2QKCA

Structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKLNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and kinetic study of differences between human and Escherichia coli manganese superoxide dismutases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 72
structure length 196
sequence length 196
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2qkcA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2qkcA02
3QVNA 1GN6A 1EM1A 1GN4A 1IX9A 4YIPA 1MSDA 1PL4A 1B06A 1MMMA 1P7GA 1GN3A 3DC5A 1XILA 1KKCA 1EN4A 1N0NA 4BR6A 1ZTEA 3CEIA 3KKYA 3RN4A 3IC9A 4JZ2A 3K9SA 1JR9A 1XUQA 4YIOA 4C7UA 1BT8A 1IXBA 4X9QA 3C3TA 1IDSA 4F6EA 1I08A 3AK1A 2QKAA 2P4KA 1AR5A 5AG2A 1ZUQA 1AP5A 1LUVA 3MDSA 1BSMA 3TJTA 1AR4A 1WB7A 3AK2A 1VEWA 4E4EA 2CDYA 1MNGA 2RCVA 1QNMA 3LSUA 1XDCA 4JYYA 3DC6A 5A9GA 1SZXA 1Y67A 1VARA 1N0JA 1I0HA 2CE4A 1EN6A 1AVMA 1JA8A 3OT7A 2QKCA 2ADPA 2GDSA 1PM9A 1D5NA 1ZSPA 1MA1A 2AW9A 4JZGA 1LUWA 1ZLZA 1BS3A 1AP6A 4FFKA 3EVKA 2ADQB 3C3SA 1GN2A 1XREA 3AK3A 4GUNA 3BFRA 1WB8A 1EN5A
chains in the Genus database with same CATH superfamily
1EM1A 1WP7A 2WLKA 4PA9A 3HKCA 1YTFD 2HR3A 1MMMA 1OCZC 1P7GA 4ZKIA 3N27A 5DECA 4B3RO 1F4NA 2YEVB 2DWDC 4JYAB 1N32O 1V55B 1F7YA 2O57A 1I94O 1ZAUA 4WFAV 1B04A 3AG2C 4JI1B 3L70H 1KUQA 5LYJA 5L3DA 4O4IA 1WA8B 3JAKA 3LDDA 4DUYB 1R3LC 1TVKA 3C3TA 2EIJB 4O2BA 1H5WA 2HP8A 2EINC 5H5NA 1Q8IA 3ABTA 2QEXV 4X66O 1R3JC 1P4RA 1NS1A 1VP7A 4DV4B 1V55C 1Q81W 4MVSA 3ZN0A 2EBOA 3ETQA 2YXYA 3W7UA 1FFXB 4PDLA 4MTOA 3MAQA 1QNMA 5F2VO 3GWOA 4W4LA 3W7WA 2ZIOA 3X2QB 3CCUV 4TV9A 3MHSC 2QGNA 3JD0A 1NH2D 3N2KB 1Y67A 2QE7G 1FXVA 2P90A 1N36B 2AHYA 1WLEA 5E79Z 1N32B 3ETEA 2Q5ZA 3VQXA 5CBFA 3HKCB 5CA3A 2CUGA 2P6JA 5CMUA 4TOIA 4JI6O 4ASUG 2FL4A 4HZ3A 1BS3A 1VQPV 3MD0A 4EB6B 1F51A 2CH7B 4JV5B 4CC6A 1XHXA 1YEWA 2A7WA 1FD9A 2QWRB 1NTKH 2P06A 3G6EV 4NXMB 3TGUH 1XL4A 2X7RB 4WBNB 2GTSA 3ASOC 4DK0A 3RWRD 1KBHA 4Q6GA 2QWOB 4ZOLB 1VF7A 3WB2A 1YCIA 2IH1C 4TUYB 5LMNO 4R6ZA 4JI6B 1R3IC 4JPRA 1SERA 5HFMA 1ZTEA 3W7TA 3ZMSA 3RN4A 2Y48A 4I55B 3UT5B 4PI2A 2FB5A 3CX5F 1M4UA 4UFZA 2ITDC 2BSKB 1VQ4V 3CCJV 2XT9A 3S3XA 1V54C 4O4LA 4FM2A 2PZSA 1VIBA 4JI2O 1UPGA 4O4JB 1AR4A 4DV1O 4KP4A 5ITZA 2LW1A 2NLJC 1GK9A 1W2BU 4IYIA 3UO2A 4LFCO 2R72A 1F4MA 2HHHB 3QO7A 5IY5C 4K8ZA 2F43G 3PJSK 4H13B 3DTUB 4DW0A 2QSAA 3D8CA 3IAYA 1FKAO 4YJ2A 4GLXA 2ADPA 4K0KB 3K08A 3JAMN 4UCRA 3JD2A 3M99B 3OE7G 3CCQV 4LF4B 4UXNA 3OTFA 4ZI7A 1I5XA 2EINB 3AG1C 2VQFO 3KCXA 4X1IA 4L8JA 5LHHA 4LFAO 4JYBA 3P30A 3A0BZ 2B9ZA 4J41A 4LH6A 1ORQC 1KP2A 4CS2A 3JASA 2PTMA 3AK3A 1XHZA 1KC8W 2F95B 2NNUA 1L0NH 4DRXA 4DR2O 1NTMH 4LF8B 1AI5A 1QQCA 3OR6C 3ASNB 2WLJA 2BSKA 2GHYA 2JGDB 3FD9A 5LL6Y 1YVWA 1OCZB 2QM7A 1N0NA 4GKJB 4AQYB 4BR6A 1X59A 3TCUA 3FB6C 4GKKO 2ZINA 3CEIA 3ML0A 5IJ0B 2X6CA 4B3SB 3N2KA 3E22A 5LGUA 2IH3C 3RYCB 3EFFK 4DV6O 3JCZA 4YHHO 5J2TA 4DR2B 4B3TO 4MS2A 4LC1A 4PELA 4K35A 2YSUB 4FVMA 1O9HA 2Y0IA 3A2FA 2IJJA 4LNUA 2LJ2A 4TWKA 4TSFG 2YIDA 5KHKA 1BHAA 4I0XA 4QPJA 4LBEC 2HLDG 5FPRA 3CC7V 1I7FA 3G4SV 4IT5A 3GWKC 4QNHB 2Q0OC 1PNLA 1XDCA 3BY6A 3H01A 3ZJZA 2QWQB 1NU1H 1OCOB 1NVPB 2W6IG 1AI4A 4MVMA 5LXTA 1I5YA 2V4DA 1P84F 4XDJA 4DO2A 2JS5A 2X6AA 1AJNA 1PM9A 3T1HO 1N33O 5JWPA 4JI3O 3AG1B 1FXKB 2UUCO 2RNBA 4IIJB 1GMGA 4DYLA 1H2GA 1F23A 3CHXA 1NQTA 5L3GA 2WLMA 4RQEA 3H1IH 4IL6Z 4Q20A 2CGOA 1SQVH 3E86A 4O2BB 3JD3A 2JVDA 3SPHA 2X0LA 2EZOA 4UVCA 3ZMTA 1ZL8A 3OMIB 1GRJA 4EKWA 4OX9B 4IGGA 3DGEA 5EIBC 4JZ2A 2PYLA 1FFXA 5CA0A 4DV7B 2UU9B 1UJWB 5IYZA 4X9QA 3O65A 1QVFU 1B3QA 1XOUA 1BZKA 5EBMC 3SPGA 4DR3O 4QE9A 2YC0A 3TK1A 3VOUA 4LF5O 5CA1A 4J9YB 2IM9A 2GUZB 4FZ1A 4B3RB 3WU2Z 2OYQA 1NZ6A 4G27B 3SYOA 2R70A 4QPKA 4GX5A 1Y4MA 4HNAA 5LGTA 3DC6A 5H9CA 3ZHUA 3IGAC 1WNSA 2PI4A 1MABG 1JPXA 1K8AW 1VQ9V 3CCMV 2ZNIA 4CH3A 4JI8B 2QKCA 3K58A 1YHQV 1LR1A 4O4LB 4CH6A 1DF4A 2QM8A 4D6TH 4B3MB 2WLIB 1ZLZA 2AZ0A 2CTRA 1SKVA 2ZM6O 2P5OA 2DQ3A 4QJFB 4BIOA 2ZR2A 5JQGB 4JTDB 2MK3A 1MSWD 2IJHA 4MTGA 1Z5VA 4LF9B 4JAAA 1N33B 5DM6V 1IX9A 3OD4A 1P49A 3OTOO 3RYHB 1H2KA 4LF6O 1DF5A 3I55V 2BOBC 1RSOB 4X1YB 1L8DA 3P32A 1FAFA 4MT8A 1YJWV 4X65B 1WP8A 4O2AB 1R1BA 4LF7O 1HP8A 5FNVA 4QIWF 4X20B 3K9SA 1YJNV 3T4DA 1GTOA 4WFFA 2EIJC 2F23A 4AI8A 2LQTA 2XUMA 3K0DA 4UUJC 1AR5A 1Q7YW 3JASB 1AP5A 3CPWU 4JTCB 3CP1A 1SQGA 5B1AB 1HNZB 2YIBD 2M6YA 2MW2B 3JSLA 4HAMA 3D3IA 4MTXA 2LFSA 4G28B 3E83A 4H44B 2YIAA 2QWPB 3ABKB 5C8YB 1QU7A 4UCOA 5LP6A 3LSQA 4KFMA 4DR7B 1N0JA 1QCEA 2P4VA 2WWWA 1FJGB 1I0HA 2LGQA 2CAZC 2HEPA 4FLXA 1CEZA 1GM8A 1XEQA 2OCCC 2GDSA 2HVJC 2UXCO 1A32A 4TQDA 4FM0A 2UUAO 4ICGA 3SR2C 1U97A 3SPJA 2H3OA 1H8EG 3WG7C 5GTIZ 3CSXA 2UXNA 4DUZB 2X6BA 3ABMC 4NXNB 3HKEB 3U11A 5IYCO 1W0JG 1GO3F 3K5MA 4FFBA 3ETDA 1HR0B 1E79G 3SJBC 4OX9O 1VQ5V 4GKKB 1GN4A 5CB4B 4YIPA 1N8RW 1B06A 1P7BA 1VF6C 1SF9A 2UUCB 3OFNG 1EN4A 4NKGB 3UM7A 2IJIA 4DK1A 2XTAA 4K0KO 2JK5C 2V1DA 4UV8A 1VMGA 1Z5WA 4LF4O 4NR1A 3OTOB 3JALA 2QWNB 3BA9A 3OUFA 1QLEC 4JI3B 5L3EA 5H6RA 2CTWA 5DN6G 1QHTA 4PA6A 3IFXA 3JD1A 3CWBH 5KUKA 3OM3B 4JI8O 2F66C 1K5QA 2ZNJA 4CH4A 2Q73A 1JX9A 3G67A 4DV4O 4I0XB 4Z1MG 3QF7A 1SS3A 1BL8A 1BSMA 5BZBA 4FPPA 1MZFA 5LMUB 5HFLA 5GONA 4E4EA 1J95A 2R9RB 2ILMA 3IJ4A 2BTOA 5CN0A 1NVPD 3WG7B 5A9GA 3RVYA 2Q4PA 1JQ0A 4BW9A 3CCLV 1K5SA 5B1OA 4DR5O 1OCRC 1SETA 4U7NA 5LHIA 1BMFG 5BY1A 1PNMA 3TETA 1JMKC 2B5UA 5LOVA 4LFBB 4UCUA 1PD3A 3EHBB 4PA7A 4X8AA 5H2FZ 4JI5O 3KCYA 4R8CA 2GV9A 2QTSA 1M93A 3OGIB 3QVNA 4UV9A 4WCEV 1BQZA 1R6NA 2VRZA 5LMNB 2CK3G 2CGNA 1J5EB 2YDEA 5IT9N 3G71V 5JJJB 2BE3A 1DK1A 4N23A 4NYKA 3FB7C 3JARA 1SQXH 3SPCA 5JJEB 1M56C 2DJVA 3ZMUA 2Z5UA 1SA0B 2XAQA 1OCCC 1G4YB 3MHHC 4LF7B 4JI7O 3RFRA 4R50A 4DR5B 1OV9A 2K9PA 3ETGA 2VWJA 1BCCH 4ABMA 4F6EA 2ITCC 4OPHA 2EILC 4DV7O 5LP6C 5BR8B 5AG2A 1LUVA 2PYJA 1Y6XA 3RW0A 2AHZA 3T4ZA 3OMAB 2BTQB 3F5TA 4J80A 4X66B 4RAIA 2V7QG 5LOVB 3AG2B 1WA8A 2Y4TA 4WFGA 5EZYB 2ZQMA 1GKFA 2E74B 1XI1A 4X1KA 5BR8O 2LFRA 4DV0B 4DUZO 2F93B 5LA6A 1Z2GA 1RFYA 3HR0A 1SESA 4BIZA 3DXRA 1MA1A 4RUFA 3WFVA 2ARHA 4JZGA 2OT5A 3RYFB 4AHCA 3GB7C 4FFKA 4U3JA 3EVKA 4UB8Z 3UCSC 2DYRC 1YZBA 4FLUA 4EEQA 1KB9F 4GUNA 4X88A 2YXHA 3CRAA 3HKEA 3JAKB 1JJ2U 1K4CC 1TVKB 3CS5A 4F6RB 1GN3A 1VQLV 3ABMB 4WFEA 1R6KA 4X20A 1RM1C 2CTQA 2ZD9A 2UXBB 1IZ3A 1KP3A 3PN1A 2EIKB 1NI8A 1H2MA 1FXKA 4CZZA 2ATKC 4YHHB 1XUQA 5KAIZ 4N21A 2OIEA 4DV2B 4X89A 2ZR3A 1SA0A 2JDIG 1NR7A 3I56V 4I4TB 2Z3YA 4R7CA 2BCCH 1G6UA 2EULA 2HHHO 1WPXA 3LNNA 2JGUA 1WPBA 5J2UB 1BQ0A 1HWYA 4ZBMA 3QO8A 1N34B 1K4DC 1MNGA 2ZE7A 1NBMG 2QR4A 3E8HA 1Y74A 2C2AA 3FAVB 2JEXA 1S5HC 2ZIMA 1OHHG 5B3SC 1ENVA 5IWAB 4YJ3A 5IY5B 2EJ7A 5KHGA 1YF2A 2Y69C 3RVZA 1K33A 4P9OA 2P67A 4I55A 2YEVA 3SJAC 3JATB 5EZYA 3K04A 1K7DA 3JCUZ 3B09A 2XAHA 1E1QG 5EYPA 2DYSB 4CBCA 1K9MW 3CD6V 2HJFC 4PV1B 4ZOLA 1OCOC 4DR6B 3APQA 5JVDB 1RP3B 5KAFZ 2RQ6A 2K1EA 1FXKC 4CC5A 1WB8A 1TUBB 1UFIA 2H8PC 3A8TA 1CPYA 2Y0PA 1H2LA 1PL4A 3TXQA 4W4KA 4DRXB 2WA4A 5E1AC 4RO2A 4JI0B 5EIBD 3SYAA 4JI7B 2F1MA 3CMAV 1W0KG 4MTFA 1N4CA 3TXSA 4I9WA 3L73H 5LHGA 2Q68A 4X1IB 3B2EE 5KX5A 4LFBO 4C7UA 1OCCB 3QTCA 4UCTA 4PA3A 1AR1B 4E2LA 2XAFA 1M56B 2RJZA 1XNQB 3KZIZ 3K5NA 3FX7A 4JV5O 3CXCU 4P2ZA 4YJ3B 3U0ZA 4MSWC 3OGCC 4JAVA 2KKWA 1VQOV 1PKXA 2UXCB 3TJTA 3BRCA 2KG7A 3AK2A 1ROPA 4MW3A 3E89A 4PHZA 2E76B 2VS0A 3RT3C 3C90A 1S0VA 3ZHRA 1O9GA 2ZE5A 3B8MA 2ODMA 2HG5C 3SYQA 4GCZA 3ZN1A 5D5PA 1JCHA 2CE4A 3K0GA 2IU0A 5CBGA 4X64B 3ASNC 4JI0O 1KQSU 1HW7A 5LA6B 3AEIA 4BWAA 1YI2V 1SRYA 3ZS8C 1GM9A 2DYSC 1VF6A 2N04A 1RM1B 2LO1A 1GN2A 2PI5A 3RYIA 1S5LZ 4BW5A 3AG3B 1Y76A 4I4TA 2OTJV 5BMVA 5EBWC 1MSDA 1MZEA 1K3EA 1AJQA 1T5EA 2E5LB 2ZT9B 3DC5A 5J2UA 1KKCA 2GTAA 3D3QA 3M7MX 2OTLV 4JTAB 3L72H 2GBOA 1GH6A 4DV1B 2Q7EA 1ZL8B 5K1PA 2QTOA 3AG3C 5IWAO 2Y4UA 4LH7A 4LF6B 1QLEB 5IDJA 1WAZA 1BGYH 4IHJA 4LFCB 5CA0B 2L6LA 1QBZA 4HNAB 1SQQH 4DV3B 3ZMVA 1Y66A 1KECA 3R65A 1QLNA 4IIJA 1ZUQA 3CJHB 1K97A 5CA1B 3S3WA 4YXWG 3BEHA 3K57A 3M8AA 4JI4O 1VEWA 3ZMZA 2RCVA 2IW5A 4X1KB 3CCEV 3K3WA 4B3SO 3R66A 1Q6HA 3A0RA 2KG7B 3WB0A 2BOCC 4JYYA 2YXLA 4BAYA 2EILB 2QA4V 4GYCB 3SYCA 5TISZ 4MVZA 1SZXA 3CB2A 1X4TA 3ZBHA 3KG2A 4ZIBA 3P3PA 1KYOF 2DYRB 1JA8A 5EC1C 1HDJA 4MVQA 4GZRB 3ABLB 4H0LB 1D5NA 3ZHSA 1S72V 3ABKC 4B7EA 3F7YC 1IURA 3H9VA 5KLVH 2AGAA 3HB3B 1XREA 1SQFA 3BCCH 1TUEB 1CXZB 2GUZA 4PA4A 1R6TA 5EC2C 4JASA 1GN6A 2IU3A 3K79A 1NH2B 4LCUC 4OPAA 2ETNA 4K8XA 3DSQA 4DV0O 1Q5OA 3LUTB 4MW8A 1PL0A 1THZA 5LMUO 2Q8VA 3LDEA 4MVUA 4XDLA 5KHJA 1M9NA 4PJ0Z 2YI9A 2Q67A 3ZRWA 1JR9A 1L1FA 1YTFB 4PI0A 5IJ9B 2OWOA 3JD4A 3VQYA 5KX5B 1EZVH 2WA3A 5LP6B 1V9PA 2Q0AA 4WBNA 2ZDIA 3K5OA 4YY3O 4HBNA 4JGSA 3STLC 2P4KA 1AROP 4NB5A 4A5UB 5JQGA 4TUYA 1S76D 1US6A 1H2NA 3J81N 3AG4B 5L3BA 1IBMB 1Y74B 3D36C 2B1GA 2UXXA 4NTYA 4DW1A 1BE3H 5EBLC 4JYAO 1PV0A 2G38A 4X64O 5JCOC 2XAJA 2AXTZ 1SQPH 4DR7O 4PD4F 1R73A 5JVDA 1AI7A 5D5QA 2VQEO 1G1XB 2PUSA 1U96A 4TV8A 2YS8A 1M90W 4TT3G 1Q3EA 3OW2U 2NN4A 2A3QA 5J2TB 3ZRSA 4NXNO 2XNDG 3H1JH 3ZEDA 1JOYA 3W7XA 1ZSPA 2DOSA 4DR3B 4QGPA 4D7TA 4FJCC 2UUBB 4X1YA 3ABLC 3AG4C 4H33A 4J7ZA 2UXBO 1TUBA 4IYHA 5B1BB 4FLTA 1HR0O 3ZHQA 4O2AA 1S3JA 2UXDB 2W0FC 4X62O 3RYIB 4DV5B 2HKOA 2UUAB 3ZRWB 5IJ9A 2EIMB 1IXMA 2JEUA 4B3TB 3OEEG 5CB4A 2JRIA 4GKJO 5KMGA 3AG7A 4WFBV 4OGQB 1XILA 1Q6UA 4CS3A 1XNRB 1XMQO 5IE9A 4DV3O 1Q86W 1QVGU 1XNQO 5DEDA 1XQ8A 2EIMC 3K06A 1VQKV 2D2CB 1NT2B 4U3FH 4DR6O 2XASA 3GVMA 3RYFA 1VQMV 2EX3A 2BTQA 3E8BA 1VQ8V 3ZRXA 3L71H 2H94A 3HKBA 5KA6A 3ICXA 5JCOA 1IJGA 2W6JG 3BVOA 4JI1O 4PDVA 3QO5A 3ZX6A 4WFHA 2JGDA 4EFBA 4DUYO 2Q69A 4GX1A 5BMVB 5KHIA 5B66Z 2VQFB 4ZI7B 1VF5B 2A0LA 5EK0A 1N36O 5IJ0A 1SC5B 3LSSA 3LSUA 3SGIA 2AZ2A 4FLZA 3ABUA 4U3JB 1ZWIC 1G8MA 1VARA 1IVSA 1VQ6V 4LF9O 1PPJH 1PP9H 3CCRV 2Q7GA 2B1IA 4JYCA 4TV8B 3P3NA 4KHPB 2KSDA 5JH7B 1PNKA 4I50B 1CP9A 3Q4HA 1K92A 2DQ0A 3K5LA 1KMIZ 3OUSA 2JS3A 2ADQB 2EIKC 3CC4V 1B6QA 1W59A 1HNWO 1OZ0A 3FB8C 2IJKA 5B1BC 3U10A 1AILA 2FMLA 2DWEC 3FAVA 3ZRVA 5J9PC 5FL7G 2ZXWB 1URFA 1M1KW 4BIUA 2LW7A 1Q6IA 2DN9A 4ZHQB 3APOA 3KDRA 3B77A 4XDKA 5B1AC 1D5AA 1EZJA 3FB5C 5B5EZ 3CRQA 1XMOO 3KKYA 5KUMA 3STZC 3J80N 5LGNA 4P30A 4LP8A 2YICA 1S5JA 4KUMA 3J7AU 2A06H 1IXBA 2R9IA 4DR1O 2HVKC 1MG1A 4D7SA 2QDOA 5H6QA 2EJRA 4NXMO 1KD1W 4LNUB 1YDXA 3ZHTA 1RSOA 4I5SA 3HKDB 2UU9O 1D2DA 4UB6Z 4FLYA 2YUAA 1YITV 4GT1A 3UT5A 2XHBA 3K59A 5EYPB 2CH7A 1RPRA 1GM7A 1JVMA 3T2MA 3CCSV 5JH7A 1R3KC 5A2QN 2IBZH 5LBQA 4J7JA 3OAAG 3E22B 4K3AA 3CXHF 1IBMO 3RYCA 2ZE6A 2CTPA 5KMGB 3FYEB 3EXAA 4H37A 1DLBA 1KKDA 4UVBA 4O4HB 5C93A 3SYPA 4JI2B 3NXSA 2ZE8A 3BPZA 4MVOA 2AW9A 4JF3A 1Q43A 3BABA 1ZX3A 3JARB 3T1YB 1SQBH 3T1CA 2JJ1G 2Q7HA 4UCSA 2Y69B 1DGSA 4CH5A 3BFRA 2WAMA 3B40A 3CE2A 3H1KH 1EFRG 4FMTA 2QJ1A 4YJ2B 4UCVA 1XNRO 3CCVV 4B3MO 1FJGO 3UQ8A 2NR5A 4NTXA 4DV5O 1M57B 4RUEA 5B3SB 1FFTB 1JNBA 2RDCA 2WLIA 1N34O 3DXRB 5IYBO 1IBLB 5KA5A 4DR1B 4LF5B 3JAWB 4YIOA 2UUBO 1BT8A 3RGBA 3BA8A 2A9HA 1BHBA 4DXWA 1M5IA 2YIBA 3ZCCA 3SJCC 1OCRB 2E75B 2JIZG 1FOUA 1I08A 1L0LH 3AK1A 1WN7A 2PF4E 3N2GB 2WLLB 1JJOA 1M57C 2Z0AA 1VQNV 1IBLO 2WLNA 4B08A 3K9AA 4GX2A 4Z2WA 4MVRA 3T1YO 4WF9V 2JJ2G 3JALB 2HFEC 4IHJB 5K1XA 4FLVA 2WSSG 1IBKO 1GAXA 4YY3B 3CYOA 2N05A 1YSCA 4J9ZB 1E1RG 3RBZA 1Y76B 2EZPA 4DR4O 4X65O 3OR7C 4O4IB 4CS4A 4F6RA 3B8NA 3OMNB 2ZKOA 3CRRA 2FKXA 3QNEA 1LUWA 3OEHG 5B1NA 1SZTA 1XL6A 3BAAA 1YXBA 1FS0G 1KU9A 3L74H 3G6BA 3W7SA 3BHPA 1Q82W 1EN5A 3A0HZ 1IBKB 4KL1A 2W0XA 1COWG 1I94B 4HYOA 2DE0X 3RYHA 4EFEA 1OJHA 4FM1A 1FYJA 5GW7A 4KXRA 2RMKB 3T1HB 4F4LA 4DV2O 5C8YA 1K73W 3HKBB 5GTHZ 2Q9LA 1JFFA 4RWUA 4U7OA 1LNQA 1AI6A 3F5WC 3H1HH 3Q4HB 3E2EA 2P7TC 3E35A 3JATA 1S77D 5FLXN 2WPDG 1YJ9V 5LXTB 2UXDO 1IDSA 2OCCB 4UVAA 3UKMA 4EB6A 1NJIW 4J11A 2XAGA 2KB1A 4LR3A 1XMQB 4FFBB 3L9DA 1WB7A 4QE7A 3X2QC 4JI5B 4OXSA 1WJZA 2CDYA 3N2GA 5L3FA 3ZIAG 4I50A 5FNVB 5IYZB 1H38A 1AJPA 2ZDIC 2WLHA 1VQ7V 4PDRA 1FXHA 1V54B 4Z1VA 3SJQC 4NTWA 5LYJB 3E8GA 2E3CA 3ZHVA 1TGOA 1EN6A 1AVMA 3CC2V 1HNWB 4B7KA 3QG5A 4AQYO 1K34A 4RQFA 2ZXWC 2QM4A 4NVPA 2M7WA 4P9PA 1HNXB 1TAEA 3CRMA 3VBBA 3THOA 4KHPO 1AP6A 2OCHA 4FLWA 3L75H 5L3CA 3ASOB 2VQEB 4ZHQA 1DTOA 2E5LO 5KHHA 3HKDA 1TA8A 2PY5A 3IC7A 2F4VO 3FYIB 3LNMB 4FZ0A 2YI8A 2HJDA 2L35A 3CJHA 2LGWA 1EBOA 1MOFA 4LWSA 3E8FA 2ZM6B 4GX0A 3HPLC 2RN9A 3D36A 4TQFA 3IC9A 4O4HA 3O9OA 1NTZH 1YIJV 3FFQA 2XOKG 4FK5C 3CMEV 3JAWA 2VWKA 2Q6AA 3SDLA 3JYCA 2OIGA 2F4VB 1Q90D 1QR8A 2QKAA 3G80A 2P22C 4O4JA 1HNXO 3MDSA 3FKSG 4J7KA 5FPOA 2KQXA 5ITZB 2GSMB 4XBFA 1H8HG 2DMXA 1XMOB 4X62B 3I5DA 1NKDA 5IYDO 4DR4B 3LDCA 3WB1A 2FTKA 1AB3A 3CRCA 5CBHA 4JI4B 3VQWA 3SPIA 1NR1A 2QKSA 3H1LH 1QR9A 2DW4A 1FPOA 1H2SB 2FYUH 3JSNA 4I7ZB 3UO3A 2A79B 3OT7A 4PDMA 4L87A 3VQVA 4I9QA 2N74A 2D3OW 1JFFB 3B4SA 1XBLA 4J42A 2PGGA 5JJNB 4JAUA 2WLLA 3K03A 4TV9B 2R9AA 3F7VC 4G2KA 5GONB 4FIPC 1HNZO 3C3SA 4DV6B 4LWSB 2ZCEA 4J10A 4AILC 2LP7A 5BXZA 1RPOA 4LFAB 4LF8O 3NR7A 1J5EO
chains in the Genus database with same CATH topology
3QVNA 1GN6A 1EM1A 1GN4A 1IX9A 4YIPA 1MSDA 1PL4A 1B06A 1MMMA 1P7GA 1GN3A 3DC5A 1XILA 1KKCA 1EN4A 3KDRA 1N0NA 4BR6A 1ZTEA 3CEIA 3KKYA 3RN4A 3IC9A 4JZ2A 3K9SA 1JR9A 1XUQA 4YIOA 4C7UA 1BT8A 1IXBA 4X9QA 3C3TA 1IDSA 4F6EA 1I08A 3AK1A 2QKAA 2P4KA 1AR5A 5AG2A 1ZUQA 1AP5A 1LUVA 3MDSA 1BSMA 3TJTA 1AR4A 1WB7A 3AK2A 1VEWA 4E4EA 2CDYA 1MNGA 2RCVA 1QNMA 3LSUA 1XDCA 4JYYA 3DC6A 5A9GA 1SZXA 1Y67A 1VARA 1N0JA 1I0HA 2CE4A 1EN6A 1AVMA 1JA8A 3OT7A 2QKCA 2ADPA 2GDSA 1PM9A 1D5NA 1ZSPA 1MA1A 2AW9A 4JZGA 1LUWA 1ZLZA 1BS3A 1AP6A 4FFKA 3EVKA 2ADQB 3C3SA 1GN2A 1XREA 3AK3A 4GUNA 3BFRA 1WB8A 1EN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QVN A;  1GN6 A;  1EM1 A;  1GN4 A;  1IX9 A;  4YIP A;  1MSD A;  1PL4 A;  1B06 A;  1MMM A;  1P7G A;  1GN3 A;  3DC5 A;  1XIL A;  1KKC A;  1EN4 A;  1N0N A;  4BR6 A;  1ZTE A;  3CEI A;  3KKY A;  3RN4 A;  3IC9 A;  4JZ2 A;  3K9S A;  1JR9 A;  1XUQ A;  4YIO A;  4C7U A;  1BT8 A;  1IXB A;  4X9Q A;  3C3T A;  1IDS A;  4F6E A;  1I08 A;  3AK1 A;  2QKA A;  2P4K A;  1AR5 A;  5AG2 A;  1ZUQ A;  1AP5 A;  1LUV A;  3MDS A;  1BSM A;  3TJT A;  1AR4 A;  1WB7 A;  3AK2 A;  1VEW A;  4E4E A;  2CDY A;  1MNG A;  2RCV A;  1QNM A;  3LSU A;  1XDC A;  4JYY A;  3DC6 A;  5A9G A;  1SZX A;  1Y67 A;  1VAR A;  1N0J A;  1I0H A;  2CE4 A;  1EN6 A;  1AVM A;  1JA8 A;  3OT7 A;  2QKC A;  2ADP A;  2GDS A;  1PM9 A;  1D5N A;  1ZSP A;  1MA1 A;  2AW9 A;  4JZG A;  1LUW A;  1ZLZ A;  1BS3 A;  1AP6 A;  4FFK A;  3EVK A;  2ADQ B;  3C3S A;  1GN2 A;  1XRE A;  3AK3 A;  4GUN A;  3BFR A;  1WB8 A;  1EN5 A; 
#chains in the Genus database with same CATH topology
 1EM1 A;  1WP7 A;  2WLK A;  4PA9 A;  3HKC A;  1YTF D;  2HR3 A;  1MMM A;  1OCZ C;  1P7G A;  4ZKI A;  3N27 A;  5DEC A;  4B3R O;  1F4N A;  2YEV B;  2DWD C;  4JYA B;  1N32 O;  1V55 B;  1F7Y A;  2O57 A;  1I94 O;  1ZAU A;  4WFA V;  1B04 A;  3AG2 C;  4JI1 B;  3L70 H;  1KUQ A;  5LYJ A;  5L3D A;  4O4I A;  1WA8 B;  3JAK A;  3LDD A;  4DUY B;  1R3L C;  1TVK A;  3C3T A;  2EIJ B;  4O2B A;  1H5W A;  2HP8 A;  2EIN C;  5H5N A;  1Q8I A;  3ABT A;  2QEX V;  4X66 O;  1R3J C;  1P4R A;  1NS1 A;  1VP7 A;  4DV4 B;  1V55 C;  1Q81 W;  4MVS A;  3ZN0 A;  2EBO A;  3ETQ A;  2YXY A;  3W7U A;  1FFX B;  4PDL A;  4MTO A;  3MAQ A;  1QNM A;  5F2V O;  3GWO A;  4W4L A;  3W7W A;  2ZIO A;  3X2Q B;  3CCU V;  4TV9 A;  3MHS C;  2QGN A;  3JD0 A;  1NH2 D;  3N2K B;  1Y67 A;  2QE7 G;  1FXV A;  2P90 A;  1N36 B;  2AHY A;  1WLE A;  5E79 Z;  1N32 B;  3ETE A;  2Q5Z A;  3VQX A;  5CBF A;  3HKC B;  5CA3 A;  2CUG A;  2P6J A;  5CMU A;  4TOI A;  4JI6 O;  4ASU G;  2FL4 A;  4HZ3 A;  1BS3 A;  1VQP V;  3MD0 A;  4EB6 B;  1F51 A;  2CH7 B;  4JV5 B;  4CC6 A;  1XHX A;  1YEW A;  2A7W A;  1FD9 A;  2QWR B;  1NTK H;  2P06 A;  3G6E V;  4NXM B;  3TGU H;  1XL4 A;  2X7R B;  4WBN B;  2GTS A;  3ASO C;  4DK0 A;  3RWR D;  1KBH A;  4Q6G A;  2QWO B;  4ZOL B;  1VF7 A;  3WB2 A;  1YCI A;  2IH1 C;  4TUY B;  5LMN O;  4R6Z A;  4JI6 B;  1R3I C;  4JPR A;  1SER A;  5HFM A;  1ZTE A;  3W7T A;  3ZMS A;  3RN4 A;  2Y48 A;  4I55 B;  3UT5 B;  4PI2 A;  2FB5 A;  3CX5 F;  1M4U A;  4UFZ A;  2ITD C;  2BSK B;  1VQ4 V;  3CCJ V;  2XT9 A;  3S3X A;  1V54 C;  4O4L A;  4FM2 A;  2PZS A;  1VIB A;  4JI2 O;  1UPG A;  4O4J B;  1AR4 A;  4DV1 O;  4KP4 A;  5ITZ A;  2LW1 A;  2NLJ C;  1GK9 A;  1W2B U;  4IYI A;  3UO2 A;  4LFC O;  2R72 A;  1F4M A;  2HHH B;  3QO7 A;  5IY5 C;  4K8Z A;  2F43 G;  3PJS K;  4H13 B;  3DTU B;  4DW0 A;  2QSA A;  3D8C A;  3IAY A;  1FKA O;  4YJ2 A;  4GLX A;  2ADP A;  4K0K B;  3K08 A;  3JAM N;  4UCR A;  3JD2 A;  3M99 B;  3OE7 G;  3CCQ V;  4LF4 B;  4UXN A;  3OTF A;  4ZI7 A;  1I5X A;  2EIN B;  3AG1 C;  2VQF O;  3KCX A;  4X1I A;  4L8J A;  5LHH A;  4LFA O;  4JYB A;  3P30 A;  3A0B Z;  2B9Z A;  4J41 A;  4LH6 A;  1ORQ C;  1KP2 A;  4CS2 A;  3JAS A;  2PTM A;  3AK3 A;  1XHZ A;  1KC8 W;  2F95 B;  2NNU A;  1L0N H;  4DRX A;  4DR2 O;  1NTM H;  4LF8 B;  1AI5 A;  1QQC A;  3OR6 C;  3ASN B;  2WLJ A;  2BSK A;  2GHY A;  2JGD B;  3FD9 A;  5LL6 Y;  1YVW A;  1OCZ B;  2QM7 A;  1N0N A;  4GKJ B;  4AQY B;  4BR6 A;  1X59 A;  3TCU A;  3FB6 C;  4GKK O;  2ZIN A;  3CEI A;  3ML0 A;  5IJ0 B;  2X6C A;  4B3S B;  3N2K A;  3E22 A;  5LGU A;  2IH3 C;  3RYC B;  3EFF K;  4DV6 O;  3JCZ A;  4YHH O;  5J2T A;  4DR2 B;  4B3T O;  4MS2 A;  4LC1 A;  4PEL A;  4K35 A;  2YSU B;  4FVM A;  1O9H A;  2Y0I A;  3A2F A;  2IJJ A;  4LNU A;  2LJ2 A;  4TWK A;  4TSF G;  2YID A;  5KHK A;  1BHA A;  4I0X A;  4QPJ A;  4LBE C;  2HLD G;  5FPR A;  3CC7 V;  1I7F A;  3G4S V;  4IT5 A;  3GWK C;  4QNH B;  2Q0O C;  1PNL A;  1XDC A;  3BY6 A;  3H01 A;  3ZJZ A;  2QWQ B;  1NU1 H;  1OCO B;  1NVP B;  2W6I G;  1AI4 A;  4MVM A;  5LXT A;  1I5Y A;  2V4D A;  1P84 F;  4XDJ A;  4DO2 A;  2JS5 A;  2X6A A;  1AJN A;  1PM9 A;  3T1H O;  1N33 O;  5JWP A;  4JI3 O;  3AG1 B;  1FXK B;  2UUC O;  2RNB A;  4IIJ B;  1GMG A;  4DYL A;  1H2G A;  1F23 A;  3CHX A;  1NQT A;  5L3G A;  2WLM A;  4RQE A;  3H1I H;  4IL6 Z;  4Q20 A;  2CGO A;  1SQV H;  3E86 A;  4O2B B;  3JD3 A;  2JVD A;  3SPH A;  2X0L A;  2EZO A;  4UVC A;  3ZMT A;  1ZL8 A;  3OMI B;  1GRJ A;  4EKW A;  4OX9 B;  4IGG A;  3DGE A;  5EIB C;  4JZ2 A;  2PYL A;  1FFX A;  5CA0 A;  4DV7 B;  2UU9 B;  1UJW B;  5IYZ A;  4X9Q A;  3O65 A;  1QVF U;  1B3Q A;  1XOU A;  1BZK A;  5EBM C;  3SPG A;  4DR3 O;  4QE9 A;  2YC0 A;  3TK1 A;  3VOU A;  4LF5 O;  5CA1 A;  4J9Y B;  2IM9 A;  2GUZ B;  4FZ1 A;  4B3R B;  3WU2 Z;  2OYQ A;  1NZ6 A;  4G27 B;  3SYO A;  2R70 A;  4QPK A;  4GX5 A;  1Y4M A;  4HNA A;  5LGT A;  3DC6 A;  5H9C A;  3ZHU A;  3IGA C;  1WNS A;  2PI4 A;  1MAB G;  1JPX A;  1K8A W;  1VQ9 V;  3CCM V;  2ZNI A;  4CH3 A;  4JI8 B;  2QKC A;  3K58 A;  1YHQ V;  1LR1 A;  4O4L B;  4CH6 A;  1DF4 A;  2QM8 A;  4D6T H;  4B3M B;  2WLI B;  1ZLZ A;  2AZ0 A;  2CTR A;  1SKV A;  2ZM6 O;  2P5O A;  2DQ3 A;  4QJF B;  4BIO A;  2ZR2 A;  5JQG B;  4JTD B;  2MK3 A;  1MSW D;  2IJH A;  4MTG A;  1Z5V A;  4LF9 B;  4JAA A;  1N33 B;  5DM6 V;  1IX9 A;  3OD4 A;  1P49 A;  3OTO O;  3RYH B;  1H2K A;  4LF6 O;  1DF5 A;  3I55 V;  2BOB C;  1RSO B;  4X1Y B;  1L8D A;  3P32 A;  1FAF A;  4MT8 A;  1YJW V;  4X65 B;  1WP8 A;  4O2A B;  1R1B A;  4LF7 O;  1HP8 A;  5FNV A;  4QIW F;  4X20 B;  3K9S A;  1YJN V;  3T4D A;  1GTO A;  4WFF A;  2EIJ C;  2F23 A;  4AI8 A;  2LQT A;  2XUM A;  3K0D A;  4UUJ C;  1AR5 A;  1Q7Y W;  3JAS B;  1AP5 A;  3CPW U;  4JTC B;  3CP1 A;  1SQG A;  5B1A B;  1HNZ B;  2YIB D;  2M6Y A;  2MW2 B;  3JSL A;  4HAM A;  3D3I A;  4MTX A;  2LFS A;  4G28 B;  3E83 A;  4H44 B;  2YIA A;  2QWP B;  3ABK B;  5C8Y B;  1QU7 A;  4UCO A;  5LP6 A;  3LSQ A;  4KFM A;  4DR7 B;  1N0J A;  1QCE A;  2P4V A;  2WWW A;  1FJG B;  1I0H A;  2LGQ A;  2CAZ C;  2HEP A;  4FLX A;  1CEZ A;  1GM8 A;  1XEQ A;  2OCC C;  2GDS A;  2HVJ C;  2UXC O;  1A32 A;  4TQD A;  4FM0 A;  2UUA O;  4ICG A;  3SR2 C;  1U97 A;  3SPJ A;  2H3O A;  1H8E G;  3WG7 C;  5GTI Z;  3CSX A;  2UXN A;  4DUZ B;  2X6B A;  3ABM C;  4NXN B;  3HKE B;  3U11 A;  5IYC O;  1W0J G;  1GO3 F;  3K5M A;  4FFB A;  3ETD A;  1HR0 B;  1E79 G;  3SJB C;  4OX9 O;  1VQ5 V;  4GKK B;  1GN4 A;  5CB4 B;  4YIP A;  1N8R W;  1B06 A;  1P7B A;  1VF6 C;  1SF9 A;  2UUC B;  3OFN G;  1EN4 A;  4NKG B;  3UM7 A;  2IJI A;  4DK1 A;  2XTA A;  4K0K O;  2JK5 C;  2V1D A;  4UV8 A;  1VMG A;  1Z5W A;  4LF4 O;  4NR1 A;  3OTO B;  3JAL A;  2QWN B;  3BA9 A;  3OUF A;  1QLE C;  4JI3 B;  5L3E A;  5H6R A;  2CTW A;  5DN6 G;  1QHT A;  4PA6 A;  3IFX A;  3JD1 A;  3CWB H;  5KUK A;  3OM3 B;  4JI8 O;  2F66 C;  1K5Q A;  2ZNJ A;  4CH4 A;  2Q73 A;  1JX9 A;  3G67 A;  4DV4 O;  4I0X B;  4Z1M G;  3QF7 A;  1SS3 A;  1BL8 A;  1BSM A;  5BZB A;  4FPP A;  1MZF A;  5LMU B;  5HFL A;  5GON A;  4E4E A;  1J95 A;  2R9R B;  2ILM A;  3IJ4 A;  2BTO A;  5CN0 A;  1NVP D;  3WG7 B;  5A9G A;  3RVY A;  2Q4P A;  1JQ0 A;  4BW9 A;  3CCL V;  1K5S A;  5B1O A;  4DR5 O;  1OCR C;  1SET A;  4U7N A;  5LHI A;  1BMF G;  5BY1 A;  1PNM A;  3TET A;  1JMK C;  2B5U A;  5LOV A;  4LFB B;  4UCU A;  1PD3 A;  3EHB B;  4PA7 A;  4X8A A;  5H2F Z;  4JI5 O;  3KCY A;  4R8C A;  2GV9 A;  2QTS A;  1M93 A;  3OGI B;  3QVN A;  4UV9 A;  4WCE V;  1BQZ A;  1R6N A;  2VRZ A;  5LMN B;  2CK3 G;  2CGN A;  1J5E B;  2YDE A;  5IT9 N;  3G71 V;  5JJJ B;  2BE3 A;  1DK1 A;  4N23 A;  4NYK A;  3FB7 C;  3JAR A;  1SQX H;  3SPC A;  5JJE B;  1M56 C;  2DJV A;  3ZMU A;  2Z5U A;  1SA0 B;  2XAQ A;  1OCC C;  1G4Y B;  3MHH C;  4LF7 B;  4JI7 O;  3RFR A;  4R50 A;  4DR5 B;  1OV9 A;  2K9P A;  3ETG A;  2VWJ A;  1BCC H;  4ABM A;  4F6E A;  2ITC C;  4OPH A;  2EIL C;  4DV7 O;  5LP6 C;  5BR8 B;  5AG2 A;  1LUV A;  2PYJ A;  1Y6X A;  3RW0 A;  2AHZ A;  3T4Z A;  3OMA B;  2BTQ B;  3F5T A;  4J80 A;  4X66 B;  4RAI A;  2V7Q G;  5LOV B;  3AG2 B;  1WA8 A;  2Y4T A;  4WFG A;  5EZY B;  2ZQM A;  1GKF A;  2E74 B;  1XI1 A;  4X1K A;  5BR8 O;  2LFR A;  4DV0 B;  4DUZ O;  2F93 B;  5LA6 A;  1Z2G A;  1RFY A;  3HR0 A;  1SES A;  4BIZ A;  3DXR A;  1MA1 A;  4RUF A;  3WFV A;  2ARH A;  4JZG A;  2OT5 A;  3RYF B;  4AHC A;  3GB7 C;  4FFK A;  4U3J A;  3EVK A;  4UB8 Z;  3UCS C;  2DYR C;  1YZB A;  4FLU A;  4EEQ A;  1KB9 F;  4GUN A;  4X88 A;  2YXH A;  3CRA A;  3HKE A;  3JAK B;  1JJ2 U;  1K4C C;  1TVK B;  3CS5 A;  4F6R B;  1GN3 A;  1VQL V;  3ABM B;  4WFE A;  1R6K A;  4X20 A;  1RM1 C;  2CTQ A;  2ZD9 A;  2UXB B;  1IZ3 A;  1KP3 A;  3PN1 A;  2EIK B;  1NI8 A;  1H2M A;  1FXK A;  4CZZ A;  2ATK C;  4YHH B;  1XUQ A;  5KAI Z;  4N21 A;  2OIE A;  4DV2 B;  4X89 A;  2ZR3 A;  1SA0 A;  2JDI G;  1NR7 A;  3I56 V;  4I4T B;  2Z3Y A;  4R7C A;  2BCC H;  1G6U A;  2EUL A;  2HHH O;  1WPX A;  3LNN A;  2JGU A;  1WPB A;  5J2U B;  1BQ0 A;  1HWY A;  4ZBM A;  3QO8 A;  1N34 B;  1K4D C;  1MNG A;  2ZE7 A;  1NBM G;  2QR4 A;  3E8H A;  1Y74 A;  2C2A A;  3FAV B;  2JEX A;  1S5H C;  2ZIM A;  1OHH G;  5B3S C;  1ENV A;  5IWA B;  4YJ3 A;  5IY5 B;  2EJ7 A;  5KHG A;  1YF2 A;  2Y69 C;  3RVZ A;  1K33 A;  4P9O A;  2P67 A;  4I55 A;  2YEV A;  3SJA C;  3JAT B;  5EZY A;  3K04 A;  1K7D A;  3JCU Z;  3B09 A;  2XAH A;  1E1Q G;  5EYP A;  2DYS B;  4CBC A;  1K9M W;  3CD6 V;  2HJF C;  4PV1 B;  4ZOL A;  1OCO C;  4DR6 B;  3APQ A;  5JVD B;  1RP3 B;  5KAF Z;  2RQ6 A;  2K1E A;  1FXK C;  4CC5 A;  1WB8 A;  1TUB B;  1UFI A;  2H8P C;  3A8T A;  1CPY A;  2Y0P A;  1H2L A;  1PL4 A;  3TXQ A;  4W4K A;  4DRX B;  2WA4 A;  5E1A C;  4RO2 A;  4JI0 B;  5EIB D;  3SYA A;  4JI7 B;  2F1M A;  3CMA V;  1W0K G;  4MTF A;  1N4C A;  3TXS A;  4I9W A;  3L73 H;  5LHG A;  2Q68 A;  4X1I B;  3B2E E;  5KX5 A;  4LFB O;  4C7U A;  1OCC B;  3QTC A;  4UCT A;  4PA3 A;  1AR1 B;  4E2L A;  2XAF A;  1M56 B;  2RJZ A;  1XNQ B;  3KZI Z;  3K5N A;  3FX7 A;  4JV5 O;  3CXC U;  4P2Z A;  4YJ3 B;  3U0Z A;  4MSW C;  3OGC C;  4JAV A;  2KKW A;  1VQO V;  1PKX A;  2UXC B;  3TJT A;  3BRC A;  2KG7 A;  3AK2 A;  1ROP A;  4MW3 A;  3E89 A;  4PHZ A;  2E76 B;  2VS0 A;  3RT3 C;  3C90 A;  1S0V A;  3ZHR A;  1O9G A;  2ZE5 A;  3B8M A;  2ODM A;  2HG5 C;  3SYQ A;  4GCZ A;  3ZN1 A;  5D5P A;  1JCH A;  2CE4 A;  3K0G A;  2IU0 A;  5CBG A;  4X64 B;  3ASN C;  4JI0 O;  1KQS U;  1HW7 A;  5LA6 B;  3AEI A;  4BWA A;  1YI2 V;  1SRY A;  3ZS8 C;  1GM9 A;  2DYS C;  1VF6 A;  2N04 A;  1RM1 B;  2LO1 A;  1GN2 A;  2PI5 A;  3RYI A;  1S5L Z;  4BW5 A;  3AG3 B;  1Y76 A;  4I4T A;  2OTJ V;  5BMV A;  5EBW C;  1MSD A;  1MZE A;  1K3E A;  1AJQ A;  1T5E A;  2E5L B;  2ZT9 B;  3DC5 A;  5J2U A;  1KKC A;  2GTA A;  3D3Q A;  3M7M X;  2OTL V;  4JTA B;  3L72 H;  2GBO A;  1GH6 A;  4DV1 B;  2Q7E A;  1ZL8 B;  5K1P A;  2QTO A;  3AG3 C;  5IWA O;  2Y4U A;  4LH7 A;  4LF6 B;  1QLE B;  5IDJ A;  1WAZ A;  1BGY H;  4IHJ A;  4LFC B;  5CA0 B;  2L6L A;  1QBZ A;  4HNA B;  1SQQ H;  4DV3 B;  3ZMV A;  1Y66 A;  1KEC A;  3R65 A;  1QLN A;  4IIJ A;  1ZUQ A;  3CJH B;  1K97 A;  5CA1 B;  3S3W A;  4YXW G;  3BEH A;  3K57 A;  3M8A A;  4JI4 O;  1VEW A;  3ZMZ A;  2RCV A;  2IW5 A;  4X1K B;  3CCE V;  3K3W A;  4B3S O;  3R66 A;  1Q6H A;  3A0R A;  2KG7 B;  3WB0 A;  2BOC C;  4JYY A;  2YXL A;  4BAY A;  2EIL B;  2QA4 V;  4GYC B;  3SYC A;  5TIS Z;  4MVZ A;  1SZX A;  3CB2 A;  1X4T A;  3ZBH A;  3KG2 A;  4ZIB A;  3P3P A;  1KYO F;  2DYR B;  1JA8 A;  5EC1 C;  1HDJ A;  4MVQ A;  4GZR B;  3ABL B;  4H0L B;  1D5N A;  3ZHS A;  1S72 V;  3ABK C;  4B7E A;  3F7Y C;  1IUR A;  3H9V A;  5KLV H;  2AGA A;  3HB3 B;  1XRE A;  1SQF A;  3BCC H;  1TUE B;  1CXZ B;  2GUZ A;  4PA4 A;  1R6T A;  5EC2 C;  4JAS A;  1GN6 A;  2IU3 A;  3K79 A;  1NH2 B;  4LCU C;  4OPA A;  2ETN A;  4K8X A;  3DSQ A;  4DV0 O;  1Q5O A;  3LUT B;  4MW8 A;  1PL0 A;  1THZ A;  5LMU O;  2Q8V A;  3LDE A;  4MVU A;  4XDL A;  5KHJ A;  1M9N A;  4PJ0 Z;  2YI9 A;  2Q67 A;  3ZRW A;  1JR9 A;  1L1F A;  1YTF B;  4PI0 A;  5IJ9 B;  2OWO A;  3JD4 A;  3VQY A;  5KX5 B;  1EZV H;  2WA3 A;  5LP6 B;  1V9P A;  2Q0A A;  4WBN A;  2ZDI A;  3K5O A;  4YY3 O;  4HBN A;  4JGS A;  3STL C;  2P4K A;  1ARO P;  4NB5 A;  4A5U B;  5JQG A;  4TUY A;  1S76 D;  1US6 A;  1H2N A;  3J81 N;  3AG4 B;  5L3B A;  1IBM B;  1Y74 B;  3D36 C;  2B1G A;  2UXX A;  4NTY A;  4DW1 A;  1BE3 H;  5EBL C;  4JYA O;  1PV0 A;  2G38 A;  4X64 O;  5JCO C;  2XAJ A;  2AXT Z;  1SQP H;  4DR7 O;  4PD4 F;  1R73 A;  5JVD A;  1AI7 A;  5D5Q A;  2VQE O;  1G1X B;  2PUS A;  1U96 A;  4TV8 A;  2YS8 A;  1M90 W;  4TT3 G;  1Q3E A;  3OW2 U;  2NN4 A;  2A3Q A;  5J2T B;  3ZRS A;  4NXN O;  2XND G;  3H1J H;  3ZED A;  1JOY A;  3W7X A;  1ZSP A;  2DOS A;  4DR3 B;  4QGP A;  4D7T A;  4FJC C;  2UUB B;  4X1Y A;  3ABL C;  3AG4 C;  4H33 A;  4J7Z A;  2UXB O;  1TUB A;  4IYH A;  5B1B B;  4FLT A;  1HR0 O;  3ZHQ A;  4O2A A;  1S3J A;  2UXD B;  2W0F C;  4X62 O;  3RYI B;  4DV5 B;  2HKO A;  2UUA B;  3ZRW B;  5IJ9 A;  2EIM B;  1IXM A;  2JEU A;  4B3T B;  3OEE G;  5CB4 A;  2JRI A;  4GKJ O;  5KMG A;  3AG7 A;  4WFB V;  4OGQ B;  1XIL A;  1Q6U A;  4CS3 A;  1XNR B;  1XMQ O;  5IE9 A;  4DV3 O;  1Q86 W;  1QVG U;  1XNQ O;  5DED A;  1XQ8 A;  2EIM C;  3K06 A;  1VQK V;  2D2C B;  1NT2 B;  4U3F H;  4DR6 O;  2XAS A;  3GVM A;  3RYF A;  1VQM V;  2EX3 A;  2BTQ A;  3E8B A;  1VQ8 V;  3ZRX A;  3L71 H;  2H94 A;  3HKB A;  5KA6 A;  3ICX A;  5JCO A;  1IJG A;  2W6J G;  3BVO A;  4JI1 O;  4PDV A;  3QO5 A;  3ZX6 A;  4WFH A;  2JGD A;  4EFB A;  4DUY O;  2Q69 A;  4GX1 A;  5BMV B;  5KHI A;  5B66 Z;  2VQF B;  4ZI7 B;  1VF5 B;  2A0L A;  5EK0 A;  1N36 O;  5IJ0 A;  1SC5 B;  3LSS A;  3LSU A;  3SGI A;  2AZ2 A;  4FLZ A;  3ABU A;  4U3J B;  1ZWI C;  1G8M A;  1VAR A;  1IVS A;  1VQ6 V;  4LF9 O;  1PPJ H;  1PP9 H;  3CCR V;  2Q7G A;  2B1I A;  4JYC A;  4TV8 B;  3P3N A;  4KHP B;  2KSD A;  5JH7 B;  1PNK A;  4I50 B;  1CP9 A;  3Q4H A;  1K92 A;  2DQ0 A;  3K5L A;  1KMI Z;  3OUS A;  2JS3 A;  2ADQ B;  2EIK C;  3CC4 V;  1B6Q A;  1W59 A;  1HNW O;  1OZ0 A;  3FB8 C;  2IJK A;  5B1B C;  3U10 A;  1AIL A;  2FML A;  2DWE C;  3FAV A;  3ZRV A;  5J9P C;  5FL7 G;  2ZXW B;  1URF A;  1M1K W;  4BIU A;  2LW7 A;  1Q6I A;  2DN9 A;  4ZHQ B;  3APO A;  3KDR A;  3B77 A;  4XDK A;  5B1A C;  1D5A A;  1EZJ A;  3FB5 C;  5B5E Z;  3CRQ A;  1XMO O;  3KKY A;  5KUM A;  3STZ C;  3J80 N;  5LGN A;  4P30 A;  4LP8 A;  2YIC A;  1S5J A;  4KUM A;  3J7A U;  2A06 H;  1IXB A;  2R9I A;  4DR1 O;  2HVK C;  1MG1 A;  4D7S A;  2QDO A;  5H6Q A;  2EJR A;  4NXM O;  1KD1 W;  4LNU B;  1YDX A;  3ZHT A;  1RSO A;  4I5S A;  3HKD B;  2UU9 O;  1D2D A;  4UB6 Z;  4FLY A;  2YUA A;  1YIT V;  4GT1 A;  3UT5 A;  2XHB A;  3K59 A;  5EYP B;  2CH7 A;  1RPR A;  1GM7 A;  1JVM A;  3T2M A;  3CCS V;  5JH7 A;  1R3K C;  5A2Q N;  2IBZ H;  5LBQ A;  4J7J A;  3OAA G;  3E22 B;  4K3A A;  3CXH F;  1IBM O;  3RYC A;  2ZE6 A;  2CTP A;  5KMG B;  3FYE B;  3EXA A;  4H37 A;  1DLB A;  1KKD A;  4UVB A;  4O4H B;  5C93 A;  3SYP A;  4JI2 B;  3NXS A;  2ZE8 A;  3BPZ A;  4MVO A;  2AW9 A;  4JF3 A;  1Q43 A;  3BAB A;  1ZX3 A;  3JAR B;  3T1Y B;  1SQB H;  3T1C A;  2JJ1 G;  2Q7H A;  4UCS A;  2Y69 B;  1DGS A;  4CH5 A;  3BFR A;  2WAM A;  3B40 A;  3CE2 A;  3H1K H;  1EFR G;  4FMT A;  2QJ1 A;  4YJ2 B;  4UCV A;  1XNR O;  3CCV V;  4B3M O;  1FJG O;  3UQ8 A;  2NR5 A;  4NTX A;  4DV5 O;  1M57 B;  4RUE A;  5B3S B;  1FFT B;  1JNB A;  2RDC A;  2WLI A;  1N34 O;  3DXR B;  5IYB O;  1IBL B;  5KA5 A;  4DR1 B;  4LF5 B;  3JAW B;  4YIO A;  2UUB O;  1BT8 A;  3RGB A;  3BA8 A;  2A9H A;  1BHB A;  4DXW A;  1M5I A;  2YIB A;  3ZCC A;  3SJC C;  1OCR B;  2E75 B;  2JIZ G;  1FOU A;  1I08 A;  1L0L H;  3AK1 A;  1WN7 A;  2PF4 E;  3N2G B;  2WLL B;  1JJO A;  1M57 C;  2Z0A A;  1VQN V;  1IBL O;  2WLN A;  4B08 A;  3K9A A;  4GX2 A;  4Z2W A;  4MVR A;  3T1Y O;  4WF9 V;  2JJ2 G;  3JAL B;  2HFE C;  4IHJ B;  5K1X A;  4FLV A;  2WSS G;  1IBK O;  1GAX A;  4YY3 B;  3CYO A;  2N05 A;  1YSC A;  4J9Z B;  1E1R G;  3RBZ A;  1Y76 B;  2EZP A;  4DR4 O;  4X65 O;  3OR7 C;  4O4I B;  4CS4 A;  4F6R A;  3B8N A;  3OMN B;  2ZKO A;  3CRR A;  2FKX A;  3QNE A;  1LUW A;  3OEH G;  5B1N A;  1SZT A;  1XL6 A;  3BAA A;  1YXB A;  1FS0 G;  1KU9 A;  3L74 H;  3G6B A;  3W7S A;  3BHP A;  1Q82 W;  1EN5 A;  3A0H Z;  1IBK B;  4KL1 A;  2W0X A;  1COW G;  1I94 B;  4HYO A;  2DE0 X;  3RYH A;  4EFE A;  1OJH A;  4FM1 A;  1FYJ A;  5GW7 A;  4KXR A;  2RMK B;  3T1H B;  4F4L A;  4DV2 O;  5C8Y A;  1K73 W;  3HKB B;  5GTH Z;  2Q9L A;  1JFF A;  4RWU A;  4U7O A;  1LNQ A;  1AI6 A;  3F5W C;  3H1H H;  3Q4H B;  3E2E A;  2P7T C;  3E35 A;  3JAT A;  1S77 D;  5FLX N;  2WPD G;  1YJ9 V;  5LXT B;  2UXD O;  1IDS A;  2OCC B;  4UVA A;  3UKM A;  4EB6 A;  1NJI W;  4J11 A;  2XAG A;  2KB1 A;  4LR3 A;  1XMQ B;  4FFB B;  3L9D A;  1WB7 A;  4QE7 A;  3X2Q C;  4JI5 B;  4OXS A;  1WJZ A;  2CDY A;  3N2G A;  5L3F A;  3ZIA G;  4I50 A;  5FNV B;  5IYZ B;  1H38 A;  1AJP A;  2ZDI C;  2WLH A;  1VQ7 V;  4PDR A;  1FXH A;  1V54 B;  4Z1V A;  3SJQ C;  4NTW A;  5LYJ B;  3E8G A;  2E3C A;  3ZHV A;  1TGO A;  1EN6 A;  1AVM A;  3CC2 V;  1HNW B;  4B7K A;  3QG5 A;  4AQY O;  1K34 A;  4RQF A;  2ZXW C;  2QM4 A;  4NVP A;  2M7W A;  4P9P A;  1HNX B;  1TAE A;  3CRM A;  3VBB A;  3THO A;  4KHP O;  1AP6 A;  2OCH A;  4FLW A;  3L75 H;  5L3C A;  3ASO B;  2VQE B;  4ZHQ A;  1DTO A;  2E5L O;  5KHH A;  3HKD A;  1TA8 A;  2PY5 A;  3IC7 A;  2F4V O;  3FYI B;  3LNM B;  4FZ0 A;  2YI8 A;  2HJD A;  2L35 A;  3CJH A;  2LGW A;  1EBO A;  1MOF A;  4LWS A;  3E8F A;  2ZM6 B;  4GX0 A;  3HPL C;  2RN9 A;  3D36 A;  4TQF A;  3IC9 A;  4O4H A;  3O9O A;  1NTZ H;  1YIJ V;  3FFQ A;  2XOK G;  4FK5 C;  3CME V;  3JAW A;  2VWK A;  2Q6A A;  3SDL A;  3JYC A;  2OIG A;  2F4V B;  1Q90 D;  1QR8 A;  2QKA A;  3G80 A;  2P22 C;  4O4J A;  1HNX O;  3MDS A;  3FKS G;  4J7K A;  5FPO A;  2KQX A;  5ITZ B;  2GSM B;  4XBF A;  1H8H G;  2DMX A;  1XMO B;  4X62 B;  3I5D A;  1NKD A;  5IYD O;  4DR4 B;  3LDC A;  3WB1 A;  2FTK A;  1AB3 A;  3CRC A;  5CBH A;  4JI4 B;  3VQW A;  3SPI A;  1NR1 A;  2QKS A;  3H1L H;  1QR9 A;  2DW4 A;  1FPO A;  1H2S B;  2FYU H;  3JSN A;  4I7Z B;  3UO3 A;  2A79 B;  3OT7 A;  4PDM A;  4L87 A;  3VQV A;  4I9Q A;  2N74 A;  2D3O W;  1JFF B;  3B4S A;  1XBL A;  4J42 A;  2PGG A;  5JJN B;  4JAU A;  2WLL A;  3K03 A;  4TV9 B;  2R9A A;  3F7V C;  4G2K A;  5GON B;  4FIP C;  1HNZ O;  3C3S A;  4DV6 B;  4LWS B;  2ZCE A;  4J10 A;  4AIL C;  2LP7 A;  5BXZ A;  1RPO A;  4LFA B;  4LF8 O;  3NR7 A;  1J5E O; 
#chains in the Genus database with same CATH homology
 3QVN A;  1GN6 A;  1EM1 A;  1GN4 A;  1IX9 A;  4YIP A;  1MSD A;  1PL4 A;  1B06 A;  1MMM A;  1P7G A;  1GN3 A;  3DC5 A;  1XIL A;  1KKC A;  1EN4 A;  3KDR A;  1N0N A;  4BR6 A;  1ZTE A;  3CEI A;  3KKY A;  3RN4 A;  3IC9 A;  4JZ2 A;  3K9S A;  1JR9 A;  1XUQ A;  4YIO A;  4C7U A;  1BT8 A;  1IXB A;  4X9Q A;  3C3T A;  1IDS A;  4F6E A;  1I08 A;  3AK1 A;  2QKA A;  2P4K A;  1AR5 A;  5AG2 A;  1ZUQ A;  1AP5 A;  1LUV A;  3MDS A;  1BSM A;  3TJT A;  1AR4 A;  1WB7 A;  3AK2 A;  1VEW A;  4E4E A;  2CDY A;  1MNG A;  2RCV A;  1QNM A;  3LSU A;  1XDC A;  4JYY A;  3DC6 A;  5A9G A;  1SZX A;  1Y67 A;  1VAR A;  1N0J A;  1I0H A;  2CE4 A;  1EN6 A;  1AVM A;  1JA8 A;  3OT7 A;  2QKC A;  2ADP A;  2GDS A;  1PM9 A;  1D5N A;  1ZSP A;  1MA1 A;  2AW9 A;  4JZG A;  1LUW A;  1ZLZ A;  1BS3 A;  1AP6 A;  4FFK A;  3EVK A;  2ADQ B;  3C3S A;  1GN2 A;  1XRE A;  3AK3 A;  4GUN A;  3BFR A;  1WB8 A;  1EN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...