2QKCA

Structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKLNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Structural and kinetic study of differences between human and Escherichia coli manganese superoxide dismutases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 72
structure length 196
sequence length 196
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2qkcA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2qkcA02
1VARA 1I0HA 1PL4A 1N0NA 3KKYA 1ZLZA 1EN6A 5AG2A 1EN4A 1MNGA 1BT8A 1XREA 3C3TA 2CDYA 3TJTA 1XDCA 2QKCA 3OT7A 1MMMA 1PM9A 1BSMA 1IX9A 1LUVA 3CEIA 1JA8A 1P7GA 3BFRA 3AK3A 3QVNA 1WB8A 1ZTEA 3LSUA 3DC5A 1AR4A 1ZUQA 3AK1A 1B06A 1BS3A 1XUQA 4JZGA 5A9GA 1LUWA 4JZ2A 3IC9A 1MA1A 1JR9A 1EM1A 3EVKA 2ADQB 1WB7A 4X9QA 1AP5A 3K9SA 1D5NA 2ADPA 1AR5A 3AK2A 4YIPA 4C7UA 4F6EA 3C3SA 4JYYA 2RCVA 3DC6A 2AW9A 1GN2A 1EN5A 1AP6A 3MDSA 1GN6A 1SZXA 1GN3A 4GUNA 4YIOA 3RN4A 4BR6A 1VEWA 1GN4A 1IXBA 1XILA 2QKAA 1ZSPA 2GDSA 1QNMA 4FFKA 2CE4A 1I08A 1MSDA 1N0JA 2P4KA 1KKCA 1IDSA 1AVMA 1Y67A 4E4EA
chains in the Genus database with same CATH superfamily
1H2GA 3CP1A 4X66O 1PL4A 1N0NA 3E2EA 4PA4A 5B66Z 4RQEA 5KLVH 2BSKA 3A0HZ 1M93A 4H44B 3C3TA 4KHPO 4DV1B 5J2UA 2Q68A 4B3MB 4FLVA 3CPWU 3EHBB 1HNXB 1IX9A 1SC5B 1H2SB 1K5SA 1NU1H 5IJ0A 1P49A 1YITV 3CC2V 1YIJV 3JAWA 2XTAA 3N27A 2QDOA 2PI5A 1HW7A 3IFXA 4JTDB 4J7JA 1UJWB 4L87A 1N34O 1YZBA 2DW4A 3E22A 1RP3B 3ZEDA 4R50A 2LFRA 4CH5A 3TXQA 1AJQA 3U0ZA 1FAFA 2ZNIA 2EBOA 5A9GA 1LUWA 4TUYA 3K59A 1ENVA 2L35A 3CRQA 5L3FA 1BL8A 2V1DA 4GKKO 4U7OA 5IYCO 1Y76A 5B1NA 3C3SA 4JGSA 4ZHQA 3RYFB 5CA1A 1GM9A 1NT2B 1GRJA 1MZEA 4LF9B 2P06A 4JI6B 3VOUA 3UO3A 1S72V 4JAAA 1IBKO 5EC1C 3SPIA 1N32B 5JH7B 3BPZA 4LF7O 3RN4A 2D2CB 1VQLV 1M9NA 4LF8B 3OMNB 1GN4A 2AZ0A 2RMKB 2B1GA 3SR2C 3H01A 5B1AB 2X0LA 2EIJB 2W0XA 4MTGA 1N33B 3J7AU 1N0JA 3OEEG 4B3TB 1IURA 1K97A 1NTKH 1TAEA 4LR3A 4FLWA 5L3CA 1PNKA 3H1JH 3QG5A 2ITDC 4ZOLB 1HNZB 2CTPA 4U7NA 3L71H 1OCCB 2DN9A 2ODMA 2LJ2A 5IDJA 4NKGB 1DTOA 1YVWA 2GSMB 4TOIA 2FB5A 3OT7A 2CTQA 5H2FZ 2IW5A 1R6TA 4D7SA 4LCUC 2KB1A 3AK3A 4YJ3B 3RBZA 3TK1A 4DV2O 3B40A 4JTCB 1OJHA 3L73H 1ZTEA 1SF9A 4MTXA 4O4IB 3QO7A 5CN0A 1K33A 3SPGA 1L0NH 5IE9A 2GUZB 3FB8C 5C93A 5B1AC 2P5OA 2P7TC 3ZMZA 1P84F 1PNMA 2DJVA 4QGPA 4W4LA 2PF4E 5CMUA 4PI0A 2CH7B 1SA0B 4X20A 2HVKC 3OUSA 3T2MA 1WAZA 3K57A 2H8PC 1OCCC 4OPHA 5LMUO 1BGYH 3B4SA 3LSQA 5ITZB 5CBHA 2FTKA 4RUEA 4ZBMA 4BAYA 2BTOA 2ZNJA 3ETEA 1BCCH 2XAFA 5J2TA 2PGGA 4ZKIA 2ATKC 1XI1A 3H1LH 1VMGA 1H2MA 4LFCB 1IXBA 2EILB 4MVOA 2BSKB 2IH1C 4JF3A 1HR0B 1OCOB 3RYHA 3STLC 2JGDA 3UO2A 4KFMA 2WWWA 3AG7A 4YHHO 5J2UB 3RVZA 4DK1A 5GONA 3SPHA 1SS3A 2QE7G 1H2NA 4I7ZB 1MNGA 2DYRB 4CH6A 2JVDA 2Q9LA 1P7BA 3X2QB 1XDCA 4LF4O 3JSLA 2JGUA 4UVCA 4DR4B 1BZKA 4KUMA 3OE7G 5KHIA 3E22B 3WG7B 2FMLA 3N2GA 3JD1A 5IJ9A 2UUAO 1OHHG 3CC4V 3UKMA 3HB3B 4TT3G 2A7WA 1VQ7V 3M8AA 2HFEC 2OT5A 3LSUA 4RUFA 4EB6A 2H94A 4W4KA 5IY5B 3ETGA 2F4VB 2N05A 2O57A 1BS3A 2EZOA 4CS3A 3CCMV 4LC1A 1VQ5V 1K3EA 3ZX6A 3H1HH 4ZHQB 2EILC 1N4CA 1EFRG 1FD9A 2ZIMA 2FYUH 1CP9A 1OCOC 3WB2A 3RVYA 1H8HG 1XOUA 1AR5A 1VF7A 3R66A 2JEXA 2F66C 4JTAB 3O9OA 3JALA 2Y0PA 2AW9A 1Q6HA 4JAVA 2Q73A 2NNUA 1I5XA 3X2QC 3ABTA 1TGOA 2KG7A 2E5LO 2OTJV 1SZXA 1PL0A 1K34A 4X88A 4GUNA 3WG7C 3LSSA 2OIGA 2UUBB 2VQFO 3PJSK 3T1HO 1S77D 2Q5ZA 4X1YA 1NS1A 1GAXA 2P22C 1QNMA 1I08A 3ZRWA 1A32A 4JI7O 2KSDA 4DR2B 1V55B 4E4EA 1U97A 5KHHA 5IY5C 5L3BA 2YI8A 4Q6GA 1I0HA 1P4RA 4Q20A 1N36O 5DN6G 4NB5A 3IC7A 2ZDIA 1YTFD 3U10A 1XMQO 4Z1VA 5JWPA 4I9WA 3A2FA 1H5WA 2LGWA 4JASA 3KG2A 1R73A 2QTSA 1FYJA 2DOSA 2ZM6B 2IH3C 3QVNA 4X1IA 1GMGA 1VQMV 2K9PA 5IWAO 4GKJO 2BE3A 3W7XA 1IXMA 4QE7A 4RQFA 1YCIA 3TCUA 2CAZC 4DR5B 2UXCO 2HKOA 3U11A 2YXLA 3HKDB 5KUKA 1NZ6A 4X20B 3OUFA 4UVAA 2VRZA 4X64O 1EM1A 4JI2B 3EVKA 2OWOA 4P30A 3ZHRA 2BOBC 3ZCCA 2NR5A 4PELA 3K5MA 3VBBA 1V55C 4PA9A 3G67A 3ZMSA 4HZ3A 3HKCA 3K03A 4I55B 2HHHO 4UUJC 4JYYA 3FAVA 4UV8A 2X6AA 1L8DA 3OM3B 2YIBD 5J2TB 1BHBA 2WLJA 4NTXA 4JV5O 2GTAA 4JI1B 4L8JA 3SJBC 5EBWC 3L75H 2IJJA 3RYHB 5DEDA 3ETQA 2UXBO 2JGDB 4J7KA 5LGNA 1CPYA 2ZR2A 1FOUA 4EEQA 4DV6O 2PI4A 1AILA 2UXCB 1DLBA 4WFEA 4JYAO 4CC5A 2B1IA 1WP7A 5EBLC 5LOVB 3ASOB 4DV7O 4DV4B 4EFBA 5E1AC 5KAFZ 4CC6A 4JAUA 1COWG 3ZHVA 2PZSA 3D3QA 4DR7O 5LHIA 3GB7C 1H2KA 3CRRA 5IJ9B 3WU2Z 2H3OA 3OMIB 5KUMA 2X7RB 4DUYB 4JV5B 3ZHQA 4FJCC 4EB6B 2PUSA 5H9CA 4PA6A 4JI3B 1W0KG 4X1KA 1FXHA 3RYIA 2Q8VA 5TISZ 1R6KA 3ZHSA 2UXDB 1M56B 4GYCB 2F23A 1AB3A 1KMIZ 2F1MA 1Y6XA 2RQ6A 3AK1A 4H33A 3FB7C 1QCEA 1J5EB 4X62O 3T4DA 3DGEA 3JALB 3ASOC 3UM7A 3B8NA 2ZE7A 1LR1A 2KG7B 3A8TA 4QNHB 2GBOA 5K1PA 3J80N 4PA7A 5LL6Y 4FPPA 5IYZA 1GH6A 2YXHA 1Q7YW 5D5QA 5EK0A 3MDSA 4F6RA 3ZRWB 1OCZC 3FB6C 4DYLA 1VQ9V 2DE0X 5BXZA 4OXSA 4UB8Z 1H38A 4IHJA 4CH3A 3T1YB 2PYJA 1M56C 1Q90D 4DV1O 1NBMG 5IYDO 4B3MO 1JMKC 1B6QA 1JNBA 1HNXO 1Y74A 2ZKOA 1Q6UA 3JASA 4PDLA 3HR0A 1PP9H 2IJIA 4X1IB 5B3SB 2XNDG 1YTFB 3B2EE 4LFBB 4FLUA 1BSMA 1L1FA 2QGNA 3G6EV 2EX3A 3CCLV 5JCOA 4B7KA 2UU9B 1AR4A 3EXAA 3HKCB 4FLYA 5GW7A 3ASNC 3S3WA 5LGUA 3FAVB 1NTZH 3K3WA 3ML0A 2WLKA 3EFFK 1BHAA 4LF9O 1I5YA 2Y4TA 1FFXB 2ZDIC 4JI6O 1WB7A 3K06A 1FFTB 3OW2U 4YXWG 1KU9A 4C7UA 1JX9A 2RN9A 2GV9A 1N32O 3VQXA 3E8HA 2QWNB 3F7YC 2EINB 3APQA 3DC6A 4LF8O 3ABLB 3AG3B 3UT5A 3J81N 1HNWB 1K5QA 5B3SC 5KX5A 1N33O 1U96A 5CB4A 4B3TO 4X89A 4FLXA 4PA3A 4MVQA 5BZBA 4H37A 4OGQB 1HNZO 1KP2A 5LHGA 2IU0A 1XILA 2Y4UA 1SETA 3Q4HA 2JDIG 1FXVA 3FD9A 4PI2A 2VS0A 1Y67A 4NXMB 5LA6A 2BTQA 1NQTA 5H5NA 2IJHA 3E8FA 2YXYA 1EN4A 3G71V 3OEHG 1FJGB 1WJZA 4MVMA 4K8ZA 1BT8A 1ORQC 4X1KB 3RYIB 2D3OW 1DGSA 1O9HA 4HBNA 3I56V 3T4ZA 4J41A 1YHQV 3DSQA 3F5WC 3K0DA 1CXZB 1K7DA 1R6NA 3G6BA 2EINC 3ABLC 4GX1A 3JD0A 4NR1A 3FX7A 4NYKA 3AG3C 4UVBA 2A06H 2WLHA 2LP7A 2ETNA 2AXTZ 4LNUB 2LQTA 5KHGA 4QPJA 2KQXA 2YIAA 3JARA 4LP8A 1YSCA 3SDLA 3E89A 3SYPA 2CTWA 1XQ8A 3ABMB 3CD6V 1GTOA 1XUQA 2XOKG 3OGCC 2X6CA 5IYZB 5J9PC 3K5NA 1IZ3A 5KA6A 3O65A 2ZE5A 1XNRB 4XDKA 5FNVB 3CCRV 4F6RB 3RT3C 1BQ0A 4LFCO 4LH6A 5LMNB 4J9ZB 1L0LH 4UCUA 1R3JC 5EIBC 1HR0O 4IHJB 1QQCA 2EIJC 3JD4A 1ZWIC 2ARHA 2ILMA 3FYIB 3OMAB 4B3SB 3HKBA 1O9GA 3JASB 5C8YA 2VQEB 4PJ0Z 1FKAO 1WA8A 4IIJA 4DR4O 1YEWA 3ABMC 3OAAG 4JPRA 1TUBA 3CCQV 1SQGA 1ZLZA 4BIZA 4UCTA 4NTYA 1D5AA 2HLDG 2CTRA 3MAQA 5E79Z 2YICA 2KKWA 1F7YA 4JI0B 5H6QA 3RWRD 2HR3A 4LH7A 4UB6Z 4N21A 2HJFC 4UCVA 4DR6B 4XDLA 2E76B 2F4VO 2RDCA 1M1KW 5IYBO 4PV1B 2HP8A 4LFAB 1P7GA 3JAMN 1RM1B 1KECA 4ABMA 3OGIB 2P67A 1EZJA 3TGUH 1G8MA 5IJ0B 2XT9A 3ZMUA 4TV9A 3QF7A 3JAWB 3SYOA 5LXTA 1QR9A 2W0FC 2EIKB 4DR3B 3G80A 4JZ2A 1K73W 2EJ7A 1UPGA 3UT5B 3KZIZ 1W59A 4TUYB 5KX5B 1PV0A 5CB4B 1K4CC 4P9OA 2UUBO 3P30A 1E1RG 3PN1A 2OYQA 1WNSA 1Y76B 4MVSA 4U3JA 4MT8A 2QWOB 5CA1B 4PDVA 3F5TA 4TQFA 4DR2O 5JCOC 1JPXA 1IBLB 3Q4HB 4DW1A 1WP8A 3ZS8C 1SZTA 4YIOA 1JVMA 5LA6B 2BTQB 3K58A 4BR6A 2AGAA 1KD1W 1QU7A 1RM1C 4WF9V 5EYPA 2QKAA 1AI5A 2DYRC 4FFKA 4P2ZA 2YDEA 1KKCA 1E1QG 4LF5B 3BRCA 2A3QA 1K92A 3W7TA 1ZX3A 1XNQB 2EIKC 2JJ1G 2AZ2A 5BMVA 1D2DA 5AG2A 1J95A 2ZM6O 5LHHA 1NJIW 3JD2A 4TSFG 3ZHTA 3K5OA 4J10A 1SQQH 1CEZA 4UCSA 3LNNA 1VQPV 4DR5O 1JJOA 4RO2A 1LUVA 3CB2A 3BFRA 4JI2O 1URFA 2YUAA 2UXXA 4X8AA 2Z5UA 3RFRA 2WLLA 1DK1A 4DV3B 4O4JA 3WB1A 5LP6A 1XMOB 1S5LZ 2UUCB 4K35A 3CSXA 1HP8A 3CJHA 3HKEA 1KC8W 4RAIA 2E75B 5KMGA 4JI1O 3RW0A 1AR1B 4R6ZA 1Q43A 4X9QA 4DRXA 3CMEV 4JI4B 2ITCC 4I4TA 2IBZH 4DW0A 2GHYA 2CGNA 2R9AA 4FFBA 5D5PA 3RYCA 1I94B 2ZXWB 2P4VA 3VQWA 4ZIBA 4LBEC 5C8YB 4DV4O 4HAMA 3LNMB 4U3FH 3L70H 1GM8A 1NVPD 4I5SA 1WA8B 4IIJB 3GWKC 4WFFA 2HJDA 2LGQA 2ZR3A 4EFEA 1TUBB 4AQYB 4AI8A 1SQPH 3GVMA 5FPRA 4KXRA 3FFQA 2R9IA 4DUYO 3CCEV 1OV9A 4NTWA 2OCCB 4CH4A 4GX2A 3ZRVA 2Y69B 5B1BB 2Q69A 4MW8A 4JI3O 3P32A 4O2BA 5HFLA 5GONB 2UXDO 4Z2WA 2QKCA 4WFHA 1VQ4V 4MTFA 3BY6A 2XASA 5BR8B 1N8RW 4JYBA 3K08A 2Q4PA 3JD3A 4TV9B 4FZ1A 3ZJZA 3JAKA 1J5EO 5LXTB 1VQKV 3JYCA 2QR4A 2Q0AA 2ZXWC 1NR1A 2P6JA 4NXNB 2LW7A 5JQGA 5IT9N 3N2GB 1Q3EA 5EIBD 4PD4F 2A79B 3D3IA 3K79A 5CBFA 4O4LA 2B9ZA 2FL4A 1B06A 2AHZA 1GO3F 4WFBV 1JR9A 5CA0A 1TVKA 1ROPA 1RSOA 3IGAC 1JJ2U 3DTUB 4LF6B 1NI8A 5JJJB 4YJ2A 4U3JB 2OCCC 1HDJA 2P90A 4YIPA 2CGOA 2YIDA 5B1BC 4IYIA 1M5IA 1Q5OA 4DUZB 5JH7A 3T1YO 2ZQMA 3CE2A 5EYPB 4FK5C 1IVSA 4AHCA 1AI6A 4UXNA 4ASUG 2IM9A 5LYJA 3CMAV 2OCHA 5DM6V 2BOCC 1K8AW 3FB5C 5BMVB 1F51A 4JI8B 1TA8A 4GCZA 3T1CA 4KP4A 5KA5A 4X1YB 5L3EA 3AG2B 4LFBO 3S3XA 3SYQA 1R3LC 4YY3B 2LFSA 1RPOA 4ZI7A 3CHXA 1SESA 4BIOA 4DV5B 4FM1A 1JOYA 2R72A 4K0KB 2YSUB 2UU9O 2WLLB 4O4JB 2HG5C 4CS4A 5LP6B 4DR1B 2XAQA 1WPBA 4O4IA 4HNAA 1ZAUA 3CJHB 1VQ8V 1HWYA 3HKEB 1MG1A 4IGGA 3LUTB 2QA4V 2IU3A 4DXWA 1QBZA 4DRXB 1ZUQA 3QTCA 5CA3A 1B3QA 4H0LB 4I4TB 4X65B 2W6IG 2EULA 4MVUA 2PY5A 2CH7A 4FFBB 4G27B 3RYCB 1HNWO 3ZIAG 5L3GA 1H2LA 3MD0A 5FPOA 3JSNA 5FL7G 1YJWV 1BQZA 1D5NA 4K3AA 1QVFU 3CX5F 4G28B 1QLEB 1MSWD 4D7TA 3OTOB 4B3RB 2F93B 1SQVH 5FLXN 3P3NA 2UXNA 3A0BZ 2QWQB 1QR8A 1BMFG 3MHSC 1GN6A 3H1IH 4H13B 4DV0B 2PTMA 2QJ1A 2F43G 1GN3A 4NXMO 3SYAA 2Q7EA 2HVJC 3JATA 5LP6C 1IJGA 5EBMC 5K1XA 3W7UA 4J7ZA 5CBGA 3ZBHA 3KDRA 1S5JA 1V54B 1FJGO 1R1BA 1NVPB 1K4DC 5GTHZ 4CBCA 1OCRB 2BCCH 2CK3G 4O2BB 3CRAA 2CE4A 1T5EA 4I50A 4OX9B 3KKYA 3B09A 3BVOA 3FYEB 3B77A 3SPCA 3JAKB 4DO2A 4LWSA 1XREA 3BAAA 2CDYA 3AEIA 4JI5B 5GTIZ 3TJTA 5JQGB 1QLEC 1Y4MA 2NLJC 4FIPC 4KL1A 4X66B 2R70A 1KBHA 3BABA 1Q6IA 4O4LB 1YDXA 1XL4A 3QO8A 3DXRA 1Z5VA 1TUEB 3CEIA 1JA8A 1S0VA 3AG1B 3M7MX 4EKWA 3UQ8A 2Y0IA 5CA0B 1TVKB 4KHPB 2JIZG 1RSOB 1XNRO 4YJ2B 1WN7A 4R7CA 3ETDA 4MVZA 1WLEA 1V54C 4Z1MG 4JZGA 2M7WA 3IC9A 1OCRC 1DF5A 5H6RA 5LMNO 2XAHA 2DWDC 3G4SV 1Q81W 3L9DA 1M57B 1R3IC 4GX5A 2ZCEA 1N34B 2ADPA 3CWBH 4TWKA 1VF6A 1FS0G 1X59A 1YJNV 3LDEA 4TQDA 2Q6AA 4O4HA 5LYJB 4DK0A 3MHHC 3E8BA 4B3SO 4MVRA 1I7FA 1NH2B 1G4YB 2VQEO 4GKKB 1QLNA 3D36A 2RJZA 3F7VC 2W6JG 5JJNB 1SKVA 3AG1C 1XHZA 4JI0O 1AI4A 3AG4B 2GDSA 1MOFA 4JYCA 1MSDA 4ZI7B 2C2AA 4IL6Z 1IBKB 4DR6O 1YJ9V 2WA4A 3CXCU 4UFZA 2V4DA 2F95B 4LF7B 2OIEA 2Q0OC 4IYHA 3ABKB 4LFAO 1Z2GA 1OZ0A 3D8CA 3KCYA 4HNAB 4WFGA 1M57C 1Y74B 3M99B 3SYCA 4WCEV 4R8CA 1PM9A 4DR3O 2YEVA 2OTLV 4WBNA 1B04A 1S76D 4GT1A 3HKDA 2VWJA 1VQOV 2DQ3A 2Z0AA 4XBFA 2WAMA 1S5HC 2XAGA 4OPAA 5JVDA 1SQFA 2N74A 2QKSA 1R3KC 4I55A 1MA1A 3AG4C 1F4NA 5L3DA 1E79G 2ADQB 2ZIOA 4AILC 2FKXA 2NN4A 4DV2B 1IBLO 2A9HA 3AK2A 3ZRXA 4F6EA 1NTMH 3H9VA 2RCVA 3ABKC 3JATB 1PKXA 4MSWC 1EBOA 1AJNA 1M4UA 2LW1A 3I55V 5EZYA 1FXKA 4MS2A 5LBQA 4LF5O 2E3CA 2HEPA 1JFFA 2JS3A 4I50B 4I0XA 5B1OA 4D6TH 1GK9A 2RNBA 3CS5A 1XNQO 5LOVA 1VEWA 2X6BA 5LMUB 1FPOA 3B8MA 4FVMA 1ZSPA 4TV8A 4MW3A 5A2QN 4LWSB 2ZE8A 3BA8A 1IDSA 1AROP 4UV9A 3W7WA 1YF2A 3R65A 4B08A 1GKFA 1KB9F 2V7QG 1SRYA 2L6LA 2DMXA 3DXRB 2JJ2G 1SERA 4UCRA 5KAIZ 3VQYA 4DV3O 4YHHB 2QEXV 2Q7GA 1XMOO 2ZE6A 3W7SA 1BE3H 2N04A 2UUCO 1H8EG 2CUGA 1VIBA 4WFAV 2EZPA 4QPKA 4UCOA 5HFMA 1IBMO 4LF4B 1S3JA 1G6UA 2JEUA 4JI4O 1EZVH 1PNLA 1K9MW 3CCSV 3JARB 2UUAB 3LDDA 3IAYA 4O4HB 1I94O 3CC7V 3N2KA 4PDMA 1ZL8A 4E2LA 3K9AA 1AP5A 3RGBA 3E86A 4CS2A 1F4MA 2WA3A 3STZC 3ZN0A 3THOA 2PYLA 1X4TA 1US6A 2YC0A 1W2BU 3L74H 1GN2A 3ABUA 4K8XA 4AQYO 2QWRB 5EC2C 4QJFB 3K5LA 1AP6A 2WLMA 4J9YB 2R9RB 1PPJH 3JCUZ 3WB0A 3OR6C 3SPJA 3FKSG 1IBMB 3C90A 2WLIA 3OR7C 2VWKA 4BW5A 1UFIA 2QTOA 2WLNA 2E5LB 2DYSB 2Q67A 3E8GA 3CRCA 1KUQA 3TETA 1QHTA 1VARA 2AHYA 3ZMVA 3HKBB 2G38A 1VF6C 5BR8O 4FM2A 2GTSA 4O2AA 2DQ0A 2VQFB 1EN6A 3T1HB 2WPDG 2Y48A 1JQ0A 2YEVB 3GWOA 4BIUA 1KYOF 4NXNO 4WBNB 4JI7B 3CXHF 1M90W 2A0LA 3ZRSA 3BCCH 5KHJA 3D36C 4B7EA 3E35A 5JVDB 1N36B 1LNQA 2ZT9B 2JRIA 4FLTA 1KKDA 1YXBA 3VQVA 4MTOA 1XMQB 3CCUV 4LF6O 2Q7HA 2QM4A 3NXSA 4QIWF 1WB8A 2EJRA 2B5UA 1RPRA 3K04A 3APOA 2QM7A 4FMTA 1JCHA 1FFXA 3ZN1A 4G2KA 3JCZA 1SQBH 1V9PA 2QWPB 3SJQC 4DUZO 2WSSG 4I9QA 2DYSC 5IWAB 4GKJB 5EZYB 2MW2B 3SJAC 2XAJA 1FXKB 1WPXA 1GM7A 3P3PA 3BA9A 3H1KH 4BW9A 2M6YA 3OTFA 1JFFB 2YIBA 4I0XB 2XUMA 2QSAA 4X64B 3NR7A 5BY1A 1EN5A 4FZ0A 4IT5A 3BEHA 1MZFA 4BWAA 1G1XB 4JI8O 4XDJA 1THZA 3ZMTA 1DF4A 1Q8IA 4TV8B 1XEQA 2HHHB 3LDCA 3RYFA 2QM8A 3QO5A 1AJPA 3CCJV 3QNEA 4RWUA 2Y69C 4YY3O 2IJKA 5F2VO 1NH2D 3HPLC 4DV5O 3WFVA 1OCZB 5LGTA 4K0KO 2UXBB 3ZHUA 3SGIA 3UCSC 1YI2V 4DR1O 4DV6B 2MK3A 3BHPA 5JJEB 3CYOA 1KQSU 3ICXA 4JYAB 4N23A 1AI7A 1FXKC 2JK5C 1XBLA 2EIMB 4DV7B 1VQNV 4GZRB 2K1EA 4LNUA 2DWEC 1Q82W 4HYOA 1NR7A 4ZOLA 1QVGU 1MMMA 1PD3A 4DR7B 5DECA 4X65O 2E74B 4GX0A 3SJCC 2ZINA 3N2KB 1ZL8B 3DC5A 3KCXA 3OTOO 1VQ6V 4B3RO 4YJ3A 3A0RA 1VP7A 3E83A 5FNVA 3CRMA 4PHZA 1RFYA 1MABG 4F4LA 4PDRA 1W0JG 2YS8A 2Z3YA 4DV0O 3K9SA 3TXSA 4FLZA 2XHBA 4GLXA 3ASNB 4CZZA 5KMGB 3IJ4A 2GUZA 3K0GA 5B5EZ 4J11A 4FM0A 1KP3A 4X62B 1XHXA 2WLIB 2YI9A 1Z5WA 1Q86W 2EIMC 2ZD9A 1SA0A 1F23A 2JS5A 1XL6A 4OX9O 4P9PA 1Y66A 5KHKA 3AG2C 3I5DA 1SQXH 4J42A 4A5UB 4O2AB 4NVPA 2LO1A 3L72H 5ITZA 1NKDA 3CCVV 4QE9A 1VF5B 3OFNG 2P4KA 4JI5O 1AVMA 4J80A 3OD4A 4ICGA
chains in the Genus database with same CATH topology
1VARA 1I0HA 1PL4A 1N0NA 3KKYA 1ZLZA 1EN6A 5AG2A 1EN4A 1MNGA 1BT8A 1XREA 3C3TA 2CDYA 3TJTA 1XDCA 2QKCA 3OT7A 1MMMA 1PM9A 1BSMA 1IX9A 1LUVA 3CEIA 1JA8A 1P7GA 3BFRA 3AK3A 3QVNA 1WB8A 1ZTEA 3LSUA 3DC5A 1AR4A 1ZUQA 3AK1A 1B06A 1BS3A 1XUQA 4JZGA 5A9GA 1LUWA 4JZ2A 3IC9A 1MA1A 1JR9A 1EM1A 3EVKA 2ADQB 1WB7A 4X9QA 1AP5A 3K9SA 1D5NA 2ADPA 1AR5A 3AK2A 4YIPA 4C7UA 4F6EA 3C3SA 4JYYA 2RCVA 3DC6A 2AW9A 1GN2A 1EN5A 1AP6A 3MDSA 1GN6A 1SZXA 1GN3A 4GUNA 4YIOA 3RN4A 4BR6A 1VEWA 3KDRA 1GN4A 1IXBA 1XILA 2QKAA 1ZSPA 2GDSA 1QNMA 4FFKA 2CE4A 1I08A 1MSDA 1N0JA 2P4KA 1KKCA 1IDSA 1AVMA 1Y67A 4E4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAR A;  1I0H A;  1PL4 A;  1N0N A;  3KKY A;  1ZLZ A;  1EN6 A;  5AG2 A;  1EN4 A;  1MNG A;  1BT8 A;  1XRE A;  3C3T A;  2CDY A;  3TJT A;  1XDC A;  2QKC A;  3OT7 A;  1MMM A;  1PM9 A;  1BSM A;  1IX9 A;  1LUV A;  3CEI A;  1JA8 A;  1P7G A;  3BFR A;  3AK3 A;  3QVN A;  1WB8 A;  1ZTE A;  3LSU A;  3DC5 A;  1AR4 A;  1ZUQ A;  3AK1 A;  1B06 A;  1BS3 A;  1XUQ A;  4JZG A;  5A9G A;  1LUW A;  4JZ2 A;  3IC9 A;  1MA1 A;  1JR9 A;  1EM1 A;  3EVK A;  2ADQ B;  1WB7 A;  4X9Q A;  1AP5 A;  3K9S A;  1D5N A;  2ADP A;  1AR5 A;  3AK2 A;  4YIP A;  4C7U A;  4F6E A;  3C3S A;  4JYY A;  2RCV A;  3DC6 A;  2AW9 A;  1GN2 A;  1EN5 A;  1AP6 A;  3MDS A;  1GN6 A;  1SZX A;  1GN3 A;  4GUN A;  4YIO A;  3RN4 A;  4BR6 A;  1VEW A;  1GN4 A;  1IXB A;  1XIL A;  2QKA A;  1ZSP A;  2GDS A;  1QNM A;  4FFK A;  2CE4 A;  1I08 A;  1MSD A;  1N0J A;  2P4K A;  1KKC A;  1IDS A;  1AVM A;  1Y67 A;  4E4E A; 
#chains in the Genus database with same CATH topology
 1H2G A;  3CP1 A;  4X66 O;  1PL4 A;  1N0N A;  3E2E A;  4PA4 A;  5B66 Z;  4RQE A;  5KLV H;  2BSK A;  3A0H Z;  1M93 A;  4H44 B;  3C3T A;  4KHP O;  4DV1 B;  5J2U A;  2Q68 A;  4B3M B;  4FLV A;  3CPW U;  3EHB B;  1HNX B;  1IX9 A;  1SC5 B;  1H2S B;  1K5S A;  1NU1 H;  5IJ0 A;  1P49 A;  1YIT V;  3CC2 V;  1YIJ V;  3JAW A;  2XTA A;  3N27 A;  2QDO A;  2PI5 A;  1HW7 A;  3IFX A;  4JTD B;  4J7J A;  1UJW B;  4L87 A;  1N34 O;  1YZB A;  2DW4 A;  3E22 A;  1RP3 B;  3ZED A;  4R50 A;  2LFR A;  4CH5 A;  3TXQ A;  1AJQ A;  3U0Z A;  1FAF A;  2ZNI A;  2EBO A;  5A9G A;  1LUW A;  4TUY A;  3K59 A;  1ENV A;  2L35 A;  3CRQ A;  5L3F A;  1BL8 A;  2V1D A;  4GKK O;  4U7O A;  5IYC O;  1Y76 A;  5B1N A;  3C3S A;  4JGS A;  4ZHQ A;  3RYF B;  5CA1 A;  1GM9 A;  1NT2 B;  1GRJ A;  1MZE A;  4LF9 B;  2P06 A;  4JI6 B;  3VOU A;  3UO3 A;  1S72 V;  4JAA A;  1IBK O;  5EC1 C;  3SPI A;  1N32 B;  5JH7 B;  3BPZ A;  4LF7 O;  3RN4 A;  2D2C B;  1VQL V;  1M9N A;  4LF8 B;  3OMN B;  1GN4 A;  2AZ0 A;  2RMK B;  2B1G A;  3SR2 C;  3H01 A;  5B1A B;  2X0L A;  2EIJ B;  2W0X A;  4MTG A;  1N33 B;  3J7A U;  1N0J A;  3OEE G;  4B3T B;  1IUR A;  1K97 A;  1NTK H;  1TAE A;  4LR3 A;  4FLW A;  5L3C A;  1PNK A;  3H1J H;  3QG5 A;  2ITD C;  4ZOL B;  1HNZ B;  2CTP A;  4U7N A;  3L71 H;  1OCC B;  2DN9 A;  2ODM A;  2LJ2 A;  5IDJ A;  4NKG B;  1DTO A;  1YVW A;  2GSM B;  4TOI A;  2FB5 A;  3OT7 A;  2CTQ A;  5H2F Z;  2IW5 A;  1R6T A;  4D7S A;  4LCU C;  2KB1 A;  3AK3 A;  4YJ3 B;  3RBZ A;  3TK1 A;  4DV2 O;  3B40 A;  4JTC B;  1OJH A;  3L73 H;  1ZTE A;  1SF9 A;  4MTX A;  4O4I B;  3QO7 A;  5CN0 A;  1K33 A;  3SPG A;  1L0N H;  5IE9 A;  2GUZ B;  3FB8 C;  5C93 A;  5B1A C;  2P5O A;  2P7T C;  3ZMZ A;  1P84 F;  1PNM A;  2DJV A;  4QGP A;  4W4L A;  2PF4 E;  5CMU A;  4PI0 A;  2CH7 B;  1SA0 B;  4X20 A;  2HVK C;  3OUS A;  3T2M A;  1WAZ A;  3K57 A;  2H8P C;  1OCC C;  4OPH A;  5LMU O;  1BGY H;  3B4S A;  3LSQ A;  5ITZ B;  5CBH A;  2FTK A;  4RUE A;  4ZBM A;  4BAY A;  2BTO A;  2ZNJ A;  3ETE A;  1BCC H;  2XAF A;  5J2T A;  2PGG A;  4ZKI A;  2ATK C;  1XI1 A;  3H1L H;  1VMG A;  1H2M A;  4LFC B;  1IXB A;  2EIL B;  4MVO A;  2BSK B;  2IH1 C;  4JF3 A;  1HR0 B;  1OCO B;  3RYH A;  3STL C;  2JGD A;  3UO2 A;  4KFM A;  2WWW A;  3AG7 A;  4YHH O;  5J2U B;  3RVZ A;  4DK1 A;  5GON A;  3SPH A;  1SS3 A;  2QE7 G;  1H2N A;  4I7Z B;  1MNG A;  2DYR B;  4CH6 A;  2JVD A;  2Q9L A;  1P7B A;  3X2Q B;  1XDC A;  4LF4 O;  3JSL A;  2JGU A;  4UVC A;  4DR4 B;  1BZK A;  4KUM A;  3OE7 G;  5KHI A;  3E22 B;  3WG7 B;  2FML A;  3N2G A;  3JD1 A;  5IJ9 A;  2UUA O;  1OHH G;  3CC4 V;  3UKM A;  3HB3 B;  4TT3 G;  2A7W A;  1VQ7 V;  3M8A A;  2HFE C;  2OT5 A;  3LSU A;  4RUF A;  4EB6 A;  2H94 A;  4W4K A;  5IY5 B;  3ETG A;  2F4V B;  2N05 A;  2O57 A;  1BS3 A;  2EZO A;  4CS3 A;  3CCM V;  4LC1 A;  1VQ5 V;  1K3E A;  3ZX6 A;  3H1H H;  4ZHQ B;  2EIL C;  1N4C A;  1EFR G;  1FD9 A;  2ZIM A;  2FYU H;  1CP9 A;  1OCO C;  3WB2 A;  3RVY A;  1H8H G;  1XOU A;  1AR5 A;  1VF7 A;  3R66 A;  2JEX A;  2F66 C;  4JTA B;  3O9O A;  3JAL A;  2Y0P A;  2AW9 A;  1Q6H A;  4JAV A;  2Q73 A;  2NNU A;  1I5X A;  3X2Q C;  3ABT A;  1TGO A;  2KG7 A;  2E5L O;  2OTJ V;  1SZX A;  1PL0 A;  1K34 A;  4X88 A;  4GUN A;  3WG7 C;  3LSS A;  2OIG A;  2UUB B;  2VQF O;  3PJS K;  3T1H O;  1S77 D;  2Q5Z A;  4X1Y A;  1NS1 A;  1GAX A;  2P22 C;  1QNM A;  1I08 A;  3ZRW A;  1A32 A;  4JI7 O;  2KSD A;  4DR2 B;  1V55 B;  4E4E A;  1U97 A;  5KHH A;  5IY5 C;  5L3B A;  2YI8 A;  4Q6G A;  1I0H A;  1P4R A;  4Q20 A;  1N36 O;  5DN6 G;  4NB5 A;  3IC7 A;  2ZDI A;  1YTF D;  3U10 A;  1XMQ O;  4Z1V A;  5JWP A;  4I9W A;  3A2F A;  1H5W A;  2LGW A;  4JAS A;  3KG2 A;  1R73 A;  2QTS A;  1FYJ A;  2DOS A;  2ZM6 B;  2IH3 C;  3QVN A;  4X1I A;  1GMG A;  1VQM V;  2K9P A;  5IWA O;  4GKJ O;  2BE3 A;  3W7X A;  1IXM A;  4QE7 A;  4RQF A;  1YCI A;  3TCU A;  2CAZ C;  4DR5 B;  2UXC O;  2HKO A;  3U11 A;  2YXL A;  3HKD B;  5KUK A;  1NZ6 A;  4X20 B;  3OUF A;  4UVA A;  2VRZ A;  4X64 O;  1EM1 A;  4JI2 B;  3EVK A;  2OWO A;  4P30 A;  3ZHR A;  2BOB C;  3ZCC A;  2NR5 A;  4PEL A;  3K5M A;  3VBB A;  1V55 C;  4PA9 A;  3G67 A;  3ZMS A;  4HZ3 A;  3HKC A;  3K03 A;  4I55 B;  2HHH O;  4UUJ C;  4JYY A;  3FAV A;  4UV8 A;  2X6A A;  1L8D A;  3OM3 B;  2YIB D;  5J2T B;  1BHB A;  2WLJ A;  4NTX A;  4JV5 O;  2GTA A;  4JI1 B;  4L8J A;  3SJB C;  5EBW C;  3L75 H;  2IJJ A;  3RYH B;  5DED A;  3ETQ A;  2UXB O;  2JGD B;  4J7K A;  5LGN A;  1CPY A;  2ZR2 A;  1FOU A;  4EEQ A;  4DV6 O;  2PI4 A;  1AIL A;  2UXC B;  1DLB A;  4WFE A;  4JYA O;  4CC5 A;  2B1I A;  1WP7 A;  5EBL C;  5LOV B;  3ASO B;  4DV7 O;  4DV4 B;  4EFB A;  5E1A C;  5KAF Z;  4CC6 A;  4JAU A;  1COW G;  3ZHV A;  2PZS A;  3D3Q A;  4DR7 O;  5LHI A;  3GB7 C;  1H2K A;  3CRR A;  5IJ9 B;  3WU2 Z;  2H3O A;  3OMI B;  5KUM A;  2X7R B;  4DUY B;  4JV5 B;  3ZHQ A;  4FJC C;  4EB6 B;  2PUS A;  5H9C A;  4PA6 A;  4JI3 B;  1W0K G;  4X1K A;  1FXH A;  3RYI A;  2Q8V A;  5TIS Z;  1R6K A;  3ZHS A;  2UXD B;  1M56 B;  4GYC B;  2F23 A;  1AB3 A;  1KMI Z;  2F1M A;  1Y6X A;  2RQ6 A;  3AK1 A;  4H33 A;  3FB7 C;  1QCE A;  1J5E B;  4X62 O;  3T4D A;  3DGE A;  3JAL B;  3ASO C;  3UM7 A;  3B8N A;  2ZE7 A;  1LR1 A;  2KG7 B;  3A8T A;  4QNH B;  2GBO A;  5K1P A;  3J80 N;  4PA7 A;  5LL6 Y;  4FPP A;  5IYZ A;  1GH6 A;  2YXH A;  1Q7Y W;  5D5Q A;  5EK0 A;  3MDS A;  4F6R A;  3ZRW B;  1OCZ C;  3FB6 C;  4DYL A;  1VQ9 V;  2DE0 X;  5BXZ A;  4OXS A;  4UB8 Z;  1H38 A;  4IHJ A;  4CH3 A;  3T1Y B;  2PYJ A;  1M56 C;  1Q90 D;  4DV1 O;  1NBM G;  5IYD O;  4B3M O;  1JMK C;  1B6Q A;  1JNB A;  1HNX O;  1Y74 A;  2ZKO A;  1Q6U A;  3JAS A;  4PDL A;  3HR0 A;  1PP9 H;  2IJI A;  4X1I B;  5B3S B;  2XND G;  1YTF B;  3B2E E;  4LFB B;  4FLU A;  1BSM A;  1L1F A;  2QGN A;  3G6E V;  2EX3 A;  3CCL V;  5JCO A;  4B7K A;  2UU9 B;  1AR4 A;  3EXA A;  3HKC B;  4FLY A;  5GW7 A;  3ASN C;  3S3W A;  5LGU A;  3FAV B;  1NTZ H;  3K3W A;  3ML0 A;  2WLK A;  3EFF K;  1BHA A;  4LF9 O;  1I5Y A;  2Y4T A;  1FFX B;  2ZDI C;  4JI6 O;  1WB7 A;  3K06 A;  1FFT B;  3OW2 U;  4YXW G;  1KU9 A;  4C7U A;  1JX9 A;  2RN9 A;  2GV9 A;  1N32 O;  3VQX A;  3E8H A;  2QWN B;  3F7Y C;  2EIN B;  3APQ A;  3DC6 A;  4LF8 O;  3ABL B;  3AG3 B;  3UT5 A;  3J81 N;  1HNW B;  1K5Q A;  5B3S C;  5KX5 A;  1N33 O;  1U96 A;  5CB4 A;  4B3T O;  4X89 A;  4FLX A;  4PA3 A;  4MVQ A;  5BZB A;  4H37 A;  4OGQ B;  1HNZ O;  1KP2 A;  5LHG A;  2IU0 A;  1XIL A;  2Y4U A;  1SET A;  3Q4H A;  2JDI G;  1FXV A;  3FD9 A;  4PI2 A;  2VS0 A;  1Y67 A;  4NXM B;  5LA6 A;  2BTQ A;  1NQT A;  5H5N A;  2IJH A;  3E8F A;  2YXY A;  1EN4 A;  3G71 V;  3OEH G;  1FJG B;  1WJZ A;  4MVM A;  4K8Z A;  1BT8 A;  1ORQ C;  4X1K B;  3RYI B;  2D3O W;  1DGS A;  1O9H A;  4HBN A;  3I56 V;  3T4Z A;  4J41 A;  1YHQ V;  3DSQ A;  3F5W C;  3K0D A;  1CXZ B;  1K7D A;  1R6N A;  3G6B A;  2EIN C;  3ABL C;  4GX1 A;  3JD0 A;  4NR1 A;  3FX7 A;  4NYK A;  3AG3 C;  4UVB A;  2A06 H;  2WLH A;  2LP7 A;  2ETN A;  2AXT Z;  4LNU B;  2LQT A;  5KHG A;  4QPJ A;  2KQX A;  2YIA A;  3JAR A;  4LP8 A;  1YSC A;  3SDL A;  3E89 A;  3SYP A;  2CTW A;  1XQ8 A;  3ABM B;  3CD6 V;  1GTO A;  1XUQ A;  2XOK G;  3OGC C;  2X6C A;  5IYZ B;  5J9P C;  3K5N A;  1IZ3 A;  5KA6 A;  3O65 A;  2ZE5 A;  1XNR B;  4XDK A;  5FNV B;  3CCR V;  4F6R B;  3RT3 C;  1BQ0 A;  4LFC O;  4LH6 A;  5LMN B;  4J9Z B;  1L0L H;  4UCU A;  1R3J C;  5EIB C;  1HR0 O;  4IHJ B;  1QQC A;  2EIJ C;  3JD4 A;  1ZWI C;  2ARH A;  2ILM A;  3FYI B;  3OMA B;  4B3S B;  3HKB A;  1O9G A;  3JAS B;  5C8Y A;  2VQE B;  4PJ0 Z;  1FKA O;  1WA8 A;  4IIJ A;  4DR4 O;  1YEW A;  3ABM C;  3OAA G;  4JPR A;  1TUB A;  3CCQ V;  1SQG A;  1ZLZ A;  4BIZ A;  4UCT A;  4NTY A;  1D5A A;  2HLD G;  2CTR A;  3MAQ A;  5E79 Z;  2YIC A;  2KKW A;  1F7Y A;  4JI0 B;  5H6Q A;  3RWR D;  2HR3 A;  4LH7 A;  4UB6 Z;  4N21 A;  2HJF C;  4UCV A;  4DR6 B;  4XDL A;  2E76 B;  2F4V O;  2RDC A;  1M1K W;  5IYB O;  4PV1 B;  2HP8 A;  4LFA B;  1P7G A;  3JAM N;  1RM1 B;  1KEC A;  4ABM A;  3OGI B;  2P67 A;  1EZJ A;  3TGU H;  1G8M A;  5IJ0 B;  2XT9 A;  3ZMU A;  4TV9 A;  3QF7 A;  3JAW B;  3SYO A;  5LXT A;  1QR9 A;  2W0F C;  2EIK B;  4DR3 B;  3G80 A;  4JZ2 A;  1K73 W;  2EJ7 A;  1UPG A;  3UT5 B;  3KZI Z;  1W59 A;  4TUY B;  5KX5 B;  1PV0 A;  5CB4 B;  1K4C C;  4P9O A;  2UUB O;  3P30 A;  1E1R G;  3PN1 A;  2OYQ A;  1WNS A;  1Y76 B;  4MVS A;  4U3J A;  4MT8 A;  2QWO B;  5CA1 B;  4PDV A;  3F5T A;  4TQF A;  4DR2 O;  5JCO C;  1JPX A;  1IBL B;  3Q4H B;  4DW1 A;  1WP8 A;  3ZS8 C;  1SZT A;  4YIO A;  1JVM A;  5LA6 B;  2BTQ B;  3K58 A;  4BR6 A;  2AGA A;  1KD1 W;  1QU7 A;  1RM1 C;  4WF9 V;  5EYP A;  2QKA A;  1AI5 A;  2DYR C;  4FFK A;  4P2Z A;  2YDE A;  1KKC A;  1E1Q G;  4LF5 B;  3BRC A;  2A3Q A;  1K92 A;  3W7T A;  1ZX3 A;  1XNQ B;  2EIK C;  2JJ1 G;  2AZ2 A;  5BMV A;  1D2D A;  5AG2 A;  1J95 A;  2ZM6 O;  5LHH A;  1NJI W;  3JD2 A;  4TSF G;  3ZHT A;  3K5O A;  4J10 A;  1SQQ H;  1CEZ A;  4UCS A;  3LNN A;  1VQP V;  4DR5 O;  1JJO A;  4RO2 A;  1LUV A;  3CB2 A;  3BFR A;  4JI2 O;  1URF A;  2YUA A;  2UXX A;  4X8A A;  2Z5U A;  3RFR A;  2WLL A;  1DK1 A;  4DV3 B;  4O4J A;  3WB1 A;  5LP6 A;  1XMO B;  1S5L Z;  2UUC B;  4K35 A;  3CSX A;  1HP8 A;  3CJH A;  3HKE A;  1KC8 W;  4RAI A;  2E75 B;  5KMG A;  4JI1 O;  3RW0 A;  1AR1 B;  4R6Z A;  1Q43 A;  4X9Q A;  4DRX A;  3CME V;  4JI4 B;  2ITC C;  4I4T A;  2IBZ H;  4DW0 A;  2GHY A;  2CGN A;  2R9A A;  4FFB A;  5D5P A;  3RYC A;  1I94 B;  2ZXW B;  2P4V A;  3VQW A;  4ZIB A;  4LBE C;  5C8Y B;  4DV4 O;  4HAM A;  3LNM B;  4U3F H;  3L70 H;  1GM8 A;  1NVP D;  4I5S A;  1WA8 B;  4IIJ B;  3GWK C;  4WFF A;  2HJD A;  2LGQ A;  2ZR3 A;  4EFE A;  1TUB B;  4AQY B;  4AI8 A;  1SQP H;  3GVM A;  5FPR A;  4KXR A;  3FFQ A;  2R9I A;  4DUY O;  3CCE V;  1OV9 A;  4NTW A;  2OCC B;  4CH4 A;  4GX2 A;  3ZRV A;  2Y69 B;  5B1B B;  2Q69 A;  4MW8 A;  4JI3 O;  3P32 A;  4O2B A;  5HFL A;  5GON B;  2UXD O;  4Z2W A;  2QKC A;  4WFH A;  1VQ4 V;  4MTF A;  3BY6 A;  2XAS A;  5BR8 B;  1N8R W;  4JYB A;  3K08 A;  2Q4P A;  3JD3 A;  4TV9 B;  4FZ1 A;  3ZJZ A;  3JAK A;  1J5E O;  5LXT B;  1VQK V;  3JYC A;  2QR4 A;  2Q0A A;  2ZXW C;  1NR1 A;  2P6J A;  4NXN B;  2LW7 A;  5JQG A;  5IT9 N;  3N2G B;  1Q3E A;  5EIB D;  4PD4 F;  2A79 B;  3D3I A;  3K79 A;  5CBF A;  4O4L A;  2B9Z A;  2FL4 A;  1B06 A;  2AHZ A;  1GO3 F;  4WFB V;  1JR9 A;  5CA0 A;  1TVK A;  1ROP A;  1RSO A;  3IGA C;  1JJ2 U;  3DTU B;  4LF6 B;  1NI8 A;  5JJJ B;  4YJ2 A;  4U3J B;  2OCC C;  1HDJ A;  2P90 A;  4YIP A;  2CGO A;  2YID A;  5B1B C;  4IYI A;  1M5I A;  1Q5O A;  4DUZ B;  5JH7 A;  3T1Y O;  2ZQM A;  3CE2 A;  5EYP B;  4FK5 C;  1IVS A;  4AHC A;  1AI6 A;  4UXN A;  4ASU G;  2IM9 A;  5LYJ A;  3CMA V;  2OCH A;  5DM6 V;  2BOC C;  1K8A W;  3FB5 C;  5BMV B;  1F51 A;  4JI8 B;  1TA8 A;  4GCZ A;  3T1C A;  4KP4 A;  5KA5 A;  4X1Y B;  5L3E A;  3AG2 B;  4LFB O;  3S3X A;  3SYQ A;  1R3L C;  4YY3 B;  2LFS A;  1RPO A;  4ZI7 A;  3CHX A;  1SES A;  4BIO A;  4DV5 B;  4FM1 A;  1JOY A;  2R72 A;  4K0K B;  2YSU B;  2UU9 O;  2WLL B;  4O4J B;  2HG5 C;  4CS4 A;  5LP6 B;  4DR1 B;  2XAQ A;  1WPB A;  4O4I A;  4HNA A;  1ZAU A;  3CJH B;  1VQ8 V;  1HWY A;  3HKE B;  1MG1 A;  4IGG A;  3LUT B;  2QA4 V;  2IU3 A;  4DXW A;  1QBZ A;  4DRX B;  1ZUQ A;  3QTC A;  5CA3 A;  1B3Q A;  4H0L B;  4I4T B;  4X65 B;  2W6I G;  2EUL A;  4MVU A;  2PY5 A;  2CH7 A;  4FFB B;  4G27 B;  3RYC B;  1HNW O;  3ZIA G;  5L3G A;  1H2L A;  3MD0 A;  5FPO A;  3JSN A;  5FL7 G;  1YJW V;  1BQZ A;  1D5N A;  4K3A A;  1QVF U;  3CX5 F;  4G28 B;  1QLE B;  1MSW D;  4D7T A;  3OTO B;  4B3R B;  2F93 B;  1SQV H;  5FLX N;  3P3N A;  2UXN A;  3A0B Z;  2QWQ B;  1QR8 A;  1BMF G;  3MHS C;  1GN6 A;  3H1I H;  4H13 B;  4DV0 B;  2PTM A;  2QJ1 A;  2F43 G;  1GN3 A;  4NXM O;  3SYA A;  2Q7E A;  2HVJ C;  3JAT A;  5LP6 C;  1IJG A;  5EBM C;  5K1X A;  3W7U A;  4J7Z A;  5CBG A;  3ZBH A;  3KDR A;  1S5J A;  1V54 B;  1FJG O;  1R1B A;  1NVP B;  1K4D C;  5GTH Z;  4CBC A;  1OCR B;  2BCC H;  2CK3 G;  4O2B B;  3CRA A;  2CE4 A;  1T5E A;  4I50 A;  4OX9 B;  3KKY A;  3B09 A;  3BVO A;  3FYE B;  3B77 A;  3SPC A;  3JAK B;  4DO2 A;  4LWS A;  1XRE A;  3BAA A;  2CDY A;  3AEI A;  4JI5 B;  5GTI Z;  3TJT A;  5JQG B;  1QLE C;  1Y4M A;  2NLJ C;  4FIP C;  4KL1 A;  4X66 B;  2R70 A;  1KBH A;  3BAB A;  1Q6I A;  4O4L B;  1YDX A;  1XL4 A;  3QO8 A;  3DXR A;  1Z5V A;  1TUE B;  3CEI A;  1JA8 A;  1S0V A;  3AG1 B;  3M7M X;  4EKW A;  3UQ8 A;  2Y0I A;  5CA0 B;  1TVK B;  4KHP B;  2JIZ G;  1RSO B;  1XNR O;  4YJ2 B;  1WN7 A;  4R7C A;  3ETD A;  4MVZ A;  1WLE A;  1V54 C;  4Z1M G;  4JZG A;  2M7W A;  3IC9 A;  1OCR C;  1DF5 A;  5H6R A;  5LMN O;  2XAH A;  2DWD C;  3G4S V;  1Q81 W;  3L9D A;  1M57 B;  1R3I C;  4GX5 A;  2ZCE A;  1N34 B;  2ADP A;  3CWB H;  4TWK A;  1VF6 A;  1FS0 G;  1X59 A;  1YJN V;  3LDE A;  4TQD A;  2Q6A A;  4O4H A;  5LYJ B;  4DK0 A;  3MHH C;  3E8B A;  4B3S O;  4MVR A;  1I7F A;  1NH2 B;  1G4Y B;  2VQE O;  4GKK B;  1QLN A;  3D36 A;  2RJZ A;  3F7V C;  2W6J G;  5JJN B;  1SKV A;  3AG1 C;  1XHZ A;  4JI0 O;  1AI4 A;  3AG4 B;  2GDS A;  1MOF A;  4JYC A;  1MSD A;  4ZI7 B;  2C2A A;  4IL6 Z;  1IBK B;  4DR6 O;  1YJ9 V;  2WA4 A;  3CXC U;  4UFZ A;  2V4D A;  2F95 B;  4LF7 B;  2OIE A;  2Q0O C;  4IYH A;  3ABK B;  4LFA O;  1Z2G A;  1OZ0 A;  3D8C A;  3KCY A;  4HNA B;  4WFG A;  1M57 C;  1Y74 B;  3M99 B;  3SYC A;  4WCE V;  4R8C A;  1PM9 A;  4DR3 O;  2YEV A;  2OTL V;  4WBN A;  1B04 A;  1S76 D;  4GT1 A;  3HKD A;  2VWJ A;  1VQO V;  2DQ3 A;  2Z0A A;  4XBF A;  2WAM A;  1S5H C;  2XAG A;  4OPA A;  5JVD A;  1SQF A;  2N74 A;  2QKS A;  1R3K C;  4I55 A;  1MA1 A;  3AG4 C;  1F4N A;  5L3D A;  1E79 G;  2ADQ B;  2ZIO A;  4AIL C;  2FKX A;  2NN4 A;  4DV2 B;  1IBL O;  2A9H A;  3AK2 A;  3ZRX A;  4F6E A;  1NTM H;  3H9V A;  2RCV A;  3ABK C;  3JAT B;  1PKX A;  4MSW C;  1EBO A;  1AJN A;  1M4U A;  2LW1 A;  3I55 V;  5EZY A;  1FXK A;  4MS2 A;  5LBQ A;  4LF5 O;  2E3C A;  2HEP A;  1JFF A;  2JS3 A;  4I50 B;  4I0X A;  5B1O A;  4D6T H;  1GK9 A;  2RNB A;  3CS5 A;  1XNQ O;  5LOV A;  1VEW A;  2X6B A;  5LMU B;  1FPO A;  3B8M A;  4FVM A;  1ZSP A;  4TV8 A;  4MW3 A;  5A2Q N;  4LWS B;  2ZE8 A;  3BA8 A;  1IDS A;  1ARO P;  4UV9 A;  3W7W A;  1YF2 A;  3R65 A;  4B08 A;  1GKF A;  1KB9 F;  2V7Q G;  1SRY A;  2L6L A;  2DMX A;  3DXR B;  2JJ2 G;  1SER A;  4UCR A;  5KAI Z;  3VQY A;  4DV3 O;  4YHH B;  2QEX V;  2Q7G A;  1XMO O;  2ZE6 A;  3W7S A;  1BE3 H;  2N04 A;  2UUC O;  1H8E G;  2CUG A;  1VIB A;  4WFA V;  2EZP A;  4QPK A;  4UCO A;  5HFM A;  1IBM O;  4LF4 B;  1S3J A;  1G6U A;  2JEU A;  4JI4 O;  1EZV H;  1PNL A;  1K9M W;  3CCS V;  3JAR B;  2UUA B;  3LDD A;  3IAY A;  4O4H B;  1I94 O;  3CC7 V;  3N2K A;  4PDM A;  1ZL8 A;  4E2L A;  3K9A A;  1AP5 A;  3RGB A;  3E86 A;  4CS2 A;  1F4M A;  2WA3 A;  3STZ C;  3ZN0 A;  3THO A;  2PYL A;  1X4T A;  1US6 A;  2YC0 A;  1W2B U;  3L74 H;  1GN2 A;  3ABU A;  4K8X A;  4AQY O;  2QWR B;  5EC2 C;  4QJF B;  3K5L A;  1AP6 A;  2WLM A;  4J9Y B;  2R9R B;  1PPJ H;  3JCU Z;  3WB0 A;  3OR6 C;  3SPJ A;  3FKS G;  1IBM B;  3C90 A;  2WLI A;  3OR7 C;  2VWK A;  4BW5 A;  1UFI A;  2QTO A;  2WLN A;  2E5L B;  2DYS B;  2Q67 A;  3E8G A;  3CRC A;  1KUQ A;  3TET A;  1QHT A;  1VAR A;  2AHY A;  3ZMV A;  3HKB B;  2G38 A;  1VF6 C;  5BR8 O;  4FM2 A;  2GTS A;  4O2A A;  2DQ0 A;  2VQF B;  1EN6 A;  3T1H B;  2WPD G;  2Y48 A;  1JQ0 A;  2YEV B;  3GWO A;  4BIU A;  1KYO F;  4NXN O;  4WBN B;  4JI7 B;  3CXH F;  1M90 W;  2A0L A;  3ZRS A;  3BCC H;  5KHJ A;  3D36 C;  4B7E A;  3E35 A;  5JVD B;  1N36 B;  1LNQ A;  2ZT9 B;  2JRI A;  4FLT A;  1KKD A;  1YXB A;  3VQV A;  4MTO A;  1XMQ B;  3CCU V;  4LF6 O;  2Q7H A;  2QM4 A;  3NXS A;  4QIW F;  1WB8 A;  2EJR A;  2B5U A;  1RPR A;  3K04 A;  3APO A;  2QM7 A;  4FMT A;  1JCH A;  1FFX A;  3ZN1 A;  4G2K A;  3JCZ A;  1SQB H;  1V9P A;  2QWP B;  3SJQ C;  4DUZ O;  2WSS G;  4I9Q A;  2DYS C;  5IWA B;  4GKJ B;  5EZY B;  2MW2 B;  3SJA C;  2XAJ A;  1FXK B;  1WPX A;  1GM7 A;  3P3P A;  3BA9 A;  3H1K H;  4BW9 A;  2M6Y A;  3OTF A;  1JFF B;  2YIB A;  4I0X B;  2XUM A;  2QSA A;  4X64 B;  3NR7 A;  5BY1 A;  1EN5 A;  4FZ0 A;  4IT5 A;  3BEH A;  1MZF A;  4BWA A;  1G1X B;  4JI8 O;  4XDJ A;  1THZ A;  3ZMT A;  1DF4 A;  1Q8I A;  4TV8 B;  1XEQ A;  2HHH B;  3LDC A;  3RYF A;  2QM8 A;  3QO5 A;  1AJP A;  3CCJ V;  3QNE A;  4RWU A;  2Y69 C;  4YY3 O;  2IJK A;  5F2V O;  1NH2 D;  3HPL C;  4DV5 O;  3WFV A;  1OCZ B;  5LGT A;  4K0K O;  2UXB B;  3ZHU A;  3SGI A;  3UCS C;  1YI2 V;  4DR1 O;  4DV6 B;  2MK3 A;  3BHP A;  5JJE B;  3CYO A;  1KQS U;  3ICX A;  4JYA B;  4N23 A;  1AI7 A;  1FXK C;  2JK5 C;  1XBL A;  2EIM B;  4DV7 B;  1VQN V;  4GZR B;  2K1E A;  4LNU A;  2DWE C;  1Q82 W;  4HYO A;  1NR7 A;  4ZOL A;  1QVG U;  1MMM A;  1PD3 A;  4DR7 B;  5DEC A;  4X65 O;  2E74 B;  4GX0 A;  3SJC C;  2ZIN A;  3N2K B;  1ZL8 B;  3DC5 A;  3KCX A;  3OTO O;  1VQ6 V;  4B3R O;  4YJ3 A;  3A0R A;  1VP7 A;  3E83 A;  5FNV A;  3CRM A;  4PHZ A;  1RFY A;  1MAB G;  4F4L A;  4PDR A;  1W0J G;  2YS8 A;  2Z3Y A;  4DV0 O;  3K9S A;  3TXS A;  4FLZ A;  2XHB A;  4GLX A;  3ASN B;  4CZZ A;  5KMG B;  3IJ4 A;  2GUZ A;  3K0G A;  5B5E Z;  4J11 A;  4FM0 A;  1KP3 A;  4X62 B;  1XHX A;  2WLI B;  2YI9 A;  1Z5W A;  1Q86 W;  2EIM C;  2ZD9 A;  1SA0 A;  1F23 A;  2JS5 A;  1XL6 A;  4OX9 O;  4P9P A;  1Y66 A;  5KHK A;  3AG2 C;  3I5D A;  1SQX H;  4J42 A;  4A5U B;  4O2A B;  4NVP A;  2LO1 A;  3L72 H;  5ITZ A;  1NKD A;  3CCV V;  4QE9 A;  1VF5 B;  3OFN G;  2P4K A;  4JI5 O;  1AVM A;  4J80 A;  3OD4 A;  4ICG A; 
#chains in the Genus database with same CATH homology
 1VAR A;  1I0H A;  1PL4 A;  1N0N A;  3KKY A;  1ZLZ A;  1EN6 A;  5AG2 A;  1EN4 A;  1MNG A;  1BT8 A;  1XRE A;  3C3T A;  2CDY A;  3TJT A;  1XDC A;  2QKC A;  3OT7 A;  1MMM A;  1PM9 A;  1BSM A;  1IX9 A;  1LUV A;  3CEI A;  1JA8 A;  1P7G A;  3BFR A;  3AK3 A;  3QVN A;  1WB8 A;  1ZTE A;  3LSU A;  3DC5 A;  1AR4 A;  1ZUQ A;  3AK1 A;  1B06 A;  1BS3 A;  1XUQ A;  4JZG A;  5A9G A;  1LUW A;  4JZ2 A;  3IC9 A;  1MA1 A;  1JR9 A;  1EM1 A;  3EVK A;  2ADQ B;  1WB7 A;  4X9Q A;  1AP5 A;  3K9S A;  1D5N A;  2ADP A;  1AR5 A;  3AK2 A;  4YIP A;  4C7U A;  4F6E A;  3C3S A;  4JYY A;  2RCV A;  3DC6 A;  2AW9 A;  1GN2 A;  1EN5 A;  1AP6 A;  3MDS A;  1GN6 A;  1SZX A;  1GN3 A;  4GUN A;  4YIO A;  3RN4 A;  4BR6 A;  1VEW A;  3KDR A;  1GN4 A;  1IXB A;  1XIL A;  2QKA A;  1ZSP A;  2GDS A;  1QNM A;  4FFK A;  2CE4 A;  1I08 A;  1MSD A;  1N0J A;  2P4K A;  1KKC A;  1IDS A;  1AVM A;  1Y67 A;  4E4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...