2QKCA

Structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKLNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Structural and kinetic study of differences between human and Escherichia coli manganese superoxide dismutases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 72
structure length 196
sequence length 196
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2qkcA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2qkcA02
1I08A 1AP6A 1GN4A 4JZGA 3CEIA 1EN4A 4E4EA 1MA1A 3QVNA 4BR6A 1XDCA 1BS3A 1VARA 3DC5A 3AK1A 3MDSA 1D5NA 1QNMA 1BSMA 1KKCA 2QKAA 1EN5A 3C3TA 1ZUQA 3EVKA 1EN6A 2CDYA 1Y67A 1IX9A 1EM1A 3OT7A 4C7UA 1AR5A 4YIOA 1AR4A 1XREA 1PL4A 4JZ2A 2RCVA 3LSUA 1P7GA 1WB8A 4JYYA 2CE4A 2GDSA 1ZSPA 3AK2A 1ZTEA 3TJTA 2P4KA 1ZLZA 4F6EA 5A9GA 1I0HA 3KKYA 1AP5A 1MSDA 4FFKA 2AW9A 5AG2A 1IXBA 1PM9A 2ADPA 3K9SA 4X9QA 1MNGA 1JA8A 3RN4A 1N0JA 1VEWA 1LUWA 1JR9A 1AVMA 1B06A 1XILA 2ADQB 4GUNA 3BFRA 1WB7A 1BT8A 1MMMA 1N0NA 4YIPA 1GN6A 3C3SA 1SZXA 3AK3A 1XUQA 1GN2A 3DC6A 1LUVA 2QKCA 3IC9A 1IDSA 1GN3A
chains in the Genus database with same CATH superfamily
2Z0AA 1UPGA 3CCJV 1V55C 2F43G 2UXXA 3QO7A 4IT5A 1JX9A 3AG2C 2AGAA 1V54C 1N36B 1K4DC 2LW7A 4J80A 2RN9A 1KYOF 3JAKB 4ZHQA 2JJ1G 3OD4A 4MW8A 3ZHTA 1PPJH 1VF6C 1TA8A 1R3IC 4G2KA 1Q90D 2LJ2A 3RVZA 2NLJC 3CC4V 4LFCO 3K04A 1M90W 4N23A 1D5NA 2JRIA 3EHBB 5H5NA 3M7MX 4JI4B 4ZKIA 4GKJB 4J42A 2YXYA 2ITDC 3HKCB 2P22C 3OTOB 3K0DA 5IYZB 1Y74B 4F6RB 5KHIA 5CA0A 5H6RA 1OCRB 2CE4A 2GDSA 1ZTEA 3CCUV 1I94B 4TWKA 1GM9A 2ZQMA 3TK1A 3DXRB 4K0KB 4JI5O 2WLHA 3E8HA 5AG2A 1F7YA 2LFSA 4DV5B 4X1KA 1DLBA 3E83A 1YDXA 3B8MA 4I50B 3F7YC 1GK9A 3VQXA 5B3SC 4CC5A 4W4LA 4OXSA 3UO3A 5L3CA 1XILA 1BQ0A 1H8EG 4JF3A 5FLXN 4LF4O 5DM6V 2JEUA 4JI1O 4O4HA 3UCSC 4MVRA 4R8CA 4X1IA 4JASA 4P9PA 2HHHB 1R6NA 2QJ1A 3HKDB 3CCRV 3A2FA 3CRMA 1XOUA 1SC5B 1PNMA 1IJGA 2UUCO 4JI3B 4JYCA 4DR2B 4N21A 1EN4A 2KSDA 2AZ2A 3JAWA 5LHIA 1BCCH 4FJCC 1N8RW 1VARA 2ARHA 2YICA 3CCVV 3IAYA 1Q6UA 2WA4A 4FM2A 1AJQA 1N32O 2M6YA 1JNBA 1M4UA 1PKXA 4DV7B 2F4VB 4JI0B 1PL0A 1M57B 4H37A 2ZE5A 4DK1A 3K59A 3LSQA 3P32A 2PYLA 3R65A 3K79A 3ZRVA 2YSUB 4ZI7A 5EIBD 1IXMA 3TJTA 1YI2V 1H2LA 4CS2A 3ABKB 3B4SA 4UCOA 1Q7YW 2NR5A 1Y74A 4F6RA 1OZ0A 1W0KG 3ZHSA 1LNQA 5DECA 2LGWA 3D36C 2RQ6A 1MG1A 1QR8A 4HZ3A 4LF5B 3RYCB 5KAIZ 1V54B 1I5XA 3T4DA 4I50A 1W0JG 2QKCA 2BSKB 4DW0A 2ATKC 1OV9A 5KLVH 2QWRB 4I9QA 1I08A 5B5EZ 5BMVA 2UXCO 4KUMA 3BVOA 4P2ZA 2Y0IA 5LMNO 4LF9B 3FFQA 3KCYA 4JZGA 4FLTA 4JYAO 5JJNB 3CC2V 3HKDA 1W2BU 3JASB 3GWOA 2VQEB 4MVZA 4BW5A 1AJPA 4YY3O 4H33A 4JAVA 2FB5A 3CSXA 3UKMA 1QBZA 5BZBA 3MDSA 2UXNA 3BCCH 1VQ5V 1SQGA 1FXKC 5L3EA 4DV1O 2ODMA 1EN6A 3UM7A 3PN1A 2W6JG 4JTDB 1M1KW 1EM1A 1SKVA 3I55V 2E3CA 1COWG 3SJBC 3CC7V 4CZZA 4JTCB 4I7ZB 3CCLV 3TCUA 5B3SB 1JFFB 4GLXA 3CCQV 3AG1C 4DUYB 1WP8A 2DW4A 2E74B 4W4KA 1RM1B 1G6UA 2ZDIC 2PZSA 4LF8B 1DGSA 4OPHA 5EBMC 3X2QB 1ZLZA 2YIDA 3CJHB 4AHCA 5CB4B 1IBLB 3QF7A 1MSDA 3G67A 2ZIMA 1YIJV 5EIBC 1Q3EA 4X9QA 2WPDG 1F23A 3CCMV 3JAMN 1NKDA 2QWQB 4X62O 1N0JA 2QEXV 4DV6B 4JAAA 4GUNA 3ABTA 1SF9A 4B7KA 5LA6B 1VMGA 1HP8A 2ZKOA 1GN2A 4PDVA 4NTWA 1QLNA 4DV2O 1FFTB 4LFAO 3NR7A 4WF9V 2IU0A 3OEEG 2UU9O 2UUAO 3LDCA 4MVSA 1YVWA 1OCCB 5F2VO 4IYIA 2WLLB 1QQCA 1HNZO 4GCZA 1L1FA 2CTQA 5KAFZ 2BSKA 1VF7A 1XNQB 4HAMA 1N34B 2CUGA 3QVNA 1VQOV 3AK1A 2UXBO 4QNHB 3N2GB 4X66O 4RUFA 4TT3G 1KKCA 4MSWC 5D5PA 4KHPB 5IYDO 1F4NA 4FZ1A 1Y67A 1WLEA 3GWKC 2BE3A 1TUEB 1HNXB 1X59A 4AQYO 5IJ0B 1AI7A 2CH7B 1R6TA 3E35A 3LUTB 4JV5B 3H1JH 4CC6A 1S5JA 4JTAB 2EIMB 2K9PA 2P06A 2UUBB 2BTOA 3CWBH 4J7JA 4KP4A 3LNMB 5LP6B 1OHHG 2ZXWC 4FFKA 3KG2A 2ZR2A 3K5NA 4J9YB 4FM1A 5EZYB 4DR6B 4PA3A 1K4CC 4PDMA 3JALA 3CJHA 1K34A 2P5OA 1H2MA 1XHXA 5CB4A 1K33A 4JI8O 4X20B 5IYCO 1BQZA 5E79Z 1I5YA 3C3SA 3ZBHA 3AG3C 2ZM6B 1ZX3A 5LBQA 3E2EA 3TGUH 2VQFB 1UJWB 3IC9A 3P3NA 2QGNA 1IDSA 3RGBA 4DR1O 4CH3A 4WCEV 4X89A 1YJNV 2KG7B 1NS1A 3OR6C 3S3XA 4DV4O 2Y4UA 4BR6A 2R9RB 2A0LA 1YHQV 5LL6Y 3H1KH 3OFNG 5LHGA 4J11A 1QR9A 1QNMA 2P4VA 1P49A 1ZL8B 1SQBH 2WLIB 2IM9A 3SPIA 5LHHA 3WU2Z 5LXTB 4X88A 3SPHA 4CS3A 1PNLA 3FB8C 4FFBB 3OAAG 3G6EV 2LW1A 3JYCA 4I9WA 5KX5B 2NNUA 4DV3B 1XNRO 3AG4B 2DYSC 2RDCA 4NB5A 5JCOC 1ZAUA 4GKKO 2HLDG 1IBKB 3B09A 3P3PA 1XHZA 1MZEA 5IJ0A 2GBOA 1QCEA 4PA9A 5L3BA 4PJ0Z 4BIUA 4DV0B 4IL6Z 3CCEV 1VQ4V 1MSWD 1IBMB 1V9PA 1K9MW 1B06A 1B04A 3BFRA 4OX9B 5LP6A 4YHHB 5KHKA 3ABMC 1TAEA 5IWAB 1THZA 1XUQA 3LNNA 5LGTA 1KC8W 4GYCB 1SERA 3W7WA 3ZRWB 1FS0G 2FYUH 3T1YO 2BTQB 4UCRA 4X20A 1BL8A 2PY5A 2AZ0A 3F5WC 1AP6A 2F23A 2ZNIA 1RSOB 4WFHA 5JWPA 4P9OA 3ASOC 1KBHA 3CEIA 3ML0A 3ASNB 3QNEA 4I4TB 3ZN0A 5JQGB 3WG7C 3DC5A 2YIAA 2JS5A 5C8YB 4A5UB 1OCZB 4QGPA 4MTOA 3RWRD 1K5SA 3CMAV 1VQ6V 1ZUQA 1KD1W 2IJKA 4CH6A 4YJ2B 1SQFA 3A0BZ 4O4IA 4X65B 2B5UA 4B3RO 2YXHA 2ZE6A 1J95A 5LMUB 2E5LO 4XDKA 1K8AW 4G27B 1VQ7V 2P67A 4NXMB 3LSUA 1NZ6A 2IH3C 3VQYA 1MOFA 1HNWO 4FMTA 3SYCA 5LXTA 3SPJA 1FXVA 3ZMSA 3L74H 1XMQB 2DYRC 1JOYA 1BHBA 2JIZG 4IHJA 1L0LH 4B08A 1N36O 3JARB 4PA4A 1JPXA 4DR5B 4FK5C 1HDJA 1YCIA 3CCSV 5CA1B 4DK0A 2EINC 5J2TB 2Q73A 4QE7A 1S72V 1Q6IA 1J5EB 1B3QA 4BIZA 2LFRA 1XQ8A 4JI4O 3E22A 4H13B 1NH2B 3GB7C 4GKJO 4RQEA 1G1XB 1WNSA 5GONB 2OCCB 1Z2GA 1I7FA 3OTOO 1JJ2U 1XEQA 2UXDB 3E8FA 2HEPA 1WN7A 2Q7HA 1M9NA 1I94O 5D5QA 3Q4HB 1OCOC 3JD4A 2H3OA 4JI6B 4K0KO 4WBNA 2PI5A 4GX0A 4HNAB 3WB0A 1NR1A 4PD4F 1RSOA 3ZHQA 4MTXA 2GV9A 4U3JB 4DV5O 4MTGA 3BY6A 4ZOLA 3C3TA 4O4JB 1YITV 2Q0OC 4JGSA 4L8JA 5JQGA 1PD3A 1R1BA 4KFMA 2GTSA 2YC0A 3OT7A 1N33B 2Y69B 2JVDA 5C8YA 3QO8A 5A2QN 4TV8B 5B1BC 4DR4B 4MT8A 5KMGB 1TGOA 4YJ2A 2OTLV 2JEXA 1M56C 4LH7A 2HHHO 3CS5A 1FD9A 3ABMB 3WFVA 2EIJB 3J80N 3VOUA 3JAKA 2XAGA 4NTXA 4GX5A 2HR3A 1H38A 3KKYA 3MHSC 4XDLA 4UVCA 5L3FA 1QLEC 4J7KA 4UV9A 1H2KA 4JI3O 2FKXA 5FL7G 4LF7B 1M5IA 1MNGA 4DR2O 3LSSA 3ZIAG 2P90A 2GUZB 3RN4A 4UB8Z 3JCUZ 3UQ8A 2IJHA 1W59A 3K5OA 2HG5C 2OIGA 3JARA 3SYOA 2EIKB 2QTOA 2IJJA 1GN6A 3RYHB 4DW1A 3HKCA 2EBOA 4X8AA 4LWSB 2WLJA 2A06H 5IYZA 3WG7B 2Q7EA 1WA8B 4UCUA 1NVPD 1R3JC 3JSLA 4B7EA 2Q69A 4H44B 3SPGA 3N2KB 3OR7C 4DV7O 1V55B 2F4VO 3JATB 4UV8A 4YJ3B 3AG2B 2YI8A 1TUBB 3ZS8C 2QE7G 4QPJA 3DXRA 2ZT9B 1VP7A 1O9HA 4QIWF 2N04A 1Q86W 2LQTA 2ZNJA 3ZMZA 1K3EA 5GONA 2UXCB 1URFA 4TV9B 1XDCA 3LDEA 4ASUG 2XAJA 3HKBB 4LBEC 1KUQA 1BSMA 1NQTA 2DJVA 1EN5A 1XBLA 2CTRA 2PI4A 4LF5O 4B3TB 4QJFB 5KHGA 4TUYB 2LO1A 4C7UA 2BOBC 4R50A 4U3JA 2VWJA 3CHXA 4DR7B 2XNDG 1YTFD 2HVKC 4DR3B 1JCHA 4IIJB 4JYYA 2CTWA 5LGUA 3M8AA 3BA8A 4CH4A 1RPRA 4U7NA 4LC1A 3NXSA 4J9ZB 4LFBB 4LP8A 3KDRA 4O2AB 1IXBA 1US6A 1AJNA 3N27A 2EILC 1ENVA 3U11A 1Q5OA 3F7VC 3LDDA 4FLUA 2IU3A 5H2FZ 1GO3F 5EC1C 1JR9A 1AVMA 4ABMA 2ADQB 4R6ZA 5IY5C 5K1XA 1JVMA 1OCOB 2XAQA 3FB5C 3DGEA 5B1AC 1SQXH 1R3LC 2V4DA 3BRCA 4DXWA 5JH7B 1XL6A 3SGIA 3SJCC 1SZTA 4DYLA 4QPKA 4LH6A 5EBWC 1FFXB 1GAXA 5BXZA 5IJ9B 2AHYA 3JCZA 1P84F 3CRRA 4J10A 4TOIA 1FAFA 2KB1A 2G38A 2HP8A 3RFRA 5JVDB 3L71H 2EZPA 4LWSA 4DUYO 4LF8O 1H2NA 3CYOA 1IBLO 3RYCA 1WPXA 4YJ3A 1TUBA 4GT1A 1FYJA 5BR8B 1VQ9V 4QE9A 2WLNA 2C2AA 1G8MA 2NN4A 2ILMA 3FB7C 1Y76B 3O65A 1SA0B 1F4MA 3FYEB 2V7QG 3CRQA 3GVMA 4DV6O 1VF6A 4TV9A 1IX9A 1QLEB 2Q6AA 1NI8A 5CN0A 2A3QA 4JI7B 1LR1A 3K5LA 4JZ2A 4B3SB 1WB8A 3KZIZ 3F5TA 2QTSA 2YI9A 4B3MB 2WAMA 2PGGA 1P7BA 4F6EA 1NH2D 1S3JA 4DO2A 3SPCA 4UCVA 1AP5A 3JASA 3G6BA 1F51A 4BAYA 3K9SA 3APQA 1L0NH 1IZ3A 1XNQO 1N34O 2JDIG 5CBFA 2OYQA 3BA9A 1KMIZ 1LUWA 1CXZB 1SQVH 1KP3A 1H5WA 1OJHA 1Q43A 3SJAC 3VQWA 1YF2A 2ZR3A 2CTPA 3SJQC 1E79G 2X6BA 5CMUA 2KQXA 5IT9N 5KUKA 5EYPB 4UB6Z 3DC6A 1K7DA 1JFFA 1FXHA 2A9HA 5HFMA 1GN3A 1HNXO 3BPZA 4TSFG 1PP9H 3H1IH 3OMAB 4WFBV 3JD2A 3DSQA 3T1HB 4EFEA 1GKFA 1BGYH 3RYIB 2OT5A 3JD1A 4JV5O 4RQFA 1D5AA 1KECA 3L75H 3FKSG 3ETEA 5KHJA 2UUBO 1FFXA 1G4YB 4J7ZA 2Y0PA 1FJGB 1R3KC 5JVDA 1XI1A 3OTFA 5FNVB 1PNKA 3BHPA 5CBHA 5LYJB 4NXNB 5LA6A 1FXKB 5JJJB 2Q0AA 3HB3B 4DR6O 2CGOA 3J7AU 1FPOA 2WSSG 3RYFB 2WLMA 2Q7GA 1Y66A 2EILB 5C93A 2ZM6O 4UXNA 4DRXB 1PL4A 1Z5VA 1AROP 3AG1B 1Y76A 4X1YB 2DQ0A 2VQFO 1HR0B 1A32A 1OCRC 2WLLA 3HKEB 2Q4PA 4NVPA 3THOA 1UFIA 2DN9A 4X64B 5E1AC 1TVKB 2P6JA 1RFYA 2IBZH 1YZBA 4E2LA 4ZHQB 3N2GA 2IW5A 3OUSA 1QHTA 1KU9A 2GTAA 2JJ2G 1VEWA 2HJDA 3SYPA 2JGUA 3K3WA 4GX1A 1D2DA 1MZFA 2IJIA 2EZOA 1Y6XA 3D36A 2Z3YA 3ABUA 4JAUA 4LF6B 5FPOA 5H9CA 3IC7A 1Q6HA 4JI2B 2CH7A 1X4TA 4DUZB 1GTOA 2YXLA 2QM4A 4HBNA 2K1EA 5CA0B 3IFXA 2EJRA 2Q5ZA 2QM8A 4DV3O 2ZD9A 3AG7A 3ETQA 2W6IG 5CBGA 3STLC 4AILC 2F95B 1IBKO 1ROPA 5EZYA 3TXQA 4EFBA 2Y48A 3AEIA 3E86A 4X1KB 2N74A 3RYIA 3A0RA 2CK3G 3W7XA 4DV0O 5IDJA 1GRJA 4D7TA 4BW9A 4RUEA 1AI4A 1WJZA 1IBMO 4FLVA 1XMOB 1K5QA 3HR0A 4OX9O 4D6TH 4YHHO 4EEQA 1Z5WA 1XL4A 2JGDB 3ABLC 1AI5A 1Y4MA 5IWAO 1NJIW 4K8XA 2KG7A 2YEVB 4TQFA 1FXKA 1M57C 4O4HB 2KKWA 2XAHA 4R7CA 1NR7A 1DK1A 3RYFA 2P4KA 4LR3A 1PV0A 2L35A 3IGAC 2ZXWB 3ABKC 4JYBA 1U96A 4RAIA 3HPLC 2DWEC 3FX7A 2XASA 4NR1A 4PA6A 3U10A 4LFCB 4G28B 2GHYA 1VQLV 2QWOB 1ZWIC 2QR4A 2ZDIA 1R6KA 4GZRB 3JAWB 4MVMA 4PA7A 1ZL8A 2ZINA 2WLIA 2QKSA 1NTKH 2PYJA 5L3DA 3VBBA 3H01A 1M93A 1TVKA 4FFBA 3AG3B 4I0XB 3A0HZ 5HFLA 2QDOA 3C90A 1RPOA 4UCTA 5KX5A 4X65O 4WFFA 4CBCA 5LMUO 4MW3A 3I56V 2XHBA 1BMFG 2VS0A 3BABA 2DQ3A 4JI5B 3CPWU 4NXMO 3ZX6A 2WA3A 4CS4A 4ZI7B 4FPPA 2F1MA 3OMNB 3UO2A 1XMQO 1H2GA 3EXAA 2D2CB 3T4ZA 2YIBA 3J81N 4DR5O 4LCUC 1NT2B 4LF4B 3STZC 1Q8IA 1GMGA 4JI1B 2A7WA 1H2SB 4IGGA 3ZRWA 3A8TA 2ETNA 2HFEC 1S0VA 2BTQA 4UUJC 3ZCCA 4NKGB 1J5EO 2ZIOA 1VQPV 1XREA 1S76D 2XT9A 3SYQA 3CRAA 2X7RB 2Q68A 2DYSB 4HYOA 2UUCB 1O9GA 5GTHZ 1RM1C 2YDEA 5BMVB 1WP7A 2QWNB 3X2QC 2O57A 2EX3A 4I4TA 2JGDA 2UXDO 2XTAA 4FIPC 2AW9A 2YEVA 2H8PC 2MW2B 2ADPA 4Q6GA 2F93B 2JS3A 1Q81W 4JI6O 2OTJV 1N32B 4J41A 4BIOA 1YEWA 3FAVB 1BZKA 1MMMA 2VWKA 3VQVA 2P7TC 3JD3A 4H0LB 4P30A 4PHZA 2QA4V 3H1HH 1BE3H 5KA5A 2HJFC 3E89A 1N33O 2B1GA 5B66Z 4YXWG 4MVQA 3K57A 4I0XA 3H9VA 2OCHA 4DR4O 1OCCC 3B2EE 1QVGU 3L73H 3ASOB 3ETGA 3ZHVA 1P4RA 3ABLB 2OWOA 3SR2C 1SRYA 4E4EA 1MA1A 3S3WA 5CA1A 4Z2WA 3KCXA 5J2TA 1SESA 5B1NA 4LF7O 4JI0O 1GH6A 1R73A 4FM0A 1EZVH 2CDYA 2WWWA 4UCSA 3CP1A 5LOVB 5K1PA 1EFRG 2Z5UA 1KB9F 3WB1A 2D3OW 4FLXA 1AR5A 4XBFA 4D7SA 2RCVA 3OM3B 1ZSPA 5LMNB 3AK2A 2DYRB 2DWDC 2Q8VA 1VQNV 4JYAB 4K8ZA 3Q4HA 2EIMC 4YY3B 5GTIZ 4HNAA 5LP6C 3I5DA 1GM8A 1KQSU 3K08A 2YIBD 4ZBMA 4O4LB 1K97A 3OGIB 5JCOA 3RVYA 4KXRA 4DV1B 4O4JA 2EINB 4FVMA 3T1CA 4PDRA 2JK5C 4WFEA 2BOCC 4UVAA 4EB6B 3B40A 1N0NA 2VRZA 2EJ7A 3ZMTA 4XDJA 3AK3A 1HWYA 1VIBA 5J2UB 4B3TO 4TV8A 3K0GA 4LF9O 2XUMA 1GM7A 5CA3A 5KMGA 3FAVA 3RT3C 2PUSA 2DE0X 2VQEO 4DR7O 4I5SA 4DR3O 3M99B 3D8CA 3ZN1A 1WAZA 2E76B 5GW7A 2YUAA 2IH1C 1VQMV 4CH5A 4PELA 2Q67A 3K06A 2W0FC 3ZMUA 2GUZA 4X62B 2L6LA 1L8DA 3T2MA 5DEDA 4LFBO 3MAQA 2QKAA 3EVKA 4WFGA 3RYHA 3JALB 3SDLA 2HKOA 4DV2B 4LFAB 2XOKG 3ZRSA 5H6QA 4FZ0A 3RW0A 1WA8A 5TISZ 2UU9B 5B1OA 2UUAB 3ZEDA 5KA6A 3N2KA 1FOUA 4MS2A 1AR4A 5B1BB 4AI8A 3JATA 4BWAA 3CE2A 2M7WA 5J9PC 1M56B 1HNZB 3FYIB 3AG4C 1NTMH 5LOVA 3W7TA 2DMXA 3BAAA 5A9GA 5KHHA 1I0HA 4RWUA 1YSCA 1ORQC 2N05A 2UXBB 3OW2U 3HKBA 4I55B 3CRCA 4X66B 3O9OA 3ZMVA 3ZRXA 3R66A 3G4SV 2B9ZA 5ITZB 1IURA 1JJOA 1DF5A 5FPRA 3EFFK 2ZCEA 3K03A 3ETDA 1BT8A 1Q82W 5BR8O 4TUYA 1CPYA 2LGQA 4AQYB 1JMKC 3UT5B 4O4LA 4IIJA 3JSNA 4Z1MG 2PTMA 2B1IA 3OE7G 3L72H 1NU1H 4EB6A 4JI7O 4B3SO 4UFZA 5J2UA 2ITCC 4RO2A 1CEZA 4O2AA 5EBLC 4B3MO 3DTUB 1K92A 1AILA 4KHPO 3ASNC 1VQ8V 3ICXA 3K5MA 2RJZA 4FLZA 4JI8B 3APOA 3G80A 1MABG 2RMKB 1OCZC 1AB3A 1IVSA 3RBZA 1SQQH 2FTKA 4ICGA 5EK0A 4TQDA 4O2BB 5JH7A 4MTFA 4F4LA 1VF5B 4DR1B 1T5EA 1YJ9V 5IJ9A 4U7OA 2Y4TA 1AI6A 3BEHA 4NTYA 3ZHRA 4MVUA 3CB2A 4LNUB 4Q20A 2ZE8A 1N4CA 4DV4B 3CMEV 2LP7A 3QG5A 2X0LA 5EC2C 3T1HO 4L87A 2AHZA 2F66C 1YXBA 4WFAV 3QTCA 2WLKA 2R9AA 2FMLA 1JQ0A 3CXHF 1NTZH 3MD0A 3K58A 1SA0A 5IY5B 2GSMB 3CXCU 1FJGO 1WB7A 4PDLA 2OIEA 2W0XA 1FKAO 3W7SA 1KP2A 3E8BA 4NXNO 1VQKV 1SZXA 5B1AB 4I55A 5IE9A 3ZHUA 3WB2A 4O4IB 1S77D 1LUVA 3D3QA 2HVJC 3OMIB 1KKDA 3ZJZA 1XNRB 5ITZA 2RNBA 2R9IA 5DN6G 4FLYA 4OGQB 3CX5F 5KUMA 4GKKB 2CGNA 2YS8A 1AR1B 2QWPB 2OCCC 3MHHC 3P30A 1WPBA 1YJWV 2QM7A 1NVPB 5L3GA 2MK3A 1HR0O 3UT5A 3TETA 2E75B 1GN4A 2Q9LA 4GX2A 2CAZC 4IHJB 4K35A 1SQPH 4EKWA 3OUFA 3TXSA 4X64O 4U3FH 1BS3A 2V1DA 1EBOA 2EULA 3U0ZA 1DF4A 1RP3B 1K73W 3IJ4A 3OEHG 4KL1A 1S5HC 5EYPA 1E1QG 1HW7A 4FLWA 5IYBO 3FB6C 3B77A 1QVFU 3E8GA 3T1YB 1B6QA 4Z1VA 3JD0A 2X6AA 4IYHA 1QU7A 2Y69C 4YIOA 5BY1A 1U97A 4LF6O 3E22B 1P7GA 3FD9A 4JI2O 4DUZO 1CP9A 1E1RG 2QSAA 4UVBA 4O2BA 5LGNA 1YTFB 2EIJC 2PF4E 3SYAA 2BCCH 2A79B 2DOSA 1PM9A 3L9DA 4OPAA 4PV1B 1SETA 4K3AA 1EZJA 5FNVA 3OGCC 4LNUA 5LYJA 3K9AA 3L70H 4WBNB 3G71V 1JA8A 4MVOA 3CD6V 3QO5A 4X1IB 4ZIBA 3PJSK 4B3RB 2ZE7A 2XAFA 3B8NA 4PI2A 3H1LH 1DTOA 2EIKC 4YIPA 1S5LZ 2H94A 4NYKA 2R72A 4ZOLB 5JJEB 3W7UA 1NBMG 1SS3A 4JPRA 2E5LB 2X6CA 4DRXA 1BHAA 3D3IA 1XMOO 1HNWB 4X1YA 2AXTZ 2R70A 4PI0A 1H8HG 2FL4A 3HKEA
chains in the Genus database with same CATH topology
1I08A 1AP6A 1GN4A 4JZGA 3CEIA 1EN4A 4E4EA 1MA1A 3QVNA 4BR6A 1XDCA 1BS3A 1VARA 3DC5A 3AK1A 3MDSA 1D5NA 1QNMA 1BSMA 1KKCA 2QKAA 1EN5A 3C3TA 1ZUQA 3EVKA 1EN6A 2CDYA 1Y67A 1IX9A 1EM1A 3OT7A 4C7UA 1AR5A 4YIOA 1AR4A 1XREA 1PL4A 4JZ2A 2RCVA 3LSUA 1P7GA 1WB8A 4JYYA 2CE4A 2GDSA 1ZSPA 3AK2A 1ZTEA 3TJTA 2P4KA 1ZLZA 4F6EA 5A9GA 1I0HA 3KKYA 1AP5A 1MSDA 3KDRA 4FFKA 2AW9A 5AG2A 1IXBA 1PM9A 2ADPA 3K9SA 4X9QA 1MNGA 1JA8A 3RN4A 1N0JA 1VEWA 1LUWA 1JR9A 1AVMA 1B06A 1XILA 2ADQB 4GUNA 3BFRA 1WB7A 1BT8A 1MMMA 1N0NA 4YIPA 1GN6A 3C3SA 1SZXA 3AK3A 1XUQA 1GN2A 3DC6A 1LUVA 2QKCA 3IC9A 1IDSA 1GN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I08 A;  1AP6 A;  1GN4 A;  4JZG A;  3CEI A;  1EN4 A;  4E4E A;  1MA1 A;  3QVN A;  4BR6 A;  1XDC A;  1BS3 A;  1VAR A;  3DC5 A;  3AK1 A;  3MDS A;  1D5N A;  1QNM A;  1BSM A;  1KKC A;  2QKA A;  1EN5 A;  3C3T A;  1ZUQ A;  3EVK A;  1EN6 A;  2CDY A;  1Y67 A;  1IX9 A;  1EM1 A;  3OT7 A;  4C7U A;  1AR5 A;  4YIO A;  1AR4 A;  1XRE A;  1PL4 A;  4JZ2 A;  2RCV A;  3LSU A;  1P7G A;  1WB8 A;  4JYY A;  2CE4 A;  2GDS A;  1ZSP A;  3AK2 A;  1ZTE A;  3TJT A;  2P4K A;  1ZLZ A;  4F6E A;  5A9G A;  1I0H A;  3KKY A;  1AP5 A;  1MSD A;  4FFK A;  2AW9 A;  5AG2 A;  1IXB A;  1PM9 A;  2ADP A;  3K9S A;  4X9Q A;  1MNG A;  1JA8 A;  3RN4 A;  1N0J A;  1VEW A;  1LUW A;  1JR9 A;  1AVM A;  1B06 A;  1XIL A;  2ADQ B;  4GUN A;  3BFR A;  1WB7 A;  1BT8 A;  1MMM A;  1N0N A;  4YIP A;  1GN6 A;  3C3S A;  1SZX A;  3AK3 A;  1XUQ A;  1GN2 A;  3DC6 A;  1LUV A;  2QKC A;  3IC9 A;  1IDS A;  1GN3 A; 
#chains in the Genus database with same CATH topology
 2Z0A A;  1UPG A;  3CCJ V;  1V55 C;  2F43 G;  2UXX A;  3QO7 A;  4IT5 A;  1JX9 A;  3AG2 C;  2AGA A;  1V54 C;  1N36 B;  1K4D C;  2LW7 A;  4J80 A;  2RN9 A;  1KYO F;  3JAK B;  4ZHQ A;  2JJ1 G;  3OD4 A;  4MW8 A;  3ZHT A;  1PPJ H;  1VF6 C;  1TA8 A;  1R3I C;  4G2K A;  1Q90 D;  2LJ2 A;  3RVZ A;  2NLJ C;  3CC4 V;  4LFC O;  3K04 A;  1M90 W;  4N23 A;  1D5N A;  2JRI A;  3EHB B;  5H5N A;  3M7M X;  4JI4 B;  4ZKI A;  4GKJ B;  4J42 A;  2YXY A;  2ITD C;  3HKC B;  2P22 C;  3OTO B;  3K0D A;  5IYZ B;  1Y74 B;  4F6R B;  5KHI A;  5CA0 A;  5H6R A;  1OCR B;  2CE4 A;  2GDS A;  1ZTE A;  3CCU V;  1I94 B;  4TWK A;  1GM9 A;  2ZQM A;  3TK1 A;  3DXR B;  4K0K B;  4JI5 O;  2WLH A;  3E8H A;  5AG2 A;  1F7Y A;  2LFS A;  4DV5 B;  4X1K A;  1DLB A;  3E83 A;  1YDX A;  3B8M A;  4I50 B;  3F7Y C;  1GK9 A;  3VQX A;  5B3S C;  4CC5 A;  4W4L A;  4OXS A;  3UO3 A;  5L3C A;  1XIL A;  1BQ0 A;  1H8E G;  4JF3 A;  5FLX N;  4LF4 O;  5DM6 V;  2JEU A;  4JI1 O;  4O4H A;  3UCS C;  4MVR A;  4R8C A;  4X1I A;  4JAS A;  4P9P A;  2HHH B;  1R6N A;  2QJ1 A;  3HKD B;  3CCR V;  3A2F A;  3CRM A;  1XOU A;  1SC5 B;  1PNM A;  1IJG A;  2UUC O;  4JI3 B;  4JYC A;  4DR2 B;  4N21 A;  1EN4 A;  2KSD A;  2AZ2 A;  3JAW A;  5LHI A;  1BCC H;  4FJC C;  1N8R W;  1VAR A;  2ARH A;  2YIC A;  3CCV V;  3IAY A;  1Q6U A;  2WA4 A;  4FM2 A;  1AJQ A;  1N32 O;  2M6Y A;  1JNB A;  1M4U A;  1PKX A;  4DV7 B;  2F4V B;  4JI0 B;  1PL0 A;  1M57 B;  4H37 A;  2ZE5 A;  4DK1 A;  3K59 A;  3LSQ A;  3P32 A;  2PYL A;  3R65 A;  3K79 A;  3ZRV A;  2YSU B;  4ZI7 A;  5EIB D;  1IXM A;  3TJT A;  1YI2 V;  1H2L A;  4CS2 A;  3ABK B;  3B4S A;  4UCO A;  1Q7Y W;  2NR5 A;  1Y74 A;  4F6R A;  1OZ0 A;  1W0K G;  3ZHS A;  1LNQ A;  5DEC A;  2LGW A;  3D36 C;  2RQ6 A;  1MG1 A;  1QR8 A;  4HZ3 A;  4LF5 B;  3RYC B;  5KAI Z;  1V54 B;  1I5X A;  3T4D A;  4I50 A;  1W0J G;  2QKC A;  2BSK B;  4DW0 A;  2ATK C;  1OV9 A;  5KLV H;  2QWR B;  4I9Q A;  1I08 A;  5B5E Z;  5BMV A;  2UXC O;  4KUM A;  3BVO A;  4P2Z A;  2Y0I A;  5LMN O;  4LF9 B;  3FFQ A;  3KCY A;  4JZG A;  4FLT A;  4JYA O;  5JJN B;  3CC2 V;  3HKD A;  1W2B U;  3JAS B;  3GWO A;  2VQE B;  4MVZ A;  4BW5 A;  1AJP A;  4YY3 O;  4H33 A;  4JAV A;  2FB5 A;  3CSX A;  3UKM A;  1QBZ A;  5BZB A;  3MDS A;  2UXN A;  3BCC H;  1VQ5 V;  1SQG A;  1FXK C;  5L3E A;  4DV1 O;  2ODM A;  1EN6 A;  3UM7 A;  3PN1 A;  2W6J G;  4JTD B;  1M1K W;  1EM1 A;  1SKV A;  3I55 V;  2E3C A;  1COW G;  3SJB C;  3CC7 V;  4CZZ A;  4JTC B;  4I7Z B;  3CCL V;  3TCU A;  5B3S B;  1JFF B;  4GLX A;  3CCQ V;  3AG1 C;  4DUY B;  1WP8 A;  2DW4 A;  2E74 B;  4W4K A;  1RM1 B;  1G6U A;  2ZDI C;  2PZS A;  4LF8 B;  1DGS A;  4OPH A;  5EBM C;  3X2Q B;  1ZLZ A;  2YID A;  3CJH B;  4AHC A;  5CB4 B;  1IBL B;  3QF7 A;  1MSD A;  3G67 A;  2ZIM A;  1YIJ V;  5EIB C;  1Q3E A;  4X9Q A;  2WPD G;  1F23 A;  3CCM V;  3JAM N;  1NKD A;  2QWQ B;  4X62 O;  1N0J A;  2QEX V;  4DV6 B;  4JAA A;  4GUN A;  3ABT A;  1SF9 A;  4B7K A;  5LA6 B;  1VMG A;  1HP8 A;  2ZKO A;  1GN2 A;  4PDV A;  4NTW A;  1QLN A;  4DV2 O;  1FFT B;  4LFA O;  3NR7 A;  4WF9 V;  2IU0 A;  3OEE G;  2UU9 O;  2UUA O;  3LDC A;  4MVS A;  1YVW A;  1OCC B;  5F2V O;  4IYI A;  2WLL B;  1QQC A;  1HNZ O;  4GCZ A;  1L1F A;  2CTQ A;  5KAF Z;  2BSK A;  1VF7 A;  1XNQ B;  4HAM A;  1N34 B;  2CUG A;  3QVN A;  1VQO V;  3AK1 A;  2UXB O;  4QNH B;  3N2G B;  4X66 O;  4RUF A;  4TT3 G;  1KKC A;  4MSW C;  5D5P A;  4KHP B;  5IYD O;  1F4N A;  4FZ1 A;  1Y67 A;  1WLE A;  3GWK C;  2BE3 A;  1TUE B;  1HNX B;  1X59 A;  4AQY O;  5IJ0 B;  1AI7 A;  2CH7 B;  1R6T A;  3E35 A;  3LUT B;  4JV5 B;  3H1J H;  4CC6 A;  1S5J A;  4JTA B;  2EIM B;  2K9P A;  2P06 A;  2UUB B;  2BTO A;  3CWB H;  4J7J A;  4KP4 A;  3LNM B;  5LP6 B;  1OHH G;  2ZXW C;  4FFK A;  3KG2 A;  2ZR2 A;  3K5N A;  4J9Y B;  4FM1 A;  5EZY B;  4DR6 B;  4PA3 A;  1K4C C;  4PDM A;  3JAL A;  3CJH A;  1K34 A;  2P5O A;  1H2M A;  1XHX A;  5CB4 A;  1K33 A;  4JI8 O;  4X20 B;  5IYC O;  1BQZ A;  5E79 Z;  1I5Y A;  3C3S A;  3ZBH A;  3AG3 C;  2ZM6 B;  1ZX3 A;  5LBQ A;  3E2E A;  3TGU H;  2VQF B;  1UJW B;  3IC9 A;  3P3N A;  2QGN A;  1IDS A;  3RGB A;  4DR1 O;  4CH3 A;  4WCE V;  4X89 A;  1YJN V;  2KG7 B;  1NS1 A;  3OR6 C;  3S3X A;  4DV4 O;  2Y4U A;  4BR6 A;  2R9R B;  2A0L A;  1YHQ V;  5LL6 Y;  3H1K H;  3OFN G;  5LHG A;  4J11 A;  1QR9 A;  1QNM A;  2P4V A;  1P49 A;  1ZL8 B;  1SQB H;  2WLI B;  2IM9 A;  3SPI A;  5LHH A;  3WU2 Z;  5LXT B;  4X88 A;  3SPH A;  4CS3 A;  1PNL A;  3FB8 C;  4FFB B;  3OAA G;  3G6E V;  2LW1 A;  3JYC A;  4I9W A;  5KX5 B;  2NNU A;  4DV3 B;  1XNR O;  3AG4 B;  2DYS C;  2RDC A;  4NB5 A;  5JCO C;  1ZAU A;  4GKK O;  2HLD G;  1IBK B;  3B09 A;  3P3P A;  1XHZ A;  1MZE A;  5IJ0 A;  2GBO A;  1QCE A;  4PA9 A;  5L3B A;  4PJ0 Z;  4BIU A;  4DV0 B;  4IL6 Z;  3CCE V;  1VQ4 V;  1MSW D;  1IBM B;  1V9P A;  1K9M W;  1B06 A;  1B04 A;  3BFR A;  4OX9 B;  5LP6 A;  4YHH B;  5KHK A;  3ABM C;  1TAE A;  5IWA B;  1THZ A;  1XUQ A;  3LNN A;  5LGT A;  1KC8 W;  4GYC B;  1SER A;  3W7W A;  3ZRW B;  1FS0 G;  2FYU H;  3T1Y O;  2BTQ B;  4UCR A;  4X20 A;  1BL8 A;  2PY5 A;  2AZ0 A;  3F5W C;  1AP6 A;  2F23 A;  2ZNI A;  1RSO B;  4WFH A;  5JWP A;  4P9O A;  3ASO C;  1KBH A;  3CEI A;  3ML0 A;  3ASN B;  3QNE A;  4I4T B;  3ZN0 A;  5JQG B;  3WG7 C;  3DC5 A;  2YIA A;  2JS5 A;  5C8Y B;  4A5U B;  1OCZ B;  4QGP A;  4MTO A;  3RWR D;  1K5S A;  3CMA V;  1VQ6 V;  1ZUQ A;  1KD1 W;  2IJK A;  4CH6 A;  4YJ2 B;  1SQF A;  3A0B Z;  4O4I A;  4X65 B;  2B5U A;  4B3R O;  2YXH A;  2ZE6 A;  1J95 A;  5LMU B;  2E5L O;  4XDK A;  1K8A W;  4G27 B;  1VQ7 V;  2P67 A;  4NXM B;  3LSU A;  1NZ6 A;  2IH3 C;  3VQY A;  1MOF A;  1HNW O;  4FMT A;  3SYC A;  5LXT A;  3SPJ A;  1FXV A;  3ZMS A;  3L74 H;  1XMQ B;  2DYR C;  1JOY A;  1BHB A;  2JIZ G;  4IHJ A;  1L0L H;  4B08 A;  1N36 O;  3JAR B;  4PA4 A;  1JPX A;  4DR5 B;  4FK5 C;  1HDJ A;  1YCI A;  3CCS V;  5CA1 B;  4DK0 A;  2EIN C;  5J2T B;  2Q73 A;  4QE7 A;  1S72 V;  1Q6I A;  1J5E B;  1B3Q A;  4BIZ A;  2LFR A;  1XQ8 A;  4JI4 O;  3E22 A;  4H13 B;  1NH2 B;  3GB7 C;  4GKJ O;  4RQE A;  1G1X B;  1WNS A;  5GON B;  2OCC B;  1Z2G A;  1I7F A;  3OTO O;  1JJ2 U;  1XEQ A;  2UXD B;  3E8F A;  2HEP A;  1WN7 A;  2Q7H A;  1M9N A;  1I94 O;  5D5Q A;  3Q4H B;  1OCO C;  3JD4 A;  2H3O A;  4JI6 B;  4K0K O;  4WBN A;  2PI5 A;  4GX0 A;  4HNA B;  3WB0 A;  1NR1 A;  4PD4 F;  1RSO A;  3ZHQ A;  4MTX A;  2GV9 A;  4U3J B;  4DV5 O;  4MTG A;  3BY6 A;  4ZOL A;  3C3T A;  4O4J B;  1YIT V;  2Q0O C;  4JGS A;  4L8J A;  5JQG A;  1PD3 A;  1R1B A;  4KFM A;  2GTS A;  2YC0 A;  3OT7 A;  1N33 B;  2Y69 B;  2JVD A;  5C8Y A;  3QO8 A;  5A2Q N;  4TV8 B;  5B1B C;  4DR4 B;  4MT8 A;  5KMG B;  1TGO A;  4YJ2 A;  2OTL V;  2JEX A;  1M56 C;  4LH7 A;  2HHH O;  3CS5 A;  1FD9 A;  3ABM B;  3WFV A;  2EIJ B;  3J80 N;  3VOU A;  3JAK A;  2XAG A;  4NTX A;  4GX5 A;  2HR3 A;  1H38 A;  3KKY A;  3MHS C;  4XDL A;  4UVC A;  5L3F A;  1QLE C;  4J7K A;  4UV9 A;  1H2K A;  4JI3 O;  2FKX A;  5FL7 G;  4LF7 B;  1M5I A;  1MNG A;  4DR2 O;  3LSS A;  3ZIA G;  2P90 A;  2GUZ B;  3RN4 A;  4UB8 Z;  3JCU Z;  3UQ8 A;  2IJH A;  1W59 A;  3K5O A;  2HG5 C;  2OIG A;  3JAR A;  3SYO A;  2EIK B;  2QTO A;  2IJJ A;  1GN6 A;  3RYH B;  4DW1 A;  3HKC A;  2EBO A;  4X8A A;  4LWS B;  2WLJ A;  2A06 H;  5IYZ A;  3WG7 B;  2Q7E A;  1WA8 B;  4UCU A;  1NVP D;  1R3J C;  3JSL A;  4B7E A;  2Q69 A;  4H44 B;  3SPG A;  3N2K B;  3OR7 C;  4DV7 O;  1V55 B;  2F4V O;  3JAT B;  4UV8 A;  4YJ3 B;  3AG2 B;  2YI8 A;  1TUB B;  3ZS8 C;  2QE7 G;  4QPJ A;  3DXR A;  2ZT9 B;  1VP7 A;  1O9H A;  4QIW F;  2N04 A;  1Q86 W;  2LQT A;  2ZNJ A;  3ZMZ A;  1K3E A;  5GON A;  2UXC B;  1URF A;  4TV9 B;  1XDC A;  3LDE A;  4ASU G;  2XAJ A;  3HKB B;  4LBE C;  1KUQ A;  1BSM A;  1NQT A;  2DJV A;  1EN5 A;  1XBL A;  2CTR A;  2PI4 A;  4LF5 O;  4B3T B;  4QJF B;  5KHG A;  4TUY B;  2LO1 A;  4C7U A;  2BOB C;  4R50 A;  4U3J A;  2VWJ A;  3CHX A;  4DR7 B;  2XND G;  1YTF D;  2HVK C;  4DR3 B;  1JCH A;  4IIJ B;  4JYY A;  2CTW A;  5LGU A;  3M8A A;  3BA8 A;  4CH4 A;  1RPR A;  4U7N A;  4LC1 A;  3NXS A;  4J9Z B;  4LFB B;  4LP8 A;  3KDR A;  4O2A B;  1IXB A;  1US6 A;  1AJN A;  3N27 A;  2EIL C;  1ENV A;  3U11 A;  1Q5O A;  3F7V C;  3LDD A;  4FLU A;  2IU3 A;  5H2F Z;  1GO3 F;  5EC1 C;  1JR9 A;  1AVM A;  4ABM A;  2ADQ B;  4R6Z A;  5IY5 C;  5K1X A;  1JVM A;  1OCO B;  2XAQ A;  3FB5 C;  3DGE A;  5B1A C;  1SQX H;  1R3L C;  2V4D A;  3BRC A;  4DXW A;  5JH7 B;  1XL6 A;  3SGI A;  3SJC C;  1SZT A;  4DYL A;  4QPK A;  4LH6 A;  5EBW C;  1FFX B;  1GAX A;  5BXZ A;  5IJ9 B;  2AHY A;  3JCZ A;  1P84 F;  3CRR A;  4J10 A;  4TOI A;  1FAF A;  2KB1 A;  2G38 A;  2HP8 A;  3RFR A;  5JVD B;  3L71 H;  2EZP A;  4LWS A;  4DUY O;  4LF8 O;  1H2N A;  3CYO A;  1IBL O;  3RYC A;  1WPX A;  4YJ3 A;  1TUB A;  4GT1 A;  1FYJ A;  5BR8 B;  1VQ9 V;  4QE9 A;  2WLN A;  2C2A A;  1G8M A;  2NN4 A;  2ILM A;  3FB7 C;  1Y76 B;  3O65 A;  1SA0 B;  1F4M A;  3FYE B;  2V7Q G;  3CRQ A;  3GVM A;  4DV6 O;  1VF6 A;  4TV9 A;  1IX9 A;  1QLE B;  2Q6A A;  1NI8 A;  5CN0 A;  2A3Q A;  4JI7 B;  1LR1 A;  3K5L A;  4JZ2 A;  4B3S B;  1WB8 A;  3KZI Z;  3F5T A;  2QTS A;  2YI9 A;  4B3M B;  2WAM A;  2PGG A;  1P7B A;  4F6E A;  1NH2 D;  1S3J A;  4DO2 A;  3SPC A;  4UCV A;  1AP5 A;  3JAS A;  3G6B A;  1F51 A;  4BAY A;  3K9S A;  3APQ A;  1L0N H;  1IZ3 A;  1XNQ O;  1N34 O;  2JDI G;  5CBF A;  2OYQ A;  3BA9 A;  1KMI Z;  1LUW A;  1CXZ B;  1SQV H;  1KP3 A;  1H5W A;  1OJH A;  1Q43 A;  3SJA C;  3VQW A;  1YF2 A;  2ZR3 A;  2CTP A;  3SJQ C;  1E79 G;  2X6B A;  5CMU A;  2KQX A;  5IT9 N;  5KUK A;  5EYP B;  4UB6 Z;  3DC6 A;  1K7D A;  1JFF A;  1FXH A;  2A9H A;  5HFM A;  1GN3 A;  1HNX O;  3BPZ A;  4TSF G;  1PP9 H;  3H1I H;  3OMA B;  4WFB V;  3JD2 A;  3DSQ A;  3T1H B;  4EFE A;  1GKF A;  1BGY H;  3RYI B;  2OT5 A;  3JD1 A;  4JV5 O;  4RQF A;  1D5A A;  1KEC A;  3L75 H;  3FKS G;  3ETE A;  5KHJ A;  2UUB O;  1FFX A;  1G4Y B;  4J7Z A;  2Y0P A;  1FJG B;  1R3K C;  5JVD A;  1XI1 A;  3OTF A;  5FNV B;  1PNK A;  3BHP A;  5CBH A;  5LYJ B;  4NXN B;  5LA6 A;  1FXK B;  5JJJ B;  2Q0A A;  3HB3 B;  4DR6 O;  2CGO A;  3J7A U;  1FPO A;  2WSS G;  3RYF B;  2WLM A;  2Q7G A;  1Y66 A;  2EIL B;  5C93 A;  2ZM6 O;  4UXN A;  4DRX B;  1PL4 A;  1Z5V A;  1ARO P;  3AG1 B;  1Y76 A;  4X1Y B;  2DQ0 A;  2VQF O;  1HR0 B;  1A32 A;  1OCR C;  2WLL A;  3HKE B;  2Q4P A;  4NVP A;  3THO A;  1UFI A;  2DN9 A;  4X64 B;  5E1A C;  1TVK B;  2P6J A;  1RFY A;  2IBZ H;  1YZB A;  4E2L A;  4ZHQ B;  3N2G A;  2IW5 A;  3OUS A;  1QHT A;  1KU9 A;  2GTA A;  2JJ2 G;  1VEW A;  2HJD A;  3SYP A;  2JGU A;  3K3W A;  4GX1 A;  1D2D A;  1MZF A;  2IJI A;  2EZO A;  1Y6X A;  3D36 A;  2Z3Y A;  3ABU A;  4JAU A;  4LF6 B;  5FPO A;  5H9C A;  3IC7 A;  1Q6H A;  4JI2 B;  2CH7 A;  1X4T A;  4DUZ B;  1GTO A;  2YXL A;  2QM4 A;  4HBN A;  2K1E A;  5CA0 B;  3IFX A;  2EJR A;  2Q5Z A;  2QM8 A;  4DV3 O;  2ZD9 A;  3AG7 A;  3ETQ A;  2W6I G;  5CBG A;  3STL C;  4AIL C;  2F95 B;  1IBK O;  1ROP A;  5EZY A;  3TXQ A;  4EFB A;  2Y48 A;  3AEI A;  3E86 A;  4X1K B;  2N74 A;  3RYI A;  3A0R A;  2CK3 G;  3W7X A;  4DV0 O;  5IDJ A;  1GRJ A;  4D7T A;  4BW9 A;  4RUE A;  1AI4 A;  1WJZ A;  1IBM O;  4FLV A;  1XMO B;  1K5Q A;  3HR0 A;  4OX9 O;  4D6T H;  4YHH O;  4EEQ A;  1Z5W A;  1XL4 A;  2JGD B;  3ABL C;  1AI5 A;  1Y4M A;  5IWA O;  1NJI W;  4K8X A;  2KG7 A;  2YEV B;  4TQF A;  1FXK A;  1M57 C;  4O4H B;  2KKW A;  2XAH A;  4R7C A;  1NR7 A;  1DK1 A;  3RYF A;  2P4K A;  4LR3 A;  1PV0 A;  2L35 A;  3IGA C;  2ZXW B;  3ABK C;  4JYB A;  1U96 A;  4RAI A;  3HPL C;  2DWE C;  3FX7 A;  2XAS A;  4NR1 A;  4PA6 A;  3U10 A;  4LFC B;  4G28 B;  2GHY A;  1VQL V;  2QWO B;  1ZWI C;  2QR4 A;  2ZDI A;  1R6K A;  4GZR B;  3JAW B;  4MVM A;  4PA7 A;  1ZL8 A;  2ZIN A;  2WLI A;  2QKS A;  1NTK H;  2PYJ A;  5L3D A;  3VBB A;  3H01 A;  1M93 A;  1TVK A;  4FFB A;  3AG3 B;  4I0X B;  3A0H Z;  5HFL A;  2QDO A;  3C90 A;  1RPO A;  4UCT A;  5KX5 A;  4X65 O;  4WFF A;  4CBC A;  5LMU O;  4MW3 A;  3I56 V;  2XHB A;  1BMF G;  2VS0 A;  3BAB A;  2DQ3 A;  4JI5 B;  3CPW U;  4NXM O;  3ZX6 A;  2WA3 A;  4CS4 A;  4ZI7 B;  4FPP A;  2F1M A;  3OMN B;  3UO2 A;  1XMQ O;  1H2G A;  3EXA A;  2D2C B;  3T4Z A;  2YIB A;  3J81 N;  4DR5 O;  4LCU C;  1NT2 B;  4LF4 B;  3STZ C;  1Q8I A;  1GMG A;  4JI1 B;  2A7W A;  1H2S B;  4IGG A;  3ZRW A;  3A8T A;  2ETN A;  2HFE C;  1S0V A;  2BTQ A;  4UUJ C;  3ZCC A;  4NKG B;  1J5E O;  2ZIO A;  1VQP V;  1XRE A;  1S76 D;  2XT9 A;  3SYQ A;  3CRA A;  2X7R B;  2Q68 A;  2DYS B;  4HYO A;  2UUC B;  1O9G A;  5GTH Z;  1RM1 C;  2YDE A;  5BMV B;  1WP7 A;  2QWN B;  3X2Q C;  2O57 A;  2EX3 A;  4I4T A;  2JGD A;  2UXD O;  2XTA A;  4FIP C;  2AW9 A;  2YEV A;  2H8P C;  2MW2 B;  2ADP A;  4Q6G A;  2F93 B;  2JS3 A;  1Q81 W;  4JI6 O;  2OTJ V;  1N32 B;  4J41 A;  4BIO A;  1YEW A;  3FAV B;  1BZK A;  1MMM A;  2VWK A;  3VQV A;  2P7T C;  3JD3 A;  4H0L B;  4P30 A;  4PHZ A;  2QA4 V;  3H1H H;  1BE3 H;  5KA5 A;  2HJF C;  3E89 A;  1N33 O;  2B1G A;  5B66 Z;  4YXW G;  4MVQ A;  3K57 A;  4I0X A;  3H9V A;  2OCH A;  4DR4 O;  1OCC C;  3B2E E;  1QVG U;  3L73 H;  3ASO B;  3ETG A;  3ZHV A;  1P4R A;  3ABL B;  2OWO A;  3SR2 C;  1SRY A;  4E4E A;  1MA1 A;  3S3W A;  5CA1 A;  4Z2W A;  3KCX A;  5J2T A;  1SES A;  5B1N A;  4LF7 O;  4JI0 O;  1GH6 A;  1R73 A;  4FM0 A;  1EZV H;  2CDY A;  2WWW A;  4UCS A;  3CP1 A;  5LOV B;  5K1P A;  1EFR G;  2Z5U A;  1KB9 F;  3WB1 A;  2D3O W;  4FLX A;  1AR5 A;  4XBF A;  4D7S A;  2RCV A;  3OM3 B;  1ZSP A;  5LMN B;  3AK2 A;  2DYR B;  2DWD C;  2Q8V A;  1VQN V;  4JYA B;  4K8Z A;  3Q4H A;  2EIM C;  4YY3 B;  5GTI Z;  4HNA A;  5LP6 C;  3I5D A;  1GM8 A;  1KQS U;  3K08 A;  2YIB D;  4ZBM A;  4O4L B;  1K97 A;  3OGI B;  5JCO A;  3RVY A;  4KXR A;  4DV1 B;  4O4J A;  2EIN B;  4FVM A;  3T1C A;  4PDR A;  2JK5 C;  4WFE A;  2BOC C;  4UVA A;  4EB6 B;  3B40 A;  1N0N A;  2VRZ A;  2EJ7 A;  3ZMT A;  4XDJ A;  3AK3 A;  1HWY A;  1VIB A;  5J2U B;  4B3T O;  4TV8 A;  3K0G A;  4LF9 O;  2XUM A;  1GM7 A;  5CA3 A;  5KMG A;  3FAV A;  3RT3 C;  2PUS A;  2DE0 X;  2VQE O;  4DR7 O;  4I5S A;  4DR3 O;  3M99 B;  3D8C A;  3ZN1 A;  1WAZ A;  2E76 B;  5GW7 A;  2YUA A;  2IH1 C;  1VQM V;  4CH5 A;  4PEL A;  2Q67 A;  3K06 A;  2W0F C;  3ZMU A;  2GUZ A;  4X62 B;  2L6L A;  1L8D A;  3T2M A;  5DED A;  4LFB O;  3MAQ A;  2QKA A;  3EVK A;  4WFG A;  3RYH A;  3JAL B;  3SDL A;  2HKO A;  4DV2 B;  4LFA B;  2XOK G;  3ZRS A;  5H6Q A;  4FZ0 A;  3RW0 A;  1WA8 A;  5TIS Z;  2UU9 B;  5B1O A;  2UUA B;  3ZED A;  5KA6 A;  3N2K A;  1FOU A;  4MS2 A;  1AR4 A;  5B1B B;  4AI8 A;  3JAT A;  4BWA A;  3CE2 A;  2M7W A;  5J9P C;  1M56 B;  1HNZ B;  3FYI B;  3AG4 C;  1NTM H;  5LOV A;  3W7T A;  2DMX A;  3BAA A;  5A9G A;  5KHH A;  1I0H A;  4RWU A;  1YSC A;  1ORQ C;  2N05 A;  2UXB B;  3OW2 U;  3HKB A;  4I55 B;  3CRC A;  4X66 B;  3O9O A;  3ZMV A;  3ZRX A;  3R66 A;  3G4S V;  2B9Z A;  5ITZ B;  1IUR A;  1JJO A;  1DF5 A;  5FPR A;  3EFF K;  2ZCE A;  3K03 A;  3ETD A;  1BT8 A;  1Q82 W;  5BR8 O;  4TUY A;  1CPY A;  2LGQ A;  4AQY B;  1JMK C;  3UT5 B;  4O4L A;  4IIJ A;  3JSN A;  4Z1M G;  2PTM A;  2B1I A;  3OE7 G;  3L72 H;  1NU1 H;  4EB6 A;  4JI7 O;  4B3S O;  4UFZ A;  5J2U A;  2ITC C;  4RO2 A;  1CEZ A;  4O2A A;  5EBL C;  4B3M O;  3DTU B;  1K92 A;  1AIL A;  4KHP O;  3ASN C;  1VQ8 V;  3ICX A;  3K5M A;  2RJZ A;  4FLZ A;  4JI8 B;  3APO A;  3G80 A;  1MAB G;  2RMK B;  1OCZ C;  1AB3 A;  1IVS A;  3RBZ A;  1SQQ H;  2FTK A;  4ICG A;  5EK0 A;  4TQD A;  4O2B B;  5JH7 A;  4MTF A;  4F4L A;  1VF5 B;  4DR1 B;  1T5E A;  1YJ9 V;  5IJ9 A;  4U7O A;  2Y4T A;  1AI6 A;  3BEH A;  4NTY A;  3ZHR A;  4MVU A;  3CB2 A;  4LNU B;  4Q20 A;  2ZE8 A;  1N4C A;  4DV4 B;  3CME V;  2LP7 A;  3QG5 A;  2X0L A;  5EC2 C;  3T1H O;  4L87 A;  2AHZ A;  2F66 C;  1YXB A;  4WFA V;  3QTC A;  2WLK A;  2R9A A;  2FML A;  1JQ0 A;  3CXH F;  1NTZ H;  3MD0 A;  3K58 A;  1SA0 A;  5IY5 B;  2GSM B;  3CXC U;  1FJG O;  1WB7 A;  4PDL A;  2OIE A;  2W0X A;  1FKA O;  3W7S A;  1KP2 A;  3E8B A;  4NXN O;  1VQK V;  1SZX A;  5B1A B;  4I55 A;  5IE9 A;  3ZHU A;  3WB2 A;  4O4I B;  1S77 D;  1LUV A;  3D3Q A;  2HVJ C;  3OMI B;  1KKD A;  3ZJZ A;  1XNR B;  5ITZ A;  2RNB A;  2R9I A;  5DN6 G;  4FLY A;  4OGQ B;  3CX5 F;  5KUM A;  4GKK B;  2CGN A;  2YS8 A;  1AR1 B;  2QWP B;  2OCC C;  3MHH C;  3P30 A;  1WPB A;  1YJW V;  2QM7 A;  1NVP B;  5L3G A;  2MK3 A;  1HR0 O;  3UT5 A;  3TET A;  2E75 B;  1GN4 A;  2Q9L A;  4GX2 A;  2CAZ C;  4IHJ B;  4K35 A;  1SQP H;  4EKW A;  3OUF A;  3TXS A;  4X64 O;  4U3F H;  1BS3 A;  2V1D A;  1EBO A;  2EUL A;  3U0Z A;  1DF4 A;  1RP3 B;  1K73 W;  3IJ4 A;  3OEH G;  4KL1 A;  1S5H C;  5EYP A;  1E1Q G;  1HW7 A;  4FLW A;  5IYB O;  3FB6 C;  3B77 A;  1QVF U;  3E8G A;  3T1Y B;  1B6Q A;  4Z1V A;  3JD0 A;  2X6A A;  4IYH A;  1QU7 A;  2Y69 C;  4YIO A;  5BY1 A;  1U97 A;  4LF6 O;  3E22 B;  1P7G A;  3FD9 A;  4JI2 O;  4DUZ O;  1CP9 A;  1E1R G;  2QSA A;  4UVB A;  4O2B A;  5LGN A;  1YTF B;  2EIJ C;  2PF4 E;  3SYA A;  2BCC H;  2A79 B;  2DOS A;  1PM9 A;  3L9D A;  4OPA A;  4PV1 B;  1SET A;  4K3A A;  1EZJ A;  5FNV A;  3OGC C;  4LNU A;  5LYJ A;  3K9A A;  3L70 H;  4WBN B;  3G71 V;  1JA8 A;  4MVO A;  3CD6 V;  3QO5 A;  4X1I B;  4ZIB A;  3PJS K;  4B3R B;  2ZE7 A;  2XAF A;  3B8N A;  4PI2 A;  3H1L H;  1DTO A;  2EIK C;  4YIP A;  1S5L Z;  2H94 A;  4NYK A;  2R72 A;  4ZOL B;  5JJE B;  3W7U A;  1NBM G;  1SS3 A;  4JPR A;  2E5L B;  2X6C A;  4DRX A;  1BHA A;  3D3I A;  1XMO O;  1HNW B;  4X1Y A;  2AXT Z;  2R70 A;  4PI0 A;  1H8H G;  2FL4 A;  3HKE A; 
#chains in the Genus database with same CATH homology
 1I08 A;  1AP6 A;  1GN4 A;  4JZG A;  3CEI A;  1EN4 A;  4E4E A;  1MA1 A;  3QVN A;  4BR6 A;  1XDC A;  1BS3 A;  1VAR A;  3DC5 A;  3AK1 A;  3MDS A;  1D5N A;  1QNM A;  1BSM A;  1KKC A;  2QKA A;  1EN5 A;  3C3T A;  1ZUQ A;  3EVK A;  1EN6 A;  2CDY A;  1Y67 A;  1IX9 A;  1EM1 A;  3OT7 A;  4C7U A;  1AR5 A;  4YIO A;  1AR4 A;  1XRE A;  1PL4 A;  4JZ2 A;  2RCV A;  3LSU A;  1P7G A;  1WB8 A;  4JYY A;  2CE4 A;  2GDS A;  1ZSP A;  3AK2 A;  1ZTE A;  3TJT A;  2P4K A;  1ZLZ A;  4F6E A;  5A9G A;  1I0H A;  3KKY A;  1AP5 A;  1MSD A;  3KDR A;  4FFK A;  2AW9 A;  5AG2 A;  1IXB A;  1PM9 A;  2ADP A;  3K9S A;  4X9Q A;  1MNG A;  1JA8 A;  3RN4 A;  1N0J A;  1VEW A;  1LUW A;  1JR9 A;  1AVM A;  1B06 A;  1XIL A;  2ADQ B;  4GUN A;  3BFR A;  1WB7 A;  1BT8 A;  1MMM A;  1N0N A;  4YIP A;  1GN6 A;  3C3S A;  1SZX A;  3AK3 A;  1XUQ A;  1GN2 A;  3DC6 A;  1LUV A;  2QKC A;  3IC9 A;  1IDS A;  1GN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...