2QKIC

Human c3c in complex with the inhibitor compstatin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
306
structure length
292
Chain Sequence
TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Structure of compstatin in complex with complement component C3c reveals a new mechanism of complement inhibition.
pubmed doi rcsb
molecule tags Immune system/hydrolase inhibitor
total genus 60
structure length 292
sequence length 306
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qkiC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2qkiC01
2TMPA 3L3OC 3I70A 1JB3A 3V96A 2J0TD 4FXGC 1UAPA 3HS0C 1JC7A 1GXDC 1BR9A 2A73B 2XWBB 5JPNC 2QKIC 3CU7A 1BV8A 3KLSA 1AYOA 2PN5A 2E2DC 1BQQT 5FO7B 2I07B 2WINB 4ILWA 5JPMC 5FO8B 1UEAB 1OO9B 2XWJB 1EDYA 3G6JB 1XWEA 5FO9B 4D94A 2A74C 2ICEC 2B39A 1PXUA 3MA2B 3FRPB 3T4AC 4LNVA 4FXKC 1D2BA 1BUVT 3HRZC 2WIIB 5FOBB 3OHXC 3CKIB
chains in the Genus database with same CATH superfamily
2QMJA 2D7PA 4M8QA 5E4EC 4KTGA 3AWFA 3OQRA 2P8LB 4C58B 2GVBA 4GH7B 2V5YA 2HPTA 5C6TH 1X6LA 1SOSA 3FPYA 4F7MB 1JI1A 1UWFA 4NBYB 4GKNA 3GRGA 3ZVVA 3G6DL 4R0LB 1PA6A 3NZHL 4FTVB 5G5DA 5TF1L 3PHAA 1GL4B 3HOGA 2F0SA 5FFOA 4WWNA 2E9JA 4GSDH 3KNBB 4A6YH 1OCWL 4B3EA 1VQFA 3CK0H 3IU4H 4DFAA 5IHZA 2BNRB 2AK4A 4F20A 2BNUA 3RGVB 4GXUN 2WXKA 4JZJB 5H4ZA 5FO9A 1KG0B 3QO0B 3SE6A 3SKOB 2DQ6A 1NCAH 1MJ8H 1IAIM 2VWEE 1LO0H 2VUMB 3IDNA 4DOHB 3ZE0E 3GLEA 1CICB 4JI4L 3REWA 5DRNB 4HMDA 1BR9A 3T56B 2WTRB 1YEGL 1U2CA 3BI9X 2Z64C 3K46A 5I1LB 4BZ1H 1BIIB 5ELNA 5G4OA 4I3RL 5A2AA 2BSRA 5L9DH 2NNXA 1DBAH 3B7TA 3KBHE 3KYMB 1EEYB 3U36B 3S1QB 4X6EB 2Y06L 3C09B 4R4ND 4NC2B 1FR3A 3CFKB 1NQBA 3L3OA 5JHBA 4XB7A 2WBJC 2W0KA 5AW0B 2D03H 4MAUH 2XN9D 3HUJB 4TNVK 2V2WA 2G9DA 5GSVA 3S48A 3S16H 3I74A 5T5FA 3IAGC 2B1HH 4U6HA 1M6OB 2BOLA 3ARXA 1GXDC 2XQBL 3PHSA 4B9JA 3RWEB 5CZVL 3HOVB 1N64L 3FAXA 3BGFC 1AYOA 3BVUA 3KLAA 4OLUL 3ZKND 4J23A 1ZLUK 2RBMA 1F13A 1LYLA 3QOJA 2LXKA 4O58L 1TVDA 1ICWA 3CHXA 5DJAA 3CFDA 3CG8A 4L4VE 1HEZA 3M4OB 3VI3E 4C3HH 2A1WL 3GZOA 4LGSB 3IKKA 1L9SA 4LEEA 4ZUSA 1BX2A 1NCCH 2LTQB 3BDLA 1BDYA 5BOJA 4OLYH 5CEXA 4YPGB 4HISA 2RHQB 2GKIA 5TE4H 3WTVA 4FA8A 4LFHD 4LVNB 4A3JB 4HS3A 5C07A 3D31A 1MZZA 1NKOA 3SQOH 1ZY9A 4ERSL 3P3UA 1HHGB 3AEVA 3Q6GL 2F53D 4LL1A 1CTOA 4P5SA 1UWXH 3IXAA 3V4UL 2H2PD 2H7WA 5GGSB 1YMMD 4ORGB 4PGDB 1T1ZB 1EJFA 2MP1A 2BSCA 2QGEA 4ZUTB 2X70B 1QASA 3TXAA 2HT2D 4DV7Q 4GRMB 3L5JA 5GGRB 1R0AL 2DUDA 1C8PA 3EUDA 1D9KD 3L4CA 1LT4D 3BG3A 3NEMA 4X4MA 5FXCH 4UUJA 2CJTA 3QG7H 1KIRA 2DLIA 4EDWH 1I1YA 1SUJA 4CA4A 1WIPA 3BUYA 5K39B 3EBGA 1A14H 1QUPA 2YD3A 1IBKQ 4S1SH 3F62A 3QQ3A 3VRLE 2P28B 3C8HA 3VFNB 3G6AB 3WO4C 4JI5Q 1EFXD 5D1QB 5C0FA 4QJFA 1U0QA 1U41A 2HJKB 2NY4D 4HD5A 3DUUB 1BCIA 4B3TL 1VERA 1NE3A 3HHMA 5ALBL 1TWCB 1KF9B 1J9SA 2XPGA 1OTSD 2EDDA 3Q5YA 3U7WH 1XCTB 3PCYA 5H1SE 4DR4L 1OAXH 2WTPA 2E9WA 5FYLD 4HWBL 3NJVA 1RPQA 1IBZA 3KR3H 5DD3H 1E27B 1UXWB 4E36A 1TKWB 2FFKB 4K8IA 1XH2A 4ETQB 5LMNQ 1NEZA 2J0TD 2B63G 4FXGC 2VO5A 2XICA 3QNYB 1PZAA 5FYKU 4ZO7A 2OF1A 5GQBA 1WUZA 4Z23A 2D3JA 4RNRB 4UNTA 4Y16B 5E9DB 4FNSA 3IEAA 3BYYA 2ZKXA 3HKSA 2GJZA 4KKAD 1V8QA 1Q86C 5B1CA 1AH1A 4FHKA 2R56L 1Q9KB 3QISA 2HYMA 3NXWA 1JWMB 4KKLD 4Y1AD 5BRZB 2DQJL 2AK1H 1YUHA 3OKLB 2JEBI 2W9EH 3FO9A 3CHSA 2FHBA 4GQ9L 5TFSL 3L45A 2WXFA 3VVVA 2ATKB 1YJDH 2F1AA 2DQIL 4IKLA 1MW3A 2C35B 5AB0A 3VD9A 2BIPA 3FNKA 1MELA 4S1QH 5E2TH 3MJ7B 3S17H 5CMAB 4EI5D 1IBDA 4KH2A 4BD4A 2DMGA 4BH7A 3VRIB 1BCPC 1RU9L 5DD5L 3MRJB 5C09E 1GGIL 2PO6C 3U2IA 1BVNT 2CIIB 1QVCA 5JHLH 2H0EA 4R97C 3TO4B 3OR7B 1CK0L 1TIUA 2FHCA 2PNDA 2QQLL 2VZ3A 3F7PC 5KN5A 3CN1A 2VZTA 4W93A 4C83A 3WLBA 2O30A 4PJ5B 1Q72H 3BWUC 2JELH 4GAAA 1X3QA 1OSPL 3LV3A 4LOFA 1ZXKA 4ONGH 1MHPL 1ZWIB 2UZXB 3EYVA 4I48A 5FDYA 3W2DL 4MXWL 1IL8A 2AJSH 3AYHB 5K9OA 1H5BB 3RUGB 1M4KA 4G7SB 2IWGA 4QOKA 4UV4H 5LDSA 1KYOK 3HLKA 4NO3A 2DJUA 4PLNC 1FF5A 1CB4A 4XNQB 4Q9BA 1U8OA 4WQOA 3FCSB 1TEYA 1FGVH 2ITCB 3E3QC 1LD9B 2ADIB 4OLZL 1J9TA 1A7QH 2B0SH 4E68A 3QZPA 5DLMH 2R6GA 1P5UB 2HKFH 4NJAL 1C0AA 2AF2A 1KIPB 4EQ5A 2OCCB 1RIVH 4HCRA 3WMQA 4F37K 1W6JA 5BW7C 4CL7A 4NN5C 5F6HI 5FA3A 1HHJB 1QHPA 3D2UB 1N2RA 2XWDA 3B7SA 4UQCA 4APQC 3WIFA 5AJ3Q 3WFDL 1B0RB 3VXUE 4Y5YA 5C3EH 2FLMA 1U8NA 1J0JA 2HFGL 2WUBL 2RA4A 5IWLA 1LQSR 2YJLA 3TVMA 4HXAL 2PNHA 3S5LB 3S9WA 1QZHA 2ZAHA 5DUJA 5LGHL 4KROB 3CQZH 4XAKE 1IGTB 1MCKA 8FABB 3A56A 4R4QA 1OVZA 3S8WA 4ODXB 4Z76B 1R24A 1WA2X 1OK0A 3BGAA 4GSQA 2W59A 2YHGA 4NN6C 3RNQA 2PWFA 5BMFH 1C8QA 5IUCA 1DUZA 1AKPA 1EFQA 5KEEA 3ASNB 3GXUB 4NGHL 5I8OL 2O6CA 3MAWA 5HYIA 3BX7C 1YHBA 3P3YA 2EDRA 4LSRH 2ZSVB 1RUQL 4QF1B 1FL3A 2QF7A 3BDBA 2ZOUA 3R93A 4O02B 3RY4A 2Y24A 4BA2I 1HKLH 5HD8D 1IAKB 3RBSA 4KK7A 5E2VH 3DYMA 5F9DC 3RDTC 1HILA 4X6CB 5CINL 1M53A 4G6AC 4K6DA 5T1KB 1AO7A 1DO5A 1HQ4B 4N2KA 5M9OA 2PUQT 4WW2A 1FIGH 3F5WB 2VDNB 4EVNA 4BH8A 5CV6A 3PP3H 1N8ZB 1J10A 1NL0H 4FQLH 2FX9L 4OF5A 4WWKB 3BDCA 2VLKB 4LVHC 1S9WB 3CZNA 5E4IA 4N9TA 1GGCH 2XRSD 4A3MB 1R3LA 1SXAA 3DTUB 1NTGA 4JGNA 1IIIA 1U21A 2F7IA 4ALPA 4UQ3A 3K4AA 1PJ9A 2KH2B 1WZKA 3DXAD 3VUAA 4DGYH 5I6KA 5E6SB 4PH8A 2A77L 1MAML 5IYBG 3ECUA 1JE4A 4G6JL 4L3FA 4J28A 4LSDA 4PLJD 2PWHA 3TEZA 4WWID 5EPLA 2GITB 4Y0GA 5KZCB 4JRYE 5FLXc 2BSBA 5EPKA 2NVQH 2DH3A 2BIOA 1BVZA 4JI3L 1CQYA 2BS8A 4GY4A 3EFDH 3JVFC 5JPMC 4JO4H 4Y4KB 3KEDA 3AREC 3VMPA 2AQ3B 5IWAQ 5EPMA 4AJ0A 1ZXQA 5D1ZD 3K3QA 4NQSB 5KS9F 1G7MB 3W39A 1F02I 2YTVA 2BVQA 3KBEA 2QKIA 4KBPA 1G9EA 3ESMA 4NJ9H 4OEMB 3OW2A 1I8MA 1JZIA 5D70L 4PI2A 4X4ZA 2K0RA 3TJPA 3GQFA 2WLIB 1A63A 3SDDB 1CD1A 3CDGA 2XIWA 4N6RA 3G5XA 2VDKB 4XC1H 5D93B 3A24A 4PY8J 1PFBA 4CBVA 3FQYA 4PD4K 4G6ML 1VCIA 4CU8A 2QPFA 5EIVA 3U9PL 1CS6A 4PBWD 2EYLA 3VG0L 2YGNA 4OLVH 3TV8A 5EIIA 4ALAL 1I8KA 3IRZA 1XMOL 3GXNA 2Q0ZX 4RISL 1CZ8L 4G8IA 1CFTB 1OF2B 3K5RA 3SPJA 3HG9A 4NYLB 2X6UA 1STNA 2Y1VA 4S1DC 4UAIA 1HZAA 3LOWA 3GTQH 2MQHA 4XYOA 4J4PC 5T3XE 4FYQA 2COVD 3BPLC 5E8NB 3STLA 4M1UB 1D7BA 4YSUA 2Y07L 3HC3H 4LPCA 1E6JL 1S7VB 4HUNB 3L95B 4I9WE 1MJCA 4DZ8A 3D09A 1DQJB 2H41A 4LFCL 2DMHA 2J6EA 1XGTB 2R4SH 4Z7VB 1B9MA 4N28A 4OCRL 2E4TA 4MAYC 5MERB 5D3DA 2ADYA 4K8RL 4JE4B 4KJYA 4M62L 5D2LF 3V6FA 4IRSD 1D5ZA 3V0VB 1OE3A 1G7LA 2IAMD 4NP4H 1NGPL 5FYKL 5L6YH 3QDJE 4DF9A 3ULUC 3NDYE 1P0SE 4RGMA 3MMEA 5DZAA 5F7MC 1S9XA 4A66A 1GJIA 5AAWA 2EDGA 5M7QA 3VQLA 3X11B 1CLZL 1Q12A 3EH3B 3IF1A 2YWYA 1KWGA 1HQRD 2APVA 1PL3A 3BYTA 3DWTA 3RGVC 1AKJA 2WNWA 1ECZA 2AV1B 3B34A 1NWPA 2V7HA 3VFMB 1JYXA 3NTKA 1KCBA 1U3YA 3IJ7A 3NFSH 1U8MA 4J3OH 5H37A 5TQ2L 3S2CA 1CICC 3QXAB 5B21A 3TZUA 3BHBA 1XSIA 2QQQA 5IHBA 4V190 4HDIB 4PY7B 3T4YB 4BFBD 5HGAB 3LPWA 2WNGA 2QHRL 1PH3A 3AXHA 4HOXA 4ODGA 1MREH 3HMXL 2VDOH 4BK5A 4X6BA 1AOZA 1CTNA 3HAEG 1J86A 2NVTB 2Y7OA 2E7BA 4GFTB 3BFWA 1QSED 1R5VA 5BN3A 1VQNA 2WLKA 4I1NB 1CFSB 2GYSA 3PUXA 1JBJA 4ZFZA 1JHTA 1RIUH 2ADGB 3GV6A 1KTLB 1I4GA 2MPAH 3LCYA 4TVUA 3BIAX 3NCEB 4A2HA 2C8NA 2I5YH 3O3BA 4MX7A 5HHVH 4HSPA 4FZEL 4OIIH 1L9QA 3VFPA 3BDOA 1CLCA 1T03L 2NN6G 2W65B 3BD3A 3DUZA 2Y4SA 3SKNB 4CJ1A 1AGDB 4YEFA 3OAWA 4HCGA 3QXTA 1SSOA 2BRQA 3TP8A 3ET9F 3EO1B 3FQNA 3IDJB 4R4BA 2GI7A 2EKSB 3OKEB 1OLLA 2C9OA 4YDMA 1MNUH 3MV7D 4B60A 4IUTA 1IBLL 3NENA 3L9RB 4RBPH 4RX4A 2BY0A 3AG1B 4MZ3A 4XX1G 4DVRH 3JVGA 2M2LA 3QEHB 3LGJA 1HNZL 2QV4A 4HLEA 3IETA 2LTQC 1MAJA 3AQDA 1QBLL 2XVGA 1U4FA 2XVKA 3QUXD 4HJGA 1HFUA 2EILB 4G5AA 5TGBA 5CFHA 1K73C 4XO3A 5D7LE 3L2MA 5CV7A 1NDGB 4QRRD 4FHJA 1JGLL 2A4EA 3PV7A 3QJTB 4ZYKA 4AGQA 3WTWA 2ZKMX 3RZDB 5PAZA 2YS4A 4TVSa 5CCGE 2AMCB 3MRQA 1KCUH 1HHKA 2BOBA 3CP0A 3QNXB 3PV0A 4FS0A 4QXTA 4TTDD 5I6PA 3TBSA 4KXAA 3ND8A 2VQFQ 3A6CL 4GS7B 3T8XB 1A2UA 2MNUA 1VB9A 4G82A 1V7ML 5IOPA 3Q1EA 4X8JB 1MHCB 1B3JA 4YLQT 3E0GA 3ZE2F 2UUBL 4Y52H 3ARQA 3IK2A 4Z7WF 2ALYB 2WXGA 1O78A 1I8IB 3QORA 4HU8A 3HS8A 2HRGA 4HF5L 4H25A 2JQOA 2CLZB 2EO7A 4NKDA 4MZIA 3CUPA 4LNQA 3VNYA 4O0AA 1IE4A 3QQ9C 4G80B 4UOJA 3WNPA 4F5CA 2R93G 4GSRA 4PWHA 5D1QC 3TT3H 1BBJA 3B2VH 4BFIB 1YHQA 5CD5C 2W95A 2ARJQ 3H7LA 3K7AH 4Y2DD 3NESA 2Z8VC 5IQ9A 4YE4L 3V52L 1PIGA 2EC9T 4NKIH 2CKBA 1OIOA 2XA3A 4IDJH 4WK0B 2BWIA 3NP4A 1YAIA 4V33A 1KDJA 4OTXL 1AZZC 2AQQA 4XCCL 5CJQL 2CW0C 3JV6B 4H8PA 4NM4H 5FWQA 3ILEA 4MWFB 2XQYK 3MV11 3SOTA 3X3FL 1TFHA 1E43A 1BYNA 4U3CA 5IB2B 2FYVA 3KE0A 4KI5E 4MJIE 5HGHA 2FO8A 3O4LD 3EYUL 3MA9L 1INEL 3D0LA 2YPLB 5IY0A 1T7ZA 4Y16C 5KJ7E 3MFGB 4I4WB 1JPEA 4YHZL 2PABA 1X7SA 5LMUL 3T3PF 4JMNA 5C0CA 1MSPA 3IFLL 1R4PB 1OD9A 3VGDA 4JPSA 3MHBA 3RWJA 5KYXB 5I30L 2IG2H 2EE6A 2ZUTA 2GJ6D 1XZWA 2D8KA 4PNYA 3GI8L 1EOVA 1AGBA 4PZ8A 2FATH 2Q3ZA 1BQUA 1E9QB 2R29L 2NNAB 3CN0A 3MRHA 4O2CB 4WJG3 2HFTA 4BZ2A 4RAVA 1UOKA 5A2CA 2ICEC 1IYUA 5ID0A 5KSBA 3L08A 2Z31B 3P4OB 1SNMA 5JXEC 3DO4A 2WB1G 1VDGA 2DBLH 5E5LA 4W4OA 4Z95L 3ZRSA 4Z7UB 3KWVA 4FNTA 1GHJA 4FF9A 3BKCL 4PVNA 4A67A 4AMKL 5KVFE 3CVHB 1J8RA 4QT5B 3U6XA 2DWXA 5DEZA 1BQQT 1JV5B 5SWZB 1H3PL 1YEFL 3U1QA 1CE6A 3E6FA 5CGTA 1WTQA 5J5EA 2APBA 2YC1B 5MP6H 1LK3L 4X66L 1H5BC 2VRKA 1P5VA 5TK4A 2K3HA 1S3KL 1Y6MR 4IBUA 3K59A 1BJ1J 4HIPA 3Q48A 2VDML 5DS8B 4POGA 5DEGA 2AJXL 3ZTNL 2EIBA 3WS3B 3HJ0A 3W56A 4DR6Q 1BVLA 1FC2D 4FLHA 4BSVA 2A6JA 4OJDH 2AXFB 5F1OB 4NB7A 4KHPQ 3RVVD 3IGLA 1AC6A 4A3LG 4P4KA 4LARL 1YN7B 2M1KA 3LZFL 5C0AB 2DWSA 3NA9H 3GC3A 2UXBL 2YR3A 2NXZD 4NAMA 4P2YA 1B4LA 1TWHB 4MMYB 4RDQF 1ETA1 2IANE 3F00A 4QXUH 5FKAC 5IEHB 4ZTPH 2RHSB 3QXUA 5HI3D 1UB5B 1I1RA 1O75A 2DLTA 3ZPDA 1QFPA 4HKBA 1K83H 2IMMA 1JOKA 2BVOA 2KMWA 3IMSA 1FYCA 1UCTA 1UM4H 4X7TA 4Y2NA 3VM7A 3IM1A 2UXGA 4ZXBB 4MA7L 4JJ5B 3QFJB 4GO6B 5IFAL 3P75A 4X42A 4FQPA 1FNGA 4LCIL 3ZY7A 2R0ZL 2F5AH 3U4BL 5KVFH 3ATDA 1A3RL 3QG6B 4A3CG 4KMQA 4P46B 4Y89A 5GGTH 1A7NL 2AHIA 3MBEB 1H15A 5ESVA 2WN3A 1FZKA 3Q5TA 3HOUG 3GHEL 2WLLB 1YY8B 2FIKA 1ZTXL 3W3AA 1PU0A 2G0LA 2OX5B 4PJ7F 3T1HQ 1AOHA 5DI8B 4NNPL 4YHPA 2B63B 2DWEB 1R5WB 4KKBD 3QULA 4FHBD 3LKPB 2WVVA 4X7SH 4AIZA 1FC1A 1E30A 2P24A 4PWIA 1RTNA 3O8XD 1X5JA 5I6OA 1S6NA 2R2EA 3DRTA 3MGTA 4JCVE 1NCBH 4GOPA 2B59B 3QIUC 5FYJD 5I2IB 3ARFB 3UC0H 3DGGB 1HZLA 5IR1A 2C7UA 1OAZL 2VM9A 3KJPA 2BMKB 1EHAA 1BD2A 1MW1A 4NQDA 2NN6I 4Y5VA 3IFPA 1WIUA 2P8PA 1JGEA 5CP7A 1HK6A 4JFDA 3S1MH 1SBSL 3RPIB 4UDUC 2ZXBA 5LXGH 5BW7A 4OF0A 1JXFA 3V95A 1S4IA 2I9LA 4NCC2 1EZUA 1DBKL 4ME5A 1G6RH 3DBXA 1X9RA 3FO1B 2XN9E 3U7YH 5IEKA 5L2KA 3WEXB 1DJYA 1XFPA 1KLGA 2ZUQB 5ANME 3S97C 1CSPA 5M3FG 1AD9B 2ED9A 2FH8A 4MB5A 5C07D 1HTLD 4DZBB 3APMA 3POHA 1NGYB 4L1HA 5HYSG 3NGBB 5DQ9A 1HZCA 4PUBL 3U4AA 1VQPA 3H9SA 3UTQB 3D39B 4OD2B 5GGUA 3SBQA 3IBOA 4LWCA 4WTQA 5AALA 3WTXA 1XZ0B 4F93B 1WVZA 3CXCA 4CGUB 3V0EA 3M86A 2B4CL 3DLLA 5AW8B 4NQUA 3II3A 1IYJB 1XNRL 3JT2A 3UJTL 1S7TB 1UXMA 1AMXA 4QCIA 5DMGD 3US9A 4M1DL 3OJ2C 1N26A 3MZ5A 4PPTA 4MD4B 3VA6A 4JO3L 3OWEB 5CYUA 3DSFH 3WXVH 3CCLA 1KXTA 2R7FA 4PJGF 2PMZE 3K2IA 4ANVA 4Z0XB 3WCYA 5I6MA 2F53E 1B3QA 4IJ3C 4FFYH 3S96A 5F7NC 1ZMYA 4YEEA 3SKJL 5KSVA 1R3KB 2YXMA 5D93C 4DAPA 1A0QH 3FN3A 2YMXH 3FHQA 3AZUA 1TWGB 5JO5B 3U0WH 2VDQH 1Q8MA 2ZX6A 2D31A 3SR1A 2YMTA 2WKDA 1BXAA 4FXDA 3RKDD 1B2WL 3FQUB 1WCMG 5FLUA 3UH8A 4YHMH 4O5LH 4QHPA 5GRWA 5I6XB 3BZ5A 4AT6A 5AFWA 1GGBH 1OKEA 2BVPB 4JPIA 2RBLA 2P45B 1QG3A 4AJYV 4MQ7A 2ZONA 4N20A 2B9BA 1RL2A 3F7KA 1QFWH 4K2UL 3Q3GB 2J1ZA 1QRKA 4IUPA 4JFOA 4FD0A 4J1MA 4KMTH 4KY1L 3RIFF 2MQCA 4YSEA 2OMNA 4JI4Q 1EU3A 1JFQH 1GGTA 4Z3HA 5MEQA 4YHLH 4ELDA 1HL5A 2DJMA 4MMZB 4KKPA 4QHUB 1REIA 1HZHH 4YXLH 3P11L 1QTYT 5IB3A 5FYLE 2Y6TE 1MCQA 5DEHA 2NYZA 1H9SB 4FC3E 3UJIH 1I7ZA 1NCNA 3HW7A 4FQXC 2Y5TA 4WUKL 4R9HA 3EJCA 3FJTA 2EVGA 2NR6A 5CBAE 4LLUA 3TONA 4U31A 3NIDE 4G6FD 4ABQA 4AWJC 1DL7H 4P2QB 2K05A 5CGBA 1FRGL 4DN4L 5K1VA 3C6SA 5GS0C 2A9MH 4OLXL 4E42B 2EEDA 2F4VQ 3MEHA 3IAQA 1Y8NB 1NOFA 4GW1B 2AERT 4JDVB 4JGMA 4M61B 4MA8L 4PB9H 4WJKB 4X6DA 4XC3L 1AP2B 3FPXA 4A3GH 1NPNA 1T1YB 3OKYA 2EZ0C 1ENCA 1STAA 2EKJA 4AEHL 1JORA 3GHBH 4WF7A 2M26A 1A6ZA 5B3NA 1M7DB 3G7LA 3FUEA 3E0EA 3BZ4A 1L9TA 1OGPA 3FH7A 1NGZB 4Y1AE 1GOZA 5CC4A 1M71A 2E5EA 5EZJB 1HXKA 5FHBH 3RWDA 4DR7Q 4YWGH 3RG1C 3MLYL 4NNYA 5SWQB 1UD3A 5IB5A 1DQQB 4HUKB 1A2TA 1PSKH 4RMRA 3CLEH 5A16B 2F4IA 2PQEA 4KUZH 4MQSB 3TA3D 5K59E 1E9PA 4BSWB 4CMHB 4WV1C 4QPEA 3I4OA 1VGKA 3FUMA 2HMIC 5CU9A 1O7ZA 2BWDA 5JOFB 1HS6A 4QOKD 4KDTA 4J6IA 4NENB 3KLHC 4GLRH 1QRNA 2XU9A 4FQ1H 5CV8A 3MREB 4MZ2A 5FYLH 2C3VA 2AV7A 4KZEH 4M7KL 5CD3B 5FLVA 3K7UA 5M5XB 5T33H 3MQIA 2P8LA 2EDLA 1GC1H 3W38A 4PRNB 4F7MA 4D0DB 3S15B 2ARJB 3NABH 4QI3A 4GQZA 2Y1AA 2ZUXA 4MGXA 4N2OA 4FTVA 4R0LA 3RVTC 4AV5A 2YPVA 2JA6H 3KNBA 4W9EC 2RH0A 2W94A 3FN0H 2CDEB 4I2XE 2IX3A 1OGSA 2P5EB 4MN3A 2UZIL 1TZGH 2BNRA 3TVMD 4Z77B 1A4KA 3DARA 4PR5B 1SPDA 3RGVA 3BZKA 2YD1A 2IH8A 4JZJA 1KG0A 4K71C 4OZHE 3QO0A 5BV7B 1NTDA 4W9HC 1U4RA 1TLKA 3OXRB 3VX0A 3DJRA 1SMOA 1RP9A 2NWGA 3GTKB 1CICA 1QBML 2K7QA 5DRNA 5FGCB 3CFQA 3T04D 1WJJA 4RH6A 2WTRA 2K8QA 4H02A 1AXSB 3T16A 4K3HA 1XPUA 4YS4A 1A7OL 4IEFA 1BIIA 4AKOA 4C2MH 5I1LA 1P84K 6CGTA 3CZUB 3P30L 4M7JL 4M3KB 4ENZA 4X62L 3GIVA 1FGNL 4NWUH 3KDMB 1UYWH 2Z8SA 3CSBA 3KYMA 1EEYA 4L0ZA 4OAWB 4CKEA 1T21B 3AROA 2L7UA 2VGLM 3LEYH 3DC0A 4X6EA 1C16B 1CI3M 2A9CA 3CFKA 1WFQA 3BQVA 4K94H 2OFQA 5HI5D 1U8CB 1B2YA 1IAIH 2EQSA 1L0XA 2G3ZA 1AZQA 1FWXA 2X0UA 2Q8AL 4OGXH 1F58H 4WWOA 1M6OA 4GXVL 2C3WA 3QUYC 1V3KA 3MJGX 2Q20A 3RWEA 4FQQA 5FYKD 3CPFA 2JCCB 4N0FB 1HUMA 3UABA 4DP2X 4PGCB 1FNSL 1A8ZA 1MWAH 2H1EA 4AE0A 3T2OA 2F2HA 5I8EB 3BP5B 2KEDA 2FX7H 1MQKH 3EJZC 2HUEA 3GTGB 1A4JA 3D25B 3LB6D 2OMBA 4YPGA 3HOYH 3GRWL 5IBTL 4GG6F 4LCWA 7TAAA 1AE3A 2XZQH 3OTTA 1KCVH 3TF7C 2CPCA 1SLVA 5BO1H 1XCQA 2R3ZA 4Y2LA 4N0RA 3HAEB 3DXAE 1TJIH 1H95A 2VXVL 2FWUA 4Q58C 5GGSA 4ORGA 1T1ZA 1OM3L 5D2NB 4ZUTA 4LF6L 2X70A 4J3XA 2H32H 5IROD 4GRMA 2NDGA 2Z8WC 5GGRA 4S0HA 1QFUH 4KLKA 3GDCA 1XF1A 2DJSA 4BHUA 5EBWB 4PJXE 1HR0W 4PJFF 3QQ4B 5K39A 5TSSA 2HHHL 1RZPA 3D3VB 5CP3A 2QADB 5HJGA 1OK8A 3MX0A 3VJ6A 4RFBA 1CD8A 2YYZA 1LK2B 5JHDB 3VFNA 4TOYH 4YDZA 3G6AA 4ONHB 5JIPA 3T0BA 5D1QA 1IW7C 2Z31C 2HJKA 3GGWB 5E99H 2DQUL 2X5PA 1KJ3L 3DUUA 4JFQA 2H2SD 4NC1C 4J3TA 1O7DC 1OTTC 2MQ0A 3H9YA 4AX3A 1VMPA 1NUCA 4GLAC 1CLOL 2V37A 1KGCD 1Q4NX 1SVBA 4BBSB 1XCTA 1RL1A 3WKML 2APSA 4Z3GA 2ZXEB 1CN4A 1SLJA 3HZMB 3NMEA 4LLVB 4TQ8A 2YA0A 1RJYB 4ZTOH 1SXCA 4Y7OC 5F9OH 1SY6L 4ETQA 3AMUA 2XWZA 3ZDYB 4F8MA 1Y1DA 1JOOA 5L4JA 1SZNA 2BHUA 5HHMD 1VZHA 4KXBA 1VGEL 1KUMA 1F8TH 3OR6B 1KT2A 5E00B 4JY6A 3FB7B 1WBXB 5E9DA 3VDAA 1AI1H 2WXMA 4B9GA 2VISB 3T09A 3JWOC 1S7WB 5C4HA 4LF7Q 5KW9L 5D8JL 4YQXH 3QUGA 5D6CA 4MVBC 1VQ7A 1JWMA 2FBOJ 3OIPA 3B4NA 3QSKB 3OKLA 5IMOB 4L05A 2N01B 1AKJD 3BUQA 4LF8L 5B38G 2R93B 1DBBL 4JQIH 1JTTA 3QR1A 2ATKA 3QCVH 4DKFH 1WI5A 1ZANL 5IT2H 3MJ7A 1GZQB 3G5ZB 4LEXH 5CMAA 1XGUB 2J43A 4Y4HC 3TN0D 4H88L 2AWOA 3VRIA 1KGYE 5FW7A 5KAQG 5KWYC 2Z4TA 5FA4A 4NC0B 4N0CD 1IFRA 3TO4A 1QD0A 1JGUL 1K0RA 4P46C 1YPZF 3FKIH 1ORQB 3KMDA 1WLHA 3Q0HA 3I2ZA 2XPZA 5JLZB 4PJ5A 4YOKA 4CC4A 1QUQB 4QIRA 3LRHA 1B0GB 2WQXA 4KDWA 1A7BA 1ZWIA 3DRQA 2UZXA 2PXYC 5FR3A 4CVZB 2A68D 1KEMH 3QHFH 3WN6A 4GKKQ 4AUJA 2G2RA 1H5BA 1GS6X 3H6JA 4M3HA 3OKOB 2NY0C 2YARA 2OZ4A 3O6LL 2RSOA 3SJVB 3GJFA 1ZGLA 5F7EH 4WEBL 1R5IB 4DGIL 1TTCA 4FYRA 3ESVF 2ITCA 3M1CA 1H3WM 1CL7H 1LD9A 2ADIA 1J05B 1X4XA 3GBLA 1R3HB 1P5UA 1QSEE 3K5SA 2XTLA 3EH5B 4JZNB 2EE3A 2XWRA 1QB5D 1F45A 5C0XJ 1DUYB 4RX4D 1FD7D 4RRPA 1HHJA 3D2UA 3ILQC 3KM1A 4ZNEA 5I5MA 1UB6B 1A6VL 3HG4A 2PPBC 1G94A 5FLMG 1B0RA 1HKFA 1I85C 3GKZA 3FUDA 4JFPB 4PJ8A 4WSJA 1UTDA 2V2XB 5JVH3 3TDQA 4FTDA 2WJ7A 3KLSA 4XT3B 3F64A 3SD2A 1J8IA 4WJWA 1ZA6A 1ZT7B 2OR9L 3CC7A 3BVWA 2WB1B 3NGBC 4G2AA 4IGBC 4MNQB 4OZ4A 4XNUH 2WINB 3DIFB 1HSBA 3WN5B 4ID6A 1IGTA 2X4OA 3MV7E 8FABA 4LRIA 4ODXA 3RY6C 1FPTL 2A6ED 1TJMA 2IWFA 1W80A 3KCPB 4RGNB 1RZJH 3QJXA 3H4HA 4WKXA 3I90A 4Q9RL 1NCJA 5H35A 2ZSVA 4GKJL 4DGVL 2Q2IA 4TSBH 4XE0A 2YTXA 4QRRE 3U0PA 3QORD 2P9RA 3FULA 3MVVA 3FCTB 4O02A 1BPVA 3I56A 4B3RL 3JTBA 3RHWF 5G55A 4DT2A 5JW5A 1BF4A 5CILL 5HDWA 3CCMA 1K9TA 2JN4A 4G9FB 2JA7H 1I4QA 2LY7A 2YD5A 1HQ4A 2NW2B 5HGQA 2CLVA 3F5WA 1YNLL 3SO3C 1N8ZA 5EUOA 5ABDE 1ACZA 4WWKA 3QUMB 2VLKA 3UG5A 4BGDA 1EH9A 2YD4A 3D34A 1KNOB 1HQMC 1V3JA 4YZFF 5I6XC 1QVGA 3B9KB 3LS4H 4UWQB 3BXNB 5HY9B 4TKOB 2ZUUA 1ZHNA 4HEDA 1J1PH 2PI2E 1CDUA 2ID0A 4AH2B 4X0NA 2RDFA 3FU6A 4A2GA 1I3RB 2E9IA 4NKQB 4OBRA 3TJHC 5DMIH 1IFHL 5H94B 2E2HH 1FZJB 3BC9A 4EZLA 3Q2CA 5BR8Q 4Y4KA 4HIJB 4MMZC 1I3QH 5BOPA 4FP5D 2OT2A 4XIGS 1HNYA 4WJ3M 4KK9D 3HOUB 4JM4L 1GHFL 4GKSB 4NQSA 5C0CD 3C6EA 4DXGA 2F03A 1ACCA 2VM4A 1QLFA 4ODWA 1LL1A 4J3OF 3I02B 3FDTA 1II4E 3BJUA 2VQTA 4DK1A 5A35A 1KJ2L 3O4LE 4GRWE 3SDDA 4ZUIA 5JW4Q 2C5CA 3CXHK 4H40A 2J4XA 1ZTMA 1MI5E 1TZ8A 4ZD3H 3DWPA 1BBWA 1Q0YL 4AC2A 3QZMA 2I0QA 4XP9H 5EO1B 1FG2B 3FUHA 4XPHL 1X65A 1FVEA 1MJUL 2UWEB 2B1OA 2GJ6E 1OF2A 4FXLA 4NYLA 3ULJA 2P42B 3P9LB 1LEGB 1UM5L 5SV4A 3G9VA 1YEEH 4LPYA 5E8NA 5M3FB 4CMHC 1WBYB 4OY9A 4Z7OE 4NAJA 3NWSA 3K71B 4I87A 2ZOOA 4GP5B 4A7GA 2Z34A 2QEJC 1S7VA 5LBSL 3L95A 2CHNA 5C0AD 3KPSB 1NMCB 4N0UE 1DQJA 4DUZL 1PY4A 5SX5K 1BECA 1XGTA 2HQLA 2FX8H 4LHJB 2Z8RA 4UTBL 4Z7VA 1FHGA 1ZVYA 1K0SA 4YE0A 5EUOB 1JG9A 1RXLA 3S16B 4MJHA 5MERA 4AYBE 2X9ZA 4UT6A 3HP3A 1D5MB 2WXLA 4H7BA 1X9NA 3V0VA 4X0KB 3R06B 5HDQL 5E6UB 4P4KD 4ESKA 2CGRH 3FH5A 4L29B 5DJ2A 1TJGH 3I9GH 3DTDA 3QYNA 3FHAA 3NPZB 2VMFA 4GRWH 4A3BH 3KYNB 4KX7A 3QK0A 5EOTB 3X11A 1XMWA 3IE4A 1UC6A 3MRMA 4PLKC 1A6TB 4KQ3L 3WFHA 3UDFA 2WBKA 1FL6A 2PZTA 3GD1C 3VFMA 4UMGA 2AUJD 3TNNA 3ZE0B 1I1AA 1J1XH 2DLHA 4D2NA 2VB5A 1TU2A 2XX1A 5BQDA 5D65A 4S10A 5CCKL 1Q1EA 3IAPA 1GO3E 3VMOA 1WCMB 1A65A 4HDIA 4PY7A 2X4SB 5HGAA 2W91A 1YMHB 2EY6A 5LQBL 5ESQB 3UP1A 1DANT 3WIHH 4OXPA 1TZIB 4ZO9A 2BERA 4DAYB 1RURH 2G9HB 4P73A 2VZ1A 1KACB 4H2CA 3SBPA 3CU7A 1BV8A 3MLZL 4PP2B 5J3BA 1ZT4B 1CFSA 3PDDA 2ADGA 2FO4B 2ATPB 1KTLA 5IVXF 2JJTA 3H0TA 4P3WA 1R3IH 3LZNA 5HGGS 5IQOA 3HG0A 2Z35B 3VTAA 2W65A 3OKNA 3SDYH 4HKZB 3SKNA 4N3TA 1AGDA 2FJSA 2J20A 2HTLC 2ZWYA 1BD2D 2BP0B 1XX8A 3O6FB 4R96B 4BINA 5CLWA 3J81i 2X09A 3GQBA 3EO1A 3I6KB 3IDJA 3MC0A 4XB3A 4ZAKC 3S0PA 2EKSA 5LMUQ 3WXWL 3OKEA 3KUPA 4R8IA 5J3HC 3ZU8A 2BLFA 2WWMD 2X6CA 3L4TA 4Y4FD 3L9RA 3PO2H 1CYGA 2OMYB 4LF3B 3MEFA 1JF1A 3HZ3A 5L2KD 2RB8A 3MXWH 3QEHA 1KLGD 1QEXA 4S1RH 4M00A 4KXDA 5FYJE 4B9YA 1YJNA 5IJCC 2DBJA 3CE1A 3TV3H 2JI1A 1YEJL 1ET6A 2VIRA 3BPOB 4DVBB 1NDGA 3H9SD 2X0VA 1FUNA 4GXFA 4OO1G 2BDNL 2FJGB 3M8OL 5JTWA 1IEBA 3QNXA 2X53A 1PTOF 1N68A 5CV9A 2L7EA 3AGVA 3T1YL 3T8XA 4KY5A 1B6DA 5I6WA 2PP9A 3HE7B 3MFFB 3X3NA 5DZOA 3SBWA 1E4WL 4GUPB 3WFCH 3L3JB 4LNRB 3ATFA 1MHCA 5C07E 1QG7A 2QVIA 2CMRH 1S5BD 4L5RC 1DLHB 5AVUB 3B1UA 5GRXG 2I60L 3D4WA 1I8IA 1M6UA 3C8KB 3H53A 1AW7A 3HFMH 3MRKB 4R8WL 3HRZB 3MUY1 3ETBF 1I4FA 3LH2L 5FO8B 4OGAC 2CLZA 1A9EB 2CH4A 2HT3D 4GJTB 3GTJH 1E7VA 1SF3A 2VDLL 2VUOA 5IK3B 4MBRA 4XPFL 1VQ9A 2FR4B 4G80A 4PJCE 5EDSA 3S17B 3KLRA 1QSZA 2P3YA 2YU9B 1A9BB 4X4ME 3ZDWA 3A74A 3FO2A 3EAKA 4UANA 4GKOA 4TNFA 2ZPKL 4JFTA 2EC8A 4BFOA 1MJ7L 4UTAL 1PZ5B 5T5FH 5IGDA 2A1AA 2UXBQ 5FYJH 5CGYD 1WSST 3WFBH 4HUWA 4YSCA 3DHPA 1UM6L 3JV6A 1ZA3A 4LCUB 3SGJA 3VDYA 2I7SA 4JHZA 2YD2A 2XX0A 4WI5A 4CN6A 3WIIL 5GGVY 2UXDL 4PAZA 1F90H 3ARGB 3VDCA 4R7NB 4NKOB 5F96L 2Z7ZA 1KN4H 5C1MB 5IMKB 3C2AL 4XBMA 1SVZA 3T2NL 4GQ9H 3I2CL 3VWKB 1RHHB 2GG1A 2UYLB 2TRYA 5TFSH 2NYZD 5IYCH 1Z6HA 2NY1B 3MFGA 1LWJA 2F0VA 1JPFB 1EQWA 2E27H 2EPBA 1GOHA 3ISWA 1NC2B 2RJMA 4QTIH 2NR6D 4NNXB 5DQDH 3C60C 1BZ7B 1V9PA 2YAPA 3V4PB 5IFHH 1PFNA 1MDTA 3D7PA 4MHEA 4R4OA 5KYXA 3QG1A 1X3DA 4RDBA 1G1OA 5ENWB 2G3MA 2QQLH 2X4RB 4HUMB 1NBVL 3AMKA 2NNAA 5E6IB 1KEGL 4O2CA 2R27A 4U3HA 3SKMB 4OZGF 1F1AA 5C09B 4GEJA 4JI7Q 3UFIA 5DM73 5A7BA 3P4OA 2WIIB 3CQZB 5HGTA 2E4FA 4LSTL 4N87A 4NUGL 3FB8B 3K0XA 4HALA 4KDVA 4MXWH 2X2IA 1ENFA 1E7ZA 4I77L 4AL8H 1TDQA 1IZKA 3S2DH 4WHTB 3NP8A 1MFEH 1IGMH 4JV5L 1B4JL 1T0NA 3E8UL 3ECVA 3QFDB 1JV5A 5SWZA 2YSSB 3C5XA 1KBVA 3MRFA 4UV7L 2JLPA 4LFHG 3HMWH 4OB5L 1U92B 3GSNL 2YC1A 3QIWD 2EP6A 3AT8A 1Q1PA 4M5YL 5C86A 4YPJA 1D5IL 1T0OA 2VL5B 1A02N 1GZHA 2XKSA 2VAJA 3EYFB 1EGJA 2ZSWB 3VYNA 1RZKH 1GAFL 1ZHKB 2WLZA 2ZCLL 4QGTA 1E28A 2PYKA 4HXAH 2R7ZH 1TCRB 3DO3A 4FTVD 4BYHA 3G3LA 3QDHA 4QOKE 4ENEC 3VXUB 4JM2C 1VADB 3BKJL 3D0VB 3QDMB 3SGKC 4F7PB 1YYLL 3NZUA 4R6UA 1NJIC 4ZW3A 2BNRD 2UZPA 3VD4A 4MMYA 1EIGA 2GY5A 5AG9A 1WBZB 2D9QB 4PJDF 1A6UL 2ICWB 3CNKA 3WD5L 5DXWA 1CR9L 2NVQB 3T8MA 2QVFB 5DDHB 3ZO9A 3ZKXC 4F7CB 5BZWB 3SXHA 4OM0L 4BIKA 1F4HA 3VA2C 2P5ZX 2MOVA 4ZXBA 1QWHA 4AVIA 4M29A 1BZ8A 3T65B 4BQCA 1BREA 1TJXA 1AQ8A 4RGNC 4QRSB 1RFDL 2ZYSA 3QG6A 4HC1L 5AWNL 3WNIA 4YHHQ 3BAEL 5IHUL 3MBEA 5JR1H 1M42A 2AQRA 1NSNH 4N2GA 3NCBB 2QDBA 4FF4A 4N2MA 4YY3L 1JIBA 2W0PA 2WLLA 4XVTL 1KTJA 1KCSH 1CC3A 1THAA 1WA1X 3BVZA 1YY8A 2OX5A 3QWQB 4XVSH 5K36G 5EDXA 5DI8A 3ZHDA 2X4NB 1Q0XH 2DWEA 4AXWB 4K8JA 1FFOB 2K4KA 1R5WA 2BVEA 5EZIH 2RCSH 4EXKA 4WI4A 2E5LQ 4RRPM 1UUNA 4XO9A 3TPKA 3WY2A 2AXJA 4YUEH 5I2IA 3ARFA 3DGGA 4FQCL 2XRAL 3RX8A 4UI2A 4XP5L 5DURB 3OXSB 2YAEA 3VW3L 2BMKA 3LZPA 2FNWA 4HTHA 1DZ1A 3RPIA 1P53A 4XTRC 4PJAF 3ULVH 2MKLC 2Y0SB 3DX0A 2D0GA 3K72B 3NIFB 5B38B 3GTQB 4DR3Q 3ZYIA 5I1CL 3A7LA 2QILA 4BK8A 3T1WA 4HCRH 4LCWD 1BA9A 3LPOA 3QQDA 2WZAA 2K01A 4L9DA 3EOTH 4DZBA 1LV9A 2UUCQ 1HHHB 1NGYA 1Q9WB 1XD1A 2O5NA 3EJYD 3GZQA 2YKLH 3C9NB 1HSAB 1UFGA 3B3BA 3KG5A 3D39A 4KVCL 4OD2A 5F7AA 1J5IA 3WFEH 3NFPA 2FINB 5CJXA 1Z9SA 1BYOA 1XIWB 1IKNC 1SHMA 3MUZ1 5GPRA 5DJZB 2GC4C 4YSSA 2GIMA 3VWJB 4UINL 5TQ0L 4XT1B 4OO1I 2Z6FA 5CWSB 4OZFA 2J1WA 3ZYYX 3NJLA 4N8UA 1K8AC 1E6OH 1S7TA 4LQFH 4U6TA 1I9EA 5J06A 4LFAQ 4YAQA 2J71A 1MSGA 2QSCH 1EYAA 1TS5A 4MD4A 3OWEA 3UAJA 1GHKA 1RVFL 3EO0B 3IPEA 1HL9A 1W8OA 3NEOA 4UBDD 4MJJA 1WFJA 3H9HA 4JHVA 4RSVA 3MWYW 4WW1B 1PH1A 3AXLA 4Z0XA 1BF5A 2ZKHH 3F01A 3WNNA 3RA7H 1R3KA 3GSQB 4C56C 3MNDA 2ZXQA 2JV6A 3C5ZD 3N85L 5D7HA 3RLSA 1SJXA 3GBDA 4F2FA 3HLAA 5C0GB 2OL3B 1MCIA 1KBGH 4WLCA 1AS7A 4NPJA 3BAXA 3FQUA 1XTMA 2VDOB 4OCRH 5KRUA 3T5WA 3LQAC 2AKWB 2M9VA 3APCA 4CAGA 1G7IA 2WKOF 4ZUWB 5AAPA 3TURA 3WJLA 1WO2A 4AUYA 1U6AL 4FNUA 1T6VN 3QB3A 2CU9A 3KPPB 2EXSA 4G5ZH 2EABA 1TQBB 3F7YB 4ELKA 4M5TA 2E7LC 4R5VA 1FLRH 1NMCC 4KTAA 4I0CC 4DNIA 4RMQA 4LSUL 3S5ZA 2UX6A 3UERA 4XN4A 3N40P 4FF1A 1XDTT 3NSJA 4W6XB 1K4CB 4DR2L 4FKKA 3ZK0A 5KOMC 3KJ4C 3BP4B 1KGCE 2CM5A 1EWHA 4QHUA 4HGWB 4MMZA 5DUMH 5E9DD 4XCYB 2NXYB 3ZL4L 5J13B 3NUCA 3TTSA 1MCDA 1Q8IA 4XQJA 2XZCH 4P3DA 2OYLA 3A55A 2WO3B 2CUIA 2YMOA 1H9SA 4F37F 4X62Q 2R69L 3MLWH 4HJ7A 2Q6WA 1Z9PA 1FFPB 2ZXWB 4P2OC 4ZS6D 3L3HB 1TMCB 3ARDB 1SEBA 3WDHA 5M3MG 4P2QA 1R3JB 1IBML 5DHDA 2PTUA 5BZDB 2EUVA 2FWOB 1JTPA 2FGWL 3CLWA 4OQTA 4E42A 1MCRA 1SDAB 4IFDJ 5HHME 1KGIA 4UM9B 2I5MX 4A76A 4GW1A 4JDVA 3RMHA 2VWEC 2N8NA 3NJJA 1A1MB 3I50L 1JB3A 3JV4B 1YO4A 1TQCC 1AE6L 2AGJH 2WWNA 2EIFA 4OCYL 5GGVH 3MV9D 3TO4D 3RZCB 5C2UB 5K5YA 3GO1H 2WW8A 1ZEQX 3EIVA 1NGZA 3PE9A 2G5RA 5ID0B 1BZQK 4EIUA 3DX2A 6FABL 1OAQH 1P4IL 3D50A 5F72S 3VXNB 5SWQA 3AU1B 5A16A 2C4FU 2J4WL 1OTCA 1RHPA 1V3MA 2HSIA 2J5LB 3CX2A 1UADC 4BSWA 3LKSB 5C6AA 3KPRA 5A2FA 1RZ8B 1IQWL 1JNLL 3I3DA 4JANB 4O9HH 5JOFA 4R3SA 1PYBA 1MFVA 1C5BL 5D7IF 1ECYA 3T6WA 2IPTL 1M1KC 3ONAB 1J0IA 3G7TA 2OLDA 4MLSA 4YR6A 1X7QB 4XMKH 3ZQ9A 3O6FC 5CD3A 2CCWA 2LU7A 3L4YA 2B3GA 5IP9G 4B50A 3J81j 2VXTL 3RZWA 1UEBA 1LDPL 1SMYC 2J6EH 4W9GC 4D0DA 1JGLH 3F6JA 3D2UD 3E1F1 2JKRM 2QVMA 1S8DB 3FKIG 3JWNE 4PJ8D 5AVVB 1S7SB 1V7NL 3LKQB 3QRGH 4BJLA 1XPOA 3GBNL 5D7LB 2P5EA 4Z7AA 5L4MA 2IQAA 1I1FA 3IU3A 1E4XL 4JJHA 1EWCA 3BPOC 3FB6B 2LXJA 4PR5A 5IB4B 4KROD 4JO1L 5KVGL 2JB5L 3P0YH 1BG9A 1NMFA 3E1ZA 3OXRA 4HPHA 5KYLA 4MAZA 1DQVA 3UIZA 3OAZK 3FF8A 4OJAA 3LKOB 4HF5H 4DERA 2RDGA 5AKTA 2J1YA 3NSCA 4WJ5B 4YCWA 1AXSA 4HPOH 3CSTA 4GLRI 2FO1A 2H0PA 5IT9L 1BAFH 5KSAB 5H37H 1WF5A 3WHE0 5L37A 2N4IA 4KI0A 3KDMA 4FXKC 1A5FL 4OAWA 4TPRL 2KZKA 5DD1H 3NELA 1CU4H 3QWOB 4RA0C 1YJDC 1OP5H 2KQMA 3QWNA 3INUH 4YDIL 5JQ6H 1U8CA 3OF6A 3CN3A 4JBSA 4M9OA 4K5NA 4NRXB 4WWKD 2JQZA 2VLKD 1EX0A 3H8NA 1MCHA 2K78A 2W60A 3BT2H 4F3FB 4GNXB 3VR3A 4YHNB 1F3RB 1FNLA 3S7GA 4X6AH 3FP9A 1D5BB 1OAYH 3BLBA 4N0FA 1KJVB 3ALXA 3F6IA 3JWNH 4Z7QE 4KV6A 2VL6A 2R15A 3BFQG 4LDEB 3AXIA 1CXHA 1BGXL 3NBHA 3FTXA 4F5CE 3EOAB 3LH9A 1R9TB 5ETUB 2YPKA 4B7LA 2B8GA 2Z1PA 1L1OB 1A3ZA 4N24A 4WNJA 1Q3LA 3SZ6A 2K14A 2Z92B 3D25A 1DQML 1VPOL 3L5XL 5JEAH 2MOQA 3SOBH 4MJIB 3ARGC 5JW3H 3PXHA 4Y4KD 3FN9A 5INCB 1M1SA 5F89A 4AEEA 2X6AA 2AI0H 2NY1C 3HAEA 5E70A 4BE6A 3ZZ1A 4ABWA 1U91B 3VXQB 2VOTA 5D2NA 4PRHB 3UTOA 5F3HB 1IAII 5IIEB 1IGCH 1F4WH 3QAZB 4JPQA 1Z0NA 4P9MH 5T1JA 4KRPD 5EBWA 1F2LA 4OFPA 3HS9A 5F1NB 3SDDD 2HRHA 3QQ4A 3M1BB 3L0OA 1HRJA 5J1ZA 4U6VL 5E6IC 5I5RA 5HDBE 4OWXB 4IU2A 1LK2A 1CXFA 2W81C 3PABB 3WBDA 3U0TB 3S1NB 5JHDA 1IILE 2BCKB 3A47A 3FONB 3LN5B 4ONHA 3GGWA 1YEFH 2WXOA 3FMGL 1FDLL 5C0CE 1H6UA 3G08B 3JYBA 1ZTXE 4OIBA 1WYJA 2D73A 4LKXB 4OIKA 1GH7A 1T6BX 2X9WA 1S3KH 2WVSA 5ACMA 2JTDA 4WY7L 4AQZA 3ZMNA 4L2LA 4Q6IB 4PJIA 1AJ7H 4TF4A 1D5XB 2IO5A 1VSCA 5KSBE 1FH5L 2IJ0C 3FU3A 3KLWA 1U42A 2NY6D 3HZMA 4FF3A 2CKBH 4LLVA 2CK2A 2B2XH 3SSGA 1MFCH 1JR0D 3MJ9A 2UUAQ 1D7FA 1AG6A 1WCBB 2DQTH 3GMQB 3CC1A 3E0JA 3GDEA 4JQXA 3FQ2A 3V9CA 1LO4H 1L9PA 1Y1WH 1IC5H 2VAAA 4OJCA 3GSUB 1ZEAH 4FG0A 5E00A 1KD1C 1NAML 2N49A 3FB7A 4LAQL 5LNGA 2F0QA 4X3UA 1L9NA 1W6WA 1IL1B 2VISA 1KXVA 1S7WA 4NZUL 4F7TB 5E24E 4A39A 5BVPH 3QJQB 5C0AE 1U8JB 3ZO0A 1Y0LA 3MUHL 1VQHA 2YXVA 1F41A 4U6XB 2R2BB 2RFXA 4M1GL 1DZBA 4UOW1 2F0UA 1MRDL 2K03A 3H9ZA 1I1AD 4G8GD 2HX8A 5B8CA 2O93L 1GZQA 1MPAH 1XGUA 4MMXA 4EKJA 3UZQB 2BHZA 5ERWB 2F54A 1AQMA 2R0WH 3O6MH 1YVCA 1N32L 1SNDA 3EBHA 1OTUD 4OFVA 4I18C 3J80i 1GKEA 1O7LA 1AVAA 3HNVH 1ORQA 2E59A 3HC2A 4KV5F 1JERA 3GPSA 3MSPA 3VGAB 1EPFA 3VE0A 4OVUA 5E8PB 4NPSA 2J12B 4TUUA 1QUQA 4LPUA 2B1AH 5DFVD 2ZWSA 3DX1A 3VFGH 1B0GA 5HI4C 2LE9A 5ITBH 4BCZA 4KKCC 2RQ8A 4CVZA 1UH2A 1A15A 3AABA 1IIKA 1MDAA 4OW6A 4A3BG 3JUYA 3OKOA 2Y6SC 3NSDA 3U4KA 3SJVA 1Z47A 1IM9B 1DN0A 1R5IA 1HWGB 4ZSOB 4K3DL 5IGXH 3BQUC 1YECH 1KCRH 1VLXA 4GN4B 1J05A 2X2JA 1EY8A 2VDQB 3F12B 3VGGA 4JZNA 1FG9C 2AEPH 3Q13A 5D1ZI 4ZMWA 2KDYA 1DUYA 5LBGA 4AV0A 1MFAL 4JHAL 2BZ7A 1N7ML 4X3KA 1SYVA 1SLWA 2XN9B 4GMTH 3MROA 4PMWA 1DEDA 2D0HA 1I4RA 2DI7A 1Q82C 5ANMB 4DV3Q 1C5CL 3WO3B 3J7YW 2PW5A 2V2XA 4H8WH 4AEIL 1MAKA 1BD2E 1FAIH 4ABNA 2ZP8A 3UAEA 1ZT7A 3VXPA 3R2TA 1UURA 1Y1UA 2WB1A 3WN5A 4XNYL 2WINA 4R90H 2EDEA 2NQCA 4NLHA 3DX8B 4PV9B 1CBVH 1JGVH 4OCXL 3F7VB 1M57B 4O51B 2X4UB 1ITBB 4J3VA 5ADPH 2ETWA 2WP3O 4AYBG 4XT1C 4DO5A 3KCPA 5L2KE 4HEPG 3SKJH 3V0FA 2BH0A 1SUHA 1EUTA 2Y36L 4NUPA 1QW9A 2GT9B 3EO9H 4KJQD 5LB1A 5DFWH 1UAPA 1L7IL 4QIWE 1AQDB 3H9SE 4WHCA 3BGMA 4N1EA 3FCTA 5I28A 3STZB 5CCHE 1QLEB 1P6FA 3PO2G 5GS3A 3M1OA 2B2VC 4ZFOB 1YMMB 2XPYA 2RAMA 4BKLB 5EMYA 3LTVA 3PCOB 3JV0A 3TJEH 1Z2KA 4OCMC 2BY3A 1D9KB 3JTSB 1JTOA 3QPXL 1RZFH 3CH1B 1YYCA 2CBMA 4FQ2H 3RY5A 1ZPUA 2IY5B 2WKCA 1HU8A 3VTMA 5AENA 2B7DT 4NZFA 1KNOA 4XXWA 1N33L 5JUEL 1SN0A 2XSCA 4XAWH 5GRUL 3ZGHA 5LUMA 3H3PL 3B9KA 1GA2A 5GGSY 5HY9A 4G72B 5BJTB 4UAOB 5I9PA 2F19L 4DK6C 1IHZA 3EIFA 1EFXB 2HG5B 1MCOL 5GGRY 2NY4B 4WI6A 4AH2A 2VDRB 5HHXL 1W72B 2VM3A 1I3RA 4PJEF 1I9JL 2FQDA 1W15A 3SCMC 1E8WA 3CDYA 2VW7A 1FZJA 5H94A 1KJMB 1CLVA 2FWSA 1HJBC 1M9WA 4PCKA 1DLFL 2BHFA 5DHXB 1EV2E 4DV5L 2NXYC 5J13C 1KPVB 1YNJC 3QDGD 3T13A 5CBAB 1RUML 2XBDA 1QR1B 4GKSA 2TMPA 2K70A 3NIDB 3ZKMC 3TLRA 1WIOA 4IOCA 1PY9A 4K5WA 4HSAC 5C0RH 1TWAH 4WI8A 4UP8A 3N9GL 2C1PB 4F7EA 4WU5B 3IRBA 3AQXA 2AJUL 1C5DB 3S36X 2HWZH 4HSCX 1JZ6A 2FDBP 4IIQB 5D96C 1FO0L 4ICWA 4HSVA 3SPIA 2DEWX 1I4HA 4DEPB 5J57B 1S72A 1SBBB 1G5GA 3FF7A 5KYNA 2HT4C 4N8CL 4H20H 5D5MF 1ZVNA 1L0YB 3W1ZA 1I4XA 5EO1A 1YEIL 1FG2A 5SWSB 1N10A 3SHLA 4GI6A 4XXEA 1YJWA 4BKSC 2UWEA 3NOIA 1JXDA 3ALWA 2NVYB 4IUNA 1KCKA 4C2MB 1YC7A 3BO8A 4X6DE 5IYCG 3GSWB 4KTDH 1LEGA 1KY6A 2YK1H 4OX9Q 1E5UI 2J5LC 3KPTA 4S11A 4XMXA 2O5YL 4EI5B 2OP4H 1WBYA 3K71A 3V5HB 4PEEA 2CK0H 2AEIT 1MRCL 1JS4A 3IL8A 4L8SB 1ZPLA 2OTLA 3KPSA 5F7DA 1I8UA 3FB5B 4K3JH 4F24A 2BA0A 3GTOB 2K52A 5DZJA 4DV6L 3KOJA 3BRFA 1D5MA 3KCWA 4HGMA 1WT5A 2X42A 4TVPL 2DD8H 3R06A 1NCGA 5LL6S 1JK9A 3WE6B 5IMLB 4XP1L 3CAMA 4D3CH 3M3YH 1C1EH 4HJUA 2A74B 5HVHB 4MRBA 1VENA 4TSAH 1F9QA 1ZLWH 1SE8A 2F7PA 1D6VH 5EOTA 4AI7A 4YXHL 2X40A 2OCJA 4EQOA 4YSDA 1T80A 2EIZB 3QEUB 2JA5G 1BF2A 4OZHB 1VAHA 5EBGA 3TT1L 5K9QG 5KJRL 2FYYB 1EEZB 1BFVH 5B3JF 1IZ6A 4KTEH 4FTVE 2FB4H 4NXSA 2JIXD 3GUTA 4MJ5A 2K5VA 2OEOA 4Z3JA 5D2LB 2WAHA 4NXNQ 2O6FA 2X4SA 2DWDB 3GTTA 3VDBA 1XH3A 4XB8A 2BNRE 3D06A 4PYGA 5ESQA 4TTGA 1TZIA 2YBGA 1JZEA 1NCTA 2G60L 2R7ZG 2XWBA 4LPWA 3ZW3A 3QEQB 2A0LC 4PP2A 4DOHE 4NZRH 2OPCA 1ZLEA 4KVPA 2FO4A 2FH6A 4N3UA 3LSOB 3W1BA 4NHCL 3WENA 2J8HA 2MJWA 2WANA 3S36H 1N9PA 4X5LA 5C4JB 3R18A 2YLKA 1UZ8B 3TYGH 3GMPB 2PCPB 3EGXB 3ARFD 2W9DH 3PY9A 2Z35A 1AFVL 5F1KC 4JY5H 1MGSA 3HZKB 4HKZA 4LAJH 1UA6L 2B2TC 2NVXH 3HHSA 4R96A 4WO0A 4NFCA 4XP4H 3T0EB 1T5XD 4GNXC 3I6KA 3LIZL 1HA6A 2EDMA 3ES6A 4PS4H 1J5HA 3GEWB 3U1SH 3SGIA 3U4EB 4CKQA 3RZOH 4JDZA 4KNQA 5M3MB 3TEHB 4AIMA 2QPDB 5KTEL 4LF3A 1JMZA 4HHAB 4H1LG 3D3RA 1NCIA 1ZJBA 1QSFA 1L1OC 2F0WA 4ZYSA 5L7XL 2F0DA 2VDPL 4A3DH 5KBLA 2C3GA 5F88B 1IKFL 1SNRA 2EIDA 4KI5C 5IHWA 1EZLA 2A38A 3QCUH 5E0FA 4KHTH 4FX5A 4DVBA 9PCYA 4HOZA 2CJUH 2YPVH 3UG4A 4JO5A 1G9NH 1X4YA 5K9KB 2EDYA 3FTWA 2FJGA 3NRQA 3MACL 3DXAB 3X3GL 2FL5B 2ZXRA 1DHKA 2HKAA 2HX9A 4ZFGH 1U93B 5I18L 5LGKA 1QPPA 1CT8A 2FT8A 2BPBA 5FC9A 2D7MA 4X99B 3L3KA 2IX0A 2E75C 4K6LA 3HE7A 3MFFA 1J7VR 1LTTD 2CGZA 2IBZY 3QI9B 3X1EA 4GUPA 2EXDA 4JV5Q 1I8LC 2VUMH 3L3JA 4LCWE 1NAPA 3HE6C 4LNRA 4PJXB 1KJ3H 4ULLA 3UAJD 3PWVB 3GSVB 2AABH 4AOFA 3S88L 3BAJA 1HH6A 2E6JA 4G7ZC 1DLHA 4N1CA 1PRTD 3HI6L 4UCFA 1TPXC 4FQJL 3MRKA 1SYSA 4DGUA 2Q8BL 5LKNA 2OTWB 3HRZA 3N1GC 1WAAF 1GJXA 4HK3J 5FO8A 1A9EA 2VO8A 4HT1L 3N6YA 4XVJL 5D1ZB 3GMMB 1NMBL 4P5KB 1G7JA 4D9LL 1ICFB 2E9GA 4F2MA 1CDBA 3B7RL 3J81E 1A9BA 4P5TA 1VF7A 3D85B 3SE8H 2IX1A 2AAVA 4R5XA 2KQNA 3FKIB 5I1HL 2Q2LA 3JT0A 3L3IB 3JC66 1UACL 2XWCA 43CAB 1MF2H 3ZE2B 4JM0A 1LM0A 3V2AR 3CSGA 1UWVA 4OF7A 5E95B 1MFDL 1YQVL 3TPUA 2J44A 4E9XA 2FUTA 3L1OH 3VFVA 3GKWH 4M5ZL 1KYAA 1G5AA 2ZOKB 1IC4H 4P3CH 2CDGB 3OLEA 4OD1L 3WNKA 4OI8A 4HIMA 3ARGA 2RCNA 3M4OH 1CIDA 1P4BL 1GIGL 1WC7A 3QJRB 4GBXD 4N0YL 4NKOA 4R7NA 2CKZB 3PF2A 3RX9A 3V4VL 5IMKA 4DFHA 1SMAA 2JKXA 3K8LA 3QNZA 1ES0B 1L4IA 2JJUA 3KHQA 4FLQA 4YHKH 5EN3A 2UYLA 3VWKA 1IAOA 1YA5A 3IBEA 1KIQB 1JPFA 1NC2A 2QQKL 4KHXH 2HJLB 1SEBD 1BZ7A 4QCLA 3V4PA 1HCYA 4P2QD 1CGSL 1XF3B 3X12B 1RK7A 2PR4H 1H9RA 3KJ6H 5ENWA 1E7UA 1UNSA 3MA2B 5E1FA 2X4RA 3DMMD 7FABL 3ULUL 1J5DA 3MRRB 2TSBA 1HE8A 4IRSB 5E9DE 3EH1A 4ZW6A 2EJFC 2CO4A 5LN8A 4CSZA 1YNND 2LU4A 3QJYA 3VXTB 2N7SA 4QO1B 5G4NA 1LO5A 1DJGA 1F00I 4A2MA 1D1KA 2DN7A 2WIIA 4KFMA 5FK9C 5FF6A 2CQOA 3FB8A 4IMKC 4IJHA 3NDZE 5CP3H 2CBOA 1XF4B 3S3BB 4TLTA 1XVSA 4TMPA 5IT9c 4PRDB 1HQRB 1UQSB 1SJVA 3VGAC 3WAJA 4QY7A 1CT1D 3KYOB 5DJCB 5I2XA 1XWVA 5TDPA 4AYFA 2EYTB 3G6JF 4U49A 4WHTA 2JB6B 1PG7H 1PLFA 1IXRA 3TFKC 4QRUB 3KPRD 4HFWA 3FC8A 2YSSA 3NCJH 4ZOAA 4ZQKB 1LP9F 3O41B 3FUIA 1U92A 3Q23A 2EACA 1USQA 3TQYA 3GD7A 3MV9E 4FN0A 1DTUA 1PVHA 3R0NA 3Q8FA 5IJBC 1G6PA 3PWJA 3ULVF 4FFZA 4JHWH 4Y9EA 4QB4A 1DGSA 4MLIA 5B3SB 2BSEA 3OD3A 5TK2A 1WICA 4YDKH 3M7NA 1NIAA 2VL5A 1VZIA 3EJUA 1S78D 1QSEB 1UCBL 5DUBB 1RP8A 5LCVA 3EYFA 4BZ1A 3O13A 2ZSWA 5H4YA 1ZHKA 3I73A 5T1DL 4OM1L 2CWRA 4R4NC 3U46A 4DW2L 4EBQL 4QNPE 2VQ1A 3KLSX 1TCRA 4P2RD 1YG9A 3BMVA 4MNOA 4XNZC 1UGKA 2E7CA 3T1FB 2W9LA 2YUWA 2XN9C 3W81A 4NUJA 3VXUA 2NZIA 1TOXA 3HOWH 4LF9L 1G4RA 2BW5A 3CWGA 3D0VA 3KGSA 2BSSB 3QDMA 5DHVA 4I3SL 4U3XA 3GB7B 3KBGA 1NUDA 1AZVA 1WBZA 2ICWA 1H8SA 1ZSHA 5TE7H 4GW5A 5J9PB 5EIIG 3P77B 4WTXA 3ML8A 2K1MA 4LGRB 2A6HD 1R19A 2K04A 1K5WA 4WFED 5BZWA 5K9QI 2Q86B 4FCHA 3KWTA 4IOIB 1VZGA 4IK6A 3IDIB 3T65A 1RIHH 3U9WA 4ZNEE 2DM3A 1J9OA 1PX3A 1XEUA 4QRSA 5IW3A 3QUXB 4XXCA 5F70A 4X6FB 1NZRA 3JTTB 4PB0L 4QRRB 4U4BA 1KNEA 4OT1L 1YNLH 4DP0X 4UQEA 3MO1B 3FT3A 3HZXA 3TZVD 4F8NA 4P59L 4ZW8A 3RIKA 3MCG1 2X4NA 1DO6A 2DB8A 4XN8A 2VRAA 4ZZKA 4AXWA 1FFOA 5L2JA 2H2PC 4HIHA 4LJZC 5KJ4A 4B0MB 3OF6D 1DQDL 1DOKA 2FBRA 3N44F 2B2WC 4EKXA 1RJTA 1NINA 3UMTA 5ISZA 2IOMA 2QDVA 1D9KC 5DR5L 2MPMA 1G1CA 3W57A 4BZYA 3D07A 4A38A 4JFWA 5I71C 3E3XA 4KKNA 3NN8B 5CUSH 1I9RL 3IAYA 2D0FA 2OZ4H 1EHLL 2V3DA 3GJFH 5DWUL 4KY7A 4OKVB 2Y0SA 4UAOC 2NY2D 3QRFM 1U2YA 5B38A 4J6RL 5JIKA 3AQZA 1Q7YC 1PJWA 1S5IL 1ET8A 1JVLA 4Y2DB 4OZIF 5C3XA 2DY2A 4N8PA 3T3MF 1PLCA 2VLKE 2ITFA 4S3SA 1OTSC 4CGYB 1FVDB 1HHHA 1YJ9A 4XVUD 2MCMA 5T1LB 4NQQA 5EBLB 1JPSH 2CQVA 2DICA 4EO5A 1XIWA 1IGIL 1EO5A 3O2WH 4PS8A 5ELIA 5BN5A 5DJZA 1KJ2H 3NJMA 3VWJA 2BP8B 5GAGC 3KL3A 1KBPA 1WE5A 5CWSA 1GC1C 2AANA 2JQMA 4GRLB 5T3ZD 2ZM6L 2GCYB 3GS4A 4M8RA 3TH2T 1SLXA 2A19A 4QD2E 3L8QA 4ODBD 3R3OA 4HULB 3W37A 1E24A 1OPGH 4XZ4A 4M03A 1INDH 3JWNG 4ODHL 4AVKA 3O4LB 5ISRA 2JCWA 4A3BB 2UUDH 2QADD 3QUZC 4GRWB 4M56A 2AZUA 1TQSA 2C26A 4AQ8C 1LTGD 4JVPA 3LRMA 5I0XA 2CQAA 2ES2A 4KKAC 1UM5H 1MHEB 1U95B 4XO4A 3PGZA 5TPWH 2MCG1 2EDKA 3GSQA 5HTSA 4DEPC 2E6QA 3PUZA 4NXML 4KKLC 4O02H 4NSKB 1EZSA 5CBEA 3FFOA 2P48B 5E08H 1FNFA 1A3LH 3CD6A 5EEUA 2ZF9A 4P57B 3H56A 3VMNA 2YRZA 2GJ6B 1ACXA 2VSKB 3Q5OA 1I3GH 4W9IC 2OL3A 1NC4A 2D7NA 1F2QA 4HAGA 2MCPL 4K7FB 1TJHH 5ICZA 1IC7L 1GKHA 2VDNH 4EI5C 1A7PL 1G6VK 2Q1EA 4PJGB 4DV0L 3KPPA 4N0UB 1A1NA 4WI0A 3F7YA 4L8SC 2HB0A 2WLYA 1GR7A 4G8AC 1SXTA 1M05B 3BH9B 5MEOB 4K94C 4AYBB 3FT2B 3BP4A 5HPMB 4MCNA 1MVFA 1GUOA 4HGWA 4I0PB 3RWCB 2D62A 2KA7A 4XCYA 2IPKB 2OR8A 2J3SA 4NDMA 4K4KA 2OSYA 3CZGA 4FA7B 3U82B 3IDGB 1DBML 1FFPA 4P2CG 3L3HA 3WYRA 3ARDA 1YYMH 5HVHC 3BRGC 1SN2A 5BZDA 3HBPA 3BVXA 2FWOA 3IDYB 2JA8G 4UM9A 4CADB 3CVIL 4XPGH 1Z5YD 4Z8FL 4NM8L 3LDBC 5KVDL 1A1MA 3Q9PA 3EOBB 2FLBT 2F54D 3GSRB 3JV4A 4ONFL 3MLZH 2OYMA 1IJNA 4FDBA 3KW7A 3RZCA 1M4VA 5EAYA 3SKUD 5IVZB 1BMGA 5IHZB 4NW2A 2B8OT 5AOMA 4YFLI 1OHZA 1HINH 3H2PA 4XMLH 4WI9A 2D3NA 2VDKH 5FO9B 1Y1WG 1EL0A 1AFPA 4L37B 4WNSA 3VXNA 3H3VH 1CKNB 3DROA 1KTBA 1I31A 1MIEL 3H7BB 3FSZA 1UWEL 3VA5A 1MD2D 4G8GE 4X9IA 2ED6A 1KFAL 1LLAA 3ARWA 2AAAA 4X8CA 5HJ3B 3RE0A 3WAKA 1TYEB 4FXTA 4EI6B 1RZ8A 1OW0C 1CGUA 1VEOA 4JANA 3HBZA 2EY2A 3HG2A 2O5ZL 2P80A 2WLMA 3GTJB 3SJVD 1VQKA 2DZEA 4F9LC 4ZS7L 2BIHA 5GS1C 1PS3A 5C2BH 1EAOA 4BXXH 3L2PA 2DLFL 1X5HA 1BEYL 3WEBA 2XWEA 3L3OB 1WZLA 3QPQD 2XA8H 4XMTA 5INDB 1EHXA 2G75B 4LPVA 3EDEA 1NIEA 5HD8C 2HH0L 4KXCA 3ZDXF 2PQAB 3M8OH 3ZKQD 3RRQA 2FAUA 3O8XB 2R9HD 1S8DA 3HKFA 1U3HA 2RR3A 4JI6L 5ELCA 4KNTA 4U6HB 4UT6H 4XPTH 1S7SA 5AD0B 2L7JA 1P7KB 5IESL 5D7LA 4OGZA 4ELMF 4EI0A 3ASOB 2C9QA 3D8GA 3FB6A 5IB4A 4PG9B 2ZTEA 3A22A 2VSCA 3PFQA 3CFDB 3QS3A 1XT5A 3IGAB 4TLUA 1CLYL 4AUUA 3UPRA 1BX2B 1VA9A 1YITA 3EDDA 3LKOA 2HAZA 5GGQL 5CEXB 1BLNB 4NOBA 5KYWB 1CWVA 2DQEH 4DK0A 2XFXB 4PLJC 4JKNA 4WJ5A 4XMWA 3QHZH 4PVLA 4XPFH 3N41F 1PIFA 5C07B 2NQDA 3IDUA 3KYKH 2UVFA 4IRZL 1Z3GH 2YZ1A 5KSAA 5AZ2L 3GXTA 5F9WB 2QZ5A 1ACYH 3DOHA 4B3SL 4JI0L 3TBTB 1EYDA 1RH8A 2AKRB 3S35L 4LLYB 4FI8A 3IXAB 2Z4HA 3DIDA 2VQEQ 1AS6A 3H4FA 5D1ZC 1MJ7H 4PJCB 3CU1A 5AAMC 3GI9H 1LT6D 4XQQA 1N6VA 4KRMB 3TASA 4JREB 3EDFA 3THML 2V5SA 1K5NB 5I1IL 4OSUL 1HWHB 5EOCJ 4NRXA 3QARA 5F0JB 3RNUA 2QL1A 1EJOL 1NBCA 1N18A 4NAQA 4ZCKA 2BS9A 3MRGA 4G6KH 4YHNA 1CHQD 3ZX1A 3QQ3B 3HN8A 4PMCA 3F2UA 3B9KD 2V8MA 1KJVA 2ZAIA 2IDSA 2IGTA 3B8YA 3G04A 3HB3D 4IPHA 5C0FB 2R0LH 2IIJA 6PCYA 2JA5B 3I70A 1OSEA 2H4EA 1AQHA 3CVDA 3CCSA 2RQXA 3P3SA 2XPGB 2BIIA 3QEGL 2JTYA 3MKKA 4PJBF 4GIAA 5FECB 4IALA 2WACA 3F65A 1Z9OA 2ENQA 3MLVL 3QIBB 2X89A 5INCA 4HH9B 1N32Q 1ZKOA 1E4JA 4Y9BA 4LAAA 1XWEA 3O11A 2G30A 4XGZA 4ZLTF 1HNWQ 1PYSB 1U91A 1ZLVH 3VXQA 4DH2A 5BCAA 1LEIB 4YXLL 2R7ZB 4PRHA 2QGQA 2EH8H 5F3HA 3RZDH 1MY7A 2KL6A 5IIEA 3V0IA 4N2DA 3PGFL 1PHJA 4HBCL 3L5IA 3S9DB 3LXCA 5F1NA 1DM0B 1J12A 3BYYB 3BW9B 4IRSC 3M1BA 1B1ZA 3P0VH 2IAMC 3T6VA 4Q9QH 3PABA 3U0TA 3QDGE 3FONA 2MFNA 2HCIA 5GS0L 2FLRT 3N1PC 4OELB 4QTFA 2KOLA 4MJ6A 4OB5H 4G6FB 2WXPA 1XGYL 1VMCA 4M6NL 3RDTD 2YBRB 3QUKA 4BWTA 4K0KQ 4G6AD 5T5NF 2MOGA 2HKHL 1DFBH 3FCUB 4RFOL 4CRPA 1RZJC 4XOEA 5GGTA 4H1LB 2J88L 2BOCB 1EAJA 4M8AA 4Q6IA 2YO3A 2CXGA 1D5XA 2H0JA 3CXDH 1ZCRA 4NLAA 2B15A 3RYMA 4ZT1A 2V33A 3NEXA 3KPSD 2B8FA 3A5UA 2VZAA 4QJ3B 1WCBA 3WLBB 3WLWD 3CC5A 3VFWB 1RULL 1IT9H 2LSSA 3BP6B 3GMQA 4YGAB 4FJ6A 4X2UA 4DV7L 3SE9H 4YSAA 4DR5Q 1JWUB 3GSOA 4E9SA 3CRKC 1FBIL 3QE5A 4W70A 2ED8A 3TA3B 2LKVA 3ARRA 1UOLA 3EYVB 4K9EH 1JWSA 3LHPH 4GMSL 4LNVA 1BWWA 3BN9C 3T2PA 5K9OB 1IL1A 4QOKB 1IBKL 4F7XA 2CR0A 3ZZQA 1B7YB 1ADQA 1O0VA 1EAPB 3STBA 4G9DA 3WS6A 1U8OB 2NCEA 1FYHB 4O42A 1HCVA 4RA3A 5AOJA 3V55A 4JI5L 4XI5D 4TLKA 4U6YB 3ATBA 4HFUH 3E8VA 3QJOA 4K3EH 4L1BA 4B9PA 3NIGE 2JWYA 4IJTA 2R2BA 1I5FA 4NDXA 2CO7A 1YHPA 5I8CB 2UY6B 1XGRB 3DX3A 4AZ8A 3O0RL 1XBRA 3G5WA 1BCPF 1N2RB 5J6HB 1IE5A 4UT7L 3UZQA 5ERWA 3A0OA 2J2ZB 4M7ZC 5I1JL 3BEVB 3WMPA 4Y5YB 2PF6A 1BQLL 4U0QB 5KNDA 4MJ2A 1WTHA 3QUXC 2E6PA 4FMFA 4FABH 3BWUF 1K85A 4N2EA 5E8PA 4B3MQ 2VLLB 4LQ1A 4OFDA 5LMNL 4UU9B 1AQKH 4YHOH 3ARTA 4U4IA 5I9QC 4OI7A 4KOBA 1DBJH 1R24B 2ZWZA 3RNQB 1KSRA 4AW7A 1JB7A 4M43H 3PYCA 1DUZB 2XG5B 4NQEB 4J4PD 4XOBA 4M3JA 5FGBA 1KENL 2KKQA 2X12A 1QVFA 4JKPL 5CU5A 1WWCA 4ZMTA 5CJ8A 5J22A 1SGKA 3D4YA 1P9MC 4F9PC 1IM9A 1KB5L 4ZSOA 5I0ZA 2L4OA 4DR1Q 1OPOA 4IZ8A 4EVOA 1VCAA 2G4EA 4AQ1B 1EYCA 3I91A 5EF2A 3F12A 3OZKA 1X4ZA 2A4ZA 4MAYD 4KZDL 2DJFC 1QSFD 4X4XB 2A83B 5DK0B 4NQCA 1EGJH 4WGVB 1U58B 5ANMA 4ODTH 5C4XG 4Y2DC 2FBJH 4RHRA 1HT6A 1IBFA 2UVEA 4PRBB 3HA0A 3IYLW 3V0JA 3L2NA 5IM7B 4PSRA 1CXKA 4WTWA 4D94A 3ARZA 3DX8A 1R34A 1DQLL 4PV9A 1TWHH 1LHZA 1NLBH 3F7VA 4O51A 4TN9A 2X4UA 4JI2Q 1UWXK 12E8H 3HE7D 4PV8B 3FSWA 3J80E 3C87A 5DUPH 3WU1A 5CJOH 2MQGA 2GT9A 4I7AA 2J72A 1FGBD 4CMMB 3PDOB 1U8IA 2DH2A 4DIXA 3UC2A 1AGCB 1K28A 1MH5B 4QRBA 3V8CA 1AQDA 2NY3C 1HDMA 5E4WC 4EZJA 3UTSB 4RMSA 1XGZA 4WCYH 5HDOA 5A7EA 1NR2A 4Y8DC 2PO4A 2QCPX 1YMMA 1EDYA 2B2UC 4G3YH 3W39B 3WSQH 4BKLA 1CQVA 1UH4A 2R61A 2OI9B 5DMJB 2BVQB 3MXVH 4A3DG 3ABMB 1WDAA 4RKBA 1RUPL 4P5TD 1KN2L 2D2OA 1I8MB 4P5RA 3AQQA 5AJ3L 1IYVA 3LN4B 4LSUH 4TNEA 3CDGB 4N6RB 3WI9A 3LZRA 2EIMB 4YHYB 3ZR6A 4HU2A 3L7EB 1CF8H 3H1ZA 5LAPA 3JAML 4HIXH 5BJTA 1JDAA 1G2SA 2VC2H 3MYJB 1W0YT 2PW1B 2HG5A 3F8UB 1HEHC 2RMNA 4U1GB 4TQIA 3RLNA 5EIIB 3Q24A 1I8KB 1W72A 3EBAA 3GXMA 1E67A 4HK0B 4PW9A 3ZZSA 1GTFA 4LFBQ 3CVHL 4DPGA 3UE1A 1T83C 2H5UA 4HS6B 4QYOB 1XSJA 2ZP0T 4X9FA 3TFBA 2IQ9H 3U30C 4DN3L 1KJMA 5LN4A 1E5CA 2JKIS 3V8OA 5BNXD 5IQ7L 1K6QH 4NRYA 1UASA 3BZDB 4WFN3 4DP4X 3C5SB 2RCFA 4PWEA 4WRLA 2CHZA 1NC2D 1KPVA 3D9AH 3GZKA 4BY1G 5CBAA 1QR1A 1MFBL 2HT1A 3BSZL 3F58H 5COYA 1FV1A 4JQVC 4JFUA 1JE6A 4U33A 5EB9A 4RMTA 2D7OA 2XNAA 5KVGE 5CSBA 1KYOJ 5AVXB 1Q46A 3MBXH 4HZAA 5A43C 1JD7A 4XNAA 1FIEA 4KVNL 5HHMB 1KULA 3TM6A 1CA5A 2C1PA 4OZFH 1KC5H 3JWOL 3IDYC 2Q3XA 1JYVA 1C5DA 1G7LB 3HZYB 4Z0BH 3ZXAC 2OMZB 4JR9H 5AB9A 4AQYL 4AIOA 3DKHA 1LO5D 4XO8A 3L3DB 3CFNA 4IIQA 3R1GH 2VL4A 1I50H 2IL8A 2Q87A 3GK8H 5EWIH 1F4XL 1SBBA 4G1MB 5D4QA 2OMVB 5H8DA 4XPAH 3Q05A 4RWYL 2NXZC 1YEDA 4P2QE 1KTKE 5SWSA 2YZ8A 2EDWA 3LNIA 2CO3A 1HIML 4UOQA 2L0CA 4MXVF 1LXMA 1BQKA 3BJ91 5CD5D 4WZ9A 1S7QB 5KS9A 2V7HB 3BEWA 5HI3C 1X56A 4ODSH 2KHJA 4R2GB 1HVXA 3GSWA 3F83A 4Z78B 4RLDA 1TWGH 1HC1A 3MA7B 3Q7JA 3SGDI 4QLWA 4DUVA 3BHBB 3DA0A 3TN0B 3B9EA 2P44B 4JL2A 5IWAL 3TF4A 2GVAA 1Y07A 1JCVA 1AXTH 4DNTB 4L8SA 2BSED 3FB5A 3KH4A 4C1NI 2XXGA 1JHLH 3LKRB 3B2PA 4ISVB 4WK4B 4CBZA 3AFLA 1G91A 4IPGA 4JI1Q 1CE1H 4ADGA 5JMRA 1B0WA 1RZ7H 2W8CA 3ENEA 3V0AC 1CF1A 3L3OC 1CGWA 1N0LB 1LO3L 3KPRE 4PGJA 4KKBC 3ULUF 1JPST 1T2QL 1F6FB 4FYDA 5D6DA 3I84A 5IMLA 1VKXA 3QDMD 1YVLA 2X1PA 2A74A 3L9YA 5I8KH 1KTDB 1KFGA 4NFDA 4XNXL 3FQNB 5E8DL 3VSUA 5ANHA 2LLLA 1KC8C 1A3VA 4UT9L 1AZPA 1WFOA 4TM9A 1QABA 4U2YA 4B9WA 2EIZA 3QEUA 3PNWB 4OZHA 4B6ZA 2FYYA 1EEZA 2JP1A 3I3BA 3ERSX 2VYRE 4BBRG 1WGVA 3K0WA 3AS0A 2A6DB 4P2RE 4L8CB 5F7KC 1DCZA 3M07A 3TZDA 4OQTH 2RDHA 5D2LA 1UENA 4TSCL 3NBNA 2CDFB 4XE5B 2DWDA 2HVJB 1I7TB 1QHQA 4E41D 2P1YA 2PW2A 3M6DA 4LLAA 3WTYA 4C3JB 2NLJA 4UZGA 1MG3C 1GYUA 1NJ9B 2VN5A 1DVTA 3QEQA 4ZX4A 4U0RB 4RWSC 2IGFH 1CFBA 4I88A 4WFEE 3LSOA 4YZWA 1F56A 3HUJF 5HHPB 3HOWG 4A68A 5IOPB 4QRPB 3GMPA 4V1DA 1BXXA 2PCPA 4JREC 4YWLA 3EGXA 3PL6A 2HP4A 3VR2A 1QNZL 3MLXH 4N6QA 5ISZD 3UYRH 2VXUL 2R1YA 4Q8BA 3GXDA 1FN4A 3PP3K 1PDKB 3T0EA 1SNCA 3I75A 4GEIA 2OXHB 3OHMB 3QORB 4LLWB 4LEOB 1U3JA 3FUJA 4M48L 5ELEA 4P2CB 4NKDB 3LNNA 5IGGA 2AZAA 1J1OL 4AL8C 4JI8Q 3C2SA 1SAPA 3O2DL 1VFAB 3HBGA 5TD4A 5T1MB 1BBJB 5DJYB 4N5ED 5CKGA 3F7LA 4HHAA 2JA8B 5M5XH 4HPYL 2Z0SA 5IQ9B 1OB1A 1TR7A 5IVXB 3HC4H 2CKBB 1R9FA 2V9QA 3S15H 4APXB 4XH2B 5F88A 3WY1A 2WZ0A 4NHUB 4AMWA 2FK9A 3RKDC 1K4DB 3X1BA 5K9KA 3D1MC 4PWFA 3Q0AA 1XIWD 5DT1L 4JO2L 2A6IB 2XXMB 1FNEB 4KXZH 2ZOWA 3DXAA 4Q0XH 2FL5A 1FNWA 1UA7A 1U93A 2CRZA 3J8F7 3KHOA 3AS2A 4QUOA 3OB0H 4F1SA 4X99A 1MN4A 1RZKC 3K74B 3MODH 3PQIA 4OWTB 3TS0A 4EE2A 5BV7H 4IRJA