2QKCA

Structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKLNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structural and kinetic study of differences between human and Escherichia coli manganese superoxide dismutases.
pubmed doi rcsb
total genus 72
structure length 196
sequence length 196
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2qkcA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2qkcA02
1WB8A 4JZGA 5AG2A 3RN4A 3C3TA 1EN5A 3AK3A 1JR9A 1XUQA 3CEIA 4C7UA 1MA1A 2QKCA 1KKCA 1BSMA 1PM9A 3OT7A 1EM1A 4YIOA 2CE4A 4JYYA 1VEWA 1PL4A 1IDSA 2P4KA 1EN4A 3MDSA 1LUWA 3LSUA 1D5NA 1BS3A 4BR6A 1JA8A 1AR5A 3EVKA 4GUNA 1MNGA 4X9QA 1P7GA 2CDYA 5A9GA 1VARA 1XILA 1ZSPA 1B06A 1EN6A 1N0JA 1AVMA 1ZLZA 1ZTEA 2ADQB 1XDCA 1IX9A 1AP6A 2RCVA 3IC9A 3KKYA 1WB7A 2AW9A 1BT8A 1SZXA 3QVNA 1I08A 3DC5A 1ZUQA 4FFKA 1Y67A 4YIPA 3BFRA 4F6EA 1GN2A 2ADPA 1IXBA 1XREA 2GDSA 3C3SA 2QKAA 3DC6A 3K9SA 1GN6A 1I0HA 3AK2A 1GN3A 1AR4A 1AP5A 1QNMA 1MSDA 1N0NA 4E4EA 3AK1A 1LUVA 1GN4A 3TJTA 1MMMA 4JZ2A
chains in the Genus database with same CATH superfamily
3GB7C 2QTSA 3ASOB 2R9RB 4U3FH 3K5MA 1M4UA 5D5PA 1WB8A 4CS3A 1W2BU 3ABMB 2HEPA 2WLIB 4W4KA 3AEIA 3ZHSA 5EBLC 1KB9F 3E86A 4X66B 4PA3A 2OCHA 4B08A 3BAAA 1PNMA 2JEUA 4H13B 3AG3C 1M90W 2P22C 1HP8A 4DRXB 1R3LC 2LGWA 1SC5B 4XDJA 5CBGA 1ROPA 1ZL8B 5KMGA 3T4ZA 1AR1B 1FXVA 5CA0B 4UCTA 4H37A 3K03A 4ZKIA 2Z3YA 2PUSA 4LFAO 2JEXA 1M5IA 3HKCA 1KC8W 2Q7EA 4L87A 3SR2C 2ADQB 1GKFA 3LSSA 1TAEA 2GBOA 4D6TH 2VRZA 3ASNC 3I56V 4UVBA 1H2MA 1GAXA 1R3IC 4X1KA 1A32A 3FYIB 1M57C 3G6BA 2IJJA 1DF5A 1JX9A 3FAVA 1ZWIC 3SJBC 1HWYA 3A2FA 3OEHG 3JARB 4LF7B 1VQ4V 2WWWA 4RUFA 4BIUA 1Z5VA 1V9PA 5LA6B 3JD2A 1GN6A 4X88A 2F4VO 3QG5A 3UQ8A 1NTMH 4QE9A 3F7VC 2QA4V 4NXNO 1J95A 4XBFA 1H8HG 1IBMO 2YIBA 2UUAB 1UFIA 3FB7C 4O4IA 1H38A 3W7XA 3ZRVA 3Q4HA 2ZIOA 1KYOF 4IIJB 3ZMSA 5JCOC 2UUCB 2F4VB 4DV4O 4B3SB 4I4TA 5LOVA 2X6BA 1XNRB 1X59A 4PDLA 4LF7O 2F66C 1AI7A 3CCUV 3JAKB 1W0JG 1VEWA 3F7YC 1K7DA 3BHPA 5IY5B 2PYJA 2H3OA 4JI5O 4QGPA 1S77D 4GUNA 4R50A 2NN4A 1VARA 3K04A 5LA6A 1IBLO 3N27A 1NS1A 4MTOA 2H94A 1R3JC 1FXHA 2W0XA 4JPRA 5J2UA 4FPPA 1B6QA 1XMQO 1S5LZ 4HNAB 4X89A 3ZHUA 1KMIZ 2L35A 3W7TA 3OMNB 4JI3B 2JJ2G 1Y67A 2WA3A 4MW8A 3N2GA 2AGAA 5IYDO 1WPXA 3T1YO 2Y4UA 2G38A 1XEQA 2X0LA 3RW0A 1F4MA 2Z0AA 2Q5ZA 2Z5UA 1AR4A 4OXSA 2P4VA 3SGIA 2UUBO 2XT9A 1N34B 4CH6A 1K34A 2OIEA 1MSDA 1M1KW 2X7RB 4PA7A 3OR7C 4L8JA 1H5WA 3WFVA 2UUBB 2WA4A 4TQFA 2ZE6A 4DW1A 2IU0A 1F23A 3AG1B 2WLLB 4ZBMA 2P90A 3X2QC 2X6AA 3N2GB 2AHZA 5BZBA 1QVGU 1HR0O 1RFYA 1VQNV 1L0NH 4CH3A 3H1KH 3GWOA 1R6TA 4KXRA 1EM1A 4HNAA 4YIOA 1JCHA 2ITCC 1QLNA 4JTDB 3SYAA 4JYAB 3LSUA 2QKSA 1M9NA 2KKWA 4BWAA 1FS0G 1OV9A 4TOIA 4JI8O 4LP8A 1S76D 1P7GA 2UXBB 4UUJC 3KG2A 2PF4E 1GM7A 1B3QA 4DR4O 4DV4B 2ZDIC 1FXKB 2MW2B 1TVKA 3H1LH 4UB6Z 3KDRA 1E79G 1ZTEA 3ASNB 1IX9A 4LF8O 2FMLA 3J7AU 1VIBA 3JALB 1DF4A 1FXKC 3IAYA 2CTWA 1JVMA 3SJCC 3UCSC 1BT8A 3WG7B 4RO2A 1I08A 4XDKA 4WFBV 2BOCC 4DV5O 1YVWA 1VQKV 2GDSA 1OCOC 3HKDB 2AXTZ 1H2LA 4YJ3B 1R6NA 3ZRWB 5IJ0A 2M6YA 3RBZA 3QTCA 2PTMA 3U0ZA 2Q4PA 4X66O 3F5TA 4UCVA 1XMQB 3THOA 1GTOA 1R3KC 4PDVA 2PI4A 3ABKC 4O4HB 4HYOA 2DWDC 5KHHA 3CB2A 3M8AA 4JZ2A 3D36C 2ATKC 2XAJA 4GX0A 1US6A 4G27B 1H2SB 2KB1A 3JCUZ 3G6EV 1NTZH 3RN4A 4X62B 1NH2B 1FXKA 4QE7A 5F2VO 3WU2Z 5KUKA 1BHAA 1KP3A 4JF3A 2WLNA 4HBNA 5EK0A 4TV9B 3C90A 2EIMC 2EZPA 3KZIZ 1EN4A 3LNMB 2CH7A 3B77A 2W0FC 1YF2A 2QM4A 3VQXA 3E22B 4J41A 1XMOB 4JI4O 1GM9A 1HDJA 3ABKB 4LNUA 3B2EE 2CDYA 4Z1VA 1IJGA 1K33A 1VQPV 1ZSPA 4TV8B 1EN6A 1DTOA 2EIKC 3L9DA 4LFCO 2HVJC 3TGUH 3ZS8C 3APOA 4JI1O 4GX2A 4B3MO 4X1YB 5H9CA 3OAAG 2EIKB 2RCVA 1M56C 5DM6V 1N8RW 3SJQC 4F4LA 4DXWA 1V54C 3BRCA 2ARHA 2CTRA 3DC5A 3G80A 4CS2A 4FJCC 4GT1A 5JVDB 4DO2A 4AQYB 3SYOA 2UXCB 4K3AA 1SQXH 3K9SA 1I0HA 4I5SA 2RDCA 4TV8A 1WA8B 3ZHQA 4YXWG 3OTOO 2P5OA 5L3BA 4GZRB 4N23A 3H1HH 1Z2GA 1BCCH 5KX5B 4GKKB 5IYZB 1COWG 1EZJA 1SQFA 1QVFU 2WAMA 2CH7B 3UO2A 4I4TB 4DR3B 2QM8A 1FFTB 1MMMA 5L3CA 3FAVB 2ZQMA 5LP6A 2VWJA 1M56B 1SZTA 4DV3O 2YEVB 2V1DA 4FVMA 2XAGA 3CRRA 3AG3B 4G2KA 1BMFG 1H2GA 2EZOA 2UUAO 3K79A 5DEDA 3B4SA 4MVZA 5LMUB 1P84F 3DXRB 2KSDA 4FMTA 3KCYA 1PKXA 4WBNA 2UUCO 1IDSA 3MD0A 4FLXA 3MDSA 2Q7HA 1LR1A 1LUWA 5EC1C 2R72A 3LDDA 4FK5C 2A0LA 1BQZA 4TUYB 5JVDA 1JJ2U 1E1QG 2FL4A 4B3MB 4RQEA 5ITZA 1R6KA 4YJ2B 1XQ8A 2LW7A 3JD1A 1HNZB 4NXNB 1Q7YW 4A5UB 1MG1A 5LP6B 2JVDA 3O65A 3T1HB 3ZEDA 3ZRSA 4DR4B 2YXHA 4X64B 3M7MX 4TT3G 4FM1A 3CRQA 4B7KA 5IYZA 5LGTA 5IYCO 1SA0A 3AG1C 4CC6A 4DK0A 4WFGA 4YY3O 4JTAB 2JIZG 2RJZA 5B1OA 4JI3O 4WFEA 1VF7A 2BTQA 1SERA 1GN2A 5B66Z 5KMGB 3G4SV 3ZX6A 2C2AA 3DC6A 4JI0O 3ABLB 5KAFZ 5LXTB 5ITZB 4JI7O 1BZKA 2B5UA 1GN3A 2XTAA 3ASOC 1OCRC 2BTQB 2E75B 5LHHA 3ZMZA 1TGOA 2O57A 1YDXA 2WLKA 5KUMA 5BR8B 1TA8A 1SQBH 4EEQA 1WNSA 4UVAA 1LUVA 2UU9O 4LC1A 1VQOV 4GLXA 3P32A 3E89A 1W59A 1IBMB 2DQ0A 1S5HC 3KCXA 2A9HA 4JI7B 1WLEA 3CCQV 3CHXA 3RYCA 4HAMA 5LGUA 4UVCA 2AZ0A 3UO3A 3E8FA 4KFMA 3K58A 3CC7V 4UV8A 3BA8A 5IY5C 2BCCH 3HKBA 3E8GA 3T1YB 2Y0IA 3ZN0A 4O4JB 2ZM6O 1AROP 5LMNB 1AJPA 1QQCA 1BE3H 2E74B 2LO1A 2PY5A 3HKEA 1QHTA 3ML0A 1JPXA 1MNGA 4X9QA 2ZE8A 3U11A 4U3JA 1YTFB 3TCUA 2ZNIA 3GVMA 1HW7A 1DK1A 1XI1A 1O9HA 2WLIA 3IFXA 4UXNA 2IJHA 2Q69A 4X20A 5JJNB 4DR7B 4LF5O 3CSXA 3K9AA 3UT5A 4O2BB 4RAIA 2AW9A 2DJVA 3OMAB 4ZI7A 1CPYA 1VQ5V 4JI0B 3K57A 1HR0B 5GONB 5DN6G 3RYIA 2IJKA 1Y74A 2Y48A 2ADPA 3B40A 2JGDB 3BA9A 3RYCB 1IVSA 2Q8VA 3CWBH 4O4HA 5L3DA 3W7WA 3N2KB 1CXZB 5KHGA 1BHBA 1Q82W 1XHZA 1SETA 1Y76A 4OPHA 4O2AB 4Q20A 4NYKA 2HLDG 4TQDA 1Y74B 1N4CA 5IWAO 3H1IH 2GSMB 3R65A 1J5EO 1SQGA 5EBWC 4Z2WA 4MVSA 1NH2D 1N34O 4WF9V 1SQPH 1SQVH 1L1FA 1GRJA 2N74A 1VQMV 2GUZA 1YIJV 4DV2B 2ZM6B 2YXLA 3BPZA 3DSQA 4WFFA 2PI5A 1MA1A 1WAZA 4JYAO 2QKCA 1S5JA 4DV6O 2CAZC 4AILC 4DV2O 3UT5B 3ZMUA 4JYYA 5CN0A 1PL4A 1AILA 2BOBC 2HKOA 4BIZA 4O2AA 1L0LH 1I94O 5KX5A 2YXYA 3VQWA 4JI6O 4I55B 2PYLA 3ABUA 3E35A 4UCSA 2YIAA 2IJIA 3LDEA 4H44B 4EB6A 4DV0B 3D36A 4HZ3A 3SPHA 2WSSG 4IL6Z 3MHHC 2A79B 1HNZO 4NB5A 1XMOO 4JI4B 1TUBB 1UPGA 4GX5A 4YJ3A 5FNVB 1DGSA 4MT8A 3J80N 3JAMN 2CGNA 1GH6A 4JASA 2LP7A 4F6EA 4P9OA 2E76B 1IXBA 3ZRXA 1JNBA 4J11A 2DOSA 1GO3F 2DYSC 1I7FA 4DUZO 3T4DA 1N32O 3JD3A 4DR7O 2UXBO 1TVKB 1SQQH 4LBEC 2OWOA 4K35A 3L73H 4X1YA 4GCZA 1TUBA 5E1AC 2A06H 4DR2B 1T5EA 3UM7A 3TK1A 1HNXO 4B3TB 1K8AW 2VQEB 3D3IA 1XUQA 3CEIA 1Q43A 1OCOB 1NKDA 1VQ8V 3ZN1A 3W7SA 4DV7O 1BSMA 2CGOA 1B04A 3PN1A 2CE4A 3T1CA 1IZ3A 1Y4MA 2CTQA 2BSKA 2P4KA 4JAUA 4DW0A 5B1NA 3ETQA 1YCIA 2JDIG 4RUEA 4FM0A 3RYFA 3VOUA 1N36B 5CMUA 1AJNA 3G71V 4I50B 2VQEO 3L71H 2AZ2A 4X65B 4FLUA 3K06A 4NTXA 1FD9A 1Q3EA 3EXAA 4YHHB 5IDJA 5GTIZ 5B3SB 3CCMV 2LW1A 4JV5B 3WB0A 3HKBB 4X8AA 3E83A 5IT9N 4UCUA 1WB7A 5B5EZ 1N36O 3RYHA 4QPKA 3NXSA 2JGUA 3I55V 4LF9B 3SPJA 4I7ZB 4PA4A 3K5OA 4MVRA 3O9OA 1P7BA 3JSLA 1PPJH 2YI9A 3CCEV 4ABMA 4WCEV 3E22A 1K73W 3EFFK 2D2CB 3RFRA 1PP9H 5H6RA 4JI2O 1KBHA 1ZAUA 2KG7A 2EINC 2DYRB 3TETA 3L74H 1I5YA 3JAWA 5KA6A 5LBQA 4O4LB 1N0NA 4E4EA 4I9QA 4LFCB 1ORQC 4O2BA 1YXBA 4NTYA 1PD3A 3TXSA 2V4DA 1AI5A 1E1RG 2ZNJA 2OT5A 1JQ0A 1SF9A 4FZ0A 3ZMTA 4DR1B 3CXHF 3STLC 4DUZB 5BMVB 3SYCA 4X1IB 2A7WA 3HR0A 2P67A 5KA5A 5LHIA 2YICA 1QR8A 1PV0A 3IGAC 1WPBA 1MSWD 2XHBA 5A2QN 4CC5A 5EIBC 4PA6A 2XUMA 2HHHB 1Q90D 3T2MA 4OX9B 5H5NA 2WLMA 5KHIA 1M93A 4JGSA 1K5SA 2DE0X 5EBMC 4LF4B 2UXNA 3AG2B 4UB8Z 4O4LA 4I0XA 4FFBB 4ZOLA 5CB4B 4KHPO 4JV5O 4J7ZA 5CA1A 1VQ7V 4TWKA 3QF7A 4MTGA 4YHHO 4DR3O 1K3EA 2GTAA 5GTHZ 1N0JA 1IBKO 4KHPB 2UU9B 1ZLZA 2GUZB 1K92A 1U96A 3IJ4A 3OEEG 2QTOA 2HG5C 3RGBA 4GKJO 2XASA 3JSNA 1GK9A 3SYPA 3CCJV 1RM1C 3K08A 4DR5O 1IURA 2UXXA 4FLWA 1AI6A 1SZXA 3P3PA 4J42A 1RM1B 3BFRA 4NKGB 2OCCB 3ZIAG 4TUYA 3APQA 1AJQA 4IYIA 3K5LA 2E3CA 2HJFC 5JQGB 2NLJC 2NNUA 3SPCA 3VBBA 2P06A 1G1XB 5FPOA 2W6IG 2B1IA 2L6LA 1LNQA 1Z5WA 3CPWU 1G6UA 3NR7A 1RSOB 2Q0AA 3L75H 5C8YA 3RVYA 2VQFO 1GN4A 2ZE7A 3B8MA 4ZI7B 1KUQA 2K1EA 3WB2A 2R70A 2QM7A 5FNVA 4LFBO 4JZGA 2YC0A 3IC7A 3A8TA 4MVUA 2QWPB 1NTKH 2ZINA 2RQ6A 4MSWC 4UCOA 1EN5A 2Q67A 1WP8A 2QWQB 3AK3A 2F23A 1CP9A 2DYSB 1XBLA 2DQ3A 1U97A 1F4NA 3H9VA 2GHYA 3JASB 1KU9A 5JQGA 1PM9A 3OGIB 1FPOA 2XNDG 4DV7B 1OJHA 1WA8A 4ZHQA 1R1BA 1CEZA 1D5NA 2F95B 1IBKB 1N33B 1JA8A 4DV1B 3HKDA 3CP1A 1YEWA 2ZE5A 4FLYA 3ABMC 4JAAA 2Q7GA 4GKJB 4K8XA 3R66A 2Y69C 1NR7A 4Z1MG 3RYIB 3D8CA 4FM2A 4D7TA 4LCUC 2ODMA 1AP6A 1KP2A 1G8MA 2JGDA 3DTUB 4DK1A 1H2NA 3DXRA 3J81N 2EIJB 1S3JA 2LGQA 3EHBB 2P7TC 3QVNA 2LQTA 1FJGB 4J7KA 1JMKC 4FFKA 3K3WA 3K59A 5LOVB 3CMAV 3MHSC 4WFAV 4I9WA 5LL6Y 1W0KG 4LR3A 4CBCA 2DW4A 3ZJZA 5LYJB 4TV9A 3FB5C 5KHKA 3S3WA 3ZMVA 2Q9LA 2VQFB 4PA9A 1F7YA 3QNEA 1FFXA 3CRAA 4JI2B 1Q6HA 3TJTA 4LFBB 3TXQA 3WB1A 3LNNA 4LF4O 5AG2A 4OPAA 3JYCA 5GONA 4OGQB 3LSQA 3SJAC 3C3TA 4NVPA 3FYEB 3E8BA 3RWRD 1BL8A 4O4IB 2W6JG 1OCRB 2B1GA 4FLVA 3A0RA 3OMIB 4PJ0Z 3E2EA 4X64O 4EB6B 1Q8IA 4PV1B 1K97A 2YI8A 3JAWB 4DYLA 1YJWV 2UXDB 5CBHA 2QWRB 3CRMA 2Q73A 1AR5A 3ETEA 2F93B 4B3RO 2IH1C 5IWAB 4QPJA 5B3SC 1SS3A 5EYPB 5A9GA 2LFRA 2EINB 1NJIW 1OCZC 2RMKB 2DN9A 1AVMA 1NU1H 3P3NA 4IIJA 4UFZA 1FKAO 1N32B 3IC9A 4PI0A 4XDLA 4LWSB 2NR5A 4IHJB 3MAQA 3BCCH 1VQ9V 2WLLA 1ZUQA 1BQ0A 2N05A 4YIPA 3AG2C 3CD6V 4EKWA 3CJHB 4J9YB 2FTKA 1YITV 4LWSA 2ZT9B 5CA1B 5CB4A 4P30A 2JK5C 4DR6O 4I50A 4MVMA 4R7CA 1XL6A 1S0VA 1D5AA 5KAIZ 3ZCCA 4RQFA 4X65O 1SA0B 3F5WC 2ZR3A 3I5DA 2Y4TA 1AB3A 4BAYA 2HVKC 5CBFA 4NXMO 2OYQA 1YZBA 3K0DA 3B8NA 3OTOB 3CCSV 4JI5B 1QU7A 4PHZA 2GV9A 4WBNB 2Q0OC 4QNHB 4FIPC 1JR9A 1URFA 3OM3B 1VF6C 2ETNA 5E79Z 4R8CA 1KKCA 4JI6B 2HP8A 5B1BB 3RT3C 4FLZA 2GTSA 2R9AA 1M57B 4TSFG 4CZZA 5B1BC 1K4DC 1IXMA 4BR6A 3VQVA 5IJ9A 2BE3A 2JJ1G 1QBZA 1HNXB 3JATB 3CS5A 4B3TO 1VQ6V 2QSAA 1OZ0A 1MOFA 4JI1B 4GKKO 2EIMB 3ICXA 5J2TA 3ABLC 1XL4A 4X1IA 1VF5B 2K9PA 3D3QA 2Q68A 4J9ZB 4U7OA 5BMVA 5JH7A 2WPDG 3SYQA 3CCRV 2IBZH 3OUSA 4D7SA 2D3OW 2LJ2A 1YJ9V 5L3GA 4NTWA 1RPOA 5J2TB 1I94B 2BTOA 2B9ZA 2QR4A 5K1XA 5LMUO 3K0GA 2MK3A 1RSOA 4IGGA 4I0XB 3AG4C 1WN7A 3BABA 3X2QB 2YIDA 2Y69B 2F43G 3JAKA 2ILMA 4UCRA 3AG4B 1OCZB 1Q6IA 2JS5A 3FKSG 3CCLV 5KHJA 4LFAB 4DV3B 4NXMB 2A3QA 4K0KO 2EILB 1HNWO 2FB5A 5HFLA 3G67A 1QCEA 2DMXA 3JD4A 1L8DA 4RWUA 1VQLV 1K9MW 2QE7G 1VMGA 3VQYA 4X20B 1JFFB 2DWEC 2OIGA 3ZHRA 2P6JA 4PD4F 2OTLV 1Y6XA 2YSUB 2UXCO 4DV6B 2CUGA 3OE7G 1S72V 1YSCA 5JJJB 1BS3A 1Q81W 4DR5B 1FFXB 1MZEA 1FJGO 2ZXWB 2R9IA 2EX3A 5EZYB 3T1HO 1SKVA 3RVZA 4ICGA 4BIOA 5KLVH 3M99B 4LF6B 4B3RB 4K0KB 3E8HA 5BY1A 1Q6UA 5C93A 1D2DA 1WJZA 5HFMA 1I5XA 1FYJA 4OX9O 1RP3B 2YDEA 4LF6O 3UKMA 1ENVA 2XAHA 4MS2A 2XOKG 2UXDO 4PI2A 1Y76B 1XNRO 4CH5A 4FLTA 2CTPA 2QKAA 3OW2U 5EZYA 5DECA 1NQTA 3AK2A 4LF8B 5LGNA 3GWKC 1OCCC 2JRIA 5CA3A 4N21A 1YHQV 3OTFA 2PZSA 1P49A 3OFNG 3CX5F 4KUMA 1YJNV 1QNMA 1MABG 4JYCA 4JAVA 3CC2V 2PGGA 4IHJA 1HNWB 5CA0A 1V55B 3AK1A 2XAFA 2E5LO 5L3FA 2ZDIA 4WFHA 4QIWF 2EILC 2QDOA 1NR1A 3CJHA 1QLEC 4KP4A 1KECA 4AQYO 3HKCB 4F6RA 4MTXA 4ZIBA 2V7QG 5FPRA 1XNQO 5LMNO 2LFSA 4LH7A 3JD0A 5H2FZ 1EZVH 3Q4HB 2YUAA 1R73A 2IM9A 4CH4A 3BY6A 3FX7A 4K8ZA 1MZFA 2FKXA 4MTFA 4B3SO 1TUEB 2IW5A 3SPIA 1UJWB 2E5LB 1VP7A 3ZBHA 2KQXA 1SESA 2VS0A 3L72H 3U10A 1NT2B 5L3EA 2VWKA 1WP7A 1ZX3A 2HR3A 3KKYA 4YJ2A 4H0LB 2BSKB 1N33O 3CXCU 5LYJA 3ETDA 5J2UB 2OTJV 3FD9A 4Q6GA 3H1JH 4BW9A 3C3SA 2ZXWC 1JOYA 4ZOLB 3JATA 1K5QA 2CK3G 5TISZ 3WG7C 1YTFD 5EYPA 4J10A 4J80A 4P9PA 2RNBA 4H33A 4DUYO 4DRXA 5FLXN 4BW5A 1ZL8A 3OR6C 4DV0O 5JH7B 2QEXV 4MVOA 3RYHB 5BXZA 2QWOB 5B1AC 4QJFB 2EIJC 5IYBO 2HFEC 5EIBD 5J9PC 3OUFA 1NBMG 1Q86W 1Q5OA 3HPLC 5K1PA 1NZ6A 1SRYA 3SPGA 1NVPD 1EBOA 1Y66A 3CYOA 4PELA 1XHXA 2HHHO 5H6QA 4DR1O 4GX1A 2KG7B 3QO7A 4ASUG 4W4LA 1KD1W 2F1MA 2FYUH 1JJOA 5JCOA 3ZRWA 3JARA 1H8EG 3EVKA 5JWPA 3ETGA 1G4YB 2WLHA 4O4JA 1B06A 4E2LA 2ITDC 2YIBD 4U7NA 3P30A 4JI8B 4B7EA 3SDLA 3FB8C 3AG7A 2XAQA 3S3XA 3LDCA 3CMEV 1PL0A 2EULA 3LUTB 3H01A 1THZA 1X4TA 2YEVA 2Y0PA 1AI4A 2ZR2A 4AI8A 1FAFA 2H8PC 2WLJA 1XREA 1KKDA 5D5QA 2DYRC 1OHHG 4FZ1A 3HKEB 4LF9O 2IH3C 1OCCB 4JYBA 4DV5B 1KQSU 4U3JB 1J5EB 3PJSK 4LH6A 2ZD9A 3OD4A 4AHCA 1PNKA 2EBOA 2HJDA 5LHGA 2X6CA 3DGEA 3HB3B 5FL7G 1QLEB 1YI2V 1GMGA 3CRCA 3CC4V 2AHYA 1F51A 4CS4A 3JALA 2ZCEA 1K4CC 5IJ9B 4C7UA 3W7UA 4FFBA 2ZKOA 4G28B 2JS3A 3B09A 4GYCB 1EFRG 3OT7A 3K5NA 1V54B 4MVQA 4UV9A 3FFQA 1XNQB 2EJ7A 5JJEB 3L70H 1H2KA 1V55C 3ABTA 4P2ZA 4X62O 3N2KA 4IYHA 3STZC 3ZHVA 4J7JA 4EFEA 3JCZA 5LXTA 5IJ0B 3QO5A 1XILA 1QR9A 5B1AB 1RPRA 3ZHTA 4KL1A 3CCVV 4LF5B 3QO8A 1XDCA 4F6RB 5IE9A 4DR2O 1IBLB 1VF6A 3JASA 2ZIMA 4PDMA 1NVPB 2N04A 2IU3A 4NR1A 2QGNA 3A0HZ 5BR8O 2EJRA 2OCCC 4MW3A 2M7WA 4R6ZA 1FOUA 2RN9A 5LP6C 3OGCC 4DR6B 4DV1O 2YS8A 2QWNB 5EC2C 5GW7A 4PDRA 2Q6AA 4IT5A 3BVOA 4I55A 1XOUA 4YY3B 5C8YB 1DLBA 4EFBA 1P4RA 3FB6C 1AP5A 2QJ1A 4ZHQB 3RYFB 3BEHA 1NI8A 3CE2A 4JTCB 1GM8A 3A0BZ 1PNLA 4DUYB 1JFFA 4LNUB 4X1KB 1O9GA 1BGYH
chains in the Genus database with same CATH topology
1WB8A 4JZGA 5AG2A 3RN4A 3C3TA 1EN5A 3AK3A 1JR9A 1XUQA 3CEIA 4C7UA 1MA1A 2QKCA 1KKCA 1BSMA 1PM9A 3OT7A 1EM1A 4YIOA 2CE4A 4JYYA 1VEWA 1PL4A 1IDSA 2P4KA 1EN4A 3MDSA 1LUWA 3LSUA 1D5NA 1BS3A 4BR6A 1JA8A 1AR5A 3EVKA 4GUNA 1MNGA 4X9QA 1P7GA 2CDYA 5A9GA 1VARA 1XILA 1ZSPA 1B06A 1EN6A 1N0JA 1AVMA 3KDRA 1ZLZA 1ZTEA 2ADQB 1XDCA 1IX9A 1AP6A 2RCVA 3IC9A 3KKYA 1WB7A 2AW9A 1BT8A 1SZXA 3QVNA 1I08A 3DC5A 1ZUQA 4FFKA 1Y67A 4YIPA 3BFRA 4F6EA 1GN2A 2ADPA 1IXBA 1XREA 2GDSA 3C3SA 2QKAA 3DC6A 3K9SA 1GN6A 1I0HA 3AK2A 1GN3A 1AR4A 1AP5A 1QNMA 1MSDA 1N0NA 4E4EA 3AK1A 1LUVA 1GN4A 3TJTA 1MMMA 4JZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WB8 A;  4JZG A;  5AG2 A;  3RN4 A;  3C3T A;  1EN5 A;  3AK3 A;  1JR9 A;  1XUQ A;  3CEI A;  4C7U A;  1MA1 A;  2QKC A;  1KKC A;  1BSM A;  1PM9 A;  3OT7 A;  1EM1 A;  4YIO A;  2CE4 A;  4JYY A;  1VEW A;  1PL4 A;  1IDS A;  2P4K A;  1EN4 A;  3MDS A;  1LUW A;  3LSU A;  1D5N A;  1BS3 A;  4BR6 A;  1JA8 A;  1AR5 A;  3EVK A;  4GUN A;  1MNG A;  4X9Q A;  1P7G A;  2CDY A;  5A9G A;  1VAR A;  1XIL A;  1ZSP A;  1B06 A;  1EN6 A;  1N0J A;  1AVM A;  1ZLZ A;  1ZTE A;  2ADQ B;  1XDC A;  1IX9 A;  1AP6 A;  2RCV A;  3IC9 A;  3KKY A;  1WB7 A;  2AW9 A;  1BT8 A;  1SZX A;  3QVN A;  1I08 A;  3DC5 A;  1ZUQ A;  4FFK A;  1Y67 A;  4YIP A;  3BFR A;  4F6E A;  1GN2 A;  2ADP A;  1IXB A;  1XRE A;  2GDS A;  3C3S A;  2QKA A;  3DC6 A;  3K9S A;  1GN6 A;  1I0H A;  3AK2 A;  1GN3 A;  1AR4 A;  1AP5 A;  1QNM A;  1MSD A;  1N0N A;  4E4E A;  3AK1 A;  1LUV A;  1GN4 A;  3TJT A;  1MMM A;  4JZ2 A; 
#chains in the Genus database with same CATH topology
 3GB7 C;  2QTS A;  3ASO B;  2R9R B;  4U3F H;  3K5M A;  1M4U A;  5D5P A;  1WB8 A;  4CS3 A;  1W2B U;  3ABM B;  2HEP A;  2WLI B;  4W4K A;  3AEI A;  3ZHS A;  5EBL C;  1KB9 F;  3E86 A;  4X66 B;  4PA3 A;  2OCH A;  4B08 A;  3BAA A;  1PNM A;  2JEU A;  4H13 B;  3AG3 C;  1M90 W;  2P22 C;  1HP8 A;  4DRX B;  1R3L C;  2LGW A;  1SC5 B;  4XDJ A;  5CBG A;  1ROP A;  1ZL8 B;  5KMG A;  3T4Z A;  1AR1 B;  1FXV A;  5CA0 B;  4UCT A;  4H37 A;  3K03 A;  4ZKI A;  2Z3Y A;  2PUS A;  4LFA O;  2JEX A;  1M5I A;  3HKC A;  1KC8 W;  2Q7E A;  4L87 A;  3SR2 C;  2ADQ B;  1GKF A;  3LSS A;  1TAE A;  2GBO A;  4D6T H;  2VRZ A;  3ASN C;  3I56 V;  4UVB A;  1H2M A;  1GAX A;  1R3I C;  4X1K A;  1A32 A;  3FYI B;  1M57 C;  3G6B A;  2IJJ A;  1DF5 A;  1JX9 A;  3FAV A;  1ZWI C;  3SJB C;  1HWY A;  3A2F A;  3OEH G;  3JAR B;  4LF7 B;  1VQ4 V;  2WWW A;  4RUF A;  4BIU A;  1Z5V A;  1V9P A;  5LA6 B;  3JD2 A;  1GN6 A;  4X88 A;  2F4V O;  3QG5 A;  3UQ8 A;  1NTM H;  4QE9 A;  3F7V C;  2QA4 V;  4NXN O;  1J95 A;  4XBF A;  1H8H G;  1IBM O;  2YIB A;  2UUA B;  1UFI A;  3FB7 C;  4O4I A;  1H38 A;  3W7X A;  3ZRV A;  3Q4H A;  2ZIO A;  1KYO F;  4IIJ B;  3ZMS A;  5JCO C;  2UUC B;  2F4V B;  4DV4 O;  4B3S B;  4I4T A;  5LOV A;  2X6B A;  1XNR B;  1X59 A;  4PDL A;  4LF7 O;  2F66 C;  1AI7 A;  3CCU V;  3JAK B;  1W0J G;  1VEW A;  3F7Y C;  1K7D A;  3BHP A;  5IY5 B;  2PYJ A;  2H3O A;  4JI5 O;  4QGP A;  1S77 D;  4GUN A;  4R50 A;  2NN4 A;  1VAR A;  3K04 A;  5LA6 A;  1IBL O;  3N27 A;  1NS1 A;  4MTO A;  2H94 A;  1R3J C;  1FXH A;  2W0X A;  4JPR A;  5J2U A;  4FPP A;  1B6Q A;  1XMQ O;  1S5L Z;  4HNA B;  4X89 A;  3ZHU A;  1KMI Z;  2L35 A;  3W7T A;  3OMN B;  4JI3 B;  2JJ2 G;  1Y67 A;  2WA3 A;  4MW8 A;  3N2G A;  2AGA A;  5IYD O;  1WPX A;  3T1Y O;  2Y4U A;  2G38 A;  1XEQ A;  2X0L A;  3RW0 A;  1F4M A;  2Z0A A;  2Q5Z A;  2Z5U A;  1AR4 A;  4OXS A;  2P4V A;  3SGI A;  2UUB O;  2XT9 A;  1N34 B;  4CH6 A;  1K34 A;  2OIE A;  1MSD A;  1M1K W;  2X7R B;  4PA7 A;  3OR7 C;  4L8J A;  1H5W A;  3WFV A;  2UUB B;  2WA4 A;  4TQF A;  2ZE6 A;  4DW1 A;  2IU0 A;  1F23 A;  3AG1 B;  2WLL B;  4ZBM A;  2P90 A;  3X2Q C;  2X6A A;  3N2G B;  2AHZ A;  5BZB A;  1QVG U;  1HR0 O;  1RFY A;  1VQN V;  1L0N H;  4CH3 A;  3H1K H;  3GWO A;  1R6T A;  4KXR A;  1EM1 A;  4HNA A;  4YIO A;  1JCH A;  2ITC C;  1QLN A;  4JTD B;  3SYA A;  4JYA B;  3LSU A;  2QKS A;  1M9N A;  2KKW A;  4BWA A;  1FS0 G;  1OV9 A;  4TOI A;  4JI8 O;  4LP8 A;  1S76 D;  1P7G A;  2UXB B;  4UUJ C;  3KG2 A;  2PF4 E;  1GM7 A;  1B3Q A;  4DR4 O;  4DV4 B;  2ZDI C;  1FXK B;  2MW2 B;  1TVK A;  3H1L H;  4UB6 Z;  3KDR A;  1E79 G;  1ZTE A;  3ASN B;  1IX9 A;  4LF8 O;  2FML A;  3J7A U;  1VIB A;  3JAL B;  1DF4 A;  1FXK C;  3IAY A;  2CTW A;  1JVM A;  3SJC C;  3UCS C;  1BT8 A;  3WG7 B;  4RO2 A;  1I08 A;  4XDK A;  4WFB V;  2BOC C;  4DV5 O;  1YVW A;  1VQK V;  2GDS A;  1OCO C;  3HKD B;  2AXT Z;  1H2L A;  4YJ3 B;  1R6N A;  3ZRW B;  5IJ0 A;  2M6Y A;  3RBZ A;  3QTC A;  2PTM A;  3U0Z A;  2Q4P A;  4X66 O;  3F5T A;  4UCV A;  1XMQ B;  3THO A;  1GTO A;  1R3K C;  4PDV A;  2PI4 A;  3ABK C;  4O4H B;  4HYO A;  2DWD C;  5KHH A;  3CB2 A;  3M8A A;  4JZ2 A;  3D36 C;  2ATK C;  2XAJ A;  4GX0 A;  1US6 A;  4G27 B;  1H2S B;  2KB1 A;  3JCU Z;  3G6E V;  1NTZ H;  3RN4 A;  4X62 B;  1NH2 B;  1FXK A;  4QE7 A;  5F2V O;  3WU2 Z;  5KUK A;  1BHA A;  1KP3 A;  4JF3 A;  2WLN A;  4HBN A;  5EK0 A;  4TV9 B;  3C90 A;  2EIM C;  2EZP A;  3KZI Z;  1EN4 A;  3LNM B;  2CH7 A;  3B77 A;  2W0F C;  1YF2 A;  2QM4 A;  3VQX A;  3E22 B;  4J41 A;  1XMO B;  4JI4 O;  1GM9 A;  1HDJ A;  3ABK B;  4LNU A;  3B2E E;  2CDY A;  4Z1V A;  1IJG A;  1K33 A;  1VQP V;  1ZSP A;  4TV8 B;  1EN6 A;  1DTO A;  2EIK C;  3L9D A;  4LFC O;  2HVJ C;  3TGU H;  3ZS8 C;  3APO A;  4JI1 O;  4GX2 A;  4B3M O;  4X1Y B;  5H9C A;  3OAA G;  2EIK B;  2RCV A;  1M56 C;  5DM6 V;  1N8R W;  3SJQ C;  4F4L A;  4DXW A;  1V54 C;  3BRC A;  2ARH A;  2CTR A;  3DC5 A;  3G80 A;  4CS2 A;  4FJC C;  4GT1 A;  5JVD B;  4DO2 A;  4AQY B;  3SYO A;  2UXC B;  4K3A A;  1SQX H;  3K9S A;  1I0H A;  4I5S A;  2RDC A;  4TV8 A;  1WA8 B;  3ZHQ A;  4YXW G;  3OTO O;  2P5O A;  5L3B A;  4GZR B;  4N23 A;  3H1H H;  1Z2G A;  1BCC H;  5KX5 B;  4GKK B;  5IYZ B;  1COW G;  1EZJ A;  1SQF A;  1QVF U;  2WAM A;  2CH7 B;  3UO2 A;  4I4T B;  4DR3 B;  2QM8 A;  1FFT B;  1MMM A;  5L3C A;  3FAV B;  2ZQM A;  5LP6 A;  2VWJ A;  1M56 B;  1SZT A;  4DV3 O;  2YEV B;  2V1D A;  4FVM A;  2XAG A;  3CRR A;  3AG3 B;  4G2K A;  1BMF G;  1H2G A;  2EZO A;  2UUA O;  3K79 A;  5DED A;  3B4S A;  4MVZ A;  5LMU B;  1P84 F;  3DXR B;  2KSD A;  4FMT A;  3KCY A;  1PKX A;  4WBN A;  2UUC O;  1IDS A;  3MD0 A;  4FLX A;  3MDS A;  2Q7H A;  1LR1 A;  1LUW A;  5EC1 C;  2R72 A;  3LDD A;  4FK5 C;  2A0L A;  1BQZ A;  4TUY B;  5JVD A;  1JJ2 U;  1E1Q G;  2FL4 A;  4B3M B;  4RQE A;  5ITZ A;  1R6K A;  4YJ2 B;  1XQ8 A;  2LW7 A;  3JD1 A;  1HNZ B;  4NXN B;  1Q7Y W;  4A5U B;  1MG1 A;  5LP6 B;  2JVD A;  3O65 A;  3T1H B;  3ZED A;  3ZRS A;  4DR4 B;  2YXH A;  4X64 B;  3M7M X;  4TT3 G;  4FM1 A;  3CRQ A;  4B7K A;  5IYZ A;  5LGT A;  5IYC O;  1SA0 A;  3AG1 C;  4CC6 A;  4DK0 A;  4WFG A;  4YY3 O;  4JTA B;  2JIZ G;  2RJZ A;  5B1O A;  4JI3 O;  4WFE A;  1VF7 A;  2BTQ A;  1SER A;  1GN2 A;  5B66 Z;  5KMG B;  3G4S V;  3ZX6 A;  2C2A A;  3DC6 A;  4JI0 O;  3ABL B;  5KAF Z;  5LXT B;  5ITZ B;  4JI7 O;  1BZK A;  2B5U A;  1GN3 A;  2XTA A;  3ASO C;  1OCR C;  2BTQ B;  2E75 B;  5LHH A;  3ZMZ A;  1TGO A;  2O57 A;  1YDX A;  2WLK A;  5KUM A;  5BR8 B;  1TA8 A;  1SQB H;  4EEQ A;  1WNS A;  4UVA A;  1LUV A;  2UU9 O;  4LC1 A;  1VQO V;  4GLX A;  3P32 A;  3E89 A;  1W59 A;  1IBM B;  2DQ0 A;  1S5H C;  3KCX A;  2A9H A;  4JI7 B;  1WLE A;  3CCQ V;  3CHX A;  3RYC A;  4HAM A;  5LGU A;  4UVC A;  2AZ0 A;  3UO3 A;  3E8F A;  4KFM A;  3K58 A;  3CC7 V;  4UV8 A;  3BA8 A;  5IY5 C;  2BCC H;  3HKB A;  3E8G A;  3T1Y B;  2Y0I A;  3ZN0 A;  4O4J B;  2ZM6 O;  1ARO P;  5LMN B;  1AJP A;  1QQC A;  1BE3 H;  2E74 B;  2LO1 A;  2PY5 A;  3HKE A;  1QHT A;  3ML0 A;  1JPX A;  1MNG A;  4X9Q A;  2ZE8 A;  3U11 A;  4U3J A;  1YTF B;  3TCU A;  2ZNI A;  3GVM A;  1HW7 A;  1DK1 A;  1XI1 A;  1O9H A;  2WLI A;  3IFX A;  4UXN A;  2IJH A;  2Q69 A;  4X20 A;  5JJN B;  4DR7 B;  4LF5 O;  3CSX A;  3K9A A;  3UT5 A;  4O2B B;  4RAI A;  2AW9 A;  2DJV A;  3OMA B;  4ZI7 A;  1CPY A;  1VQ5 V;  4JI0 B;  3K57 A;  1HR0 B;  5GON B;  5DN6 G;  3RYI A;  2IJK A;  1Y74 A;  2Y48 A;  2ADP A;  3B40 A;  2JGD B;  3BA9 A;  3RYC B;  1IVS A;  2Q8V A;  3CWB H;  4O4H A;  5L3D A;  3W7W A;  3N2K B;  1CXZ B;  5KHG A;  1BHB A;  1Q82 W;  1XHZ A;  1SET A;  1Y76 A;  4OPH A;  4O2A B;  4Q20 A;  4NYK A;  2HLD G;  4TQD A;  1Y74 B;  1N4C A;  5IWA O;  3H1I H;  2GSM B;  3R65 A;  1J5E O;  1SQG A;  5EBW C;  4Z2W A;  4MVS A;  1NH2 D;  1N34 O;  4WF9 V;  1SQP H;  1SQV H;  1L1F A;  1GRJ A;  2N74 A;  1VQM V;  2GUZ A;  1YIJ V;  4DV2 B;  2ZM6 B;  2YXL A;  3BPZ A;  3DSQ A;  4WFF A;  2PI5 A;  1MA1 A;  1WAZ A;  4JYA O;  2QKC A;  1S5J A;  4DV6 O;  2CAZ C;  4AIL C;  4DV2 O;  3UT5 B;  3ZMU A;  4JYY A;  5CN0 A;  1PL4 A;  1AIL A;  2BOB C;  2HKO A;  4BIZ A;  4O2A A;  1L0L H;  1I94 O;  5KX5 A;  2YXY A;  3VQW A;  4JI6 O;  4I55 B;  2PYL A;  3ABU A;  3E35 A;  4UCS A;  2YIA A;  2IJI A;  3LDE A;  4H44 B;  4EB6 A;  4DV0 B;  3D36 A;  4HZ3 A;  3SPH A;  2WSS G;  4IL6 Z;  3MHH C;  2A79 B;  1HNZ O;  4NB5 A;  1XMO O;  4JI4 B;  1TUB B;  1UPG A;  4GX5 A;  4YJ3 A;  5FNV B;  1DGS A;  4MT8 A;  3J80 N;  3JAM N;  2CGN A;  1GH6 A;  4JAS A;  2LP7 A;  4F6E A;  4P9O A;  2E76 B;  1IXB A;  3ZRX A;  1JNB A;  4J11 A;  2DOS A;  1GO3 F;  2DYS C;  1I7F A;  4DUZ O;  3T4D A;  1N32 O;  3JD3 A;  4DR7 O;  2UXB O;  1TVK B;  1SQQ H;  4LBE C;  2OWO A;  4K35 A;  3L73 H;  4X1Y A;  4GCZ A;  1TUB A;  5E1A C;  2A06 H;  4DR2 B;  1T5E A;  3UM7 A;  3TK1 A;  1HNX O;  4B3T B;  1K8A W;  2VQE B;  3D3I A;  1XUQ A;  3CEI A;  1Q43 A;  1OCO B;  1NKD A;  1VQ8 V;  3ZN1 A;  3W7S A;  4DV7 O;  1BSM A;  2CGO A;  1B04 A;  3PN1 A;  2CE4 A;  3T1C A;  1IZ3 A;  1Y4M A;  2CTQ A;  2BSK A;  2P4K A;  4JAU A;  4DW0 A;  5B1N A;  3ETQ A;  1YCI A;  2JDI G;  4RUE A;  4FM0 A;  3RYF A;  3VOU A;  1N36 B;  5CMU A;  1AJN A;  3G71 V;  4I50 B;  2VQE O;  3L71 H;  2AZ2 A;  4X65 B;  4FLU A;  3K06 A;  4NTX A;  1FD9 A;  1Q3E A;  3EXA A;  4YHH B;  5IDJ A;  5GTI Z;  5B3S B;  3CCM V;  2LW1 A;  4JV5 B;  3WB0 A;  3HKB B;  4X8A A;  3E83 A;  5IT9 N;  4UCU A;  1WB7 A;  5B5E Z;  1N36 O;  3RYH A;  4QPK A;  3NXS A;  2JGU A;  3I55 V;  4LF9 B;  3SPJ A;  4I7Z B;  4PA4 A;  3K5O A;  4MVR A;  3O9O A;  1P7B A;  3JSL A;  1PPJ H;  2YI9 A;  3CCE V;  4ABM A;  4WCE V;  3E22 A;  1K73 W;  3EFF K;  2D2C B;  3RFR A;  1PP9 H;  5H6R A;  4JI2 O;  1KBH A;  1ZAU A;  2KG7 A;  2EIN C;  2DYR B;  3TET A;  3L74 H;  1I5Y A;  3JAW A;  5KA6 A;  5LBQ A;  4O4L B;  1N0N A;  4E4E A;  4I9Q A;  4LFC B;  1ORQ C;  4O2B A;  1YXB A;  4NTY A;  1PD3 A;  3TXS A;  2V4D A;  1AI5 A;  1E1R G;  2ZNJ A;  2OT5 A;  1JQ0 A;  1SF9 A;  4FZ0 A;  3ZMT A;  4DR1 B;  3CXH F;  3STL C;  4DUZ B;  5BMV B;  3SYC A;  4X1I B;  2A7W A;  3HR0 A;  2P67 A;  5KA5 A;  5LHI A;  2YIC A;  1QR8 A;  1PV0 A;  3IGA C;  1WPB A;  1MSW D;  2XHB A;  5A2Q N;  4CC5 A;  5EIB C;  4PA6 A;  2XUM A;  2HHH B;  1Q90 D;  3T2M A;  4OX9 B;  5H5N A;  2WLM A;  5KHI A;  1M93 A;  4JGS A;  1K5S A;  2DE0 X;  5EBM C;  4LF4 B;  2UXN A;  3AG2 B;  4UB8 Z;  4O4L A;  4I0X A;  4FFB B;  4ZOL A;  5CB4 B;  4KHP O;  4JV5 O;  4J7Z A;  5CA1 A;  1VQ7 V;  4TWK A;  3QF7 A;  4MTG A;  4YHH O;  4DR3 O;  1K3E A;  2GTA A;  5GTH Z;  1N0J A;  1IBK O;  4KHP B;  2UU9 B;  1ZLZ A;  2GUZ B;  1K92 A;  1U96 A;  3IJ4 A;  3OEE G;  2QTO A;  2HG5 C;  3RGB A;  4GKJ O;  2XAS A;  3JSN A;  1GK9 A;  3SYP A;  3CCJ V;  1RM1 C;  3K08 A;  4DR5 O;  1IUR A;  2UXX A;  4FLW A;  1AI6 A;  1SZX A;  3P3P A;  4J42 A;  1RM1 B;  3BFR A;  4NKG B;  2OCC B;  3ZIA G;  4TUY A;  3APQ A;  1AJQ A;  4IYI A;  3K5L A;  2E3C A;  2HJF C;  5JQG B;  2NLJ C;  2NNU A;  3SPC A;  3VBB A;  2P06 A;  1G1X B;  5FPO A;  2W6I G;  2B1I A;  2L6L A;  1LNQ A;  1Z5W A;  3CPW U;  1G6U A;  3NR7 A;  1RSO B;  2Q0A A;  3L75 H;  5C8Y A;  3RVY A;  2VQF O;  1GN4 A;  2ZE7 A;  3B8M A;  4ZI7 B;  1KUQ A;  2K1E A;  3WB2 A;  2R70 A;  2QM7 A;  5FNV A;  4LFB O;  4JZG A;  2YC0 A;  3IC7 A;  3A8T A;  4MVU A;  2QWP B;  1NTK H;  2ZIN A;  2RQ6 A;  4MSW C;  4UCO A;  1EN5 A;  2Q67 A;  1WP8 A;  2QWQ B;  3AK3 A;  2F23 A;  1CP9 A;  2DYS B;  1XBL A;  2DQ3 A;  1U97 A;  1F4N A;  3H9V A;  2GHY A;  3JAS B;  1KU9 A;  5JQG A;  1PM9 A;  3OGI B;  1FPO A;  2XND G;  4DV7 B;  1OJH A;  1WA8 A;  4ZHQ A;  1R1B A;  1CEZ A;  1D5N A;  2F95 B;  1IBK B;  1N33 B;  1JA8 A;  4DV1 B;  3HKD A;  3CP1 A;  1YEW A;  2ZE5 A;  4FLY A;  3ABM C;  4JAA A;  2Q7G A;  4GKJ B;  4K8X A;  3R66 A;  2Y69 C;  1NR7 A;  4Z1M G;  3RYI B;  3D8C A;  4FM2 A;  4D7T A;  4LCU C;  2ODM A;  1AP6 A;  1KP2 A;  1G8M A;  2JGD A;  3DTU B;  4DK1 A;  1H2N A;  3DXR A;  3J81 N;  2EIJ B;  1S3J A;  2LGQ A;  3EHB B;  2P7T C;  3QVN A;  2LQT A;  1FJG B;  4J7K A;  1JMK C;  4FFK A;  3K3W A;  3K59 A;  5LOV B;  3CMA V;  3MHS C;  4WFA V;  4I9W A;  5LL6 Y;  1W0K G;  4LR3 A;  4CBC A;  2DW4 A;  3ZJZ A;  5LYJ B;  4TV9 A;  3FB5 C;  5KHK A;  3S3W A;  3ZMV A;  2Q9L A;  2VQF B;  4PA9 A;  1F7Y A;  3QNE A;  1FFX A;  3CRA A;  4JI2 B;  1Q6H A;  3TJT A;  4LFB B;  3TXQ A;  3WB1 A;  3LNN A;  4LF4 O;  5AG2 A;  4OPA A;  3JYC A;  5GON A;  4OGQ B;  3LSQ A;  3SJA C;  3C3T A;  4NVP A;  3FYE B;  3E8B A;  3RWR D;  1BL8 A;  4O4I B;  2W6J G;  1OCR B;  2B1G A;  4FLV A;  3A0R A;  3OMI B;  4PJ0 Z;  3E2E A;  4X64 O;  4EB6 B;  1Q8I A;  4PV1 B;  1K97 A;  2YI8 A;  3JAW B;  4DYL A;  1YJW V;  2UXD B;  5CBH A;  2QWR B;  3CRM A;  2Q73 A;  1AR5 A;  3ETE A;  2F93 B;  4B3R O;  2IH1 C;  5IWA B;  4QPJ A;  5B3S C;  1SS3 A;  5EYP B;  5A9G A;  2LFR A;  2EIN B;  1NJI W;  1OCZ C;  2RMK B;  2DN9 A;  1AVM A;  1NU1 H;  3P3N A;  4IIJ A;  4UFZ A;  1FKA O;  1N32 B;  3IC9 A;  4PI0 A;  4XDL A;  4LWS B;  2NR5 A;  4IHJ B;  3MAQ A;  3BCC H;  1VQ9 V;  2WLL A;  1ZUQ A;  1BQ0 A;  2N05 A;  4YIP A;  3AG2 C;  3CD6 V;  4EKW A;  3CJH B;  4J9Y B;  2FTK A;  1YIT V;  4LWS A;  2ZT9 B;  5CA1 B;  5CB4 A;  4P30 A;  2JK5 C;  4DR6 O;  4I50 A;  4MVM A;  4R7C A;  1XL6 A;  1S0V A;  1D5A A;  5KAI Z;  3ZCC A;  4RQF A;  4X65 O;  1SA0 B;  3F5W C;  2ZR3 A;  3I5D A;  2Y4T A;  1AB3 A;  4BAY A;  2HVK C;  5CBF A;  4NXM O;  2OYQ A;  1YZB A;  3K0D A;  3B8N A;  3OTO B;  3CCS V;  4JI5 B;  1QU7 A;  4PHZ A;  2GV9 A;  4WBN B;  2Q0O C;  4QNH B;  4FIP C;  1JR9 A;  1URF A;  3OM3 B;  1VF6 C;  2ETN A;  5E79 Z;  4R8C A;  1KKC A;  4JI6 B;  2HP8 A;  5B1B B;  3RT3 C;  4FLZ A;  2GTS A;  2R9A A;  1M57 B;  4TSF G;  4CZZ A;  5B1B C;  1K4D C;  1IXM A;  4BR6 A;  3VQV A;  5IJ9 A;  2BE3 A;  2JJ1 G;  1QBZ A;  1HNX B;  3JAT B;  3CS5 A;  4B3T O;  1VQ6 V;  2QSA A;  1OZ0 A;  1MOF A;  4JI1 B;  4GKK O;  2EIM B;  3ICX A;  5J2T A;  3ABL C;  1XL4 A;  4X1I A;  1VF5 B;  2K9P A;  3D3Q A;  2Q68 A;  4J9Z B;  4U7O A;  5BMV A;  5JH7 A;  2WPD G;  3SYQ A;  3CCR V;  2IBZ H;  3OUS A;  4D7S A;  2D3O W;  2LJ2 A;  1YJ9 V;  5L3G A;  4NTW A;  1RPO A;  5J2T B;  1I94 B;  2BTO A;  2B9Z A;  2QR4 A;  5K1X A;  5LMU O;  3K0G A;  2MK3 A;  1RSO A;  4IGG A;  4I0X B;  3AG4 C;  1WN7 A;  3BAB A;  3X2Q B;  2YID A;  2Y69 B;  2F43 G;  3JAK A;  2ILM A;  4UCR A;  3AG4 B;  1OCZ B;  1Q6I A;  2JS5 A;  3FKS G;  3CCL V;  5KHJ A;  4LFA B;  4DV3 B;  4NXM B;  2A3Q A;  4K0K O;  2EIL B;  1HNW O;  2FB5 A;  5HFL A;  3G67 A;  1QCE A;  2DMX A;  3JD4 A;  1L8D A;  4RWU A;  1VQL V;  1K9M W;  2QE7 G;  1VMG A;  3VQY A;  4X20 B;  1JFF B;  2DWE C;  2OIG A;  3ZHR A;  2P6J A;  4PD4 F;  2OTL V;  1Y6X A;  2YSU B;  2UXC O;  4DV6 B;  2CUG A;  3OE7 G;  1S72 V;  1YSC A;  5JJJ B;  1BS3 A;  1Q81 W;  4DR5 B;  1FFX B;  1MZE A;  1FJG O;  2ZXW B;  2R9I A;  2EX3 A;  5EZY B;  3T1H O;  1SKV A;  3RVZ A;  4ICG A;  4BIO A;  5KLV H;  3M99 B;  4LF6 B;  4B3R B;  4K0K B;  3E8H A;  5BY1 A;  1Q6U A;  5C93 A;  1D2D A;  1WJZ A;  5HFM A;  1I5X A;  1FYJ A;  4OX9 O;  1RP3 B;  2YDE A;  4LF6 O;  3UKM A;  1ENV A;  2XAH A;  4MS2 A;  2XOK G;  2UXD O;  4PI2 A;  1Y76 B;  1XNR O;  4CH5 A;  4FLT A;  2CTP A;  2QKA A;  3OW2 U;  5EZY A;  5DEC A;  1NQT A;  3AK2 A;  4LF8 B;  5LGN A;  3GWK C;  1OCC C;  2JRI A;  5CA3 A;  4N21 A;  1YHQ V;  3OTF A;  2PZS A;  1P49 A;  3OFN G;  3CX5 F;  4KUM A;  1YJN V;  1QNM A;  1MAB G;  4JYC A;  4JAV A;  3CC2 V;  2PGG A;  4IHJ A;  1HNW B;  5CA0 A;  1V55 B;  3AK1 A;  2XAF A;  2E5L O;  5L3F A;  2ZDI A;  4WFH A;  4QIW F;  2EIL C;  2QDO A;  1NR1 A;  3CJH A;  1QLE C;  4KP4 A;  1KEC A;  4AQY O;  3HKC B;  4F6R A;  4MTX A;  4ZIB A;  2V7Q G;  5FPR A;  1XNQ O;  5LMN O;  2LFS A;  4LH7 A;  3JD0 A;  5H2F Z;  1EZV H;  3Q4H B;  2YUA A;  1R73 A;  2IM9 A;  4CH4 A;  3BY6 A;  3FX7 A;  4K8Z A;  1MZF A;  2FKX A;  4MTF A;  4B3S O;  1TUE B;  2IW5 A;  3SPI A;  1UJW B;  2E5L B;  1VP7 A;  3ZBH A;  2KQX A;  1SES A;  2VS0 A;  3L72 H;  3U10 A;  1NT2 B;  5L3E A;  2VWK A;  1WP7 A;  1ZX3 A;  2HR3 A;  3KKY A;  4YJ2 A;  4H0L B;  2BSK B;  1N33 O;  3CXC U;  5LYJ A;  3ETD A;  5J2U B;  2OTJ V;  3FD9 A;  4Q6G A;  3H1J H;  4BW9 A;  3C3S A;  2ZXW C;  1JOY A;  4ZOL B;  3JAT A;  1K5Q A;  2CK3 G;  5TIS Z;  3WG7 C;  1YTF D;  5EYP A;  4J10 A;  4J80 A;  4P9P A;  2RNB A;  4H33 A;  4DUY O;  4DRX A;  5FLX N;  4BW5 A;  1ZL8 A;  3OR6 C;  4DV0 O;  5JH7 B;  2QEX V;  4MVO A;  3RYH B;  5BXZ A;  2QWO B;  5B1A C;  4QJF B;  2EIJ C;  5IYB O;  2HFE C;  5EIB D;  5J9P C;  3OUF A;  1NBM G;  1Q86 W;  1Q5O A;  3HPL C;  5K1P A;  1NZ6 A;  1SRY A;  3SPG A;  1NVP D;  1EBO A;  1Y66 A;  3CYO A;  4PEL A;  1XHX A;  2HHH O;  5H6Q A;  4DR1 O;  4GX1 A;  2KG7 B;  3QO7 A;  4ASU G;  4W4L A;  1KD1 W;  2F1M A;  2FYU H;  1JJO A;  5JCO A;  3ZRW A;  3JAR A;  1H8E G;  3EVK A;  5JWP A;  3ETG A;  1G4Y B;  2WLH A;  4O4J A;  1B06 A;  4E2L A;  2ITD C;  2YIB D;  4U7N A;  3P30 A;  4JI8 B;  4B7E A;  3SDL A;  3FB8 C;  3AG7 A;  2XAQ A;  3S3X A;  3LDC A;  3CME V;  1PL0 A;  2EUL A;  3LUT B;  3H01 A;  1THZ A;  1X4T A;  2YEV A;  2Y0P A;  1AI4 A;  2ZR2 A;  4AI8 A;  1FAF A;  2H8P C;  2WLJ A;  1XRE A;  1KKD A;  5D5Q A;  2DYR C;  1OHH G;  4FZ1 A;  3HKE B;  4LF9 O;  2IH3 C;  1OCC B;  4JYB A;  4DV5 B;  1KQS U;  4U3J B;  1J5E B;  3PJS K;  4LH6 A;  2ZD9 A;  3OD4 A;  4AHC A;  1PNK A;  2EBO A;  2HJD A;  5LHG A;  2X6C A;  3DGE A;  3HB3 B;  5FL7 G;  1QLE B;  1YI2 V;  1GMG A;  3CRC A;  3CC4 V;  2AHY A;  1F51 A;  4CS4 A;  3JAL A;  2ZCE A;  1K4C C;  5IJ9 B;  4C7U A;  3W7U A;  4FFB A;  2ZKO A;  4G28 B;  2JS3 A;  3B09 A;  4GYC B;  1EFR G;  3OT7 A;  3K5N A;  1V54 B;  4MVQ A;  4UV9 A;  3FFQ A;  1XNQ B;  2EJ7 A;  5JJE B;  3L70 H;  1H2K A;  1V55 C;  3ABT A;  4P2Z A;  4X62 O;  3N2K A;  4IYH A;  3STZ C;  3ZHV A;  4J7J A;  4EFE A;  3JCZ A;  5LXT A;  5IJ0 B;  3QO5 A;  1XIL A;  1QR9 A;  5B1A B;  1RPR A;  3ZHT A;  4KL1 A;  3CCV V;  4LF5 B;  3QO8 A;  1XDC A;  4F6R B;  5IE9 A;  4DR2 O;  1IBL B;  1VF6 A;  3JAS A;  2ZIM A;  4PDM A;  1NVP B;  2N04 A;  2IU3 A;  4NR1 A;  2QGN A;  3A0H Z;  5BR8 O;  2EJR A;  2OCC C;  4MW3 A;  2M7W A;  4R6Z A;  1FOU A;  2RN9 A;  5LP6 C;  3OGC C;  4DR6 B;  4DV1 O;  2YS8 A;  2QWN B;  5EC2 C;  5GW7 A;  4PDR A;  2Q6A A;  4IT5 A;  3BVO A;  4I55 A;  1XOU A;  4YY3 B;  5C8Y B;  1DLB A;  4EFB A;  1P4R A;  3FB6 C;  1AP5 A;  2QJ1 A;  4ZHQ B;  3RYF B;  3BEH A;  1NI8 A;  3CE2 A;  4JTC B;  1GM8 A;  3A0B Z;  1PNL A;  4DUY B;  1JFF A;  4LNU B;  4X1K B;  1O9G A;  1BGY H; 
#chains in the Genus database with same CATH homology
 1WB8 A;  4JZG A;  5AG2 A;  3RN4 A;  3C3T A;  1EN5 A;  3AK3 A;  1JR9 A;  1XUQ A;  3CEI A;  4C7U A;  1MA1 A;  2QKC A;  1KKC A;  1BSM A;  1PM9 A;  3OT7 A;  1EM1 A;  4YIO A;  2CE4 A;  4JYY A;  1VEW A;  1PL4 A;  1IDS A;  2P4K A;  1EN4 A;  3MDS A;  1LUW A;  3LSU A;  1D5N A;  1BS3 A;  4BR6 A;  1JA8 A;  1AR5 A;  3EVK A;  4GUN A;  1MNG A;  4X9Q A;  1P7G A;  2CDY A;  5A9G A;  1VAR A;  1XIL A;  1ZSP A;  1B06 A;  1EN6 A;  1N0J A;  1AVM A;  3KDR A;  1ZLZ A;  1ZTE A;  2ADQ B;  1XDC A;  1IX9 A;  1AP6 A;  2RCV A;  3IC9 A;  3KKY A;  1WB7 A;  2AW9 A;  1BT8 A;  1SZX A;  3QVN A;  1I08 A;  3DC5 A;  1ZUQ A;  4FFK A;  1Y67 A;  4YIP A;  3BFR A;  4F6E A;  1GN2 A;  2ADP A;  1IXB A;  1XRE A;  2GDS A;  3C3S A;  2QKA A;  3DC6 A;  3K9S A;  1GN6 A;  1I0H A;  3AK2 A;  1GN3 A;  1AR4 A;  1AP5 A;  1QNM A;  1MSD A;  1N0N A;  4E4E A;  3AK1 A;  1LUV A;  1GN4 A;  3TJT A;  1MMM A;  4JZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...