 B;  3AG1 C;  3OUF A;  2B1I A;  2KQX A;  3MHH C;  1E1R G;  4MVO A;  3APQ A;  4B7E A;  2IJI A;  3T4D A;  3FB6 C;  4DR1 B;  1NKD A;  1XMQ B;  2XHB A;  4BAY A;  2X7R B;  1XNQ O;  4EKW A;  2IH3 C;  4LNU A;  3OMI B;  3E83 A;  3D3Q A;  3ZS8 C;  2HJF C;  1KD1 W;  2KSD A;  2A0L A;  3ABM C;  1I94 O;  1PNM A;  4O2A B;  3OFN G;  1VF5 B;  1SQQ H;  2BCC H;  5IYZ A;  2GV9 A;  3AG4 B;  1LR1 A;  2DYR C;  2Q9L A;  2KKW A;  1BGY H;  1NI8 A;  3ASN B;  3OR7 C;  2V7Q G;  5FLX N;  1M56 C;  4JTA B;  1XHX A;  5DM6 V;  5IWA O;  1Q5O A;  3HKD A;  1H2M A;  1IBK O;  4OPA A;  4Q20 A;  2VQF B;  1KKC A;  4TV8 A;  3ETQ A;  1XRE A;  5JVD A;  2FTK A;  4O4J A;  2GDS A;  4R7C A;  2JK5 C;  3ZHV A;  3CS5 A;  1ZTE A;  4MVR A;  1IBM B;  4HNA A;  3RYC B;  1FJG O;  1XNR O;  4AHC A;  3H1J H;  2FKX A;  5JCO A;  1RPO A;  4OX9 B;  1W59 A;  2Q7E A;  4G28 B;  2VWJ A;  3S3W A;  2DYS C;  2H94 A;  3D36 A;  2MW2 B;  1YI2 V;  4O2B A;  1EN6 A;  3ZMU A;  2XND G;  4IGG A;  4DRX A;  1G4Y B;  2YIB A;  2F23 A;  3F5W C;  2X0L A;  3O9O A;  1XOU A;  1ZSP A;  3K03 A;  3OM3 B;  1FFX A;  5IJ9 A;  2A3Q A;  1QR9 A;  4YHH B;  2OCC B;  4LFC B;  1Q3E A;  2YI8 A;  4ZOL B;  1YVW A;  5BR8 O;  3LDE A;  3VQY A;  5GTI Z;  5J9P C;  3HKB A;  1HNX O;  3K58 A;  4B3M O;  2BSK A;  2HVJ C;  4UFZ A;  3HB3 B;  1E79 G;  4RO2 A;  4X1I A;  2QWR B;  3ZHT A;  2FYU H;  4QE9 A;  3TJT A;  1KEC A;  1BT8 A;  3FAV B;  2EBO A;  2DMX A;  2ILM A;  4LR3 A;  1WB7 A;  2Y4T A;  4MTG A;  3OR6 C;  2CH7 A;  1OHH G;  3MDS A;  2ADP A;  1QCE A;  3G4S V;  1VF7 A;  2ZXW B;  1Q82 W;  4X65 B;  4DV0 O;  4K8X A;  2F93 B;  2JIZ G;  2AHZ A;  1XHZ A;  1WN7 A;  4LNU B;  2XT9 A;  1QLE B;  5H6Q A;  1YJ9 V;  2ODM A;  4DUZ O;  3LUT B;  2RCV A;  4J9Y B;  3T4Z A;  2G38 A;  5CA3 A;  1QBZ A;  1ZWI C;  1NH2 D;  3CCU V;  5GW7 A;  5CN0 A;  4O4L A;  1GN2 A;  3BPZ A;  3E89 A;  4PDL A;  1G6U A;  4I0X A;  2AGA A;  2ADQ B;  5LP6 B;  2E5L O;  4FFB B;  4LF8 B;  2A9H A;  4EFB A;  1DLB A;  5J2U A;  5L3G A;  4DV5 B;  1RM1 B;  1OJH A;  4X64 O;  4AQY O;  2P22 C;  1KU9 A;  4X20 A;  2QWN B;  5GON A;  3CCE V;  1OCC B;  2UXD B;  4ZKI A;  4I7Z B;  2GSM B;  3ZRW B;  3K5M A;  4JI6 O;  3APO A;  4PJ0 Z;  1B04 A;  4WBN A;  5B1N A;  4UCO A;  1M57 C;  1R6T A;  5KAI Z;  1FXK C;  1J5E B;  3E8G A;  3GVM A;  3RBZ A;  4AQY B;  3ZHS A;  5BZB A;  1THZ A;  2QKC A;  3LDC A;  4IHJ A;  1FAF A;  3MHS C;  1AJQ A;  5L3E A;  2ZQM A;  3OD4 A;  3IFX A;  3FB8 C;  2ITD C;  4LFA O;  4B3S B;  4QGP A;  4CZZ A;  1Q86 W;  3F7Y C;  3BAA A;  3R66 A;  5D5P A;  3KKY A;  4UVB A;  2JEX A;  2K1E A;  1K4D C;  4QPK A;  4LF6 O;  1EFR G;  2LP7 A;  3SYA A;  2RQ6 A;  4DXW A;  3ASO B;  2UXC B;  3HKB B;  5EC2 C;  2QKA A;  5GTH Z;  3QVN A;  1F4N A;  3SPJ A;  1H38 A;  4EB6 A;  4GKJ O;  5ITZ B;  3CXC U;  3K3W A;  3K5N A;  1QQC A;  1MZE A;  4B3S O;  1URF A;  1G8M A;  4K8Z A;  1P49 A;  4UB6 Z;  4GZR B;  2E76 B;  3CCS V;  4KHP O;  3BRC A;  3SPC A;  5IDJ A;  2EIL C;  3UO2 A;  1HR0 B;  2XAS A;  3EHB B;  3OAA G;  1JOY A;  2P7T C;  4TSF G;  4DV6 B;  3QO7 A;  4LF6 B;  3JAR B;  4U7N A;  1M1K W;  4UV8 A;  4RWU A;  5LMN B;  4FM2 A;  3OMA B;  1K73 W;  1NVP D;  1FKA O;  4I55 B;  1GN6 A;  3U0Z A;  5B3S B;  3JAS A;  4PA4 A;  2WLL B;  3BAB A;  1RFY A;  3HKC B;  4BW9 A;  2DW4 A;  4IYH A;  4HBN A;  3J81 N;  1OZ0 A;  4FVM A;  4MVS A;  3K57 A;  4B3R O;  5KMG A;  1IXB A;  3L72 H;  3CHX A;  2CGN A;  4D7S A;  1AIL A;  3UQ8 A;  2BE3 A;  1XI1 A;  3ML0 A;  2R9I A;  2HEP A;  3SJC C;  1HP8 A;  2Y0P A;  1TGO A;  4EFE A;  5LMU O;  4DK1 A;  1NQT A;  4Z1V A;  3AG7 A;  2EZP A;  4DYL A;  3SJQ C;  2P06 A;  4CBC A;  1V55 C;  1NVP B;  1ZX3 A;  5KX5 A;  3ZN1 A;  1SRY A;  1V55 B;  1WA8 B;  5LMU B;  5B1B B;  1V9P A;  2PTM A;  4O4J B;  4X65 O;  4DR2 B;  1BCC H;  1MA1 A;  1KP2 A;  3L9D A;  5AG2 A;  4DV1 O;  1K3E A;  2DYS B;  1R6N A;  1U97 A;  4MT8 A;  4K35 A;  4JYY A;  5LYJ A;  1IBL B;  4JI6 B;  2JDI G;  3WB2 A;  2QA4 V;  2ZM6 B;  1QHT A;  3OTF A;  1N36 B;  4XDL A;  4WF9 V;  3AG2 B;  2DOS A;  2E3C A;  4FJC C;  2Q6A A;  3CXH F;  1OCO C;  4X1Y A;  3OE7 G;  3ZHR A;  4CH6 A;  1JR9 A;  4J7Z A;  1JX9 A;  4E2L A;  1Y67 A;  5K1P A;  1R3K C;  2YIB D;  3CYO A;  4HNA B;  4O2A A;  3E22 B;  2UUB O;  4P9P A;  1VQN V;  3ABK B;  2UXB B;  3G80 A;  3CRC A;  3SJB C;  5L3C A;  3WG7 B;  1PD3 A;  5GON B;  4QPJ A;  3S3X A;  1VF6 C;  3ETG A;  3HKC A;  4AIL C;  2YIC A;  4KFM A;  1ZAU A;  1HWY A;  1FXK A;  3AG1 B;  1S76 D;  1BE3 H;  5JWP A;  3RYI B;  3UO3 A;  4HAM A;  3JAK B;  4UCT A;  3CSX A;  2FB5 A;  3E8F A;  2LGQ A;  3X2Q B;  2ZDI A;  5LHG A;  5KHG A;  4JI7 B;  4J80 A;  4ABM A;  1RSO A;  5LGN A;  1XIL A;  2Y48 A;  4PDV A;  3AG2 C;  3P32 A;  4PV1 B;  4NVP A;  4HYO A;  1Q7Y W;  1Q6U A;  4OPH A;  1AP5 A;  5KAF Z;  3B8N A;  2ZCE A;  3OGI B;  2W0F C;  1XL6 A;  2PF4 E;  5L3B A;  3RYH B;  3CC4 V;  1WNS A;  1TUE B;  3B2E E;  4TOI A;  4RUF A;  3DGE A;  4LF5 O;  1F7Y A;  4BW5 A;  3SGI A;  5IWA B;  1IBK B;  1RP3 B;  4CS2 A;  1VQ4 V;  2ZR2 A;  1Q6I A;  4I4T B;  1GM8 A;  1BZK A;  1KC8 W;  2Q67 A;  4RUE A;  4FFK A;  4GUN A;  2QKS A;  1W0K G;  4MW3 A;  3N2G B;  2YEV A;  1GN4 A;  4F6R B;  2F4V B;  4TQD A;  4CH5 A;  4A5U B;  4LF9 B;  2QWQ B;  1YF2 A;  4TUY A;  1HNW B;  4B7K A;  1IX9 A;  1Y74 A;  3T2M A;  2Q68 A;  4F6E A;  3H01 A;  5EK0 A;  1YJW V;  1LUW A;  1GK9 A;  2PYL A;  4FLT A;  4X89 A;  1N34 B;  4MTX A;  5KHJ A;  5CMU A;  1AR5 A;  1WP8 A;  1EBO A;  2ZNJ A;  4GKK O;  4K0K B;  2OTJ V;  2BSK B;  4DR5 O;  4U3J A;  4GLX A;  2WA4 A;  1NR7 A;  1S3J A;  4JV5 O;  4KXR A;  4LFB O;  1SC5 B;  3ZRS A;  4UV9 A;  4ICG A;  2QGN A;  4JI2 B;  1MOF A;  4MVU A;  3CCV V;  1IZ3 A;  5B66 Z;  5LP6 C;  4CS3 A;  2ZD9 A;  1TVK B;  3ASN C;  2HG5 C;  3SPI A;  3THO A;  4E4E A;  1Z5W A;  3LNM B;  2QDO A;  3TXQ A;  2E74 B;  4JI3 B;  2PZS A;  2F66 C;  3C3S A;  3KG2 A;  1UJW B;  1VQ8 V;  5LA6 B;  1E1Q G;  2B5U A;  2YC0 A;  2XAH A;  3RYH A;  2UXX A;  4WCE V;  3CX5 F;  3JD2 A;  1K9M W;  3VOU A;  4TUY B;  2NR5 A;  3B4S A;  4L8J A;  2JGU A;  5LL6 Y;  5FPO A;  3N2G A;  2L6L A;  2QM7 A;  4FZ1 A;  4JYB A;  2HHH O;  1WPX A;  2OT5 A;  4JI8 O;  1GRJ A;  4FIP C;  1IBM O;  5BMV A;  3GWO A;  1JCH A;  4JTC B;  3JD1 A;  2CK3 G;  3LSU A;  3T1Y O;  3ZJZ A;  1XQ8 A;  5CB4 B;  1I5X A;  4MVQ A;  1SET A;  1JFF B;  1ROP A;  1MZF A;  3RWR D;  5H5N A;  2WWW A;  3CCR V;  2IM9 A;  4NR1 A;  1NR1 A;  1XL4 A;  4H13 B;  1H2K A;  5DED A;  5JQG A;  3AG3 B;  3UT5 A;  2Q73 A;  4FK5 C;  5A9G A;  3ABU A;  1BL8 A;  1LNQ A;  3AG3 C;  4I0X B;  5LGU A;  1XEQ A;  4WFB V;  2JS5 A;  2QSA A;  1RM1 C;  4FLV A;  4JI8 B;  3G6E V;  4NXM O;  4U3F H;  1FFT B;  1SQB H;  2ITC C;  1VP7 A;  2JJ2 G;  3DC5 A;  4UCR A;  1D2D A;  1S5J A;  3E8H A;  3FYI B;  3BA9 A;  3ZHU A;  5C8Y B;  4IIJ B;  2WLM A;  2P90 A;  2C2A A;  1EN5 A;  2ZE8 A;  1I5Y A;  1JJ2 U;  5IYD O;  4DR2 O;  1AVM A;  4GT1 A;  4I9W A;  2P4K A;  1I08 A;  1SQV H;  3BVO A;  2HJD A;  2RJZ A;  5LA6 A;  3KZI Z;  2D3O W;  5JQG B;  2B1G A;  2ARH A;  3F7V C;  1N33 O;  5LBQ A;  2WLK A;  3STL C;  3CJH B;  4WFF A;  2PYJ A;  5LXT A;  2HKO A;  2Z0A A;  3GB7 C;  4X8A A;  3TGU H;  1H2S B;  4DR6 O;  2Y0I A;  5BMV B;  3EFF K;  3K5O A;  5KX5 B;  1DTO A;  3JAR A;  2IJH A;  1F51 A;  1WPB A;  1N0N A;  1Y4M A;  3F5T A;  4X1K A;  5JJE B;  2UXC O;  2DWD C;  4BIU A;  4GX1 A;  2VRZ A;  4X20 B;  1IJG A;  3JYC A;  4DR1 O;  4X64 B;  2QTO A;  4OXS A;  2YXH A;  1QU7 A;  1NBM G;  1H2N A;  4PI0 A;  5LHH A;  1JQ0 A;  4JYC A;  3D36 C;  3P30 A;  4UVA A;  5J2T B;  2HVK C;  4PA3 A;  1XNQ B;  3CC2 V;  2QEX V;  3ABK C;  4DUZ B;  2MK3 A;  3N2K A;  5IT9 N;  1R73 A;  3JSL A;  4XBF A;  4DV7 B;  2RMK B;  4BWA A;  2BTO A;  3Q4H A;  5JH7 B;  4KHP B;  4J7J A;  2O57 A;  3K5L A;  3N2K B;  4I55 A;  1R3I C;  4MS2 A;  4MTF A;  3FKS G;  2VQE B;  2R9A A;  4ZOL A;  3U11 A;  1ZLZ A;  4BIZ A;  3A2F A;  3QG5 A;  1VF6 A;  2EIK C;  1AI4 A;  1VQO V;  1YTF B;  4FZ0 A;  2WA3 A;  3KDR A;  2DQ0 A;  3MAQ A;  3MD0 A;  1KMI Z;  1XMO B;  5DEC A;  4RQE A;  5KUM A;  2KG7 A;  5LOV A;  2CH7 B;  3CB2 A;  3EXA A;  3CRA A;  3GWK C;  5JJJ B;  1WLE A;  2GUZ B;  2DYR B;  4H44 B;  4OGQ B;  5B5E Z;  3ZMV A;  4GYC B;  4F4L A;  2LO1 A;  3CJH A;  2BOC C;  2YSU B;  2OIG A;  4LF7 B;  1R3L C;  1JVM A;  3C3T A;  4BR6 A;  3C90 A;  4IL6 Z;  5CA1 A;  4P2Z A;  3ZBH A;  3M8A A;  4JAA A;  1YCI A;  3T1H O;  3H9V A;  4KUM A;  4MVM A;  1HW7 A;  5FNV B;  4YIP A;  4DV6 O;  2UUC O;  3P3P A;  3ICX A;  1SQP H;  3LNN A;  2F1M A;  3R65 A;  5FNV A;  1N34 O;  1Y6X A;  3TK1 A;  1H2G A;  1R3J C;  4NYK A;  3IGA C;  1NS1 A;  4YIO A;  3H1I H;  5KHK A;  3QTC A;  1VQP V;  3RT3 C;  4LFB B;  1MNG A;  3CE2 A;  1WA8 A;  2Q69 A;  2YEV B;  4F6R A;  3RFR A;  1S5H C;  2JS3 A;  4TQF A;  1IXM A;  4LC1 A;  4FLX A;  2ZE5 A;  4QJF B;  1J95 A;  2XOK G;  2N04 A;  5J2T A;  4J7K A;  2YDE A;  2ZE7 A;  3SPG A;  4OX9 O;  1IBL O;  1VQ5 V;  4MVZ A;  3E2E A;  4JI0 B;  2Y69 C;  4PA9 A;  2DE0 X;  4X66 B;  4JZ2 A;  3HKD B;  1BSM A;  3FAV A;  3PJS K;  3G71 V;  1S0V A;  2JJ1 G;  1F4M A;  4LP8 A;  1M4U A;  1ZL8 B;  4ZI7 A;  5IYZ B;  2LGW A;  3JAT A;  3OUS A;  5L3F A;  2QWP B;  1SQG A;  3UM7 A;  4I50 A;  2RNB A;  1HR0 O;  4DR7 O;  3WU2 Z;  1Z2G A;  1RPR A;  1S77 D;  1KUQ A;  2XAJ A;  1QVF U;  1AP6 A;  5IY5 B;  2ATK C;  4YY3 O;  1FXK B;  1H5W A;  3FX7 A;  3P3N A;  1AJP A;  4DW0 A;  2UUA O;  2CDY A;  4IYI A;  1QLN A;  3DTU B;  2QE7 G;  1NZ6 A;  3RVZ A;  1VQ9 V;  2YXL A;  4DR7 B;  3SYC A;  4JI7 O;  2UXD O;  4JZG A;  1GM9 A;  1GN3 A;  2GBO A;  2LFS A;  5B1O A;  4GCZ A;  4G2K A;  4X1I B;  4UUJ C;  2QM8 A;  2VS0 A;  1VQ7 V;  1JJO A;  1OCO B;  4DR3 O;  2ZDI C;  2OCC C;  4N21 A;  4UXN A;  1YIJ V;  3QF7 A;  2GTS A;  4JF3 A;  3M7M X;  1L0L H;  3VQX A;  1PL0 A;  1TA8 A;  2HHH B;  1CEZ A;  1QNM A;  1AR1 B;  1OCC C;  3ZRV A;  5L3D A;  2FML A;  5EBW C;  2A06 H;  1M56 B;  1R1B A;  2NN4 A;  3W7X A;  1NTK H;  3H1H H;  2CTP A;  5BXZ A;  3K0D A;  3SYQ A;  1U96 A;  2AHY A;  2Q5Z A;  4O4I B;  5KMG B;  5C93 A;  4QE7 A;  3CPW U;  2EIL B;  4LH7 A;  3ZIA G;  4X9Q A;  4YXW G;  2Q4P A;  1HNW O;  4MTO A;  2VQE O;  1V54 B;  1NH2 B;  4P9O A;  2AZ0 A;  2PI4 A;  4EEQ A;  3ZMZ A;  1YXB A;  3ZHQ A;  1ARO P;  3SYO A;  3UKM A;  1XNR B;  2UU9 O;  4TWK A;  1P84 F;  5EIB D;  4TV9 B;  3SPH A;  4JI5 O;  3IC9 A;  4DR6 B;  4O4I A;  2WLH A;  3A0R A;  5KHI A;  2P5O A;  4I50 B;  1T5E A;  4WFE A;  2M7W A;  1Z5V A;  3FB5 C;  4UCS A;  3I55 V;  3B40 A;  4AI8 A;  2XAF A;  4LF4 O;  1DGS A;  3QNE A;  1MSW D;  4QNH B;  1OCR C;  1TVK A;  3BCC H;  1FYJ A;  4JTD B;  2OTL V;  5LP6 A;  1EZJ A;  2H3O A;  1OCR B;  3BEH A;  1KKD A;  1Y74 B;  5H2F Z;  1PL4 A;  5EYP A;  2CE4 A;  3E86 A;  3K04 A;  1NU1 H;  3A0B Z;  3JD3 A;  2N05 A;  4JAU A;  1FFX B;  4TT3 G;  5IJ9 B;  2R9R B;  5KLV H;  1KQS U;  4WFH A;  2X6A A;  3LSQ A;  4IHJ B;  1KYO F;  2V4D A;  1Q6H A;  1XDC A;  3VQV A;  3K9A A;  1DF5 A;  4O4H A;  2UUC B;  1OCZ C;  3RYF B;  3SDL A;  2RN9 A;  4LF5 B;  2WLJ A;  4NTW A;  1BQZ A;  3RN4 A;  4LF4 B;  2KB1 A;  1K92 A;  5BR8 B;  1NTZ H;  3T1Y B;  4JYA B;  4FLZ A;  1IUR A;  2ZNI A;  4ZHQ A;  1UPG A;  2PY5 A;  2EX3 A;  4X66 O;  3JCZ A;  5JJN B;  3W7T A;  5JVD B;  1QLE C;  1SES A;  3E22 A;  2CTQ A;  1K5Q A;  3W7S A;  4X1K B;  3CRR A;  3RYC A;  4YHH O;  4FM1 A;  1N36 O;  4PDR A;  2EJ7 A;  3ABL C;  4DK0 A;  3ZED A;  3IAY A;  4LF7 O;  1NT2 B;  1PM9 A;  1GH6 A;  3CCQ V;  1DK1 A;  3EVK A;  4NXM B;  3RYI A;  2Q0A A;  1H8H G;  3NXS A;  4J41 A;  1A32 A;  2W6I G;  4KP4 A;  4O4H B;  4X62 O;  2UUA B;  1D5A A;  3ZRX A;  1MMM A;  5CBH A;  3IC7 A;  3W7U A;  3JCU Z;  1YDX A;  3BHP A;  3CCJ V;  1EN4 A;  5IJ0 B;  1B06 A;  2EJR A;  1P7G A;  1GO3 F;  2X6C A;  1AJN A;  2IH1 C;  2WLI A;  1JA8 A;  2DWE C;  3OTO B;  1IDS A;  3ZX6 A;  1EZV H;  2OIE A;  5J2U B;  1JFF A;  1BS3 A;  1YZB A;  3D8C A;  2YIA A;  2ETN A;  4UCU A;  2QR4 A;  3U10 A;  4LFC O;  2H8P C;  1SKV A;  4W4K A;  4GX5 A;  4IT5 A;  3K06 A;  4DV3 O;  4DR5 B;  3JAS B;  2NNU A;  4GKJ B;  2YXY A;  2N74 A;  4RQF A;  1VQM V;  3BFR A;  5LXT B;  2E75 B;  1PNK A;  1D5N A;  1JMK C;  2YID A;  5D5Q A;  2KG7 B;  3B8M A;  4JI5 B;  2UXN A;  3I5D A;  1LUV A;  2Z5U A;  1N32 O;  4PHZ A;  3QO8 A;  5H9C A;  4JI1 B;  2BOB C;  2IU0 A;  4LFA B;  1GM7 A;  5CBG A;  2LJ2 A;  1G1X B;  4LF9 O;  1F23 A;  5IYB O;  1K33 A;  2WSS G;  4QIW F;  5FPR A;  2D2C B;  4DR4 O;  2ZT9 B;  3N27 A;  5HFL A;  5F2V O;  3K9S A;  3OT7 A;  1L8D A;  2CTW A;  3CCM V;  2B9Z A;  4B3T O;  5EIB C;  3K79 A;  4FFB A;  3HKE B;  3VQW A;  2K9P A;  1B6Q A;  4DV0 B;  1N32 B;  1I0H A;  5B3S C;  1OV9 A;  5IJ0 A;  5HFM A;  4NXN O;  2EZO A;  1XBL A;  4ASU G;  4PEL A;  5KA6 A;  3CCL V;  1N4C A;  5A2Q N;  3AK1 A;  3JAL B;  2ZKO A;  5FL7 G;  4J9Z B;  1O9H A;  2EIJ C;  1M90 W;  1YIT V;  4J10 A;  5K1X A;  3AK3 A;  3PN1 A;  2GTA A;  4PD4 F;  5CA0 A;  1ZL8 A;  4ZI7 B;  2Q7H A;  1ENV A;  1P4R A;  1PPJ H;  4DW1 A;  3BY6 A;  4FLY A;  2IBZ H;  1AI7 A;  3OEH G;  1BHB A;  1FPO A;  3T1C A;  5EBL C;  2HLD G;  3ZCC A;  3ZRW A;  3OMN B;  4CH4 A;  4JV5 B;  2JRI A;  4WBN B;  3T1H B;  2XAQ A;  5IE9 A;  1L0N H;  4K3A A;  1Y76 A;  2OYQ A;  1NJI W;  2CUG A;  3LSS A;  4CC5 A;  1S72 V;  4I9Q A;  3AEI A;  2LQT A;  1H8E G;  3JAK A;  5CA0 B;  3STZ C;  1VIB A;  4X1Y B;  4Z2W A;  1XUQ A;  3SR2 C;  3ABT A;  3CC7 V;  5E1A C;  5CBF A;  4YJ2 B;  1AI6 A;  1SF9 A;  2IJK A;  2LW7 A;  2WLN A;  1ORQ C;  1P7B A;  3L70 H;  2BTQ B;  1WAZ A;  1WP7 A;  2EIJ B;  1KBH A;  4MW8 A;  2DN9 A;  1M9N A;  2W6J G;  3CEI A;  1Q8I A;  3B09 A;  4NTX A;  1Y76 B;  4DR4 B;  1BMF G;  1QR8 A;  2YS8 A;  1FXH A;  1K34 A;  2AXT Z;  2BTQ A;  3DSQ A;  4U7O A;  4GX0 A;  4JI0 O;  2HP8 A;  1Q81 W;  4WFA V;  2ZE6 A;  3ASO C;  1TAE A;  4TV9 A;  3HPL C;  4NTY A;  1TUB B;  4EB6 B;  1H2L A;  3FB7 C;  1NTM H;  5CA1 B;  3J80 N;  3OTO O;  3DXR B;  3CME V;  3TXS A;  3WB0 A;  2QTS A;  2ZM6 O;  5B1A B;  4KL1 A;  1PV0 A;  3H1L H;  4FLU A;  1SA0 A;  4Q6G A;  3ZN0 A;  2R70 A;  2P4V A;  2YUA A;  3E8B A;  2QM4 A;  3CRM A;  4JGS A;  3M99 B;  5TIS Z;  4DV3 B;  4BIO A;  5CB4 A;  2EUL A;  4MSW C;  1VQL V;  3I56 V;  1QVG U;  4DO2 A;  2XTA A;  5EC1 C;  5H6R A;  3A0H Z;  4DV1 B;  2GHY A;  3OGC C;  1VEW A;  2A7W A;  4DV4 O;  4YJ3 A;  3ZMS A;  4PA7 A;  2Z3Y A;  2RDC A;  4JI4 B;  1AI5 A;  2IW5 A;  3RYF A;  2E5L B;  2X6B A;  1COW G;  4NKG B;  4O2B B;  3CWB H;  4CS4 A;  1HNZ B;  1R6K A;  1PP9 H;  1GTO A;  2CGO A;  4LCU C;  1M5I A;  3CP1 A;  4LF8 O;  2Q7G A;  4J11 A;  1O9G A;  4D6T H;  3FFQ A;  1BHA A;  4JAS A;  4LWS B;  2XAG A;  4N23 A;  4R50 A;  2W0X A;  4X62 B;  1BQ0 A;  3FD9 A;  3D3I A;  2CAZ C;  4YJ3 B;  3CD6 V;  5LHI A;  3W7W A;  4UB8 Z;  3JD4 A;  3ETD A;  4RAI A;  3KCX A;  1YJN V;  3ZMT A;  2EIM B;  2V1D A;  3O65 A;  4JPR A;  1SA0 B;  4PDM A;  4PI2 A;  4YJ2 A;  2ZXW C;  4O4L B;  4YY3 B;  5EBM C;  3LDD A;  4DV2 B;  2VWK A;  4LH6 A;  5B1B C;  4HZ3 A;  1K7D A;  1SQX H;  1WB8 A;  2LFR A;  1L1F A;  2AW9 A;  2JEU A;  1UFI A;  4D7T A;  4NB5 A;  3K59 A;  5LMN O;  4FM0 A;  2M6Y A;  2WAM A;  2EIK B;  3JD0 A;  2AZ2 A;  3L75 H;  1V54 C;  4FMT A;  3RVY A;  2F4V O;  4I4T A;  4DV7 O;  3WB1 A;  1TUB A;  5IYC O;  1B3Q A;  2F95 B;  1K8A W;  1M93 A;  4R6Z A;  3K0G A;  2IU3 A;  4DR3 B;  3UT5 B;  5DN6 G;  3HR0 A;  1Q43 A;  2EIN B;  1YEW A;  5C8Y A;  1K97 A;  1MAB G;  4JAV A;  5EYP B;  3SJA C;  3FYE B;  2Q8V A;  3RGB A;  4P30 A;  4K0K O;  4GKK B;  3CRQ A;  4I5S A;  5ITZ A;  2Y4U A;  1GAX A;  1Q90 D;  4L87 A;  2F43 G;  5B1A C;  2HFE C;  4ZIB A;  3B77 A;  2A79 B;  1AB3 A;  1M57 B;  3G67 A;  5KHH A;  4CC6 A;  4B08 A;  4ZHQ B;  2JGD A;  5EZY A;  2PGG A;  1S5L Z;  3JAL A;  4IIJ A;  4B3T B;  1SQF A;  2FL4 A;  2WPD G;  4CH3 A;  1KB9 F;  3IJ4 A;  3HKE A;  4JYA O;  3JAW A;  1SZX A;  4DV5 O;  1HDJ A;  4JI4 O;  1EM1 A;  1SZT A;  3A8T A;  2DJV A;  3UCS C;  1OCZ B;  3CMA V;  1GMG A;  1AR4 A;  1SS3 A;  3L71 H;  3X2Q C;  1FXV A;  1ZUQ A;  2VQF O;  1PKX A;  5E79 Z;  2XUM A;  1HNZ O;  2UUB B;  4LWS A;  2HR3 A;  1N0J A;  1X59 A;  1MSD A;  2PI5 A;  1JPX A;  2QJ1 A;  1W0J G;  4FPP A;  2OCH A;  3ABM B;  3ABL B;  4B3R B;  1W2B U;  2CTR A;  2Q0O C;  1JNB A;  3RW0 A;  2P67 A;  3ETE A;  5JCO C;  2WLI B;  4LBE C;  1I94 B;  4UVC A;  1N8R W;  1FD9 A;  1FOU A;  3TCU A;  1YHQ V;  1YSC A; 
#chains in the Genus database with same CATH homology
 3AK3 A;  1IX9 A;  1BS3 A;  1PL4 A;  1GN6 A;  2CE4 A;  1JR9 A;  4F6E A;  1Y67 A;  1LUW A;  4YIO A;  5A9G A;  1MNG A;  1XDC A;  1AR5 A;  1QNM A;  1VEW A;  1IXB A;  3BFR A;  2QKC A;  3RN4 A;  3TJT A;  1BT8 A;  1D5N A;  3DC5 A;  1ZLZ A;  1WB7 A;  1EN5 A;  3MDS A;  3KDR A;  2ADP A;  4JZ2 A;  3KKY A;  1LUV A;  1BSM A;  4X9Q A;  4E4E A;  1XUQ A;  1AVM A;  1KKC A;  2P4K A;  1XRE A;  3C3S A;  1I08 A;  1XIL A;  4C7U A;  2GDS A;  1PM9 A;  1ZTE A;  1SZX A;  2QKA A;  3EVK A;  3QVN A;  1EM1 A;  3K9S A;  3OT7 A;  1AR4 A;  1AP5 A;  1MA1 A;  3CEI A;  1ZUQ A;  2RCV A;  3IC9 A;  1AP6 A;  3AK2 A;  5AG2 A;  1I0H A;  1MMM A;  1N0J A;  1GN2 A;  1VAR A;  3C3T A;  1MSD A;  4BR6 A;  4JYY A;  2CDY A;  2ADQ B;  3DC6 A;  1EN4 A;  1B06 A;  1WB8 A;  1P7G A;  1EN6 A;  1N0N A;  4FFK A;  2AW9 A;  3AK1 A;  4GUN A;  1JA8 A;  1GN4 A;  4JZG A;  1IDS A;  1GN3 A;  1ZSP A;  3LSU A;  4YIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...