2QKIC

Human c3c in complex with the inhibitor compstatin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
306
structure length
292
Chain Sequence
TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of compstatin in complex with complement component C3c reveals a new mechanism of complement inhibition.
pubmed doi rcsb
molecule tags Immune system/hydrolase inhibitor
molecule keywords Complement C3
total genus 60
structure length 292
sequence length 306
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qkiC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2qkiC01
1XWEA 1BV8A 1BR9A 1GXDC 3OHXC 1BUVT 3CU7A 2ICEC 2PN5A 5FOBB 2WINB 4FXGC 1AYOA 3FRPB 5FO7B 3HS0C 3MA2B 2A73B 1BQQT 4FXKC 5JPMC 5FO8B 4ILWA 2E2DC 3V96A 4LNVA 1PXUA 2J0TD 1UEAB 1JC7A 3T4AC 2I07B 2A74C 1JB3A 2QKIC 1UAPA 2TMPA 2B39A 3G6JB 3I70A 3L3OC 1D2BA 3CKIB 4D94A 3KLSA 5JPNC 1OO9B 5FO9B 3HRZC 2XWJB 2XWBB 2WIIB 1EDYA
chains in the Genus database with same CATH superfamily
3FT9A 5ENWA 2WBKA 4X98A 2V4DA 1CGSL 5EIQA 2E5EA 2X6VA 4YBLC 1HXYD 2ENYA 4PGDA 3WEAA 2PPFA 1IKOP 1KELH 4HJSA 3RWJA 5DWUH 1AQKL 5FLMH 2VDML 5C5MA 2VC2H 4QAMB 5IUCA 3EKCA 5DMKA 5C6PB 4LK1C 2N49A 1AD9A 5ANHA 5TH2B 3HZ3A 3AMKA 3TIDA 3KWTA 1Q81C 2EEDA 1GZQB 4JPIB 1NOFA 2IPUK 4DK0A 3SKJL 4DEPB 3P7JA 3CZLA 1HNXL 4EI5B 5DQ9B 1LM8V 3DARA 4MASA 1I8KA 5E2WH 4F1ZA 1HHHB 2CXGA 5LUMA 1G2SA 2VLJE 4PLOB 4Z7OF 5EKIA 3Q23A 2ESVB 4GT7A 2CIIB 4IU2A 2IH3A 2R2HA 4FQCL 2FR4A 1A3TA 4DP0X 3CNKA 1AOHA 1A7OH 3ATAA 3SDYL 1VGEH 3ESUF 1H3PH 3IT8D 4U6YB 2ADGA 3R2TA 4OUOA 4OXPA 4PY8J 5JYLA 3U7AA 1LNUA 2OXGB 5IEKB 3SO3C 5JOEA 2YUXA 4CL7A 1BCPF 1IZKA 2J8HA 3WLWC 4AE1A 1K8DB 4LIQL 5I8CA 1INQB 3R8BB 2L12A 3QZWA 4B9JA 4R4ND 4WTXA 1GUTA 2HRGA 3OV6A 1FFPA 4QF1B 4Y2DC 1XMEB 4HKXA 2YMOA 4GW1B 3I4MG 1BZDA 3GIVB 4MS8D 4S0HA 1KC8C 3I6GB 5HHPB 1OAJA 3VDBA 4ODGA 2H2PD 5E1IA 4DJMA 4CUCA 2FYYA 1NEZG 5DZOA 4NPSA 3FU9A 3OXRB 3MLWL 5JQIB 5IUSA 3EJTA 4J23A 3HS9A 5C9JA 3HE6C 1BYOA 3QNXB 3DOHA 3HG0A 1O78A 4ZTOH 4NN6C 3AC0A 1LP9A 5CSBA 3VJ6B 4K0OA 5F9WB 3CQQA 2HPTA 4BSVB 4AJ0A 5BXFA 4K5VA 4XCFL 1XVSA 2NMSA 3GHBH 4NWUH 2AUKA 5LXVA 5CN3A 5F96L 2VDPH 1UJTA 3GTMH 4A93G 3K6IA 5DVPA 5F7EL 5L88L 1OCRB 2XZCL 3R0NA 3GXDA 4HUXB 4WO4A 4DVBB 4D0DA 3TOPA 2AERT 3ECBA 3QNZB 2DGYA 1A4KB 4OB5H 4DEWA 2KYIA 4N0FA 1KABA 2BA0A 1T4KA 1LO2H 4JJ5B 1S5DD 4JRFA 5FCUL 4Y2DA 1F2MA 1TPXB 2CBOA 2DBJA 5KN5A 4QRTB 3BO8A 5E99L 1Z9NA 2QQQA 5CR3A 2AJXL 2V9RA 2X53A 4Q0XH 5EPJA 3ECQA 3RIFK 1IJNA 4XMKL 1DJRD 2LV4A 4JCVE 1F2YA 1IFHL 3F05A 5C09D 2O5YL 2XWJB 1CZ8L 4KJQC 4YHLL 1TU2A 1HKLL 4DN4M 1ZLWH 5CWSB 3KXFD 3X13A 1XB3A 4ODXB 4QXTB 1CFVL 5ABDE 4LSDA 3UTSB 4DV7L 3BVXA 2K32A 4QTIH 2JTYA 2IW3A 4BINA 3HG2A 4FCAA 5IWAL 4GKKL 3DPDA 2JA8G 3E5SA 3GZQA 4J28A 1NWPA 5E6IC 1MH5A 2JSOA 3WLWD 2WXPA 4DUZQ 2E27L 1RVFH 1X3FA 2A3TA 4R6UA 3AGVA 1U8PA 5BJTB 2OI9C 5FGRA 3K72A 1YG9A 3VA6A 4EQ3A 3FN3A 5IJDC 4KUCF 2HJFB 4QHNA 2QGDA 1KB9J 4QXWA 3RNKA 5EIIG 2BRQA 3FOLB 2ZCHL 3KFUA 3HC3H 4JGNA 2DQCL 3DX9B 3VFOB 4PJDA 4YHOL 1U92A 1J5HA 5D2LB 3LH9A 3EG9B 3I9GH 3Q5YA 4AG4L 4POYA 3GSVB 1GGCH 5FW6A 3TBWA 3UO1H 2M9VA 3G4SA 3VD1A 2WAQB 2DY2A 2X2IA 4M6NL 4AIZB 4F58H 3TESA 4M4RB 4R4BB 3O2VL 1SNQA 4R9HA 4U6HA 1NBYA 4AGNA 3FC8A 3NIDF 4FQ2H 4WFGD 2FB4H 1C16B 1S7VA 2ZWLT 4LOUD 2Q1EA 4WNSA 1MCOH 1MCOL 3ML9A 4DN4L 1K3BC 1OV8A 5HY9B 2I7SA 3JTSA 2V5RA 3MRNA 3QDJD 4U6XA 1F3JB 1GVIA 2NY6D 2J8UF 2JVUA 4OF8A 4XAWL 5BQ7A 5AALA 4B6ZA 4UYQA 5I5MA 2XQBH 1IGJB 5C3XA 5DEGB 4AG4H 2AMGA 3ATEA 4MD5B 3QNFA 2JN4A 5DGQA 1KGWA 5GGVY 1EY0A 3PRZA 3A5ZB 5MI0B 4X3SA 2DYPD 3CP0A 2X1QA 4FTVB 1HR0L 2R39A 1CN4A 4BFNA 1U58A 1INQA 1QNZL 1ED3B 2CHXA 2AKWB 1TNNA 1X7TA 3PQYE 4YDMA 4APQD 3GO1H 2VL5B 3N85L 5I1LB 1J5OH 3FONB 2YC1A 4O58L 4G57A 3CDGA 4G5AA 1T83A 2CCZA 1ZT4B 2ICWI 3DYMA 4HCRH 4P5KB 2EYPA 4ZNEA 1A47A 2QHLA 4Z95L 4J2QA 1O9ZA 1MVFA 1XZ0A 1ZD6A 1CFNA 4JPVL 4ES8A 3QUKB 3I85A 3NCCB 2DQFA 3PPSA 4JRYE 5MEOB 4GMSH 2V8LA 4UDUC 1I9JH 4PGEB 1EIBA 4F7CB 3EO1A 1F4XH 4R90H 4PVBA 3AG1B 2E6JA 4DPBX 4RWHA 2VISB 1MNNA 2M2DA 2B8FA 1UEYA 2X4RB 3WDNA 1CWVA 5AVVB 4GP5B 1X6LA 4L0YA 3GYRA 4U1NA 3IDNB 5DZVA 1OGPA 1OSPH 5E4AA 1KYUA 5JORB 5KWYC 4MCYA 1I7TA 3B2UD 2EXSA 5E00A 5ESVA 3AXLA 1Q9WA 4JDVB 4Y1TA 3GTGB 1KPRB 3QEGL 3TVMB 2XTJD 1CICB 4BZYA 4BHUA 1M53A 5KGUA 5C0JA 3P9LA 1J8KA 1LO2L 1UB6B 5F1SA 5FCUH 5FM5O 1SDAB 1ZGLA 3T3MF 1E43A 3ARBC 5CUSH 1SJVA 4NJAL 4LKXA 2AITA 3ZE0B 1O75A 3BVGA 5DEJA 1AGFA 3K72B 4KRMB 3CKIB 4S2SA 2E9WA 4W1TA 3UTOA 3P4MB 1VQDA 2VITA 2KI6A 3G08B 3PIQB 1TCRA 4ZFZA 1NPNA 1DUZA 3FBKA 3P30H 4GIOA 5TPWL 5T33L 1LGVA 1ZS8B 1RTOA 1RKNA 1J0IA 7PCYA 3IGAB 4UAHA 4GSQA 3D4CA 4MNHA 2XOTA 3GRGA 1T1ZB 5AW1B 3I3BA 2E2DC 3JWNG 3LPPA 1RD6A 5BN5A 3KYKH 4X9BA 5IB5A 2ITEA 2JQZA 3QNZA 5EN3A 5BRZE 4KZ0A 3VXSE 3QRFM 3T4AB 1IW7C 4FNFA 1AXTL 1IGCL 4ZMPA 2O5ZH 4K23H 3QEQA 2SODB 5DWPA 3H9HB 1T1XB 3BUYA 2XYBA 3O3EB 5IROD 3B7YA 1FI8C 1PS3A 1EL0A 1KGCD 2HKHH 3I75A 4A3KH 3WEXB 4M6OH 2EH8L 3HA0A 5IYBG 2R7ZB 2FO1A 2P46B 3QISA 4WWID 4FNTA 5CORA 3OPOA 3SB3A 1OOAA 2AZUA 1C1EL 3P2DA 4O02B 5CZVH 5BRZD 5GPRA 4G2AA 1JVKA 1YDPA 1AZVA 3UTZB 4JX0A 2E9GA 1HCZA 2B8GA 5A2QE 1S3KL 4NXNL 5HBBA 3D2UA 5IP4A 4LVEA 3M7NA 1B50A 3RPBA 4HG4K 3S16B 3BXNA 3KNBA 1TWCB 1SFOB 4LCUA 3BVUA 3B37A 3K5SA 1RUMH 3SDXE 1RLWA 3QULB 3WKQA 4FQ2L 3FCGA 3LZRA 3DTXA 3D51A 1CQKA 1MCDA 1N8ZB 5FYJD 3SJVD 3S1QB 1RL2A 2VZ3A 5IGCA 5D1XA 3QEQD 1A8ZA 2IO5A 1GGCL 1FV1B 1OE3A 4RMBA 2A6JB 3T1FA 3L7FA 4ZK8A 3SBPA 3TP5A 2D7OA 4JI1Q 3MBEB 2FWOB 4KWUA 4PRHD 5DTFA 1PIFA 3AAZA 3BP6B 3DBXB 4NC1C 2F61A 5FHBL 3M1BB 2VDRH 3EYOB 4H8QA 4OV5B 3RWFA 2Y1AA 1I4XA 3I4OA 4DAYA 1OP3K 3S24A 5A2FA 4OLYL 4KTDH 2AP2A 3FQUA 5GS1A 1SLWA 4JFSA 4D8PB 4J3OD 4HGKC 5ICXB 4ZW3A 4Z8FH 4LHUG 1X5ZA 5CR8A 4JPVH 4ZPTB 5GGRA 1R0AL 1HYRC 3D06A 4JDEA 1KCKA 2WWMD 3WMQA 3BKJL 1CGVA 4WTWA 4BWUA 3HMXH 5I66A 1GJUA 4LFAQ 1U33A 1NC2D 3AU1B 2XWCA 3LIUA 4H88H 3KMDA 3O0LA 3HC2A 3QIUA 2AQPA 5MEQB 3RP1A 2X0UA 1OAQL 4FYRA 3GRWL 4PRPB 1UUPA 5LBSA 1MJCA 5DJ6A 5C0CE 4APQB 4C83B 3UP1A 4JY4B 3TMEA 2UYLB 4I48B 5JHLA 4NUGL 1TZOA 3S4SB 1P9MC 2IH8A 4M7ZB 2ZAHA 3ZE2E 3LQAH 1FJGL 3N52A 4O1NA 3PP3H 4UUJA 2GJPA 4MLIA 2X9XA 3C12A 4BYHA 4OF5A 1T0MB 2NZOA 3CN3A 1MHCA 3ZL4H 2YS4A 3W9DB 4ADGA 3IL8A 2RALA 2VXQA 1D6EC 3QQ4B 4FI8A 4YBQD 5E99H 3TH3T 1DJWA 3PO2G 4B3RQ 3H9SA 3TO2B 3ZVVA 1DOLA 2EYTB 2JK5A 1A22B 4OJAA 4DEUA 4DR1Q 1I8UA 2WXIA 1AGEB 4ECNA 5E1QA 2E7LA 1KB5L 4J4PD 2V2XA 2ZTEA 3MOBL 2ED9A 4UQ2B 2B14A 4M62H 2BCOA 2Z1CA 2NY6C 4Q0FA 1MJJA 3BPOC 3NUCA 3WN5A 5TQ2L 4B3SQ 1K3IA 2FX9H 5EH1A 4XWOD 5HDLA 4NQDB 3TJPA 4AZ8B 2DN7A 5DO8A 4B9CA 4EIZC 1F41A 4O9HH 4G42A 3CVBA 1RFDH 2N78A 2WBXA 2YKLL 2J8OA 4JI8Q 3TPKA 3KLHC 4JJOA 4YCUA 1JWUA 4HJ0D 4R4QA 1WFNA 1Z47A 2QTEA 3GS4A 1OQOA 4TUJB 3ZHLA 1IGYB 1U21A 1U95B 2WO3B 3LOWA 4NJ9H 4XXDA 4ZZFA 1SVCP 4I18B 3D0VA 1BQHG 4UV4H 4YZWA 4LSVH 3MLTA 2HKAA 3ZTNH 1Q1BA 3VXRB 2R92G 1PYWD 1MJJB 1N68A 1TTAA 2VN6A 4F33A 4CKBA 1DBML 4I88A 5T8IA 3CAMA 5JEAG 4DK6C 2BSCA 1XX9C 4NB3A 4ZOAA 3ECUA 3LJ3A 1OAZH 4PRBA 3QI9A 4L5FL 5M5XB 3KPSB 3BWUF 1XPRA 4TNEA 3FCTB 2V9TA 4HHAA 3H9SE 3SGEI 1V7ML 1DBAL 35C8L 2OF1A 2QVMA 1QVFA 3PV6A 2A1WH 3IDYC 3FRPG 3O6FD 2IL8A 2VNUD 3QJXA 4DAYB 5AB2A 2FSEB 25C8H 2EDNA 2FYVA 2IV8A 3RVTC 3TA3C 3QJFA 3CH1B 1LILA 1K83H 2ZYRA 4TVPL 3WHXA 1VQOA 5FF6B 2D0OA 2CLVB 3PYCA 3VRLF 3WXVH 4EI6B 3S35H 2VDKB 1UURA 5IP9H 2EDTA 5C0EA 3UIZA 1R34A 2OQJA 5A2AA 3DETC 3EFOA 4JHWH 5C0AB 4GG6A 4C3JG 4LVNC 3MXUA 1KYOK 1KIRB 4C3HH 2WVTA 1FVIA 5I1EH 4JFDD 3BH4A 2YC1B 5F7NC 1CBVH 1CXHA 3ZSTA 1JE4A 4YAQB 2C3VA 3BQUA 1PD6A 3R06A 5D8JL 3CPFA 4YXKH 5TF0A 4F7PB 3GI9L 2R7FA 2FO4B 4TTGA 1F4AA 2BPBA 4Z7WA 1CKMA 4JKPH 4I13B 4JQIA 4JN1L 4M29A 5A35A 5C0DA 1FG2A 3VD9A 4JCLA 5IGGA 3EJRA 5L9DL 2JB5H 2GJ6E 2QV4A 3BXNB 1UUSA 4NEHB 1R24A 5M5XH 4LF8Q 2F0FA 1E4KA 1E6JL 1W2BA 2NUTB 4K71B 4X5WA 5I66B 1JCKB 3H91A 2VXQH 1A3VA 4K5LA 1DQJB 2OZ4H 1QRNA 1U3HB 4HISA 5AYUL 2OA9A 2EDHA 2JA6B 4K6LA 3EJSA 1AH9A 1H5BC 2JA7G 2B7DT 1D6EA 5FV2A 1CLOL 1IC1A 2NYYC 1RI8A 1TNMA 3ASNB 3BP4B 3BSGA 3CHOA 3DHJA 1KLUA 3MLRH 3SHSA 4IS6B 1YNJD 2MNUA 3CZSA 4NQCA 4Y1AB 5LO7A 4KGLA 1USQA 1E22A 4ZDHB 5I6LA 3FBQA 3DBXA 4OVUA 2DQUH 5B38B 5C44H 5DF0A 5IESH 4L4TE 4ID6A 3M07A 2EC8A 2P45B 4HS8L 1JS4A 4AYSA 3FQ4A 5CEZH 5GHWH 4P46C 3RFZA 3CRLC 1JHKH 4BZ1A 3PIOA 4PB9H 4OIJA 4FEMA 1TVDA 3RN5A 2KLRA 4W9GC 3IDIB 4QHUA 5D7JD 5CZXC 2P49B 3U9SA 5IP7H 4BBRB 3SPVA 3DHQA 2EZ0D 2F8OA 3WD5H 2R69A 1V54B 1DXMA 2CH4W 3OC8A 1F2QA 2FMCA 1F6AA 3T13A 3BCFA 3BUIA 2O6FA 3NSDA 1TT2A 1MCBA 2UV3A 3NP4A 4L3AA 4X8JB 4ZW6A 3VRJA 3TP7A 1UACH 2C3WA 4IKNA 2ZM6Q 1GGIH 2OP4L 2Z31A 3H42L 3E7JA 2IAMB 2PI2E 1UE7A 3GLDA 1X5AA 2PMZA 3IGUA 4KQ4H 4LLYA 3NRPA 5TE7H 3UAFA 4CJ0B 4AMWA 3FKIG 4K3DL 3SKOB 3ISWA 1J9RA 4RRPG 4BE5A 3M1OA 5CSZA 3KDPB 2ID5A 5MERB 2NLJA 1FYTD 3WIIL 3FT2A 2VQ1A 2EIFA 1PGRB 4PJEA 1KFGA 1CGSH 2R61A 2EUZA 4ZW7A 2CGZA 1JN6A 2K33A 3OPUA 3LNGA 1I6VC 2IALA 2BNQD 1XH1A 3EAKA 4W4OA 3L9RB 5I1JL 3UPRA 5LG1A 2Z4QA 3II2A 1EWIA 4XMUA 5AVRB 3CMAA 1GW0A 5AAPA 4QRSA 2R56H 4L4TA 3P1VA 1XD0A 4PW4A 2AMUA 2L11A 5DK3A 4L1LA 4GNXA 2R1WB 2VR9A 1TS5A 5FJ8H 1E6JH 3LVTA 3POHA 2GCYA 4QRTA 4CKVX 6PAZA 1ZKOA 1AHMA 2HTLD 4XQJA 3O2DA 4CSTA 1M71B 3APFA 4GKSB 2CJTA 3OKNA 4RMSA 4JG1L 3GTQH 2K6WA 2PW1A 2ISDA 2CR3A 3CQFA 1TR7A 3OAZH 3V4PA 1OE1A 3C09B 1XH2A 2R23A 3BZCA 3VTAA 2WLIA 1XCWA 3Q8AA 4JQVA 5F8QC 5A2LH 4ZMXA 2G9KA 1NC4A 2K4WA 4OX9Q 3LDBB 3OMIB 2ATPA 1MN4A 3Q5OA 3B6SB 3O4OC 1TTGA 4Y5VB 4XNAA 5I1EL 2OXHB 2CM6A 5IG7A 2PMZE 1OPGH 4P2RA 2OTLA 4P5TA 5GIRA 1SMYC 4J3VA 1HIML 1NAML 1CL7H 1EAPB 1Q1JL 5C07A 4WLCA 2IH1A 1DQJA 4MIUA 4IBZA 4BWWA 3ARWA 1GKHA 3FONA 1H3UA 2ZPKL 3VXQA 1E7UA 4WGKA 1Q9KA 1LP9F 1KPVB 3JZYA 1CTOA 3HG9A 5EUOB 3UAAA 4ZFGH 4IU3B 5FDWB 5T3ZH 2ATKA 1FAIL 2W07B 4WJ5A 2Z92A 4ODTH 4GRMB 3NBHA 1MFDL 1TFPA 2BVPA 4BSJA 3C60D 4K8JA 1TCMA 2FO4A 5DVNA 2CUIA 3JWDH 4EIGB 3SDDB 1HFNA 2O61B 4Y19A 4QOKE 4P23A 1NCBH 5C09B 4NKDA 1VQAA 1V27A 4XGZA 4BFFA 3RURA 4NFDA 4JZJC 4U1GB 3QIAA 3KXFB 4XMZA 1OAZL 3ASOB 3MRKA 5KG9B 1E9PA 1Q12A 2QADB 2ZWKA 1YPZB 5CIPH 2KCNA 4JREB 4RGNA 1QPPA 3HRZB 1LLRD 1GC1C 5CP7B 1ZLSH 5KBDA 2NZ9D 2WXHA 4BRJA 2NR6D 1E0OB 1ASPA 2HVKB 4RISH 4I65A 1KIUB 2VDRB 3AU7A 3V96A 1VGKB 4KJQD 1FDLH 3VO0A 2QZQA 4E41D 5E2UH 3EBHA 1VMCA 1CGWA 1NUGA 2EKSB 4MQXD 2PF6A 2VN4A 4PMBA 2WP8J 3QOJA 1IVLA 4DGYH 1WJ3A 5M3FH 5INDB 4N8PA 3TA3D 2RHQB 2X89D 1LWJA 3SPCA 2FECI 5TQ2H 5D3DA 1KBWA 1OOWA 3WNIA 2F0UA 3QRGH 2YD1A 3F7RA 2C5DC 5IEHB 4A55A 5T3XL 5A16A 1NUCA 1PZDA 1XEUA 4H8VA 2ZUXA 1EEUA 5ESAB 1MSHA 4FFVD 4CN1A 1E4WH 3ERXA 2OPCA 3ATFA 3DHMA 4GZYC 1I8LA 1AC6A 2W0KA 1UFUA 4J12A 4TPRL 2Q76B 4E9TA 3K6SA 4YK4B 1ESRA 5AZEH 1Y18B 5E7NA 1B0IA 1SJHB 2MOVA 4UP9A 2BWIA 4N0RA 4IOIA 2BSRA 1G7QB 4KRPB 1DN0B 4N2IA 2AMCB 1JNHB 5MENB 3MU3A 1CHQD 2NPLX 1YECL 1U41A 2GJ6D 3SDAA 1GHFH 5JPMA 4IBUA 4R5TA 3X3MA 4IYKA 1W0VB 2HFEA 2BSED 4FZ8H 1JBJA 4UF7C 4NMZA 2BH8A 1U36A 5FGSA 2A83B 3CXDL 1NA8A 3DIDA 2H8PA 1S8DB 1CFMA 4KV5E 3UC0H 4J1UB 1E5CA 3QUXB 4Y2OB 3BAEH 3LKSA 1DJYA 3VB9A 5CEXA 4ODVH 2YLKA 5C0IA 1DUYB 2H32H 3D39D 3LKQB 4XP4H 3JYBA 3MBWB 4F57H 4LF6L 1T5WA 2R69H 1YNJC 4WVRA 5B21A 2ZSVB 3TT1H 1HE8A 1RIVL 4LLYB 4Z3TA 1X56A 2RDFA 1NKRA 5D1QB 2X4UB 4ZQKB 5E4IA 2VR4A 2K28A 5AD0A 4PP1C 5IODA 2A6HD 2KHAA 5LWYH 4OT1L 4KTDL 3QQ3B 5FS5A 2RCSH 1B0GB 1QTPA 3SGEH 1QA9A 1L1OC 3QZWB 4PS4L 1G9HA 4Q6IB 3N2JA 2GIMA 2YLHA 2KCTA 4A3DG 3K2KA 4PJ8B 4BZ2L 5E8DH 5L7XH 3GSNL 2Z35B 3HE6A 5FO8A 1JZ2A 1EYAA 4HC1A 3R06B 4DAGH 2F7IA 4O4YL 4YSDA 5KTEL 5KTEH 4UZUA 3WUZA 3I84A 4GRWF 4EDXB 2X4OB 4BBRH 4J8RB 1YNTB 4GQRA 3LB6C 3D7PA 4PV8B 3LSOB 4PRAB 2VO8A 4OFYD 4M6AA 4RMUA 4BSVA 2YMXH 3CZUB 3S2HB 2MPMA 2RCSL 3K6DA 1I82A 3MLSL 4HKZB 4OZGE 4X5LA 3GGWA 1F18A 4XBPB 2IH3B 4OZHF 4ANVA 4ELKB 2KQNA 1VGKA 1YJWA 3LS5L 3EIFA 4DOHE 3LWEA 1DVXA 3BD5A 5IB1B 5KVMC 4Y7NB 3EYOA 4MRCA 4B97A 2VXVH 4O02A 4IMLB 1GD7A 5CU5A 4ZPVB 3A6BL 3G6JB 3MRIA 4OJCA 1HJCA 5KSAD 1U91B 4L4JA 3UJJL 1U2YA 2JA8H 4GUOA 3CVIH 5L37A 1MLBB 4J6RH 3UH8A 2BZ7A 1YN7B 2CKBH 3BGFB 1L6PA 1UZGA 4P04A 3DTXB 3CXDH 5JHDA 2N0MA 1MAJA 1Z5YD 2JJWA 4HBCL 4LESA 1S9WA 2ZAIA 3FHQA 1VFAB 4HOWA 4O2DA 4OJDH 1K9MC 4RZKA 1S3RA 3PE9A 3E1F1 5HHOD 5HJ3A 4YHYB 1KYFA 4IN3A 4WFEE 2FEEI 1VQNA 2OL3A 3CH8A 3BUTA 1X9RA 5CN1A 4OO1H 4NAMA 4DP8X 5D2LE 2CW0C 3QPQD 4ZFOA 3F58H 1ZXKA 2YA0A 4UBDD 3BKYH 5AW4B 2WZPA 2NY4B 1GCFA 1SOSA 1EHLH 1X5XA 3I50L 4JZOA 2F7RA 1QVCA 1JWUB 1BVLB 4QUCA 3HN3A 3RZDH 1EIFA 4KHTH 4GP8B 3WYRA 1EQTA 1ZJBA 4FNQA 5C0BA 2V2TB 1VFOA 3IFDA 3ILQD 1I8AA 2JKRM 3EVQA 3QRGL 5ID0B 3PMFA 1ACXA 3S3DB 3QQ9C 4PTTA 1C12B 1NDMA 5C9KA 4PRNB 4G80A 1OHQA 4LRIC 4XXWA 4WFN3 4LASH 3MJGX 3EROA 3QJQB 3ZL4L 5A2IH 2HT3C 2VWEE 1A6VH 3T4YA 1V55B 2D0FA 3MR9A 2MQGA 1EZ6A 4JFEE 4OGAD 5SWSD 1M6OB 2IBZX 5B8CB 4RGOH 3MREB 3GTPH 3BEVA 1UT2A 2FXQA 4GI6A 5D5MF 1FVCA 3TV3H 1LE5B 3W5NA 3HUJB 2XXMB 4BBSB 2JIXA 4M93B 2XRQD 2VITB 1JVOA 3PIQA 4NKOA 5JEAJ 4OCSL 2IMNA 4Q5VA 3D05A 5T1MB 4B60A 1VCBC 2X2JA 1QWNA 1SEBB 4XNZC 4XPAH 4OJFL 3OKYA 3RAJL 1YEHH 3QXDA 4TUOB 2ZAGA 1U6AH 1N4XH 4HAGA 3HPLA 2DWDA 1T1ZA 4WU5B 4JEGB 3ULVD 3FQ1A 4X2UA 4MS6A 2NR6C 1KF9B 1UXLA 4P2QB 4XNXH 3H2WA 2UUDH 1XGPA 2DDQL 1Y18A 4G8FA 3VFVB 3ZE2B 3K46A 3PUVA 4CC0A 5DMJB 1D5XA 1F97A 3GXNA 2P8PA 2V3DA 2F68X 4OD2B 3R8BA 3BDYH 1T04A 2D7TH 1HNZL 1OF2B 2YQBA 4M6ML 4OF0A 2VXSH 4XTRD 4QRRB 2QGBA 4JBKA 3GMOB 1N32L 3K6NA 2F0TA 4A3MH 3TO4C 1OP5K 2MIZA 2R51A 3OGOE 3VXMB 3ZDXE 4R97B 5DD6B 2ASBA 1HHGA 4U0RB 2MJ8A 5JHLH 2BNRA 3QIBB 4GRWB 4F24A 4Z77B 4LU5L 5T5FL 3RWCA 3BP6A 3QB3A 2JEAI 1ACYH 1LO5D 1RZGB 3MFYA 4YHHQ 3QYNA 2R15A 3HOVG 4G4KA 1YPZF 2QL1A 4E5XB 4G1EB 4YHNA 4HQQH 3UTTD 4QMGA 4NO2A 3HOXB 1Y6KR 5CU9A 3MNWB 4YPJA 3CQZB 1U8QA 3NK4A 3FQNA 1XGQA 3EGSA 3IRZA 4IRSC 4NT6A 4B7IA 1ZT7A 2CFMA 5BV7B 4F88A 1RZIB 3MJ9L 2KEDA 3QIBC 2BDOA 1SSOA 1HEHC 3OQRA 2JELL 3F58L 1BX2A 3A5UA 3RX8A 5GRJH 1MHHB 2G5RA 1K28A 1P4IL 1F90H 2BOBB 5IT9L 4POFA 1O5DT 2FVNA 4IRJB 1FAKT 4LLWB 2IOMA 1DDHA 3RVVC 2Z34A 3FSVA 1Q94A 3NJNA 1I1AB 3ARUA 1UCBH 4ZMWA 4YL9A 1PZSA 4GUPB 4P74A 1EXGA 3CFCL 3LN4A 5EDSA 5JNYA 2XRAL 1KG0A 4YHZH 3VQ1C 3QWOB 3SD2A 2YRZA 4DUXA 2CKBL 5GQBA 2NX5E 1SVBA 2VXVL 2ZCZA 1ICTA 5HGGS 1YRKA 2JKSA 2X41A 4Z0BL 2A5UA 2BHZA 5ELIA 5K9QI 1IGFL 3PF5A 1FNGA 2Y5EA 2DJMA 1RZ7L 3GGWB 5GZNA 4ELKA 3D3RA 3HOUB 1K6QH 1HTYA 3EDKA 3LMJL 1OP4A 1X44A 3MKGA 3A23A 3PFUA 4TSCH 3ULAB 5B3SB 4JRLA 4L8SB 4Q7DA 3D69A 1MW3A 1AAJA 3WEMA 1ND0B 4A2MA 3KDMB 1IAIL 5KVDL 4FLHA 5FYLL 1C8CA 1E65A 1SLXA 3Q1EA 3QFGA 2ARJB 3NTKA 4BFEA 4A38A 2A6KB 4R84A 1SVZA 2V3FA 4N5EC 2V17H 4NKOB 1X9UA 1LD9A 5FPIA 5F44A 3ROOA 1ID2A 1WTXA 2C4XA 3ER0A 1ZWIA 1UB5B 3OJDA 3K0YA 1FIGL 3D48R 4AW7A 3LTVA 3QEGH 5EU3B 3TASA 4EXKA 2A5HA 1LUZA 4TL4A 3TQYA 3CJJA 2WB1G 5BCAA 4UM9B 2C3HA 5IOKA 2QT6A 3NSXA 5EF1A 4HUXA 4H1LA 3N6RA 3NTHA 4LDLB 1FL5B 2AKRB 1N6QL 3EJIA 3LEVH 2A8VA 4HALA 5J8OA 3WN5B 3HOZB 2DJUA 1ZHNA 4LFHG 5B1JC 4G43A 3MNZB 3PWUA 3HTLX 1EYCA 3VMNA 5DDHA 5L2KA 1UB5A 3PS6A 4I0KA 4DH2A 3J7YW 1BVLA 2ZX5A 1J1OH 2LE9A 1Y7VA 1WFIA 1F58H 2F54D 3FUEA 5KJ7E 5FLVA 2XN9B 1T89C 5DJDA 2YFOA 4KDVA 2CRIA 3VI4F 5D7HA 2B0SL 1QR1A 4BCZA 3MUHL 1FNUA 3M17A 1P7HL 1NGZB 2E7DA 2YSTA 5CCHE 2PZTA 3ILPA 4HJ9A 2F7QA 1PJ9A 3CSTA 3WLBA 2FX7L 1CR9L 2G60H 2HT4C 2R4SH 4H8UA 1OAKL 5LMNW 1YEJH 5I24A 4OUUB 5LBSH 4MA7L 4HWBL 1EDQA 1UOLA 2PWGA 4NUMA 3SE3A 2ZXBA 2H1EA 1INEH 4IOAA 2AV1A 3EH5B 3TSSA 4CDGC 1O6VA 2B1HH 5HI5D 4KO7A 5ELFA 4ZYSA 3VCLB 4M1UB 1D9KD 4CMMA 4XT3B 4KHZA 3PHOA 3RA7H 1ICWA 4OH2A 4QRPB 2G5UA 5J39A 4X6DE 3BE1L 3OAUL 4XAKE 3LN5B 2ENBA 4OU3A 1T89A 5F0PB 2GTWB 3LVEA 1KC5L 3VXMD 2W59A 1WUZA 2I32A 1CXFA 2FGWL 4G5ZL 4EQNA 4QTFA 3OKOB 1Z0NA 5FAAA 5T1KA 5HSFA 1GJIA 2FNWA 3U0WL 5SWSA 3E6HB 3TP6A 1CD0A 4LLMA 1NIFA 5CP7A 5KSAA 4CSSA 1EGJL 3FSZA 3AFQA 3B9KC 4HCFA 3HGBA 2JCCA 2KCCA 5CMAA 3V5DB 5JOFB 3PUUA 1JXFA 1PTOB 4U7MA 1HOCA 1NCAH 1PFCA 3BPLB 3MCLH 1KCRH 1ZT1B 3VACA 5M5WH 3LD8B 1A4AA 5I75C 2R27A 1AQKH 4N2HA 2VO5A 1ZJAA 5DZLA 1AY1L 5ITBH 2ESVD 4K3EH 4RGMB 2P5WE 5IVXF 3W39A 5AOLA 1SY6L 1IB5A 2X6CA 3RWCB 4P5MB 4WU7B 2BDNH 1O7ZA 2HRLA 2XQYA 2XVKA 1MI5A 3P2TA 4HFWA 2ATPB 4I0PB 4PJHF 4XI5C 4JDEB 3UTTA 1WTVA 3K4DA 3S9WA 5AJ3Q 3ZE0E 3L9AX 4RAUB 2WN3A 1IKMA 4AQ1B 1PH1A 1S2EA 2CO6A 1HR0Q 4AVKA 2Y6SD 3NJXA 2YYZA 5GS0C 4OQTA 2QDWA 4NP9A 4HK3J 1T21A 4HMDA 4UDTB 2PZUA 1G7IA 1LLAA 2EDLA 1UWVA 1EEZA 1NCWL 2Q5BA 4YVUA 1P4LB 2FK9A 1MVYA 3SEBA 4IU3A 5FDWA 4H25A 5IOPA 1UNSA 3MGTB 3I91A 5TSSA 1QPXA 2VSKB 2DLGA 2H3NA 4R0LA 3U9OA 3EFDH 1ACCA 4NQSB 3T09A 3TBIB 1UVQB 2L4OA 4J3OG 4NENA 4ODTL 5GS2D 4CN4A 3T2OA 2GSMB 2K50A 2PMZB 1HIMH 2V1CC 5F7KC 1C08B 4LF6Q 1T6BX 3B56A 5ENWB 5GISL 1UJ3C 4KTEH 4EZJA 5IQOA 1KWGA 2DEWX 3T1YL 1WT5A 2CG9X 3BVNB 3DGCR 4GSUA 3B4NA 3GTTA 2ENQA 2Z31C 2CO7B 1G7MB 2W95A 4UMGA 1ZSDA 5PCYA 4NX0A 2R4RL 4NO0D 3SPIA 1AZNA 2OTWB 2J6EL 3C60A 1NJIC 5DUBB 3UTZA 4K9EH 3WNNA 3HCVA 1DFBL 4G8GA 1UM5H 2A9ML 1Q9WB 2HTLC 2X70A 1T4KB 4JJ5A 4EI5C 4J3UA 1HSBA 1G6RL 5ELNA 3BGMA 4NO3B 1A2TA 4YY3Q 2GHWB 3UPRB 5EC2B 1SJXA 5LNEA 4A6YL 1FF5A 1NCWH 1L9OA 2Z31B 2XFGB 4JVPA 4X7FC 4LKXB 1E30A 2GJRA 5BOPA 3D8GA 1KENL 5JA8B 2AI0H 3IU3B 3BVNA 4NPJA 3AUVA 4JPKL 3GJEB 4B0MM 3DEPA 1KB5A 2EEAA 2GC4C 3DROA 3IETB 2IANA 5IM7A 4YBLB 5F6HI 3OJMB 2YD5A 1N0LB 3Q0AA 1YUKB 3IXTB 2LSSA 3VD3A 3W11C 4KNTA 3TF7C 1VQJA 2R56L 2P24A 4G8GB 4CBPA 5EU3A 3C46A 3BYTA 4I2XA 4OCXH 4XI5D 3B9EA 2B5IC 5CGYD 5IBLD 3PO2B 5IMLB 1GHJA 1XGYH 3D09A 1Q86C 2A9DA 2PYFA 3FFCB 2EABA 2Z6BA 1EXUB 4IBLT 3NEXA 1HH9B 5TGBA 1V3KA 4H0LC 1JRHL 4FYDA 4FZEH 4IPGA 4TNGA 5GS0D 3B2DC 1QB5D 4AQYQ 5TDOB 3K4AA 5F7FA 3L7EA 4G72B 1DYQA 2KLSA 2D9CA 2LAAA 2YSSB 4B5EA 3QHZH 1SRDA 1BLNA 1EGJH 3FU7B 3GXPA 1BR9A 3MA7B 3MRHA 1DM0B 3QVAA 2KECA 4FFZH 4P5TC 4BXVA 4QDGA 3ZT7A 2VUKA 2L55A 4BUHA 1SM3L 4E41B 4OL7A 5JDJA 1HL4A 1QBAA 1OZUA 1FLRL 5E8PA 1N32Q 5ICUA 3J7AV 3NJGA 1R17A 3O6MH 4JI1L 1G7LA 4OZ4B 5B1AB 3V5HB 4LVOC 3MRPA 3WBDA 4DTGH 4F37F 1ZTXE 3OKOA 5T1KB 4WHCA 2GSGA 5ES4B 1GRWA 4PP2A 4LHUB 3F83A 3RQ3A 1G9EA 3FQTA 2A9CA 4QY8A 2D3LA 4OW6A 2A0LD 1JGDA 2IANE 5DQ9A 3ARGA 1RMFL 5CS7A 2EY6A 1A7RL 2FLMA 5IGBA 5T1DH 2KZBA 2OCJA 4OFIA 2I9TB 4P5MA 1I4GA 5KVDE 2Q87A 5JW4R 2R7DA 1V8HA 1FGNH 2ZKWA 3D3VA 2YUWA 5ANME 3VI3B 4XO5A 1LO4H 3RL1A 1UH3A 2APBA 5GGRY 3L3HB 4LBEB 4EQOA 4NNXA 4YFLF 4GAFB 1BMWA 4AITA 2GVBA 1BF5A 1A4JA 4DZ8B 5J13B 4Y9BA 2EZVA 3HN8A 1CD1A 4X4ME 2XTIA 2Z7UA 1DVZA 1VQEA 4JI2L 1T1WB 4FXKB 3BH9B 5AAWA 1JZ6A 1Q0XL 3BOVA 4W4NA 4GOPB 2CLRA 2CPUA 2G3ZA 4B9YA 1ZIAA 3PGCA 2F53D 5TDPB 3QZMA 1GUSA 4NI3A 4Y5XC 5BO1L 3R1GH 2VABB 3K7AB 2BK8A 1I4FB 4PVMA 1BCIA 4OVVA 2DJSA 2MFIA 1MDTA 4TQUS 1ZHKB 3V7AG 4EIUA 3UZQA 3BWUC 3PWPD 5IJVB 3L9RA 1PFSA 3ZMNA 3OWEB 5L0QB 2X7LA 1K4CB 3FTGA 3QT2A 2WBJD 3OGCB 4QRFA 3V0GA 4A63A 5CM1A 4P2RE 4EI5A 1CBVL 5CBEE 1E27A 3VFSB 3CSYB 4S1RL 3NZHL 4KN7C 1AS6A 4KRPC 1TZGL 5AD0B 3W38A 4AYBE 2F5BH 1UT1A 3DX8A 1EY7A 1RIPA 3FO1A 3DDGA 4JAMA 4NZDA 5DMIL 1G291 3PLYA 2HFEB 4PJ8C 3MLZL 4ABUA 4Z3HA 1Q72L 1E40A 3O3AA 3AMLA 1FCGA 5T1GA 3UROR 35C8H 3H9SB 3TO2A 4OQTL 5F89B 2FT8A 4PJ5A 4YSPA 2FT7A 1O5PA 4MA8H 4PWEA 5MP6L 3KYOB 1LEIB 2JQAA 3D8MA 5ANMA 4JCWA 4Y5XA 4DR3Q 1X5JA 3K6SB 3ORJA 3F2CA 1QATA 3TZDA 3AT9A 1YEFL 3ZU8A 3MREA 1L9TA 4FHJA 1JF1B 1I5FA 3BO8B 1A66A 4Q2ZB 3N43F 5C2UB 3AT8A 4L5FH 3OXSA 1KXQA 2BZCA 4GG8A 4O2FB 4HGMA 1FGUA 3Q0HA 4N9PA 4PG2A 3SGDH 3ZKMD 3T71A 1F8TL 1G94A 1WFUA 5TDNB 1U3NA 3GIVA 3JWDC 5C7XL 3FSOA 4MNOA 3TJEL 5J22A 1PZAA 2J2ZB 2NXZB 4KKPA 5E9AA 2OYKA 3M4PA 5J3HD 1XF5B 1QLRB 1T5KA 2ARJQ 1UXWA 2XZAH 1JZ8A 1JWMA 1R75A 4J6HA 4KZDH 1NBVH 2MQ3A 5GS1B 4NOBA 2EADA 5FLXc 3KS0H 3QG6A 1MFNA 3BZFB 1YN7A 4WUUB 4FNSA 2OXGA 2MUYA 1KJ3H 2ORBL 3ILEA 5I9OA 4ZQ3A 2BH0A 4QCLA 1L1OA 5CIPA 1ADWA 1KC5H 1M1KC 4X9HA 4TSAH 4QXUL 2JCWA 5HHOB 3S9DB 3D0AA 3OAUH 1HJBC 1WFQA 2BVYA 4NXSA 3HBPA 2CQOA 4PJEF 2CKBB 4S1SH 5IFHL 1LE9B 2CGRH 2ESVA 4IU2B 4CDFC 2K9UA 1ACYL 1KIUA 1VJSA 3LKRB 4P59L 1A2YA 3KWVA 3LX0A 2BP5M 3C5JA 4JDZA 5GRYA 5BPPA 2DQGL 1E50A 1ZPUA 4KMQA 2UZYA 1R3KB 2WXKA 3K2MC 4JFEB 5C4XB 1P6AB 4N9GA 5D7IF 1F77A 4WUUE 5DZJA 2R2CA 2QQKL 3J81c 3RUGB 3UZEC 1DBKL 1CIUA 4ACPA 1YNTA 1FJ1A 1X3EA 1KXQE 4FQXA 5MENE 3MHZA 2E86A 5EEXA 4K9JA 1X32A 4G7VH 5ELDA 2A6JA 4MD0B 3VE0B 5C0EB 2NW3B 2O5JC 3FPYA 2NZHA 3EF7A 2HLFC 3NIGB 4AQZA 1JPST 1A25A 3TBVA 4N20A 3VXUB 2XXGA 1A64A 2QHRL 3MV8A 3L2PA 2GITB 5I9QC 5EUKB 1EWCA 4A93H 2X1WL 4DNIA 5CLZA 3EF4A 4X9GA 4H13C 2W88A 4GQZA 1MCPH 4YJZL 2CUAA 1FVDA 3ZBMA 4Z3IA 1FZKB 2WXLA 3ARPA 1O7YA 4B3MQ 4G1EA 5EUOE 1JGEA 3CVHL 1PZCA 1CMOA 4FP8H 4Q4IA 4KXDA 4RFNC 2ZKYA 3GDBA 4J27A 2WP3T 5DXWA 4LLQA 2XZQL 1CZ8H 3L9BA 1QVOA 3P3RA 4KMLB 3UTQB 3L8QA 2E7MA 5HVHC 1MJ8L 3GJFB 4AQ8A 4YWKA 1QRND 3EHBB 1EK3A 4PBXA 2LU4A 1H95A 5FHBH 3G5XA 1B8AA 2AHIA 2B8OT 4XOEA 3L4ZA 1Z3GH 4G43B 4NQXA 2EXZA 1NWOA 1JHTB 2YJQA 4TYUA 4GKSA 4K7PH 4LRIA 2XFXA 2J73A 2VL4A 2YN3A 5DJ8B 2N8NA 5H8DA 2P1YA 4U3HA 1MLCA 4K5XA 4POZC 4CBVA 5DS1A 3TN0D 5AVYB 4AL8C 2LXJA 4MAYA 1A6WL 3C5XA 2VM3A 4FXGC 2WWKO 1B53A 3MRCB 3QHFH 4UM9A 3IXTA 3RI5F 5EO0A 2WOYA 5BQDA 3NP3A 2JKNA 1B4RA 3PWVB 4FRWA 4UQ2A 3LHPH 3T4AC 3TN0A 2Q10A 2D0PA 4X4XB 4PJ9B 5GGUA 1JMZA 3SJVA 1SLUA 1ZGLB 4KTGA 3BVVA 1N3NB 1FVEA 1M7UA 1PG7W 2DH2A 4WUKH 4F8TA 5ISZE 3MUGB 4GG8B 4JO2L 4BELD 2NTFA 3FU0A 1FJGQ 4E9QA 4YXLL 2EIEA 1X5HA 2AJUH 3FF7A 3NFNA 2RKSA 2MCPH 4IRJD 1MHWC 2AEQL 3SO5A 4YO0A 1D5BA 5MHSD 4KY7A 1YY9D 3M6DA 4ZNEE 4P48A 1LTTD 2F0HA 2FATL 4ISVB 1BDYA 1T9HA 2A99A 3NUKA 3O11A 4FXGA 2W0LA 1YUHB 1T2QL 2HX7A 3BKMH 4OEMB 2PCFA 3CWGA 4Y9FA 4URKA 5JXAL 4RCAA 1QSFB 3GTKB 5AJ3L 3M88A 4R26H 4ZUWA 4C47A 3FB7B 4JS7A 5HYSB 4NNYB 1KXLA 3LRMA 4TKOB 1UD3A 2WLZA 5TPWH 4QY8B 5EMYA 4JVUA 4YCVA 4LSSL 5D9SA 3D6CA 2DUDA 1JCKA 3TBYA 3QO0A 2DQ6A 5DRNA 1E28A 1CICA 1CGTA 4ZTEA 4A3JG 4NN6B 3QUZD 4QJ4B 3Q8FA 5CV9A 3RNQB 3KGTA 1FR3A 3NQIA 1DQVA 4S1QH 5FW7A 2ZWYA 5E1FA 4KNSA 3FFOA 1R47A 4HSQA 3TWCL 1BJ8A 3IU4H 1FSKB 2H3XC 4IO9A 1KLUB 1TFHA 3C5JB 1WHPA 3EO0B 4JDZB 2NUPB 2A4ZA 4H4NA 3VI3A 1L2FA 5J1ZA 1OCCB 2B4CL 3OTOQ 2ICES 3TS0A 4TF4A 4F27A 5D1QE 3CPUA 5C8JA 4NQEE 3CN1A 3TBTA 2XIDA 1A3LL 3L95B 2TSAA 5KVFH 1MCCA 2BM3A 3Q8CA 1EAPA 3G6JF 3G5VB 4JFFD 2EJFC 5F1NB 1TZHA 3BH9A 1S78C 1LDSA 1Q90A 2Y2WA 4FFYA 3TT1L 3ULUF 4IEFA 1A62A 1OM3L 1YC8A 5F9JA 4NPKA 3S5ZA 4DA2A 3OOCA 1U6AL 2ATKB 2P8MA 3K91A 3NJLA 4CHTB 1IAKB 1KBBA 3PL6D 5M3MG 4YDZA 3O41A 4KK5C 3F7YB 3O6FB 3U4BH 3CFKA 4L9LB 5LMUL 3MWYW 1YEGL 1L9RA 3NSWA 1X55A 4OLVL 3MRQB 2Z93B 5DQDH 1IBKL 1YNTF 1FIEA 4CAGA 4EMZA 5DFVC 3WTXA 3VYNA 4YUEL 3CCMA 2XKSA 5IIEB 4RBPK 4AIXA 2XA8L 4P2YA 2OMXB 3HFML 4YIQB 5BV7H 1ZYRC 1B2WL 2PTVA 3BD4A 4XTCS 4UM8B 4R4CA 4G8EA 4HOZA 4E9XA 1FA4A 4LVNB 4YK4C 2HN7A 3W82A 4DPGA 4LCUB 5B22A 2EYSB 2NSQA 3OR7A 2VS1A 5ANMB 3EBIA 3VI3E 3U0TB 3A74A 2QLYA 3ULVC 3L3GB 3DK0A 1LT3D 2ADJB 5D1QA 2Y06L 3EOYG 4XNBA 4XVSH 3KPSA 3W56A 4JV5Q 2OV0A 1UD8A 2Z91A 1KCBA 3IDYB 2XWEA 3R19A 5DURB 3ZRFC 1N0LA 4WV1B 2IC2A 2XA3A 3G08A 3UTSA 2Y36H 5IT2H 3UJIH 2AQQA 5DUBA 1YVCA 1OTTD 1ZWIB 1IBFA 4UY8C 1UEBA 2VLRB 4P2OB 2WYTA 4PRNA 4YSRA 3PABA 1U3HD 1IYJB 1TMCB 2DQTH 1ZCRA 5I6YA 3VVVA 3ZDYE 5DC9B 3QQDB 3HNTL 4UB0L 1LM0A 3TN0B 5KAQG 3J7A5 3GSUB 3BN3B 2VW6A 3VSTA 5HURA 1AG6A 3V0AC 4WW2C 4KO6A 5ADPL 5SWZD 2YGVA 3CFEB 2VZSA 1AR1B 2JE8A 4NENB 5F1IA 2G5BB 1CGYA 2IAMD 2FBOJ 2W9DL 3F64A 4IALA 4KHVA 5FKAC 3MUGA 3Q1SL 5ALBL 3SQRA 1T03H 5IM7B 4R8WL 2QMKA 3VSVA 4K3EL 3NIDE 5JLZB 5D2NC 3NACH 3RTQC 1WWWX 1AW7A 3WY3A 1G1YA 3NZ8B 5KVEH 4OCRL 1DQIA 3QIBD 4OIBA 5K1VA 3QBTB 5EDXA 1L5GB 3GXTA 5E1AB 2CO1A 5C4JH 1L9NA 3IBOA 5L4IA 1DP0A 5C0CA 3DWPA 1D9KA 1KCSL 3FYIB 4A2LA 1ILUA 2CPCA 2WSPA 5BS0E 1Z9SB 3ERQA 2I85A 4AQOA 4JFZL 3GSWB 2ZUQC 1MCQA 4W9ZA 4A2EA 1TJIL 4X5WB 3A4FA 4MWFA 1TZHB 1HT6A 4G7ZC 1HQRB 4F7EB 3PV0A 4JFQA 1E9PB 3NE5B 2ZPKH 4IKKA 5GZNC 3TEYA 3MGOB 1R9TB 1B70B 1GGUA 4MHHI 4JRWA 4GXVL 4CC4A 5GZOD 5GS1C 2WKOA 3B1UA 5KOVC 3V4UH 2AQSA 2A6ED 4HS3B 3ZO9A 1J1PL 4Q89A 2V37A 3LCYA 2BXZA 4C3JH 2OCCB 4D7PA 4NQSA 3CC7A 4DV5Q 4XCFH 1WTQA 3ZTJH 3NGBC 1QHQA 2GITA 3VSQA 3ILDA 1OAXH 4DEPC 1X3QA 3FUHA 3QUZB 3UDIA 3UDWC 3H3VH 2F6AA 1UWYA 4AEEA 2XY2A 1ZLUK 4ZO8A 2YUZA 3IXAB 5EOCH 1BVKB 5HD8C 4PTUA 3VXQB 5FFLA 1MCIA 1CT8A 4BXXG 2R9HC 2X40A 4LEEA 4MJHA 4WZ9A 1UC6A 3VGHA 1GYCA 2VL5A 4NNYA 1UWXK 1PDKA 3ARZA 4AQ1C 4OIIL 2HFGH 2ICWJ 1S7WA 4HS3A 4L0ZA 3G7LA 4C56A 2BVPB 1IBLQ 3FSWA 3ZUNC 5IJKC 5HHNB 2PKDA 1J8HA 3FZUD 4MNQD 3TIEA 2ZX9A 3DRTA 3UZVB 4RMRA 2MPVA 2BY1A 1RZQA 3QORC 2VLLB 4KK9D 1CLZH 4Y2LA 3N6YA 4PJIE 4H20L 3BW9B 2EIBA 2ZT9C 3PWLB 5FUOL 1MW1A 3IN0A 4QD2E 4HSPA 2ZP9A 2LU7A 1SNRA 3QFDB 5IYCG 3MV01 4FERA 2UUCL 5EKLA 3GDEA 3GBNL 5I0YA 2IAAC 1FZJA 4RHSA 3ARFD 4KXBA 2IPKA 4NLHA 3D39E 1JPFB 1RJYB 5DJYA 5H35A 1XIWD 1I1YB 2XPGB 1DZBA 3GBEA 3BHBA 4XPTH 2HUEA 2LW3A 3K2UL 3S3SA 2GTZB 1IXRA 2FRGP 4KQ4L 1S8DA 1ES0A 1QUNA 3EADA 4B9GA 4W4OC 4YDVA 2UXBQ 1H3PL 4I18A 3L5JA 4KUZH 3VD2A 3PF4A 3I9AA 3SGKC 1KJ2H 3WKMH 2WV3A 4Q9BA 2UUBL 4F2MB 5I8OH 2NX5D 3TWYA 1ILQA 1JYWA 4PGJA 3H0GB 3DLQR 1ET6A 2R7ZG 3P11H 1LYLA 3WD5L 2AJYL 3O8XA 1NSNH 4L8CB 2N4IA 3OR6A 1HI6A 2VKXA 3D85B 1CFBA 1I75A 1QSZA 2IX3A 2GIXA 4FQJL 2HJFA 4P3CL 5ALCH 2ZKXA 4ANUA 5AG8A 4ZUUB 4PG9B 2B9AA 5M3MH 2Z9HA 2P26A 1RJZB 2IALB 2PYEA 3U2JA 4CBZA 3GPEA 1DJXA 1YJ9A 1SMOA 2I60L 3CVDA 2AF2A 5IB5B 2HQLA 3T0XA 4KH2A 1I4FA 1NLBL 4JFDB 5DHEA 5JIHA 2ZNXA 3A0OA 3DVIA 3C3LA 3CU1A 2BSRB 1PH5A 1DONA 2OS7A 4RGTA 2VJ0A 5ESQA 3GD7A 2P5EA 2CNYA 1AE6H 1T0NA 4FFZA 4FKEA 2R2EB 4NNPL 5KBMA 2X3BA 2VXQL 1LT6D 3BG3A 3PJSA 4Y9CA 2XWTA 5G3LF 4PJ9C 8CGTA 4M1GL 2ALYB 1JZHA 2HFGL 2OSLB 4DKEH 1QRNE 4ZFFA 3ZTEA 3APDA 4G7YL 1AR1D 1E4HA 1QYGL 2ZWSA 2WQAA 4KY1H 5L9DH 5KYNA 3V7AE 5KANI 3ULVF 3T9WA 5KYUA 4P2OA 2X0VA 3TBSA 2OMTB 3EO1B 1EQRA 5T3ZL 5IGEA 4FHKA 5K9OA 4KI1A 3QUXD 4GUPA 2VCOA 1KGCE 1J0HA 2X42A 4OKVB 3CUPB 1Z5LA 5JQ6L 1I1FB 4UT9A 1SJHD 1QFPA 1QZGA 5F3BA 3L4CA 4HD9A 3VD7A 2WIIB 3O0RL 2NDGA 2LMCB 4N68A 43CAA 2X2UA 4D0CB 3UBXI 4M56A 2MPAL 2W65A 1NMCC 4NM8H 3II3A 4XX5A 2M8XA 1O80A 4IEFB 3TTSA 5L2JB 1D6EB 3L16A 3ZPDA 2GBTA 1NMFA 2EVIA 2C4FU 1A2YB 2R29L 1RERA 5KOMC 4L5FE 4B9PA 2WJ7A 2GTWA 4W6WB 2JKLA 3G6AA 1TZAA 1IC7L 1YHQA 4EUPH 2A1WL 3PNWA 4NQDE 5GGRB 1D5MA 3EGDA 3HI1B 2YFNA 3ZL1A 1QFWH 5EOTB 3NP8A 1HN1A 4NCC2 2HQEA 1TJGL 3HRZC 3RR5A 2EQSA 2CGYA 2KS0A 2ZOTA 2XNAC 1NCCH 3BD3A 1DVUA 3HOXG 4I8DA 2E2IH 4EOWL 5ELOA 3GQBA 1PDQA 3FQ2A 3T1HL 3SGJA 1VS0A 5CSGA 3VDAA 3NEMA 1YEHL 3ELAT 3VXUA 2X4QB 1KPVA 4JKNA 32C2A 1WIPA 4LOUC 4Z7OE 1AD0B 2XTJC 4AGMA 2APXA 5IYBH 2VERN 4BZ1H 3D0LB 5KJRH 5ADPH 1JI1A 2QKIC 4E0RA 4I18C 1JD7A 4G7SB 4U7KA 5BZWB 4ANWA 4ZYKA 4NJ9L 1HNXQ 5AAWC 1NUNB 4NKIL 2ZSWB 2FNBA 5I18H 3K7UA 5ACZA 4OR1A 4Y8DC 4Y4HA 1NFAA 3CCEA 3C8DA 2F4IA 1PEZA 1TQCB 1SGKA 4JZNB 3QRLA 4K8RH 5TE7L 1UWXH 4PJ7B 2AJ3B 3FW6A 4LPVA 1GGIL 3CLEH 1OLZA 1YYMH 2J6EA 3PWVA 2H26B 4XWGL 2YU9B 5HHOE 5ILTH 3WFCL 3QO1A 4N85A 2B2XL 5IR1B 1JN6B 1EAQA 5GZND 1CTNA 3LNEA 3UGUA 4Q9CA 4G82A 4KOBA 4Z7WF 3G9AB 5CJ8A 5L6YL 3ABLB 4PJDB 1YZZA 4JHZA 3OHMB 2WLLA 4E36A 1YY8A 4JI8L 3BZ4B 3ISRA 2ITFA 4HWNA 1FYTE 1TQCC 1KNOA 2BVUA 3GHEH 4NQDA 5E4WC 2A2QT 2NOYA 4WWPA 4DP2X 3QAZB 2DQEH 5DJ8A 4DU9A 3CZGA 1O6SA 5CCJA 3H3BC 3LEYL 5KEZA 3JZ7A 2IFGA 4NRXB 2MH4A 4JQXA 2N3SA 5AEAA 2MHAB 5EU5A 2I5YH 2X09A 4PG9A 4BY7H 1K8IA 4FQ1H 5CFAA 3KGUA 1S7XB 2W60A 3DX6A 3NEEA 2VQ1B 4HLZH 4ISVA 4AVHA 3D0VB 5DJYB 5H35B 2YK1H 5LGJB 4DQAA 1PY0A 4HJ7A 2ZP8A 1TEFA 1EDHA 1BZ7B 1LXMA 3BGMB 4NO3A 3S97C 1HFGA 3B5TA 5DC0A 1IBYA 3HOWG 3GB7B 2EEFA 4Y0GA 3VU2A 1TO5A 4YSQA 5COYA 4A3DH 2Y1YA 3QZNA 1H9VA 1XGTB 5AVWB 3TYFB 4EN3D 1D3CA 1FVEB 5JW4Q 1SJHA 3AFPA 3GXFA 3VG9B 3HG1B 3SPJA 3PGFH 5GRZA 1ETA1 1CBJA 4Z3GA 3NG5A 3H8NA 2UXFA 1GW6A 1LO5A 4F7XA 2JI3A 3HZYB 2EYRA 3C9NB 4Z8FL 3IFNH 4V1DA 1BD2B 2VLRE 1EA9C 1BWMA 2FJHB 4QO1B 1OGTA 3I2CL 3UMNA 3B2PA 1BIIA 1XIWC 2VT0A 1QKZH 4MQ7A 4MMZB 3PDOB 4P5SA 3VNYA 4QCIA 2B1AH 3K57A 1HINH 1NH6A 5GGSB 3CLFH 2MKLC 1QVGA 3DUUA 4D8PA 4TQ8A 1AQHA 4OCNC 1R3KA 4LSPL 3WS6C 1K2DA 1RZPA 3Q48A 3STBC 3WDHA 1D5MC 5D4QA 4DAMA 2CJUL 3RPIB 4F7KA 4A3CH 2RQ8A 1DQQA 3WIFA 2XNAA 3DBSA 2VN7A 3OZ9H 3SODB 1Q9KB 4ONOA 3UCQA 4YAQA 5ELEA 1M7XA 3L3KA 4NZTH 1IGJA 3I6GA 2ZOLB 2DJGC 4OI8A 4LAQH 4U1LB 5E6ZA 4C56D 4E0RB 2Z93A 3SE6A 1FG2B 4ZMVA 2EDXA 3BEWA 4AY0A 4BQ8A 4FTVA 3QJZA 4CNIA 4PY7A 3LMJH 1D1IA 1AKJA 2NZIA 3DLLA 1DBBH 1W0YT 3C6LC 4NHCL 3EOBB 4FXTA 4KRPD 2J5LC 1XMOQ 2YMTA 5BZXA 1ZK9A 4FP5D 1KTLA 2O5ZL 3OD3A 2L0DA 1PKQA 1T2XA 3CFCH 2ADIB 5DK2B 5TJWK 1NPJA 2F0CA 4R7XA 1I7UB 5E9DD 3V52L 4ABQA 3C87A 1WBZA 3VD0A 1PG7X 3FMCA 4R83A 3QZWG 2FAUA 2FIRT 3O6LH 3S34L 4E9VA 1X5YA 4HWZA 3PIO3 4JM2D 3TS8A 2G2RB 4HH9A 4Q97A 2MEJB 3ZHDA 3UGXA 1A9VA 2IANB 4FF9A 1AQMA 2EOTA 1PY4A 4GUQA 3DM1A 1ZHNB 4XX1G 4O02L 5T1MA 5TF1H 5T33H 4NZUH 1KMGA 3UPCA 2W0FB 4MZ2A 3D2TA 2J44A 1SJEA 1LTRD 3G9VA 1T3FB 2MNWA 3V55A 4RCNA 1STNA 1DQMH 1IGYA 3GSVA 2PXYC 1MEXH 5DZ9A 2IGFL 1YNKH 1GPOL 4UIKL 2NR6A 3L4YA 3OZ9L 4XZUA 3T16A 1VZIA 3LIZH 3U2SB 4PJAE 1B44D 4L4VE 4H8WH 4PCSA 1CDCA 4WUUA 2QLVB 1QWYA 4MAYC 4QOKD 4A7VA 3VXSD 2BP0B 3WTTA 2HWZL 3GRWA 5D7SL 1KOAA 4P57A 1W0VA 3KBHE 5C2BH 3F2UA 3B9DA 1F4XL 1KAAA 3QH3B 4KJYA 4XC1L 4HULB 4K8IA 2EYHA 2G3MA 2H1PL 4S1DD 4LSRH 3J80i 1JP5A 4YXHL 1VQHA 3N9GH 3FN9A 2LR4A 4UM9D 4S3SA 1UKQA 2PR4H 3J2PA 3L3OC 4FMFA 5HYQA 3VGAB 3DMMB 1JK9A 1FCCA 2EZ0C 1JFHA 4MVBD 3IPBA 3U50C 2BP0A 3M4QA 2DD8L 3E2HC 1O6SB 3M7OA 3QCVH 1N2RB 1S6NA 3I4MH 4X3UA 1Z7TA 1K85A 1IQWH 5FJ8G 1SBBB 3VXRD 2J1YA 1NC4D 5AOMA 2QQKH 4CADA 3IMVA 4FQHA 1BBUA 4M5SA 4RDBA 1A21A 2XN9D 4AM0B 2V2WB 1QSFE 2ZG3A 3F12A 5CEZD 2C9VA 1NL0L 1CD1B 2A69D 5SV4A 1FGBD 4AW4A 4Z7WB 3S4SA 2BWQA 2O5XL 2WWKT 3QYCA 2EIZB 1STYA 3EOBA 3D52A 5EPMA 3QR2A 4N3TA 4X6EB 1J87A 1MQ8A 4S1SL 5KBPA 2R6GA 2CR6A 4XC3L 2HG5B 1GXDC 3GKWL 2QPSA 2KH2B 2J43A 1DQML 3VYTA 2NY0D 1Y0LA 3QPXH 3ALPA 4OIFA 1TITA 3KM1A 1LTXA 1G7IB 1AJ7H 1HU8A 1IC4L 1M4KA 2ORBH 1JHLL 1MCEA 2KVMA 3CSFA 4LLWA 1TYEB 5C0XG 2DNEA 3TM6A 1BDOA 4MAYD 3ARXA 5HTSA 1RIUL 2J55A 3MRLB 4QIWE 1U2HA 4KJPD 3SJVE 4RHRA 4OD3L 4N6RB 4XHJC 2F0IA 4EAEA 2H2SD 2R8SH 5DM73 2N1KA 3AQXA 1DVFC 3AM8A 3VMPA 4AYDC 5EOCJ 2R29A 4KI5D 3F7KA 3PHQB 3T6VA 3CHBD 3ML8A 3BWAB 3TN0C 1OGAE 1JZEA 4XXCA 1C8QA 3LZFH 5IQ9B 3TCXA 4BFOA 1H6FA 4QJ5B 3B43A 5C44G 2XNAB 2J8UB 2I24N 2MNAA 2MQHA 1OCOB 4P4KA 1YITA 3WCYA 5KSBA 4EZMA 4HZLA 2AANA 1WZMA 3AQZA 5DYOA 1JK8A 4PRPE 1CQYA 1RUPH 1RZFL 3S37H 4QL5A 2OTJA 4KKCD 4GNXB 2R1WA 4OO1I 3O3EA 1OM3H 2VQEL 3SJVB 3ICEA 3AEVA 2ZWZA 1IM9A 1OTSC 4M7KH 4QI3A 1J18A 1FORH 4RRPA 5EZLB 1QSEB 1A0QH 1M05A 1TIID 5JEAH 4I0PD 3TT3H 1XJVA 3TZVD 1MUJB 1NGPL 3U58A 4ODSL 2OLDA 5MERA 1NUDA 4M9PA 3RHWF 4DK3A 3OSVA 2H6UA 4DV5L 4PBVC 5EU4B 4JR9H 5HPMA 4UT6H 1E2WA 4DR3L 1BP3B 1I4RA 2NWGA 1SJMA 2G3NA 3ECVA 1DSFH 3EYVB 4KV5F 3FHEA 4GN3B 4KI0A 4WJWA 3MJWA 1PYSB 4AMXA 2TMPA 2K1BA 4TN9A 4NQXB 2P42B 2J72A 3SDAD 4HK3N 2FDBP 2IAMA 4HS8H 5F9AC 1HNZQ 2XWTB 5JTWA 5TDOA 5A6MA 1X65A 5E95B 2L9HA 1FC2D 3KWWA 3E8VA 2J4XA 2WZ5A 5KZCB 4OT1H 2NN6I 3I3EA 4M5YL 3V6BR 5J6GB 4PJGB 1INDL 1U95A 4XXDB 3RTQB 2RF4A 3QH3A 1X7QA 3BCDA 3J81j 3V4VA 2NXZC 5JIMA 3NIFE 1D5IL 4GBXD 1ZHBA 1ZRUA 1UFGA 3N85H 1J5OL 2XETA 4KDTC 2WLMA 4M1GH 2WACA 5FKAA 2Y5TA 1WBYA 2PW7A 4IJ3C 3RB5A 4FNUA 3ZSSA 3ONAB 5C0XH 3DM3A 1V10A 4JFYA 4IRZL 5AKTA 1AFPA 4KMUC 3CK0H 3U46B 4K07A 1JMCA 3HMWH 3O8XB 1A02N 2NUTA 1U8NA 2QDLA 3QIUB 3FFDB 4MNQB 4MJIE 4A3LH 3GLEA 4P0DA 1O9WA 5GQOA 4PH8A 2NY2B 1M56B 4UT6A 1EEID 4UT9H 4ZS6D 3LEXB 4XCCL 3VRIB 1IGIL 4LOVA 3HOVH 4X4ZA 4X6CB 5HD8D 2I60H 2EDQA 1N64L 1VEOA 5E6UB 2CCLA 4BD4A 2PNHA 5GSVB 4D9RE 5IW1A 1HJPA 4LLDA 4P8QA 2F9BT 1MXGA 3S3JA 5LKNA 2VERA 1TETL 3P40A 5IEKA 4NPYB 3BEWB 4XPFH 1FZJB 4PJXA 4GI9A 1R5IB 3DMUA 3Q3GB 3SN6N 5C6TH 5I1CL 4JJHA 3MNWA 3KJ4C 2DMCA 5IQ9A 1PRTD 2ZUQB 1L4IA 3IN2A 5C4ZA 1EO7A 3I7FA 1ZT1A 4LF5L 3SK5A 1E8ZA 4OFQA 1G0XA 4ZUJA 1UWFA 2E6QA 2F03A 1CK1A 3B3BA 3QUHA 2QDBA 2FWUA 3FRPA 1ZV5A 2HA1A 3MSPA 3EO0A 4IMLA 4WAFA 5E2JA 5I16B 4RBPH 2EKJA 4M48H 4R7VA 5I2IA 4GRLD 2FWSA 1XF1A 1FFRA 2PQEA 4C3JB 2HH0L 3CZEA 2AXFA 4K73A 3T0ED 4O00A 3VG0H 3F7PC 2XWBA 4P9HH 5D2LF 4AL8L 3BAWA 3AROA 3AG4B 4F2FA 4FE9A 4CVZA 5LMUQ 3VRLE 4LMQI 3VQLA 4NQTA 5I71B 4H20H 1HHJA 4NXNQ 4UU9B 4GAJL 5TQ0L 3REWA 1SYVA 2KCMA 4AI7A 2NW3A 2AI0L 1PZUB 2X4SA 1AGBA 4BH7B 1T1YB 5TTRA 2J5LB 2VTFA 3RU8L 4HCGA 4OTXL 4DPRA 3JBG7 1KBGL 2W92A 4KMTH 3GBDA 5I71C 5D2NA 5C0FA 4OBSA 2GABA 1IFHH 3EJZC 1BVZA 2VDMB 3EH1A 2I7OA 2HVJB 1IJ9A 5AW0B 1U9KA 1VADA 5JPMB 2UY6B 4BXSV 2HKFL 4GQQA 1W91A 3L45A 2IAMC 4D2NA 4NUQA 1LTBD 2XQYG 3MBXH 4HGWA 1KV3A 4JKKA 1FFOA 4BGDA 1XXDC 4TUJA 4XP9L 4UNVA 2VJ8A 1JNJA 5F9DC 2M83A 2JF1A 1HH6A 5IQ7H 1XMWA 1DLHA 1Q1JH 3QC5X 2PNRC 4KRLB 5DUJA 3RKDD 2QKSA 4DN3L 4HW6A 5F0MB 1QP1A 3GSRA 4X7EC 5I17A 5D7LE 1BF2A 4AT6B 4JFYB 3PGDB 3DV4A 1AH1A 1EUTA 4WEUD 2E75C 5ESQB 1F9PA 2RCFA 4LL1A 4A6YB 4PIBA 3O3BB 5JQHC 5EU5B 4XMWA 1T0OA 2Z4HA 3DHPA 3V4VH 1R3LB 3SDAB 4DKAA 1MIUA 1PJWA 5AFWA 1KYDA 1RJCA 2QGEA 2Z1KA 3CFDA 2QSTA 4TUOA 4Y9GA 5CWSA 3MZ5A 3DGDA 3HI6H 4ZUUA 3EH4B 3NPZB 2P80A 2DTML 1DQTA 1TVBA 2R1XA 4JGJA 5DHVH 4BFKA 1R5VB 3T3PB 4PLNC 2BDNL 3MLTB 5D1ZD 2YHGA 2ZQKA 1LP9B 1G84A 3DVGB 1CM9A 1X5FA 5I1IL 2VR7A 1ERNA 4RKLA 1DLFH 2CLZA 1VSCA 5EEWA 1T66C 3QO2A 1EO8H 3CDGB 2VAAB 1QFOA 4JM2A 1AD0A 3QDME 2EE1A 4YHPB 4PD4J 3DC0A 4HJEA 4UQBA 5EC1B 1A7OL 3TZVC 3V6FA 5J13C 5HHNA 3QIUD 3HBZA 3SE8H 4FG0A 3HKFA 2WLHA 1KLFB 5ERWA 3VXRE 4Q14A 4JY4A 1FHNA 4AGOA 4GOSA 5D6DA 3D9AH 1FYTB 4PMWA 3PNWB 3MLZH 5ADOL 4K94H 1A3QA 3RBGA 3SKJH 2B3IA 3NK9A 5EU7C 5DMIH 5KSVB 3I6LE 1WCMH 5B4MD 4A7TA 5I6WA 4NXMQ 3SQBB 3SYOA 2EE6A 1HQ4A 3UBGA 5IFAL 4QY7A 1RULL 5CV6A 2OR7A 2J6WA 5D7EA 3WFBL 4N8CL 4XNUL 2GN5A 1MRCH 3MRHB 5D6CB 1DQDH 4PP1D 4FADA 1BG1A 1KUMA 1PNDA 2O6EA 2XTJB 2WC7A 3DV6B 5JPNB 5I28A 1WD8A 5DJ0A 4A1RA 4LF4Q 3ZT5A 5D1XD 3KPOB 4PJXF 3LV3B 5M5YH 5I8EB 4QLWA 1G7LB 3O6KH 4OZ4A 4NN5C 3ULJA 1U93B 5AVSB 2WZAA 1G7HA 1JZ7A 1YPZA 2B0SH 1Z9LA 2WZ6A 5F3HB 1IHZA 2AUJD 1J5DA 5B3JE 3UBXB 2P24B 2EVJA 3QDMA 1GS6X 3LRHA 5HHXH 3U9UA 3WY1A 7TAAA 3UEZA 2EDBA 5AKRA 1Y1VH 4Y4FB 4L5SA 3WIHL 3M85A 5IVZA 1KRSA 2WM0A 2CAKA 3QB7C 4G71B 1WC7A 4XNDA 4A3BG 2ZOWA 3TEZA 3SR1A 4RCOA 4CGYB 3VXRA 4YGVB 4HAFA 3L54A 1NBYB 3OAYH 1MH5B 2X6BA 2HCZX 4BSWB 3B5GA 3VH8G 4YE0A 2FJSA 4QR7A 3OKNB 3M4OB 5K36G 2K5DA 2R2EA 3Q01A 2B4CH 3OVUB 4RGOS 4JLRA 4V1DB 4ZTPH 2MHVA 1JXGA 2GVYA 5BOJA 1CB4A 5I74C 1ILSA 3VXNB 1IBGL 2F15A 4AK1A 4QKXB 2OJEB 3TL5A 5CD5C 4OX9L 3TA4D 3GZOA 1EFID 2Q76A 2Z4QB 4Q9QL 5EOQH 4AT6A 1AS7A 1NC2A 3FQXA 3M3YB 1II3A 4W9CC 1GSKA 1JK9B 3PO3H 2Z6FA 3B8SA 1SM3H 3WXWH 4Z0XA 4JR9L 1E7ZA 3OG4B 5HPOA 3GTLB 1N9WA 3ZYOA 1QLFA 3CCLA 3VFVA 5KVGL 1UYWH 2ZX8A 2GAZB 3GS0A 3MYZA 3OHXB 3MTRA 1QABA 4NI6A 2AWOA 3VFMB 2ZF9A 3IAPA 1MG2C 1QBLH 7PAZA 4OCRH 2Y7OA 1WTGT 2CBMA 5D65A 3LZFL 1J8IA 5F97E 4PWFA 2FEEL 2APSA 1NIDA 3SKMA 1U8JB 3LXCA 3QDJE 4HJ1A 5AOKA 2EP6A 1SEBA 5GGTA 3L5WA 3ZRSA 1F9SA 1OANA 3MBED 4LCYA 5FX3A 1CLYL 2OYMA 3N42B 4GAAA 4N2BA 4DW2H 5ID1A 4DO4A 4P23C 1IL8A 3W3BA 5HI4C 1A6AA 4YXLH 2YPKA 2DN8A 1EX0A 1DQLL 3KLLA 3K0XA 5AVQB 2BVEA 3B7RL 3GSOA 3RIAK 5HYJA 3C2SA 3WOFA 2Z64C 5H4ZA 3BAYA 3PPEA 1Q1EA 1JGUH 1YHPA 1I7TB 5IT9E 1V7NH 3I4LA 1XYIA 4DGVH 5JOPE 1EIYB 3THMH 5CF3A 4YSCA 1ICFB 3A22A 5E8OA 1AHWB 2WVVA 1JTPA 4A4IA 2IDCA 4RAUC 4E42A 2IDUA 4JBJA 1G5GA 4P2QD 5JPNA 4OAWB 3IVKB 2P8MB 2LLNA 4A3IG 1JPSH 3EZJB 1NBZA 3QIWA 3I02B 2P52A 4M43L 2C4FT 4AEIH 4AWJC 2LT9A 2LU5A 5FR3A 3V0HA 5E24E 4BQBA 2R4RH 4PJAB 3O2VH 1RURL 2XHNA 4PJIB 5JHLL 5KSVA 4XCYA 2JEBI 3ZTCC 4UWQB 4FJYA 2VR5A 3FQTB 1HOCB 4GOPA 3DEOA 4ZFQA 4PNYA 3MLUL 1IBBA 1MCWM 4NFBA 2FSDA 5JAVA 3KEHA 4TNWF 2MWCA 5ETUB 1ONQA 5EUKA 3W37A 3C6LA 3H9YA 4IUVA 5DJ0B 4F3FB 1AE3A 4F92B 1B7YB 3TO4D 2MTAA 2OSXA 4N2GA 5DVKA 5F7LB 3IE9A 2DWXA 3KW7A 4XDXA 3NJMA 4G6AD 3K5MA 1DTUA 5JHMA 3HB3B 2W1NA 1MJ7L 5F1NA 3CD4A 2APVA 4K2UL 5GJTL 3AGWA 2C3XA 2AJZB 3HMXL 4JE4B 4X5PA 3WFZA 3ATBA 5HDBE 1W9XA 5J6HA 2CXKA 2VUOA 1UM4L 3LRKA 3NTCL 1AFVH 3FFCE 2YPLA 3LNDA 1IL1A 5EBMA 3Q6FA 3S7GA 1S7QB 5EBCA 2CD0A 4UPAA 4H8WL 4YWGL 3U36B 1ZLEA 1PIGA 1IM9D 1KFAL 2IDTA 3CFIC 1HOEA 1SBBA 4YFEA 1IKFH 3EDFA 3HN5A 2NVYH 1MEXL 1XNQL 2VSMB 3P3SA 4JRYD 1ZVYA 3VAEA 3LH8A 3SYQA 1UKSA 3EYQC 4ZMLA 2EYRB 3KF6A 2G75B 3BLKA 4FFYL 3V4PB 4ZUIA 5I1AB 1L5GA 1A6PA 2ESVE 1KY7A 1LK2B 1U8MA 3MUZ1 4G6FB 4UIKH 2F0WA 1BJMA 1KIQA 3IKCA 4WSGA 2OWOA 3ARGD 2CHZA 3G5WA 1R5VA 3IAYA 2IHEA 1KN2H 2F19L 5C3EB 4L4VB 5TF1L 2YQ2A 1KNOB 3PUYA 1R6VA 3KYOA 3STBA 4HXAL 3EA6A 1FL5A 2AKRA 1D7QA 1BOYA 2JP1A 1WVZA 3PQYD 1A6TA 5A2BA 4QHNB 1JHTA 2X4TA 4B3EA 2YJLA 4MSWA 4AYFA 1HA5A 1TO4A 3LKPB 4KLKA 4KX9A 5A6IA 1S5HB 5LGJA 3KF6B 1WK0A 2G75A 1AZQA 1AVAA 4APQC 1YSOA 4BA0A 4GXFA 4JPWL 5LGHL 1ENAA 2JJQA 3TJEH 2ZXQA 4MAYB 1I8IB 4JM4H 1KIPA 2KQMA 1KBKA 3GBML 2AVFA 1F00I 3OKMB 3C6SB 4WRDA 1U0QA 1CLYH 4DW2L 2GFBB 4APXA 1BKBA 2DQFB 5ICYA 1PEWA 1S9YB 3QNXA 1CZWA 5CLXA 3A6BH 4ZZKA 2E7HA 2OMVA 4HUNB 5JIIA 1H6TA 3HEIB 1EYDA 1HK6A 4UV7H 2VB5A 1NEUA 4TULH 5DC2A 4HMCA 3D0FA 3GHPA 3SBRA 1G87A 1JGVH 1WYJA 2WTRA 3L1EA 4IKLA 1FFPB 4QF1A 4L48A 5IP9G 4L9LC 1Q9LB 1ONQB 2XV2A 4LQFH 4LVHC 1VERA 2SNSA 3CC4A 1KJMB 2PPDA 2GVAA 3UFIA 2Y25A 3E1ZA 3UZEA 4F7PA 2A7BA 4P2OD 5HXMA 2FWOA 4A3KB 4APQA 4NP5A 5KANG 3B3IB 4ACTA 3FDTA 1A5FL 3RFZB 4C59B 4HDIB 1JB7A 1W16A 3TZVB 3P3YA 4WI0A 4KJOA 4HV8A 4LT7A 1DSWA 1HHJB 2AK1H 3G5VA 3JUYA 1KACB 1WEJH 4EZKA 3K71A 2EDJA 1QKZL 4N9GB 4JHVA 5FO9A 4X66Q 4LHJB 3HW7A 2RJMA 2VC2L 3CFTA 5CGYC 5IBLC 1VFAA 4BBSH 5J1SC 1S40A 3IMUA 1MWAH 3STZA 2KZKA 3OZKA 2EDMA 4K5NA 4Y16D 1EPFA 3UOAB 4BE6A 3U9UB 3RFZC 4KKZA 2I25N 3D3VB 1H5BB 1DVFA 4KI5F 1BBJA 2GUOA 3K8LA 2Z8WC 4MGXA 3BUPA 2EAEA 5AZUA 4RGMA 1AC0A 1OCWH 1QPKA 1P9MA 1ANUA 1AIFA 1TZIA 4OJEH 2JA5G 2UX7A 1VIWA 3PAYA 5EHFA 4Z95H 1IFRA 1XZWA 5C0DB 2HLAA 1CURA 1XXFC 4Z5RB 3H3VC 5ISZA 1T1XA 2WQ8A 3BUYB 2HD3A 1PZJD 2K75A 3A7LA 2FCBA 2JI1A 2XKNB 3QXDB 5IBUG 5AB9A 1E9QB 2FUQA 3OLIA 3CGTA 4HX1B 5ECJE 3GSQA 4KZEH 3NCYP 5LCVH 3O6KL 2ED6A 3QCTL 2R0ZL 1SOKA 3PXJA 3MA9H 3BAXA 5HJBA 3GB7A 5BUAA 1EZSA 5C08D 2JA5H 3V6ZB 4X6CE 1UD5A 4QGTA 3VGBA 3N40F 3GI8L 5E4OA 2HVBA 5T1DL 1NMBL 4R0LC 3A67H 3MODL 2KHIA 4LSTH 4RSYA 4ZAKC 5GRJL 5B1BB 1J10A 3DUHA 3MNVA 4L1SA 3MZGB 5LAXB 2Q6WB 3ULLA 1TCRB 2DMKA 1B88A 4ZFZB 1SMYD 2YD8A 3FFDA 2B63B 2P5ED 1R3HA 4FI6A 2JQOA 3K0WA 2H45A 2MQCA 3HG1E 3DROB 3RWEB 3L81A 5K1JA 5I1HH 3WNKA 1BFOA 2J20A 3RVXC 2DQJL 2EIDA 2P4AB 3QA3B 5CKGA 1N7MH 4AMKH 3BDXA 3E0JA 3LB6D 2ZUSA 2EH7H 1D5BB 5DD5L 3UGEA 3FVQA 3B8YA 1IIKA 4OLZH 1NTDA 3TVMC 3NSCA 4Q4EA 4DAPA 4FFZL 4M3KB 2ITDA 1EYGA 3IS1X 4G8FB 1EIGA 4JBWA 1DCEA 1NBVL 1RKRA 3T4YB 3WTSA 2BHUA 1YY8B 3BWZA 5EU6E 3U1SL 1BMGA 1HEJC 2OMWB 1XT5A 4WY7L 4NDXA 1ZEAH 4XP6H 5I15H 2WKOF 3EOTH 3T8VA 2KT6A 4L1TA 1SNDA 3S15H 3WU1A 1VACB 2MHAA 3CRKC 1MWAA 1NGYB 2YD7A 4MZ3A 1LV9A 2J88L 2Y2YA 1O7VA 1ZHLB 2WBJC 3WUWB 1OIOA 1T20A 4K8RD 3HE7D 1SBSH 1IGMH 4PRPA 4XQNA 2Y07L 2AQTA 4AOFA 4AIOA 1XH3A 2A6DA 5EORL 2HUGA 5A3ID 2F1AA 3LH2H 5IWLC 3U9PH 4G9FB 4GKZA 4U1MA 1L9SA 5IVNA 4GG6F 5I1DA 3DV4B 1U58B 1NDTA 4H7VA 1KTDA 1ZKAA 1A6UH 1KB9K 1TWAH 1ZE3C 4JO1L 4N0YL 4Z6AT 2EIJB 4OZHE 2VQ4A 1EGJA 3H85A 1CFVH 5M3MB 1VQ8A 1MCFA 4G8EB 4O2CB 4FNLH 5J5EA 2XX1A 3IDXH 4YBQC 5CXPA 1WI5A 5DK0A 4HJJL 1R3JA 2YZ1A 1UB6A 3T53B 4XMKH 3M1BA 3L5IA 4UAOC 1F4HA 1NCDH 4HZLB 4BKLB 1EV2E 2A74C 1I7ZA 4WGWB 4GQ9L 4AV4A 3GNML 4JFEA 4MHHG 1RAMA 4MCZA 4KKCC 4ZFOB 2EDEA 5FLXL 3RVXD 5DR5H 4FG6C 3PAZA 5I82A 5KYXB 3HOYG 4FQXB 1B0RB 1LABA 2BC4A 1TS2A 4LHUA 4D7BA 5LL6S 1J0YA 2B9BA 4JG5A 4OFDA 2VLJA 4PZ8A 2Z0SA 3S15B 4M3HA 3QXTA 1O0VA 5AUMA 1J5IA 3UDFA 3C75A 4RX4A 1VF7A 1L0QA 4KY1L 4P9ML 1U8OA 1G6RB 1P84J 1TOXA 1U8IA 2JLPA 4BKLA 1W0WA 3ULUL 4GS7B 1DL7H 4HUUA 3EDJA 4EXPX 3OIQA 1DQKA 3O4LE 1JZFA 4QOKA 3BESR 3E6FA 2O93L 4AZUA 2IXQA 4X6DF 1WISA 2FX8L 3B3IA 2ID0A 1NAMB 2X89A 1G7HB 3SKNB 5TQ0H 3C2PA 4C4BA 3WEXA 4EO5A 4X7SL 1VB9A 5BJTA 4TMPA 3I4NG 5C07D 3QNYA 2R0LH 5LMNQ 3VDYA 4AE0A 2FE0A 4S11A 3VR3A 3N06B 5E6IB 2JJUA 1HZHL 4ZD3H 2XVBA 5GS0H 4JQIL 5I6XC 1MRCL 4KK6D 3BYTB 2F1BA 4I2XB 2W9LA 1ZLVK 5BS0B 8FABB 1CPUA 5EBLB 3QP3A 1NCAL 4DUYQ 4WWKC 3VGGA 3U0PA 2C9OA 4DV1L 2QSCH 2YR3A 2JA6H 2V5SA 1THAA 4WW1B 1N5YL 1NBWA 2KJXA 1NFDB 4DKDC 1FNEA 1SYCA 2XBDA 3H6MA 5IKCB 5DHVA 3CCVA 1GMEA 2X1XR 2Z7WA 5C6TL 3RYMA 1U4LA 2GA4B 4IFDG 3TBYB 5F9OH 2DWTA 5KBNC 2BA1A 4A67A 4AVJA 4YSAA 1XGUA 4PJ8A 5DRXB 1CO1A 3ARDD 2NNCA 4UILL 3HOWB 3CFDB 5E2WL 2KPNA 2WNXA 4W9FC 3VFWA 5D7LB 3M17B 4HJTA 1QASA 4Z3FA 1STHA 1IYUA 3CBJB 3EJJX 2H5XA 1WO2A 3GSNH 2QSCL 3ESPA 3OKMA 3QWRD 4PJ5B 4ZO6A 1P6WA 3S1NB 1GGBH 3ZQXA 2MKWA 1DO5A 5JW3H 5KSBF 4PJ7F 4N0UA 5FUOH 4ZXBB 1UXSB 4JQIH 3IF1B 1KELL 4PBDA 5KSAC 3MLRL 5CKAA 3GXMA 3IETA 4FF4A 4ZUVB 3GBNH 3HMWL 3G6DL 5D1QD 3FUKA 3RVVD 4LCWE 4UP8A 2FINB 1D7BA 3SYCA <