2QKIC

Human c3c in complex with the inhibitor compstatin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
306
structure length
292
Chain Sequence
TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Structure of compstatin in complex with complement component C3c reveals a new mechanism of complement inhibition.
pubmed doi rcsb
molecule tags Immune system/hydrolase inhibitor
total genus 60
structure length 292
sequence length 306
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qkiC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2qkiC01
1BUVT 2QKIC 3CU7A 1XWEA 4ILWA 5FO8B 4D94A 2PN5A 3FRPB 2WIIB 2I07B 1GXDC 2XWBB 2XWJB 1UAPA 1BR9A 1UEAB 3HS0C 1BV8A 2A74C 1BQQT 4LNVA 3HRZC 2B39A 2TMPA 3L3OC 3T4AC 5FO9B 2E2DC 2A73B 3V96A 3OHXC 1OO9B 3MA2B 3KLSA 2J0TD 4FXKC 1PXUA 2ICEC 2WINB 1AYOA 1JC7A 5JPNC 1D2BA 4FXGC 1EDYA 5JPMC 3CKIB 3I70A 5FO7B 3G6JB 5FOBB 1JB3A
chains in the Genus database with same CATH superfamily
1SNDA 3SGIA 1S7RB 3QB3A 3SBPA 4A93G 2IBZY 2DLFH 1I4HA 4NQCA 1N59B 5C86A 4WKZB 3QRGH 4H4NA 4P2QD 5EC2A 2NYZD 4QOKA 2UU9L 2Y24A 1JE6A 3NJHA 2J1YA 5C0EA 1PZJD 3DTXB 1CKMA 1QSED 1U6AH 2DQTL 2VDNH 3O45A 4KFZC 3VFSB 5ABZA 3FT1A 3MAWA 4N9GA 4PJGF 5G5DA 1NICA 4QL5A 2FWOA 3L9RA 3LZLA 3H9HA 3FT0A 4XMTA 2D31B 5CEXA 4PJGB 1UD5A 3GK8H 3GSOB 1MFUA 1WTOA 2EINB 4WTWA 3WEMA 4X0KB 3TBBA 4XODA 1SOKA 3QXUA 2AJYH 2YARA 1VFAA 3MRRA 3ULVH 1RUKH 2EQSA 3L13A 4NUPA 4Y2DB 2A74C 2OCCB 3KLRA 4H26A 1INDL 1F4YL 3VR2A 1QEWB 3DGDA 3GM0A 4MQTB 1NDGB 4AYFB 3EBAA 4XVTH 1UWEL 4ZUTA 3FQWA 2LFEA 4JQIH 2UXVA 2B14A 4KH9A 4LFBQ 1MCLA 1XGTA 2XZAH 2ERJB 4XHJC 4NBXB 5IHLB 2CUIA 2IXQB 2MKWA 3WIHL 1QVCA 1OE3A 3FOMA 4LFHG 3D69A 4X3SA 1ZWIA 5EZOL 4JOIC 2NCEA 4RBPK 4H44C 3V5DB 4LF3A 5TDOA 5JORB 4JY5H 4DF9A 4KKZA 3KPMA 1U2YA 4WW1B 3WFEL 3QWRA 4ETQB 1M9WA 2ESVB 2AJUL 4DU9A 2F0UA 3QA3B 3QAZC 4Q6KA 2MTAA 3IE9A 1BM3L 3NA9H 4XN7A 3FT2A 3BD5A 2B2UC 4IRSD 3CPUA 2DN7A 5INCB 5ENWA 4DNTB 1F6FB 1JZ2A 3JYBA 3S37X 4OO1I 4M1GH 4QEGA 2YUXA 2WZ6A 4AYBA 1KZQA 1AE6L 1GTFA 3O3AB 5JQ6H 3MRQB 2FVNA 3NFSH 2DMKA 4PD4J 4NAJA 3EGSA 3L5HA 3VX1A 3E6HA 2CMRL 5F3BB 3K46A 2GVAA 4P4KD 4KVCL 1S5HA 3L7EB 1YN7A 3QZPA 5DM63 1RP9A 1ZYRC 3P4LA 2YU9B 5FHBH 2DQCH 3P4MB 4ZUWB 4FNQA 1IGFH 3FW6A 5FM4A 2A6KB 3HBGA 4KXDA 4J6HA 3T65B 4R26L 2OBGA 1VLXA 2WKGA 3ATEA 1OGAD 3WFCH 5ECJE 4O51A 2EOTA 1GHFL 1OARL 3TDQA 1LO3L 2GSMB 5AW3B 5CLWA 1SGKA 1Y69U 1DBAH 4A6YH 1TS5A 1J5EQ 4XPTL 1D6EC 4LJZC 2K32A 1RK0A 4BBSG 2W0FA 3PF2A 1PH7A 4KPHH 3A56A 5FK9A 5IIEA 4PP1C 4URTB 5HY9B 5ISZE 3L4TA 5MHSD 4AV5A 1KYDA 2Y6SC 2H3NA 3GLAA 1BF2A 4AQAB 1G9MC 2ENQA 3QEQE 1DVQA 5LN4A 4LDOB 3ET9F 1EO5A 5DUBB 3SCMB 5I1KL 2JKSA 3GQBA 2B5IC 5IROC 3DXAB 3NIFF 1I4PA 3IJYB 5SWSD 4XNDA 1M1XB 3MLWL 1UA6L 3A0JA 4ZW7A 3CIAA 1NLDL 4JFZL 1YNTF 1N64L 2F68X 3NIFB 5DLMH 3UG4A 3B2DC 2N4IA 4YJZL 5M5WH 2Z31B 3GZPA 5G2NA 5SWZD 4E9SA 2PR9A 3QXAA 4F7TA 5T33L 1YNTB 4XCEB 4YHPB 1IT9H 3FCTB 1F9PA 3MMEA 2OMUA 2QTEA 1A14L 5ERWA 1JB3A 4F7CA 2Y2YA 4GQPH 1TTFA 1ET5A 4DR7L 2BNQD 2B1AL 3K80C 1C7SA 4NKOB 4PJAE 1FFNB 4KROB 3DETD 5EF1A 1TQWA 2VDQL 1Y8OB 5K59F 3RFZC 5EU3A 15C8L 3FU5A 4LSQL 2A6IA 2M1KA 1TQVA 2B8GA 1JWSB 4H25A 1ZDSA 5D7KE 1OTTC 5L4MA 4EEEA 2F08A 3GXTA 1N3NB 1QB5D 2BWIA 1AQHA 3HOVG 2IEPA 4YXLL 1DHKA 1TY0A 3HG4A 4QOKD 5AKRA 3PF5A 2BW4A 3FN3A 4OZGE 3RFRA 1I1AB 2C34A 2XWEA 2B2UA 2EDEA 1HQRA 2ZKYA 4LIQE 1BVKA 2VM3A 1HA5A 1WI5A 4DK0A 2L0DA 5F9WC 4KY7A 3F64A 4U4BA 1ZS2A 3TFKC 3P1VA 1FFPB 3L1FA 4HF5L 4JFHE 1MHPL 4G42B 1L9MA 4QRRE 4XPBH 1PZUB 1HAWA 2NW2A 4PG9A 2L1BA 2AJSH 4YE4H 3FUKA 3QZWB 3T0EB 4ZNEE 3EO1A 4Q52A 3HZKB 1B7YB 5D7SH 5SV4A 1BLNB 3BKCL 3SKUD 2YOAA 3MV9A 4QNPF 2RIKA 4A3IH 3O6FA 2YQGA 4M4RB 3IDGA 3GBML 5AAWC 5E7BA 1JXFA 4R6UA 3L2NA 4OY9A 3GV6A 5DK0B 2LS01 3O6KL 5I9QC 1TJGL 2FD6L 2E9GA 5KRUA 5GZOD 4PJHE 3S6CA 2VW7A 3HE7B 4U0RC 2F58H 4NWUL 1BCPF 3ND9A 5CMAB 4GAJH 1CLCA 2MCPH 4FMFA 1BCPB 2PR4H 4LNVA 4TVPE 3IKKA 1TCMA 4HD9A 1LD9A 1IKOP 3OAYK 4F57H 2A73B 4BV1A 2O30A 3CFCH 3SPHA 1PXUA 2NXYB 2KH2B 2G3ZA 1CTOA 1VACB 3QWRD 4FULA 4NIKB 4YHMH 1E4XH 5F7DA 2P42B 2WP3O 3SBQA 4JPBW 3OC8A 2IVFC 5LAXB 1KCWA 3ECBA 1JGUL 3IDMB 2MFIA 3NJGA 3F04A 3MRFB 1SNQA 25C8H 2ZWNA 3D25B 4JRYD 4ILWA 3QW9A 5AOMA 2O5ZL 2VXUL 1DQJB 4MQ7A 4WHDA 2B4CC 1FIGH 4P2OA 4XB8A 2CHWA 3IDYC 2VC2L 1D7BA 1IGIL 2YEVB 2FWUA 5CR1A 2EYSA 4XVSL 2Y4SA 1HA6A 1OXSC 5EN3A 1ZT1B 4Z3FA 4N1HB 1A6ZB 2XTIA 1X4XA 4I1RA 5GRUL 3QE5A 1YEFL 4OIAA 1KABA 2CM6A 1SDYA 4WHYH 1SNRA 3PWNA 4I0PC 1R4XA 2BP0B 1JMZA 2KKQA 2OYKA 3JWDL 4ZO6A 5IT2H 4PJ9B 4TOYL 1F41A 1SN8A 1J0KA 5HXMA 4IN3A 3K1DA 3KLSX 2COQA 3C1EA 3ULPA 4HFUH 2LU3A 4QO1B 1QLEH 1PTOD 1MCJA 1H3TA 3C09C 3ARXA 1IZKA 2RQ8A 3KPSA 3EYQC 1XIWD 2YBRA 2WINA 5T3ZH 1AXSA 3OR7B 3DXJC 3VXMB 4A7UA 1D9KC 1HEZA 3CXDH 4QPEA 1PJWA 1F11B 1L9TA 5EKIA 4A3MH 1K4DB 3GLDA 3SE9L 3SKMB 5ANMA 1PZBA 3I7FA 5CYUA 4G6MH 3HA0A 2Y5QA 5D3DA 3DIFA 2E27L 4M61B 2D9UA 1G7JB 4ZFOA 4LGRB 5E70A 2XACC 5HYJD 3WNIA 4X9FA 3IFTA 4FF1A 3ZVVA 3ZR5A 5FYJH 4JI6Q 2G5UA 1JZEA 4HBCL 3OHXA 1NCHA 1Q9OA 2EQDA 3RIFK 1QPXA 1TZIB 3GPSA 2ZD0A 5GGSA 2OR8A 3N50A 5C2UB 5I6OA 3SDAB 2W9EL 4JBMA 3ETSA 4OLUL 2G5DA 4K4KA 3WEBA 3MU3A 4ONGL 3VXSE 1O6TA 4J4PA 4CDEC 3ARGD 1MVUB 2V7NA 4P9MH 5JIHA 1DQVA 5EZJB 4RGND 1BZDA 2CWPA 4P5RA 4OV5A 5C0AB 4PMWA 1SE3A 3V4VB 3O3EB 4AIMA 3X3FH 4NZRH 3DSNB 1F86A 4WRLA 2UUAQ 4UM8A 3K6IA 2WLNA 1JE4A 1BGXL 2WVSA 4HP5A 4GI8A 4I3GA 3D4GA 3TIEB 3BDYL 2I7SA 1E1TA 3Q6FB 2CBTA 4AGNA 1MFCH 1RMFH 2OCFD 2UUDH 1HQRD 3P69A 4KO7A 3RNKB 1BD2B 5AVVB 3MLSL 3SIKA 2XX0A 4TVSa 1E5BA 3MLPA 3BHBA 4DP2X 4HJGB 5KSAD 2H4OA 3D0FA 5KVDH 2OTWB 3D9AL 3S16B 4FQPA 2IH3B 2YMOA 1VAHA 3MBEC 4V2CB 2IADB 3O6FD 3NBIA 5J3HC 4DVBB 4FYQA 5T5FA 1RURL 2HJFB 1EHAA 3FO2B 4HSVA 1WBYB 3CD4A 4FQXC 5HYIA 3D2TA 3OLEA 4BGLA 4OLWL 5HHNA 2EDHA 5LBVA 5DD1L 3GEWB 4S11A 3ER0A 4NKMA 5DUMH 1HHHB 2CDGB 5MEQB 5T1KD 5D5MF 2R4RH 4B9IA 2YTXA 1PV4A 2HX9A 1KJ3L 3R8BA 3RPIA 3ZRFC 4B9CA 5I1GL 1QUQB 3FZUC 1ZA3B 2OJZH 2PYED 5D5MB 3RVXC 3VX0A 3EW3B 4S1SH 1D9KA 5K9OB 5K69A 5LUMA 2FUQA 4K3JL 2WTPA 1YDPB 1I3RA 1G7QA 4CC0A 3ALWA 3NK3A 1J1PH 4W9EC 1E28A 4QRQB 4GI6A 3LQMA 5GRVK 1JFQL 2Y06L 3GBLA 4ZYKB 2Q6WA 2F15A 2BVOA 3N55A 4KO5A 4OCSL 3IDNA 4XNQA 5ISZA 3C46A 2K4WA 3DROB 4GLRH 1G1KA 4BY1G 4R0LB 1W9XA 2A77H 4JFXA 4X7SH 3QEQA 2J72A 1S7QA 5F9AC 3RWFA 5ICZA 3Q06A 3LXUX 4JZOB 2VR7A 4C1NK 3AITA 5CV8A 5DJYA 3KXFD 1VADB 2UYLA 4RFEB 4QT5A 2ZKMX 4KX8A 3LCYA 4JFDE 1SXCA 5F8RC 3BYYA 4G8IA 1FNLA 1RIUH 4GZYC 2CO6B 1F4WH 3FUIA 1MREH 2YGPA 3I2CH 1GS7A 5AWNL 4WWKA 1GHJA 4H20H 1VQ5A 3VYSA 1J48A 4OLXH 4KMLB 3TH3T 4HR7B 4ANXA 5E6IB 2VL4A 3OD3A 3CPWA 3CJJA 1KFAH 3DDFA 1KBBA 2NNAA 4WHTB 4WTZG 5DD6A 5ESQA 2RCNA 1YLBB 1U92A 1KULA 4RMRA 4E9XA 4N0YH 3HP3A 4PJAA 2BS9A 4H8WC 5EUKB 3T0DA 2Q2LA 1NSNH 4IU2A 1V05A 5GAHC 1QBLL 5H37A 5DHDA 4UDUB 1FVDB 2VLLB 3BVTA 3MROA 4PJXF 4HUCA 2X4QB 5JW4R 1I7ZB 1NUNB 4DP1X 3NAAL 4LUZA 2NY6C 5HI3C 4MJIB 3QRLA 2AKRA 1M57B 3FYIB 4HUVB 2NUTB 3AU1A 3P0YL 4FDWA 1MWAB 4PJXB 3F62A 5IB4B 2V5TA 5FKAC 5I15L 2XTJE 3T2PA 3MXGA 4BY1H 1LM8V 1ZA6B 4OZGA 1AO7E 2G9DA 1Y6KR 4FAAB 4IJ3C 4XCCL 4HK0A 1AKJB 1TVXA 2JYOA 3HKZE 3TN0A 4UMSA 3MLXL 3MBEA 5KYLA 3FCSB 1VRSA 3TV8A 1CFSB 4BFGA 4PJ8B 4XN8A 1KCKA 3O3BB 4QRRA 2L55A 2NY1C 4JHWH 4LKCB 4X4XB 2XVGA 3BVVA 2MQ0A 3LH2H 2VDRL 2NT1A 4ZNEA 1DBBL 1D5IH 1KJMA 3A6BL 1X6NA 4G6FB 3L4UA 4ZPVB 2NLJB 2KCTA 4P59H 2UY7A 2LOEA 1JF6A 1WWCA 2Z4QA 4KVPA 4OLYH 2F53E 1WBZA 2YD3A 1MW2A 3C6LC 4ZX6A 1FGVH 3VFMB 3QJZA 4HQQH 1XSIA 1VQGA 2GSGA 3C2PA 4PJHA 2KC0A 2E7BA 3K7UA 2NSXA 3A4EA 1K3RA 1FA4A 2QKIA 5D1QB 4AL8C 5E03A 4I4WA 2AXWA 4HZLA 2I85A 4BZYA 2HUGA 2Z8VC 4DGVH 3VA5A 1BMGA 1UD6A 3JV6B 4QJ4B 1ULVA 4K9EC 2XTSA 5DEGA 1IBMQ 1TYRA 2JIXB 4L3CB 2Y7QA 4ZMQA 1UCBL 1V9PA 1WFOA 2Q8BH 2CG9X 3MRDB 4U6YA 2Q87A 2IPKD 4C3IB 4UHVA 1BAWA 1FZMA 3U6RA 2RCFA 3Q48A 4FNRA 1WO2A 3KPLA 5HGAB 5E9DB 2Z7ZA 5JOPD 2CCWA 4EI5D 5A2QE 2B16A 3FTXA 4XNXH 3ZJAA 2WYZA 4U1JA 1EQQA 4HJ9A 2XG5B 3WG7B 5BOPA 1EGJH 3K5SA 4HFWA 2NVTH 4NBZB 3DIVA 1I9IH 4UCFA 1O7ZA 2GABA 2NZ1A 4NX0A 1QZ1A 4ZUUB 4LCCB 5BQ7B 3CG8A 2FX7H 3EYOA 1IL2A 1G7MB 1T04B 5C0JB 2ADYA 4HCGA 3FDWA 3L3OC 1I7RA 2IDSA 2Z34A 1MH5A 1TTAA 3B9AA 2K04A 1KYFA 4MJ5A 5DQDL 5TQ2H 2GEQA 4OZFB 4ICXA 3OWFA 4TUKL 4NZJA 2HRPL 2FGWL 4L9LA 3GTOB 5HHVH 2BSRA 2DWTA 4DZBA 4JB9L 4GB9A 1SY6L 5TDNB 1ICTA 3RVUD 5T1IA 2GAZA 2OZ4A 2UXTA 2CGYA 1IGML 3QH3B 3R8QA 3HAEG 4ZTOL 1IBKL 5L4JA 2A9CA 3G08B 2JLLA 5KYUA 3WENA 1SYEA 2Z65C 4AE1A 3KR3H 3E8UL 4PJ7B 1X44A 3PGCB 1NAMH 1OTUD 1YAIA 4RGTA 1QQDB 2X4NA 5ID1A 4DR2Q 3QEUB 3T8XB 1C8CA 2FJ2A 1P2CA 4KKPA 4M6ML 2VIRA 4TNWK 4NJ9L 4FLOA 1FNUA 3AEVA 2L12A 2Z0SA 1KN4L 4RVBA 4DVRL 2YEZA 1FG2A 2C9AA 4WEEA 2WKCA 5DQ9B 1M7UA 5DMKB 1ZV5A 2PMZB 4LHUA 3UJIH 3L81A 4YHNA 5EIVA 1H6UA 4RRPM 1YO4A 2K1BA 1VQOA 5GSVB 5CSZA 5M3FG 2GHZA 2VLJD 3WELA 1X32A 2ED7A 3ZYZA 3I9AA 5ILTH 3OKOA 1AACA 1UOLA 2I07B 5IP9H 1N0XH 4IDLA 4MLIA 1PDQA 4N2HA 5D6DA 1RUML 3CZKA 3P9WB 2VXQH 3VFPB 3CC1A 3BPNB 1U8QB 2LQRA 4ZNCD 5IHUL 2AQSA 2VDOH 4JMNA 5KUMA 1Q72L 2RKSA 4LB8A 3EIVA 1ZLEA 3HB3C 5F9DC 4RZCA 3P2TA 4N68A 5C0GB 3ZL1A 4RFOH 1BXVA 3MOQA 4ENED 1Z9MA 3BLPX 4HJSA 2CGRL 4X4KA 1X4YA 2ICIA 2E0PA 2YQ3A 3AREC 1T20B 4PGCB 4B3SQ 2X1QA 3O4OC 3O6ML 4MXVF 4Z7WA 1DVFB 4X7DC 3U0TA 1M2VB 3MREB 4JFPA 1TENA 3NMEA 3SE3A 3V79C 3DX7A 3DX6A 3I6GB 1TDQA 4O58L 2ADGA 2CH4W 3QQDB 2E2HB 4JFHD 4L37A 1NMCC 3VUAA 2DW5A 4KMTL 4GOSA 4M8RA 4OF6A 4DN4M 4J23A 5C0BD 3SKNA 1IAMA 1WIOA 3VA6A 4A2LA 2PP7A 4FFVC 1KLUA 1Z9SA 4B5ZA 4Q9CA 5J3BA 3A47A 3OVUB 5EO1B 3ROLB 1S5FD 3P11L 5C44B 2FBRA 1XGRB 2VKWA 4GLAC 1CSQA 5D2NB 3RTLA 4BEIA 4DTGL 7TAAA 2R69A 4KTEH 4OZ4B 4MCYA 2DKUA 3U9WA 4BFIB 3SQBA 4B3RQ 5KVFL 1U3YA 3L3HA 1F90L 2YR3A 1BR9A 2I5MX 3VYNA 1Q8IA 4H02A 1EMTL 1KTBA 1B4JH 2R93H 1FZOA 3LKOB 4DUYL 1X3PA 3MFGB 4N2LA 3C5SB 4TVPD 2QHRL 3GJFH 4TLKA 3C8KB 2Q76B 3WIAA 4QWWD 2RH0A 1E24A 2HTLC 4W81A 2HVJB 1N6UA 2CLZB 5L2KA 5KZCD 3TS8A 4BKLB 2IALA 3J27A 2CHZA 4I2XB 2DQEL 4PCTA 4PD4K 1Z7TA 3SE0A 2DD8H 1UATA 3QGVA 4LLDA 2KHJA 2FT7A 2IDTA 4RFNC 3CMOH 1JHTA 3NZ8A 1UWFA 1VQKA 2RF4A 4WGKA 3R0MA 3ITPA 4XH2B 4BFJA 4S1RH 1I3QH 1X6LA 3O11B 3AB0C 4HISA 1EEUA 2Y7NA 5E4WC 3QDGB 4JHUA 4UAOC 4A7GF 3B6YA 2G4GA 2AK4D 3VI3B 1K0SA 2DICA 4NPYA 5E4EB 1PQZA 4TVAB 1EYDA 1TJXA 1CI5A 5CGMA 4JFDA 1IVLA 1KT2B 3LKRA 4FQQB 4JPKH 5HJ3B 3V6OA 2D8KA 4P2YA 2DH2A 4HEDA 3DJRA 4QIRA 1EEZA 1R5VA 1RJLB 2VJ8A 2O6FA 4GW4A 1LP9B 1V54B 5TE4H 4R4CA 2YRZA 2BCKA 3KWTA 1FGBD 5IFAH 4FRWA 4S0HA 4D0CA 3L3JA 5B3SB 2L11A 4QXWA 3GXUB 1CGYA 1A6UH 2RA1A 1MIMH 5TQ0L 3RURA 4DP6X 4WSJA 1PFBA 2WMPA 1NCAH 3B9EA 3U46B 1X5HA 2VW6A 4IBLT 3NESA 3QNYB 4NM4H 3MRLA 2M83A 2HKFL 1L1OA 2XNAB 5L2JA 2BP8A 3FH5A 4ZUVA 1OGTA 3KHOA 2DB8A 3MHBA 2QFPA 3HE6B 1B6UA 3N44B 1R3LA 3QI9D 1UKTA 1H9VA 3LIZA 1XWVA 3B6SB 4TVPL 1X5YA 4JG0H 3U6XS 4PG2A 2PW5A 1UD8A 3A6CH 4ZS7H 4JYAQ 1WAPA 4OF0A 5B39G 1ROWA 4Y4KB 1AO7A 1EIHA 3NCMA 2DEYX 1VQHA 1Y07A 2VM9A 3HKZA 3R06B 3W9DB 1GXEA 4A38A 2B77A 2OK0L 1G9NL 4LHUD 4ZODA 3CCVA 4DK5A 3OAUL 1ZVSA 2VO8A 3NIGE 3BH4A 4F9PA 2VLRA 2LXJA 1NIEA 3SDDD 4XDXA 3B43A 3ZE0E 3GMQB 3F5WA 1Y18B 3OX8B 5IEHA 2AQ2A 2HT1A 1KEMH 3D12B 1MY7A 3FO0L 4D9RE 7FABL 1ZLDA 1V27A 2XV6B 4YE0A 3ZE2F 4F8NA 1M6OA 4GSQA 2EDBA 2PW2A 4HWEL 4ELME 1EFXD 1I3VA 4IRJC 4PP2B 4PRHB 5TFSH 3MV8B 3KZ8A 1D5MA 2PO4A 4KD3A 3ZE2B 1RK7A 3TVMD 1S3KL 3NBNA 3QXVA 1B6DA 3RUZA 4N2OA 5GGUB 2DLHA 2FK9A 5ELOA 2ZXRA 3NYKA 4IJTA 3SPVB 3QULB 1Z9OA 2WVTA 3RNQB 1I4FB 1B90A 4GQ9H 1S9XA 4F8MA 3H3VH 3X1BA 3F7YB 3V8CA 3OXRB 2GTZB 4RCOA 4GI9A 4LL4A 4NUJA 5E8PB 1FO0A 1T5KA 5IHBA 5JMOC 1EZSA 2CBMA 2EY6A 3W1GA 4TSAH 1XGPB 2VUKA 2EDLA 1SNMA 1A6AA 3CPFA 1NIBA 2DL2A 4LPXA 4HWUA 4Y7OC 1O9VA 3O8XC 1C5DA 1KELL 1O6SB 4KO9A 4WUKH 3WV0A 4K6DA 1KLUD 3D8GA 5F96H 5C08A 2P45B 5KBDA 3O9WD 1NCUA 4ZXBC 2D7TL 4GINA 4RESB 3PO2B 1GJIA 3HBPA 5T3XH 3QO1A 3QOLA 2K75A 1MCEA 4XBPB 4D8PA 1VCAA 1ZS8A 3DGGA 5L8KB 2W60B 4JVWA 4LSDA 1LYLA 4DR5Q 1DVSA 2IWHA 2BX5A 1IYUA 2PPAA 4FQLL 3I75B 4G11A 4TKOB 5KW9L 4JE4B 5EIIA 2I60L 5AW8B 2AHIA 3MYZA 1JGEB 1L0YA 2Q86A 1Q3LA 5B21A 4JN1H 3BKYH 4L4VE 4P5KA 2DMHA 3IDUA 4LEXH 2VSMB 5F8QC 3KK7A 2A1WL 5IF0A 1BX2A 5DD0L 5ETUA 3QYMA 2JKNA 1YHQA 2NY5L 4WI5A 3S48A 5L2KD 4HIMA 3DWTA 3FKIG 4LNRA 1OPGL 2M2DA 2Q5BA 1DFBH 3FU6A 4TNVF 2BOBB 3D39D 3EGDB 2RFXA 5I2IB 3ULVC 1I6HH 1XAUA 2MMXA 4M43H 2QGEA 2WHVA 3QDMB 4WGWB 3HRZC 5GGVH 3I9IA 4JDZA 5JIKA 3LB6D 4JBSA 5BV7L 4QHNA 3MA7A 3QNXB 1DD2A 2P8MA 2NVQH 4JRXB 4MHHG 2ZXGA 1WISA 2E76C 2VQ1B 4A2EA 1R4QB 1PBYA 5H94A 1BYNA 2QF7A 1VGKB 2E5EA 4L8BA 4F24A 2WNWA 2KMWA 4GBXD 4V0BA 2OZNA 4X6EB 3ILPA 4M4PA 1TJIL 2NNRA 4X5XA 4X80L 4HIIA 4W9DC 2G5RA 4KITB 3CN4A 5J1ZA 3GSQB 3RI5F 1RLWA 1U5KA 1VEOA 1KC5H 5DSCA 1LTLA 3SN6N 4URKA 3M1BB 3I4MH 3LDBC 2BSSA 4B9GA 1R17A 3U0WL 4W4OA 1X5LA 1N6QL 4Y4HB 5DS8B 5E8NB 4UINL 1PKOA 3WE1A 5JW5A 4DK6A 2VXWA 3L16A 4KKNA 3UACA 1TXYA 1DUYA 4EQPA 3RGVC 3MCKA 3X3GL 2ZNXA 3V0GA 3GMLB 4EUPG 1YMMB 3PL6C 4RRPG 3NIDB 5FLMH 1DLFH 2XXGA 3KD4A 2VN6A 2WLLA 4BKTC 4PJCF 4YHIA 2Y1VA 2OL3L 1YNKH 4HDIA 3FNKA 1E50A 3F12A 4JHZA 4YGVB 5DXWA 1T80A 4XNUL 4YFDB 1T2QH 3CFBA 3LX0A 1DZBA 1WTVA 1HILB 1XF5B 4JFED 5FYKU 4PJCB 4MZ2A 1Q8KA 2NZIA 4G9FE 4ODHH 4Z5RB 4L8CB 3FKIH 1HRJA 5G55A 2ENJA 2IAMB 5C0IA 2KDYA 3FT4B 4ADGA 2WQRA 1A3TA 4F7KA 2ZUSA 1QFPA 3GTJH 3HR5B 1DOMA 1KIXA 2R2EB 1KB3A 1JI2A 2C1PA 2CRMA 1VENA 4LP8A 4MD4A 3COOA 3GS0A 4LP4A 4OCLC 3L6FA 4K7FA 1T22A 3QEGL 2QSTA 4DAVA 2OXGA 2X6MA 4PIBA 4ZK9B 5FV1L 1QRNB 1RU9H 4L5FE 4I7ZC 9CGTA 2VLRD 2WXFA 3AMLA 1S8DA 4JI2L 1WTQA 2XN1A 2JN4A 3MXUA 5IOCA 3Q2VA 4JDTL 3S98A 4FQ2H 3N9GH 1GW6A 1LK3L 3KGRA 1YECH 2UU9Q 3I55A 2FHTA 1S5IH 1TLKA 3V6FA 3JUZA 4JI7L 4PREA 5FW7A 1M3IA 3BH9B 3F01A 3NBHA 3TO4B 5LKNA 3TO2B 2B2YC 3WTXA 1S5CD 1XPOA 1K6QH 4MAUH 4MGXA 4PWEA 3TIDA 4R4QA 2AEPL 4DH2A 4PRNA 1NE3A 1FHGA 5GAGC 2B63G 3L45A 3EDFA 4XNZB 2DWEA 1TTCA 4PRDA 5H2BA 2J7LA 2HWZL 1OSZA 1JD9A 4Y9BA 4DGIL 3DPBB 1S9YB 4GKZA 4AEHH 3FTUA 3EFXD 5KYXB 3ELAT 4ZX3A 1C4QA 1ENAA 1XL4A 2XN9C 4N4YB 2XICA 5HVGB 4FL4B 1QLFA 2O6CA 4EOWH 3DOIA 3EAKA 3Q05A 4FG0A 4OKVA 2SEBD 1STBA 3TNMB 1D5XB 1OWRM 4AIZB 3SGKC 1G6PA 2UZYB 4JI4Q 3FYEB 2NVXB 2VT0A 4BYHA 3GRWA 4J6IA 5C08D 4NHUB 1VQNA 5CZKA 3BI9X 3DUUA 2V9RA 3BN9C 2YPKA 1KPRA 1DSFL 4FQHB 4EDWH 3DM1A 3I4NG 1MCOL 2Y7LA 5ALCH 5AL8A 1BIIA 5EU7E 4YN3A 3VXNB 1KTRL 1CFVH 4MD5B 4YDIH 4H88H 4D8OA 1PYWB 3BAIA 4LCYA 5KVDE 1DO5A 2ARWA 1O78A 3JV0A 2OMVB 4YLQT 3UYPA 1MRDL 3BAXA 4N8PA 3SXHA 1QI3A 1OSPH 5TGBB 3WFHA 4JLRA 2EUVA 4HG4J 3FTSA 3EJZC 4XGZB 5B38A 1E42A 2CKZB 5F6HI 1LM0A 5KTEH 5E4AA 3NE5B 1DQQA 2X4RB 2O4XA 1B0GB 4HJJL 3ULUH 3VFOA 4QTFA 1BQRA 2ENBA 5BVJB 5CHNB 2BDOA 1AD9B 3CZJA 1HAUA 2VUYA 2YQBA 2MOQA 4QI3A 3K6SA 4ECNA 4MD0B 1PKQB 2R2CA 5GS2D 3REWB 3ZU8A 1PLFA 3BLBA 3Q22A 1DUZB 1HQ4A 2P80A 4UILH 5D7LE 4YCUA 3QUXA 3G7TA 3ESPA 3P3YA 2DS4A 3FDTA 4PY8J 3DHUA 4IBWA 1S9VB 2YPVH 4BQ9A 3ZQXA 5BS0D 1ZJAA 4RGOH 1MJ8L 1U8KA 5C2BH 3MXWH 4NIYE 4GUPA 4TQEH 4HIXH 3IMUA 5EAYA 2VMFA 2I5LX 4F58H 4U1SA 3L54A 3MJWA 3N42F 5EORH 5FKPB 1YY8A 3KGSA 2V9QA 4M3KB 1F02I 2R0KH 2ZM6Q 1KN2H 2RJMA 4GH7B 4EN2A 5DRWB 5EA0H 1WTPA 3U7YL 3N42B 4OFKA 4Y5YA 4CGTA 1YEZA 1IBGL 5IVZA 5JXAH 2K5QA 1VFBA 2KDGA 4TVUA 1WAAA 3ZO0A 4ELMA 1ZXTA 1J8HE 3PO3B 1UM6L 2Y0SB 1SN5A 1W72H 4NXKA 1JNHA 4P23A 5I75B 1JBJA 1I9EA 3RZCA 4LMQD 3P2BA 2X1XR 3HR6A 1KTJA 3LHPL 1DJGA 3LN4B 5J9PB 2B2VA 4WDIB 5J6HB 1N26A 2YXFA 3E6FA 2HFEB 3ZKQD 1I8LC 5IVOA 3TPUB 2WAQE 2V17H 4YDLC 3V4PL 3PJLA 4IURA 5C0XI 1MJ7L 1G84A 2C1OA 1MFEH 4WNJA 4HLEA 3GV3A 4RMUA 2LLLA 3T0AA 3SODB 1J1OL 3ATAA 4Z0BH 4NM8H 3U0PA 5D72L 5LHY1 2HIVA 3E6ZX 1DVUA 1HTPA 4NSKB 1VMPA 3FH7A 2DZEA 1WRFA 4XPGL 1A3LH 1MHEB 5F9OH 3H55A 2Q8AL 4UT6H 4EVNA 1ONQA 4WI6A 5B8CC 3HG1B 1JORA 1CR9L 1OP5H 3UFIA 3RUGE 2EC8A 4EX5A 3HFMH 1GPOH 4LCWD 3LHAA 4NNPL 1AJ7L 4BQCA 3KM1A 4OX9L 5J56B 1D1KA 1HTYA 3CSYA 1Y1WG 4Y7NB 2UWEF 5I1CH 2AQQA 4DV0L 1CQYA 1EEQA 3GMNB 1DE4A 1BXUA 1E8YA 1TWCH 3S5LA 2UWEB 3DMMC 4H8UA 4NJAL 4WEUD 5CINL 3V0EA 5L6YH 1CLYH 2X9ZA 4JRFA 4L4VA 5MEOA 3GBEA 1BFTA 4U68A 1XX8A 4NT6A 5B7MA 3S96A 3KUPA 4OGXL 5E5RB 3D87B 4R8IA 4N28A 2R7ZG 5HDWA 2PYKA 2NUPB 4Y9FA 4XN9A 3TYGH 1NCDL 4ALAL 1H0DB 3CN2A 2VDQB 4W9ZA 4UZSA 2XBZA 4P4KB 1ZLWK 4R7NB 2MWCA 5IKCB 1EY7A 1XV8A 4KBPA 5KJ4A 1W2BA 4S2SA 2OJEA 1XTCD 2C3VB 4BK8A 3K71B 3CFJB 2A9AA 4TQPA 2AK1L 3AS1A 1ND0A 3ZDYF 4UNTA 3A8KE 4AE0A 2I9TA 1MFBH 5DJ0A 3T5WA 1NGYA 5CEZH 4LGSB 1U3JA 3GIVB 1R3HA 1IFHH 3PP4L 3ZDYB 2W95A 3MOBL 3M4OB 5CD5D 2VY3A 4H1LB 2PXYC 2XRSD 3KBHE 3VXPB 4A68A 4V1DE 5HGBA 3UYRL 1NM4A 1UWYA 3TSSA 2CQAA 2WBJC 3NEOA 4MJ4A 3LOWA 3VD5A 4MSWB 2Y1YA 3B5TA 1WA1X 2AQ3A 3AG4B 1HH2P 3Q6GL 3WL9B 5DLQE 1RTNA 3IMTA 3SKOB 3CP0A 4EDXA 2IH1B 2J5LB 1BXTA 2LT9A 4M7JH 3INUL 4OWWB 3VYPA 1E8WA 1RJYB 2R1WA 5F1NA 4OCYH 5IGDA 2CO1A 2VMCA 2YU9H 4JI1Q 3MC0B 2TAAA 5IV2A 4OELB 2NY0B 3TZVD 3QFJB 4NQUA 3I6SA 3POHA 1U3HA 1A1NA 1G7LB 1FFTB 1TZGL 5CV5A 5I76B 3T9WA 4WJWA 4G9FA 5B3JF 5J22A 2FYYA 3IXTB 3EYSH 1JYNA 2YD2A 3K0XA 1N10A 3LKPA 1XO8A 3BUBA 5F7LB 4K2UH 5COYA 2HN7A 4G8GD 2H2PC 3AJ7A 3JWOL 1ZRUA 4X4YB 3K0YA 2BNQB 5K9JH 4ABNA 3KYNB 4WEBL 1JPEA 4XI5D 2EDTA 5KYNA 4BH8A 5ACZA 1O7VA 35C8H 2Y1ZA 1SF5A 1EJOL 2NR6C 3EJYD 4JM2D 2F0SA 2Q8TA 2R6GA 4HEME 2E3VA 4PM1A 5GIRB 3GRWL 5IY5B 3EXJA 2P5EE 3STBD 1L6XA 4XMVA 2HHHL 3P4NB 5AAPA 4OLZL 1V3LA 1MGSA 1QMUA 1FJ1A 2FYVA 4XVUD 4L3AA 3PABA 3NJJA 4NBYB 5EC2B 4QOKB 2MEJB 4U3HA 3IFPA 5IMOA 5FYLE 3E9IA 3GS7A 4P23D 5C0EB 2WWKT 3RTQD 3RZCD 4YHOL 1X5JA 5BNXD 2C9UA 4OCWL 5FDWA 3O45B 1IYJB 4KHTL 2VDMB 2CKBA 5EPMB 1WFTA 4IKLA 4PU2A 1U8IA 4N9GB 5G5DB 3SD2A 1PEZA 2FWOB 4GP8B 4KRPD 3C3LA 3H9HB 4R4FH 5E24E 5FX3A 5CEXB 4JANA 3I3DA 1XGYL 1DTUA 3MAQA 3FQRA 1ZIAA 3QQNA 2R1XA 1VFAB 2V5RA 4HXAH 2GYSA 3MRRB 4DNRB 3KS0H 2HRGA 2XKUA 4H26B 3D3VD 1IGCH 1JMCA 3L9EA 3G6AB 2E75C 4X6CE 3WHE0 3H9YA 4ELKA 3U7WL 4ZUTB 2H6UA 3FQWB 4XWGL 4LLQA 4IFDI 3C2AL 1PX4A 1XGTB 3L4VA 4P2CG 1IQDA 1SN2A 1UHVA 3FOMB 3T4YA 3PUVA 4YXHH 4GRLC 2P47B 3D69B 4O1NA 5EJWA 1VQPA 5IBUG 4MYPA 3LV3A 4KK5D 4C56C 4LF3B 3F2UA 4YBLC 2PETA 2N55A 1T3FA 1P84J 2ZONA 3KPMB 2UVEA 1JXGA 5GS1A 1E2ZA 3UYOD 2H1PL 5IBTH 5J13B 3VXTA 3FT2B 2ID5A 4JFFE 4AW7A 5ALBL 4HLZH 5C92A 3GC3A 1SEQH 5ENWB 4JRYB 3WIFA 2W65A 4AYBB 4UDTA 4K23H 1TVDA 5D1ZA 3GXIA 2JV6A 3I3CA 1YY9D 2V2WA 3V5HA 4DKEH 1OW0A 1PLGL 2BHZA 5DVPA 5AVRB 2OSWA 3MNMA 4F2ME 2MIZA 4PRBA 3EGSB 1Q9KA 5DF0A 1Q0XL 2A6JA 3E6HB 3PUUA 3U1SH 3IT8D 4PVNA 1S5HB 1EWIA 1YN7B 3VWKC 3L4CA 3K6OA 1JYXA 4KJWD 1FAIH 2FLMA 2ATKA 2ZXAA 3HMXA 2W1NA 1ED3A 3BQVA 2F19L 2A9NL 2F0OA 4M1CD 1PTOF 4F88A 4RA3A 1CDHA 4A3DB 1NMAH 2FMCA 2WSDA 4O51B 4JDVA 3UBXI 1KPUA 4FKEA 3W3BA 2CBPA 3FH8A 3PGDA 3V4UL 2MNAA 4LMQI 2ZOLA 2W0FB 1RK0B 4Q2ZA 5FK9B 5IIEB 2MNWA 4TXVB 5GGQL 1IKMA 1V8HA 4NCC1 4QXGL 5IQNA 1PVHA 3BWZA 4MAYC 3KYOA 1A7PH 2H3NB 4HUWA 3S34H 1NGQH 1SHWA 3NSYA 4LF9L 2CA3A 1K8OA 4R7XA 5E08H 2KVMA 2DM4A 4JHAH 2XIWA 1PPIA 2DQJH 2O6EA 1BQKA 3E2HB 1F2LA 3EYUL 4WFEE 1CU4L 5FHAL 3IU3A 4U6VH 1BCIA 3ARFD 2XBTA 3MRNA 3MNZA 1J8HA 3IYLW 3URYA 4OIIH 1S4IA 3CVDA 3FQ1A 3O41A 3WOFA 3QXAB 4F7TB 3E1F1 4K7PL 1KD1C 2W92A 3BDLA 3UEZA 1ETA1 4KKUA 1YEJL 4GFTB 3MMEB 2OMUB 4CKCA 1XMEB 2X2UA 4K7PY 5ERWB 4F7CB 2ZT9C 5AD0A 4HVBA 1T03H 2WAQA 1NEZG 2R61A 3RG1C 4AQ1C 2HLEB 4G7VL 4J2QA 4OF7A 1XR8A 2D0PA 4B5EA 4JREB 4AYSA 5I1HH 2JA5G 1JUFA 2NNXA 3BGFC 1UE7A 1LT5D 5EU3B 4TN9A 4FXTA 5D4IA 4QHMA 2A6IB 3AWFA 3LQAH 3UH8A 1RDPD 4XOAA 1TVHA 1HSBA 1L0QA 2F0VA 1WCMG 1FVEA 2VXTH 5HDQH 3RWCA 3H2QA 4GQZA 4OUOA 4P5TC 3RUGA 4I13B 4ZQ3A 5CO1A 4KRNA 5ACLA 2I0QA 1WUNT 1HQRB 1BVKB 4ZUIA 1C8QA 4XB7A 1VEMA 2YLKA 1D7CA 5IP7H 2GSIA 1Z6JT 3QG1A 3N1MC 1BF4A 4PG9B 4ZSOE 1VMCA 1PA6A 4QF4A 1P6AB 4X5LA 2JJVA 3EO1B 1UT9A 5IFHL 2XXMB 3AFLA 1MCWM 3MV9B 5FJ8G 5DHVA 3O6FB 3NZHL 3IDGB 4I9XA 3QUGA 2PO6A 1GC1L 2EIJB 1PCXA 4IOSD 2XQ0A 4MZIA 5DFTA 2XFXA 2P4AB 2IAND 4FFWD 1GXDC 4J28A 2B59A 1GUTA 3LAFA 3MCG1 4OM1L 3SYCA 1XNQL 2VDKL 2J1WA 1H6FA 1XYIA 2B2XH 1OM9A 3MFFA 4XPFL 1NGWA 2H32A 5B1JA 3MJ9L 2CBOA 5IZ7A 1AANA 1EZVY 5JW4M 4NQED 1M6UA 1CVSC 3ZYIA 1LD9B 1KWKA 2AERT 3BZ5A 3NN8A 4WZ9A 5CBEE 3AWEA 2R29H 2R15A 1T1ZB 1TJHH 3S16H 5CJOH 4MMXC 4E9WA 1CGSL 1IM9A 4OEMB 1AR1D 4N0UE 5F7DB 1LV9A 2KZKA 1ZGLM 1LO0H 4V1DA 1AD0A 3QDJD 3L4ZA 2O6DA 1CICD 3ECBB 3MJ8A 1CDUA 5T3XE 4LGPB 2YD0A 1E9PA 1JOIA 3FU3A 2J20A 2XPZA 4H8PA 1DDTA 3JSSA 1HZ9A 4HC1H 5LBSA 3BH8A 5HYQA 3BSZA 4JV5L 2DL9A 2EDNA 2YD8A 4MQ7B 4BUHA 1UE1A 5EZPA 4UQBA 3QJFA 4P2OB 2ZKHL 1HL9A 3QZBA 1N5AA 1STNA 5JHDE 2EYSB 3QIUA 3K59A 1OCWL 1YITA 1L3WA 1MHHA 3R4RA 1GZQA 4E9QA 4KDVA 3CQFA 1BQSA 4AM0A 4BCZA 4OM0H 2L7QA 3PWNB 4FS0A 5F88A 5BJTB 4FXDA 2X1PA 4CBVA 1BBXC 2EXYD 3N06B 3ZL4H 4FTVE 3T1FA 4KAQH 1X5GA 3A55A 3BDCA 3ISWA 2CR0A 4L6TB 3MNWA 2G60L 2XYBA 5GJTH 5AG9A 3FSVA 3KPSB 2YBRB 1ACZA 2M2LA 1Y1VB 2WINB 1AYOA 1AXSB 2BZCA 1IBKQ 1HEZB 3PS6A 5IESH 1YEEL 4HEMA 4P5TA 1RZFH 2ZE0A 3EH2A 1BQHA 5ANMB 1G1OA 4DXFA 2P5EA 4U1MA 1JSYA 5F6HJ 1TR7A 3TWCL 3PHQA 5IG7A 1AQMA 3DIFB 3NEEA 3J8F7 5AB1A 1D7FA 4ZFOB 2HD3A 4P2RD 5E5MB 1N4XL 1T7YA 1DBMH 1PY9A 3C60A 2ARJA 2VUMB 2XZCH 3UAJC 2R2BA 2QGCA 3LQZA 4OSUL 3CDZA 5HGGS 4U4IA 3N3EA 3OHXB 1U8HA 4QYOA 1Q9OB 3CDCA 1PZAA 3EO0B 1AEXA 2C3XA 2F5AH 2V3EA 4TMPA 3QBTB 5GGSB 1YEDA 4O5LL 1JGLH 2ZG1A 3ILDA 1NAKL 3HG2A 2ZXQA 3OJVC 3OJ2C 4JPSA 1YHAA 1T7ZA 3R1GL 2Y9RT 3FVQA 4R2GD 1NMBL 3CUPA 1INQA 3L2LA 4HT1H 5D71H 4TTGA 5E56A 1BDYA 1NGXA 2X89A 4M7KH 3OHMB 2BERA 2Z93A 2BE5D 2P26A 3OMGA 1MWAH 4OV5B 5D93C 4C3IG 4GRWE 3IGLA 5I1AA 2K6AA 4HKXA 1IC1A 1HFNA 3BE1H 1CF8L 4UM8B 2HYMA 4AYDC 5AENA 2EDKA 4N9OB 3SE6A 1A0QL 2EVBA 4ODUA 4KOCA 1LQBC 3FU8A 2VMDA 2EVFA 2PF6A 2K8MA 3P20A 2NTSA 4YSPA 1B9ZA 3IDJA 1N6VA 4K3EH 1RZKH 1TZHA 2O1AA 2DQUH 5I0VA 5ANHA 4JI0Q 4W93A 1A7BA 1MVYA 1ZEAL 1ZHKA 2EDQA 5L4FA 4AJWA 3PHSA 4JFFA 4XVJL 5TK2A 1OAKL 2ID0A 2EUXA 3SVMA 4J2XA 4O2FA 3UERA 1EJ6A 1F3DH 5AVUB 5C0XJ 3MUUA 2PO6D 4OZFG 1A6WL 1MCNA 4MXWH 2YOCA 4PW9A 5HHNB 4LAQL 1U9KA 3A24A 4GT7A 5I8OL 3QIBC 1PNCA 4JO4L 4PTUA 4QCIA 2Y2TA 3UGUA 4NKMB 4XHJD 1N67A 4KV5E 2FJSA 4J3SA 4N8CH 4P04A 3U1PA 3ZUNC 5DJ6A 3R8BB 3RPIB 4DUYQ 3VXUD 3K5LA 2G9KA 4FQJL 4HG4K 4FF3A 2YMXL 3H2WA 3D7PA 4S1DD 3H3VC 1DDHA 4DPRA 4C3IH 2CXGA 4YHKH 4DESA 4Z76A 3TRZA 3N5AA 3NG5A 2KECA 1Q82C 4L0PB 1I3RB 1G7QB 4LSTL 2XQBL 4EKXA 3CZFB 1E28B 2IF7A 3KJ4B 2Z9TA 1ORQA 3BPCA 4JM0A 2Q6WB 5CCKH 2BVOB 1NANI 5IW6A 4EI6B 3IDNB 1EFWA 1HR0Q 4XNQB 1UCTA 5ISZB 3PGZA 3EDEA 3M7GA 4JKWA 4PRPA 4JFXB 5JYLA 5ICZB 3QEQB 4HLJA 4XT1B 1B2WL 1S7QB 4G7SB 3RWFB 4KJYA 3SYPA 5D70L 4O2DA 5DJYB 1L7IL 1FL0A 2Q10A 4LP5A 3S1NB 2UYLB 3BDXA 5E5LA 2Y07H 3PFQA 4QT5B 1ZYRD 3FQ4A 3DUHA 3PXLA 3BYYB 1NCWH 4G8IB 4OZFH 2N3SA 1M2OA 4IHBA 3GTOH 2WCGA 4PI2A 5DZOA 3T71A 2W59A 2NX5D 4UIKL 4AEEA 5FDYA 3ULUE 4WWKB 3HOWG 1Q38A 1SE4A 4X7TA 2N3JA 3DRTA 4P71A 1MCPL 3VD1A 4LF7L 4XCFL 4J39A 1UM4L 1DQMH 5ESQB 5I0XA 2NNAB 5DD6B 5HPOA 1K8AC 4HX1A 4PJAF 3T6ZA 3NSCA 5IWLA 1U92B 1G9EA 4FG6D 5CNHA 2OR7A 2OSYA 3FUJA 4E41D 2DQ6A 4PJAB 2D03L 2AJVL 4IU2B 3UO1H 4FXKA 1KB9K 4FZEL 1UUSA 3U1QA 5DZNA 5AQ0A 2KUMA 4M03A 4Y5VA 5DFWH 3MROB 2IFFL 2K50A 5E8OA 3BWAA 2F5BL 4WU5B 5IROD 1SROA 3MRBA 2AKRB 3TH2T 4I48A 4HWBH 3MRMB 4MRCA 4OW6A 3AU1B 5ELEA 1HE8A 3BP4A 5LGYA 1PH8A 3VDCA 1RFDL 5BO1L 4OZGB 3W11D 4XYOA 2ZWZA 1MQKH 1CE1L 3V9FA 3TN0B 2EABA 1YRKA 3MWYW 1NCCH 2DTMH 4XOCA 4QRRB 1SJHA 2Q7YA 2P44B 4HHGA 4ZSOA 2VWEE 5LMUL 3C08L 1KJMB 2RSNA 5DEZA 3QIWA 2KLSA 2FFKB 3QIBA 1UT2A 3CC4A 1A7OH 1QFUL 5D7IE 2J44A 1RERA 2UY7B 3MFYA 2FNBA 4KJOA 2AKWB 2Z4QB 3KH4A 4JPIB 4PJHF 5ABAA 3BAWA 1WBZB 2BRQA 1WV7T 1KYOK 4CVXA 4R90L 2CA4A 4YC2C 2GSGB 1PFOA 3C6SA 4PJHB 2EPBA 3QQ4A 3QR1A 2A5UA 2QQNL 4DV4L 1S2EA 4OWXB 3SDYL 1F6LL 4GO9A 1I4QA 2VZ3A 2JSFA 3GI8L 4BZ2H 5CSGA 1V3JA 2QKIB 1DQIA 2WXKA 4DV7L 3FULA 3GTLB 1OP3K 4I4WB 5D1ZI 4HZLB 2JJTC 2E2HH 1TCRA 2JB5L 4ZQTA 3QT2A 1A7QL 4MA1B 3TV3H 2RA4A 2DJFC 4AZ8A 1U8NA 4DP8X 3TFKD 5CBEA 5DEGB 5FIEA 3L5WA 4GMSL 3WY3A 2KENA 2Y7QB 1CQFA 4N0UA 1L9OA 5TF0A 1A1OA 3QUYA 4U1KA 1G9ML 2PNRC 5C44H 1BG9A 4U6YB 5E2WL 4CDGC 1FZMB 4IBTA 4CVZA 3U6RB 4OT1L 2AANA 3QCVH 3VRLF 3KPLB 4O00A 3D05A 1MFAL 4UMGA 1CD8A 4P07A 5AAMC 4F9LC 4NLAA 1QBAA 1CJYA 4JS7A 4U1JB 2FX9H 1T89C 2DJGC 5FLVA 5JHDA 3RZCC 4LLYA 4HFWB 1C16A 3ZIMA 3ARWA 2F0MA 3G3LA 5C4XB 1KENL 5CR3A 1ASQA 2BHUA 4G6KH 3WTVA 1X4ZA 3CF5A 2Z8SA 3EYOB 4QRPE 4FA6A 4TNFA 5LCVL 1VFMA 5T1LA 4WFGD 1G7PA 1I7RB 3B7YA 3K4ZA 4NQDE 1MH5B 4MJ5B 2WZAA 2X4UA 4HEPG 5JW4N 4FTVA 1GD7A 3MGOA 4L9LB 2WM0A 1JRHI 2QPUA 1Q1JH 1QX1A 2NN6G 1WS7A 3MRJA 4DZBB 3J7A5 1I8UA 2HRHA 3CLWA 2VQEL 2GAZB 3DVIA 2JA6G 1FYHB 3MUJA 4LASH 1H8LA 1A65A 5CEZE 5CR8A 1YPZE 4BJLA 4B41A 2WVUA 2YRBA 3B2UD 1FRGL 4MLSA 4PRPD 1IIKA 5IREA 4LQFL 1YQVL 1Y14B 1ETZA 2GEEA 1QKZH 5CP3A 4X83A 4IOIA 1TFPA 2X4NB 5ID1B 2ZCHH 3QUMA 4FP8L 3M46A 2ZKWA 2ALYB 4EI6A 3ZZSA 4N2MA 1XR9A 2BO0A 1P2CB 5IHWA 1V7NH 2VIRB 4A3KB 3CVBA 3L17A 3HS0A 3H1ZA 4I0PD 2WXOA 4TM9A 1ZTXL 2YEZB 1FG2B 3KDMA 4K73A 1SBBA 5DDHA 5I1JH 2FR4A 4LHUB 2CUHA 1A0IA 3MLYH 4OFPA 2JKIS 1HR0W 3S36L 4IFDG 1K5NA 2OV0A 3DKHA 1JR0D 2YPLD 4QRAA 5CJQH 3ZHKA 4YHNB 2WNGA 1XMQL 4X6DE 1I5FA 5CSZB 5I9PA 3PQYD 4KZEL 3EYQD 3ULUC 5JPMA 3OKOB 3S37H 1GTNA 2VSDA 2RDFA 1LVEA 4XX5A 2EE2A 3LH8A 3O6LH 1KV7A 1WHPA 2G3MA 3NPZB 3BO8A 5IFJA 1IC4H 3I3EA 5I28A 2EYOA 5BUAA 4RZCB 2QBWA 4XNMA 3Q1EA 4PSPA 1OM3H 5BV7B 4HUXA 2NN6H 2PLTA 2B1HL 2Z0UA 4Z7WF 3ARBA 2IPTH 4AUUA 3AABA 2MUYA 3PO2G 2VDLL 5FM5O 2EE6A 1WH0A 2P28B 4Z7WB 1EFQA 3V4LA 2HQLA 2YD7A 1QBMH 3U0TB 4JFPB 4HIJA 3UTPD 2BH8A 3DX6B 3DX7B 1KQSA 3TJHD 3NIFE 1Q9WA 2DDQL 3OKYA 1BM7A 2ADGB 2AVFA 3ZMEA 4L37B 1PLBA 4HCRA 5TE7H 4JI2Q 3LZFH 4Q9QH 3VM7A 4MTKA 3W57A 4AG4H 5CCGE 4F2EA 4A04A 1DCZA 1KLUB 1Z9SB 5KG9A 1KMGA 1U41A 2DI8A 3WJLC 5LXGL 3QPKA 4OLVH 4HJ8A 1REIA 4JI7Q 2GBUA 1X9QA 4ZPVA 2DLTA 5I71C 3C5ZA 4BQ6A 3OMCA 2VWEC 1SBSH 3TT1H 4GNXC 2L9HA 3NABH 1HS6A 2X69A 4X64Q 2NTFA 2UZIH 3WAKA 2SOBA 3J81c 1CXLA 3FPUB 3W81A 4MCYB 3SGDH 5HHXH 2AMUA 2KJXA 4RWHA 3V0AC 3SQBB 1WHOA 3Q9PA 1XGZA 3D85A 1UADC 2V3FA 3L3HB 2F7OA 4UTBH 5HHOE 1FZOB 2FX8L 4OD1H 4AYEC 3LMJL 5CM1A 4MTMA 5MI0C 2MOGA 1FPTL 1Q94A 3BIBX 3QUZC 2IWGA 3VFTB 2CWRA 2XWZA 3GM8A 3QORA 4R4OA 5L2KB 5LJYH 2IALB 4DR3L 1FBIH 5TDPA 4BFKA 3U83A 3DSFH 4PPTA 2DLGA 3QUYD 3CPLA 3OWRA 4A67A 4PZ6A 2FXQA 4LLDB 1ZIBA 1JVOA 2HZHA 2C9XA 3CK0L 2V4LA 3NZ8B 1JHTB 2FB4H 3IL8A 5J3HD 1BWMA 3T0EE 4ONFL 2H2SC 3ILQD 4FQXD 2DQFA 2MOVA 3BUIA 1FD7D 2JJSC 4JG9A 5JW4Q 3QHTC 3S4SA 3SGEH 5DWUH 1FORL 2ZOKA 1KCUH 4R97B 1IL8A 1OF0A 3E0EA 4W9FC 4NPYB 1PQZB 5I6MA 1NPUA 2E9WA 4JL1A 5AOJA 3LKRB 5M3MB 1P16A 2WO3B 3FZUD 4X3KA 5I1LA 2K5HA 4NW2A 1ADQH 3BUTA 4UOW1 1EEZB 3RVXD 2VB3X 2FWSA 4BZ1L 3J7AF 4GW4B 5T1LD 3D4YA 5JJZA 4Y2DC 3ZTJH 4MAZA 1DEEA 3D30A 3I6LD 5HHMD 4DQOH 1SFDA 1TXKA 4CBPA 1HI6A 2K9UA 4D0CB 2YSTA 3L3JB 3V96A 1ET9A 3L95A 3U9PL 1UVQA 3L9BA 2CK0L 2WMPB 2X40A 3EOYG 4HMIA 1AI1L 2ERJC 1MAML 2JTDA 3D5OF 5CJ8A 4CNIA 3GUTA 1UG9A 1L1OB 4P3DA 5L2JB 2BP8B 2IOMA 2X41A 1I85A 4OO1H 4Y5XA 4IPGA 1CUOA 1OGTB 4OFVA 3ETTA 2Z7UA 4JO3L 2BIPA 4HKBA 2VB2X 3UTTE 3I84A 1I53A 2NOYA 2MSPA 3MLUH 1FNWA 3VU1A 4IPHA 2BZ7A 2ZWYA 4JJOA 3FB8A 1T6BX 2IDCA 4L23A 2ZF8A 3A5VA 2MP1A 2OYLA 3MSPA 1JGVH 3QO2A 2XTJB 2C9OA 4H0GA 2EJMA 3RQ3A 5KSBE 1IE5A 1AO7B 3BP5A 5M95B 3PMFA 3MRCA 3HKZB 1UEMA 4Q6IA 3MNVA 2JCWA 3NH7L 1ZVSB 4F3FA 3UIZA 2VLRB 3EDDA 1KBGH 2CW0D 1XFPA 4KJNA 3F5WB 1JPSH 1YYLH 3BQUA 3IAPA 3WKMH 5IEHB 2AQ2B 3QFDB 3S2AA 4CC4C 1JTTA 1MPAL 3MEHA 1QABA 3FAXA 3QJQB 3WU1A 4NQQA 2TSBA 1M6OB 2QILA 1I8IA 4IK6A 4XO3A 3BG3A 2N1TE 2PW2B 3N91A 4KDTA 4A3EB 1JNLL 3RGHA 1D5MB 1UWGH 3LS5H 4HIEA 3VXME 5ESVA 1QATA 5HI3D 5E1AA 2WQ8A 1S46A 3UZQA 3ZT7A 3HOYB 4GEIA 4QAMB 3MRIA 1F45A 1UB6B 2GN5A 5JJKA 1BP3B 2R2HA 4XMPH 5IJVA 4ENZA 1VESA 4GAYA 2XU9A 3HEIB 4YHZH 3J7YW 1S9XB 3F00A 5I6XB 2YAPA 4MMYA 5EF2A 2APXA 1AY1L 2V5SA 5E2TL 1IAIL 4AX3A 2ICWI 3B37A 4FHKA 4NUJB 2B20A 1FO0B 4CDFC 5HHPA 4JKLA 1W6WA 4XE5B 3RU8H 3SCMC 1A6AB 1F8TL 1UGNA 1C5DB 4YHYB 5C07D 3VFSA 1TNMA 5C0NC 4X3UA 4PV1C 2VN7A 5C08B 1ESOA 2G2PA 4OLEA 5IP4A 2BSTA 1NIFA 3WFBH 2Z31C 3HOGA 3C6LD 4IBYA 4OX9Q 2OMBA 4OU3A 3QO1B 1JPTL 4D8PB 4IQHA 1ZS8B 3DGGB 3GTTA 4YSRA 1NY4A 2YXWA 4F2FA 1R3KB 4JO2H 5ELBA 3O3UN 4DV0Q 4L4TE 1KACB 2L7EA 4GAGL 5EIIB 1J0HA 1ZLVH 3LGJA 5C0AE 3RL2A 4MXQC 3E3XA 4JBJA 3MV7D 5FV2A 5IYDG 5K5YA 1L0YB 2Q86B 3GIZH 1WYDA 2DI7A 4KNTA 1E6JH 1DBKH 1OAJA 4QRPA 4UQCA 4P5KB 4KROC 3ARPA 1DVXA 4FYTA 2NW3A 3D50A 4NQDA 5IF0B 3MXVL 4QKXB 5ETUB 5F6IB 5CXPA 4EIBA 2NVXH 4AC2A 4UB0L 4AVJA 4EAEA 3IAQA 4LNRB 5F71A 3A74A 3QXTA 3V5DA 1X9LA 4QXUH 2RFXB 1VS0A 4NRXA 2VZTA 3WAJA 3UG3A 4HGWA 4CAGA 3L3KA 5IB5A 1A47A 3ZK0A 4JDZB 3CDGA 1X3GA 1YPZA 3GB7A 4QHNB 3MA7B 3IDIA 3SOTA 2P8MB 1AZUA 1S9WA 5EUOA 2OMTA 1XCWA 2N56A 5H94B 2LGNA 4ZQKA 1ZKOA 3RWJA 1EXUA 1XH1A 2KQ3A 4L8BB 4BQBA 1GGCH 3O2DA 5E0QA 3TA3A 3GLZA 3ILPB 5E7FA 1MCFA 4X5XB 2FSEA 1JI1A 1C12A 4HIIB 3T0EC 2DQGH 5AZEL 1JJUA 5CUSL 5DSCB 2EP6A 4OXPA 3O4LE 2HG0A 1YVLA 1SLUA 2BSSB 4HPYH 5EO9A 1UC6A 4JFVA 1PAZA 1Q81C 1G94A 4UUJA 4GT0A 3T1HL 3GUFA 3POCA 5JW5B 3ARQA 3WXVH 4KKRA 3QJRB 3Q43A 2FUTA 5TTRA 5GGTH 2F0GA 1DUYB 3KLHC 3MCKB 1INDH 3HE7C 2HB0A 4M1DL 4X6DA 3T65A 4POGA 4PZ8A 5IYDH 5IK3B 2WLLB 3AFQA 1S7SA 1HNXL 2BOLA 3BN3B 4YHIB 5EDXA 4HDIB 4K5MA 1BCPC 3H6JA 4FQCL 3CFBB 3WIHH 3CCHA 4Z9KB 1KIQA 2LLNA 4AL8L 3N85L 2F2HA 5EZOH 2C3WA 2J8UE 2JELL 1WCQA 3MYJA 5C0IB 3SK8A 4NCC2 1AIZA 2NXYC 5CGTA 3UMTA 9PCYA 2WUBH 3MLRH 3HMWL 3WFEH 5JHLL 1A2TA 1CHQD 2C1PB 2AJUH 3S35X 4Z77A 5FGCE 1W16A 3HNTL 1KBPA 1BM3H 3EFFA 4MD4B 5LHDA 1NPJA 4FO2A 3EDKA 2DTSA 3L6FB 3HZXA 2LVCA 4K7FB 1T22B 1RD9D 2Y5EA 2OXGB 5E6YA 4CDHA 5I4DA 1K83B 5KVEE 3QG7H 3GI9H 4H8VA 4E2OA 5B7EA 4PMBA 3KLKA 3S15B 4KQ3L 3MA9L 2HHHQ 3ZHFA 1S8DB 4EQ2A 3PO3H 5EBMA 2ZTEA 3PP3H 1X54A 3BQUD 2LU7A 3KPRE 3ARDA 3P73A 4E9LA 4XB3A 1EQWA 3A54A 3HN3A 1PMRA 4FNLL 3V6FB 3HB3D 4MCNA 1GO3E 3SE4C 3NBHB 4PJ9C 1CLOL 4UWQB 2VL5A 1KRSA 4R26H 2C3HA 5GJSL 3UAAA 4Q4IA 1VB9A 2OP4L 4JW3A 4PRNB 1X9NA 3ARED 1GHFH 1LO3H 3BVGA 4FERA 2DWEB 2DWDA 4PRDB 2OW6A 5H2BB 3TN2A 2XKNA 2E7LC 1OSZB 4PQXA 5HHOA 4XPTH 4ANVA 2OMYA 4TKWA 3X3NA 2DF3A 2IDUA 3T1YL 2ZX7A 2O26U 1RSYA 4M5YL 2HUHA 1QLFB 4GRMA 4C54A 2XA8H 4OKVB 3MVVA 4X99A 3HGBA 2WLZA 1KJ2A 3LQAC 4ISVA 3TEWA 3D33A 1JXJA 5KVGL 4M48H 1UA6H 3U6XA 5FPIA 4LSUL 4B3ML 1EXHA 3DUUB 1NLDH 4JFZH 4QTHA 4Y7NH 2A9DA 3UAFA 4N9TA 2YPKB 1KPRB 2MCAA 4RDQF 3CCRA 2K5WA 1IAII 1BIIB 4M4RA 4WI3A 1F9SA 2J1KA 2EE1A 3SDAC 2H3XC 4ZMLA 4LCYB 4Y4FA 1TQCB 4LPWA 1KXVA 4PWGA 2C9SA 3VFVA 1TKWA 4D0DA 3UYPB 3T04D 1A14H 5ADOL 3WFHB 3K8AA 2YJLA 4JLRB 5C0DA 2X5PA 3P9LA 4WO4A 1E2VA 5B38B 3V05A 1HJPA 4LU5L 2AEWA 2AMGA 5GGRA 2P7TB 2VDQH 1LLAA 1E4HA 5C6WH 1BVLA 5K9QG 1G6ZA 4DF7A 1OE2A 3F83A 3LZQA 4LSQH 2Q2EB 4ZMWA 3VFOB 3CX5J 3KL5A 1ICFB 3I72A 2EXZA 4OGQC 3HRPA 4KH2A 1F58L 3OYYA 3VTAA 4XQQA 1ESFA 2EO7A 2HPTA 3K6SB 5T1DL 2UXCL 4B3VA 3HZ3A 4JM4H 2XSCA 1R19A 1Y6NR 4O02A 1UD2A 4EXKA 1WD9A 5LAXA 2B9AA 3M4OH 2F1EA 3SBRA 3JAMc 4H1LH 3V7AE 3X3MA 1HQ4B 3BRDA 4LFCL 2IH9A 5AEAA 3MCLH 3UTTA 2VRQA 1LACA 3QUXB 4M3JA 3ZSTA 4MMZA 3BVDB 3TA3D 1MHPH 1WEJL 2VMJA 4HJ1A 5CV6A 4AEIH 5LLIC 3PSIA 2A0LD 3F7PC 1TZOA 5KSBA 5EPLA 1U8KB 2Z6KC 3DGCR 1NMFA 5LG6A 1I3GH 4GUPB 3BKCH 1TR5A 4QRTA 3R3OA 3PV6A 1PRTF 1AIFA 1T7VA 2UV3A 1ZMYA 4OD2A 4U31A 3MLVH 3L9AX 3ZE0F 4GG8A 4U1SB 4PS4L 4LF9Q 1SFHA 5I8KH 5C9JA 1KCSL 1YY8B 3DOSA 3NIGB 5DMGC 2QQKH 1PRTB 3DX3A 3O6KH 1TJGH 3H3BC 3ZE0B 5L37A 1WAAF 3QDHA 3FL7A 5AVZB 4Y5YB 4ELMF 4G6JL 1KIPA 5EPKA 4NWUH 5IVZB 4WU7A 4ACTA 1P4LA 5EC1A 1VFBB 5BZDA 2VKXA 1JHLH 4ELMB 3DEPA 2DLIA 4P23B 1VQMA 1JNHB 1YEWA 4KY5A 2WO2B 5HGHA 3KPQA 3RZCB 2XBDA 4I3RL 4RISH 2GJZA 2YGQA 5DS2A 5AB9A 5BUGA 5LWYL 1EIFA 3HG5A 3SKMA 3GO5A 1KCBA 1GSKA 3TEUA 4EIZC 1ZSDA 1VQBA 4IGBA 3E6FB 4A63A 3CSGA 1MDTA 3NT0A 3HBQA 4JR9L 3FHWA 2ENSA 1JGUH 4TV3A 5LQBH 2C1OB 2J3SA 4GUCA 4YZFF 2Q3ZA 4R0LC 1ACYH 2B0SH 4N2BA 3UTSE 5AOIA 2VXUH 4G3YH 1Z32X 4R8NA 1ITCA 3U0PB 4JPWL 4K8RD 2F74A 3BEVA 1BBUA 2PMZE 1C5BH 1L0PA 4S1QH 4A2FA 4EVNB 1W3SA 1JIBA 1ONQB 3GSNA 4ZOCA 1I9JL 1ZTMA 4GY4A 4V190 3AW5A 1YEFH 4AYBG 2FZ3B 2VDMH 2WD0A 3O2DL 4IRJD 2ED6A 3WKPA 3WSQL 3IRBA 1M1SA 1FJGL 4WKXA 2CH8A 3FQYA 3C8DA 4DZ8A 1M42A 2VTFA 3CSYB 1EBAA 2CR3A 5E6IC 3MUZ1 4GO6B 4L4TA 1CT1D 5GRVL 5LG1A 2QEJC 3DX4A 1DE4B 2XKSA 2OXPA 3T2NL 3CMAA 2OJ1A 2YIHA 4FI6A 3DSNA 2O2LD 4OQ1A 3W5OA 4L4VB 2WC7A 2MTPA 1WP6A 2E9IA 4J7RA 2VLKA 2BIOA 3GKWH 4NC1C 4NO2A 1Y6MR 4LFBL 4NT6B 3S96B 5CKGA 3MGTA 3ESVF 3HPLA 3SE9H 4RCAA 3FUHA 2A8VA 3GO1H 3Q6FA 4P75A 3CN3A 3DYMA 1XNQQ 3HUJE 2Z64C 1J5HA 1DJIA 4KJQC 5FUCE 2DIEA 2RD0A 3F84A 3ND8A 3OSOA 3J81E 3APDA 3B2VL 3HC4L 2PKDA 4ZXBD 2CPCA 2B39A 2OJEB 3CVHA 4IM8A 3CFUA 1JVKA 2E6QA 3KH3A 2SODB 5HYSG 2OTWA 4FKHA 3KYHC 3ARZA 2I9TB 1ND0B 4A3CG 2OR9L 2OS7A 3OMIB 4D9QE 2IH3A 1VQJA 1NGYB 5DJ0B 4EQ5A 5K1NA 4PJ8C 2D5DA 2I25N 1A6TA 1R3HB 1RUAH 2VISA 2CO3A 4EN3B 3FO2A 5E1HB 1GIGL 2AWNA 4Y4FD 1FNEA 4GSDL 3ZE1E 1WAEA 5BN3A 4AQ8C 1UH3A 5D2NE 4FF2A 1XNRL 4QXTA 1X9RA 3O4LA 4NB3A 4M7LL 1RIVL 1RZKC 5HGBB 1EHLL 1AGBA 4ONGH 5G3LF 4K8RL 4J3OF 2B7DT 3BAJA 4JKPH 3O13A 2ZJSL 2AQ3B 4FFYA 4M02A 1OP9A 2FNWA 5CF3A 4JV5Q 2B2TA 4OFDA 1O7SA 2BSBA 4ZX5A 4D0BA 1HL5A 1HOCA 5E6ZA 4EDXB 1U95A 1BA9A 1GZPA 3ULVD 5JJLA 4PJDA 4MASA 2F0PA 4RMFA 4K5LA 5F1NB 4PIRF 3DA0A 4XNAA 2FQFA 2EXWD 2YRLA 3G6JF 5D1QC 3SZKC 5IV2B 3RDTA 1U3HB 1A1NB 5E99L 3IKJA 3B5GA 3EO9H 1BGXH 1A6VL 4A3DH 2BLFA 3G6JB 4G9FB 2FYYB 3SO5A 2A1AA 1E0OB 5E1FA 3I2ZA 2J8UA 3DROA 2VZSA 1LGVA 1KCVL 3AY4C 1S6NA 4QB4A 3UPRA 3K2KA 2HN7B 1JJGA 1MJUH 4D7BA 3H0GG 4KXCA 4K0KL 5EN2A 2BY0A 4DUXA 5CLZA 2JI2A 1YZ6A 3T6XA 1VADA 2HJLA 4F20A 3HLAA 4FXGA 1K8DA 2I46A 2QR0A 4BH8B 1OO9B 5ACZB 5CILH 5IE8A 3NXWA 2MQHA 3NFPA 4M9PA 2IX3A 1KJ2L 2DLFL 1WFIA 3TLRA 1CDGA 2H5UA 1GYWA 1F00I 1QYGL 4WCYL 4NKQB 5DZJA 2CO6A 4Q9RH 2B3IA 4KNQA 4OLWH 1TT6A 3QRGL 1VQFA 1MVFA 4TLSA 3RLNA 2HMIC 2QCPX 4WW2A 3KPRA 1FJ1B 3RIAF 5A6MA 4WUUE 3PABB 5FFOA 1JB7A 1EDHA 2O5NA 4HH8A 4LCCC 5AOKA 2VDNL 1U6AL 1SMYC 2G5BA 3HC3H 3IFPB 5E0FA 5IMOB 4KRLB 4Q89A 3N0PB 5EZLA 3X1FA 4N8FA 2R8SH 2XUWA 1J0JA 1KUMA 5FDWB 1JN6B 2CKBB 1U8IB 4XWOC 1I7TA 4CSPA 1FVDA 3GK8L 5ELNA 2W38A 1U58A 2JWYA 2Z4HA 3TH4T 1I7ZA 2QSCL 2EDOA 5KJ7E 1IAIM 2CSPA 4JANB 5BZWA 2AJYL 4Y1AE 4HGKC 4JBWA 2JA7G 1JFHA 1R0AH 2NUTA 3ULVL 1RUKL 1JFQH 2E4TA 2IQ9H 2QQLL 3FQRB 4OCSH 3ZGIA 2R1XB 3UDFA 4H0IA 1ZK9A 1J5OL 4XVTL 5C0RL 3SBWC 4JQIL 1L7TL 4O02L 3TURA 3SQOH 2K28A 5KNDA 4ELKB 1KLFA 2ZICA 3T8MA 3N6YA 4FFZA 1AE3A 2YTYA 2WZPD 4G7YL 1IQDB 3T4YB 1JOKA 4P9HC 4JY5L 3LV3B 3F65A 2J56A 4ZMOA 1LDPL 5AWNH 1T3FB 2JP1A 4L05A 2D2CC 3NA9L 4PRHE 4LZKA 3MV8E 3UDWA 5J57B 5I18H 1AQKH 5GS1B 1E9QA 1T21A 4OJFL 1DGSA 2Z4IA 1YJNA 1G2SA 3BZDA 3Q2NA 4P57A 5EOCH 2H4EA 3VXTB 2CH4A 5TF1L 4ZMXA 2XVLA 3BPNC 5JQ6L 1CD9B 2UX6A 3CFNA 2VLKD 5CJXC 5GHWH 5C3IA 3WIFB 1B8AA 2GJ6E 2W65B 2XN9D 4N22A 4UDTB 5D1ZB 4YSSA 2V2WB 3V5HB 2ICWJ 4FTDA 1ZDQA 2CD0A 3EBHA 4QMEA 3LYRA 5GZNA 4PRBB 3WUWG 3GS4A 2K6WA 1Q9KB 4ZO8A 2A6JB 3M4YA 4KHVA 1ZVNA 3SDCA 3VSTA 3P0YH 2DQCL 1IGFL 4QLRA 2EE3A 1DVFC 2ATKB 3BN9D 2X9YA 1CHPD 1ED3B 2J21A 2P9RA 5HD8D 3WFCL 4XCCH 4C1NI 1KGCD 2ZUXA 4PLJD 1SQ2N 1LK2B 2DQDH 4OI7A 4GW1A 1VFUA 3MLXH 1DBAL 4XXWC 4A6YL 2D7OA 2XWJB 4JDVB 3VVWA 1KPUB 3ZX1A 3VGHA 1XH3A 4KPHL 2V3DA 2AGJL 3PGDB 4GOPA 3EJZD 1DBBH 4N2FA 5DVKA 2ZOLB 4Q2ZB 3UOAB 1CFMA 2N8NA 3GZQA 3NCBB 5LO7A 1E3XA 1P7QA 3KYOB 3L4WA 2YKKA 1RULH 4HUWB 1T4KA 5D2NC 3GSNL 3IMWA 4Z95H 4ZUUA 3VI4A 1AG6A 4XP1H 4X0NA 1PLAA 4M5TA 1UXSB 1FZJA 4IMLA 5J1AA 3AQXA 5C71A 5AKTA 5ACMA 1ACCA 4BUGA 3BXNA 3IU3B 3MRNB 3CW2C 3D48R 3RDTD 3MNZB 3V0FA 1J8HB 1JTPA 3IFNH 1DANU 5B1KA 3S5YA 3ALPA 2GW5A 3V6ZA 1SDDA 4MQXC 4MTNA 2BXYA 1IIIA 4APQA 4JRXE 4BHUA 1Y1VH 3THMH 3NELA 1IE4A 1HHKA 2OULB 5I2YA 1I8MA 3UJTH 5AD0B 3BDOA 4R7LA 4X65Q 4N85A 4WK4B 4U1NA 4R2GB 1FF5A 1JNNH 3QEUA 1XR8B 4G7ZC 2FAUA 1MZZA 1N8ZA 1JUFB 3UTSA 5MENA 4RFBA 3LD8B 3WJJC 3NJFA 1X5AA 4A3FG 1KB5A 2ZAIA 4QHMB 4DCQA 5I5MA 1X7SA 3CVHL 1TVHB 1YJ9A 2PMZA 4GXUM 2VUMH 4B3EA 1HSBB 4J3TA 5E4EC 1FVEB 5AZUA 2WXNA 3RWCB 4X4ZA 4HAKA 1CFTA 1F6AB 3MR9A 5JEAG 3ZTDC 4N3TA 3RUGB 1A66A 1CD1A 1GMIA 3GMMA 1TS2A 5I9OA 2G9HD 5I17A 5ELCA 5CZXC 4PVBA 3WMPA 1OAQH 1HUMA 1SNCA 3FB5A 4XPBL 2WXHA 5CJXA 4YE4L 4UTCA 1KNOA 2GSIB 3BAEH 4FFYL 5D7SL 4DGUA 1MI5E 2FGWH 2YKLH 5LMUQ 3S2CA 3SR1A 1QCBD 1D3CA 1N32L 1T5WA 3K6FA 1DP0A 4NQVA 5EPJA 3HTLX 1OPOA 4Z8FL 1SY6H 1AP0A 2XNAC 2YUVA 5DHVB 3NACH 2ZCKH 4UOQA 3F2DA 1IGMH 4ZDHA 5DGQA 2PO6B 4KHZA 2QGDA 4UZGA 2X3CA 5T3ZD 2XFXB 1F2QA 1M2VA 3HE6C 4FQIL 4I18A 3HUJA 1JV5A 2B59B 1Z0NA 1S5ED 4GAJL 2KL6A 3MODH 5C0CA 2MCPL 4PWKA 2PR4L 4XXWA 1EAJA 2M8XA 1T1XA 4DV7Q 5FO7B 3MFFB 1NGWB 2H32B 4Y4KC 4M6MH 4MNQE 1WZAA 4HPOH 1RL1A 3A8JE 3CFCL 3ZYOA 3HHRB 2J6EA 2K52A 3KBFA 5FYJD 3NN8B 1E4XL 1HDMA 2J1XA 2Q0ZX 1OAUH 1VCIA 4WI8A 1IM9B 5D2NA 3V2TA 1BXXA 4HCFA 1FFRA 1BREA 1EWHA 3DMMD 2QADD 3KG5A 1ZK5A 4V1DB 5T5FH 1AD0B 4S0TD 2B3GA 4N8X1 3DO3A 3SDZA 4XOEA 1E9PB 1LO5A 1WT5A 4OAWA 4WQOA 1FIGL 1ILUA 1S7XA 4IALA 1RUMH 1QI5A 3BH8B 5HYQB 1SLWA 1F5WA 1FUNA 4Z7VA 3OAZH 3QJFB 2B2WA 4Y52H 3DJTA 4DV2L 1N5AB 1NGPL 4J3VA 3S3DB 4ERSH 4WTZA 3T4AA 3QIUB 1G51A 3TCTA 4BK5A 5AW6B 4M5SA 3SDCD 1NC2D 3LXCA 5J11B 4H0LC 1HSAA 1MHHB 2QV4A 1GZQB 5E8EA 3O6MH 4PJFE 1HESA 4V11A 4AM0B 5ES4B 2F54A 5J89A 4LCUA 3DTUB 5F88B 1IHZA 3OKLB 4DGYL 3U48A 1QLEL 3TA4D 3TEYA 4BBWA 3V0JA 1KHIA 4DUWA 1GMEA 3T1FB 4J1MA 2AQRA 2P5PA 2ZXBA 3K7AB 5IJDC 4KMTH 3MNWB 4XC3H 5A7BA 4RSVA 2WBJD 2HTKC 1NCJA 1EEFD 4JY4B 4ZTEA 4W9JC 1MFDH 1U36A 1AQDA 3RVVC 4C3HB 2YZ1A 4A7GA 1XXGA 4QJFA 3FUNA 1WQVT 1P7QD 3EVQA 3NQKA 4HK3J 5DMIL 3S1NH 4F37K 1BQHB 3T56B 5DUPH 4C3JB 4FFZL 4K5OA 2FINB 4U1MB 3FSZA 2YWZA 3PHQB 3Q13A 4MVBC 2QT6A 3T51B 5IUCA 4F92B 2AXHA 3MQIA 4OFIA 5IGFA 5EWIH 4WUUA 5LNGA 5FYJL 3C60B 4ZAKD 4ZMZA 2W07A 2ARJB 1SOSA 2R2BB 3BDBA 1PDKA 1J8SA 1XZWA 3LQZB 3SPJA 3UJJL 3CDZB 3HN5A 3MHZA 3CH1A 4RMTA 5IQLA 1U8HB 4QYOB 4LVHB 5EB9A 3FHEA 1YEDB 1XMQQ 3ABLB 1B70B 1YC8A 3BCDA 3FUMA 5BRZD 3ZW3A 1JGDA 5H37H 4Y1AA 3WMSA 5LDSA 4BWGB 2F0HA 3DBXA 3E0GA 3HI5H 4R4TA 3D2UA 3CUPB 3FU0A 1INQB 3VXQA 3D0LA 2R0WL 3IS1X 4YZWA 4AYGA 3T6WA 4JPVL 1NGXB 5AVTB 1PY0A 3X3FL 5MEND 2Z93B 1K72A 1U21A 3N40F 2EKSA 3NCJL 3OZ9H 2BSED 3CVCA 1G1YA 3W9DA 5D2LE 2F0DA 2GJJA 4JGMA 2DY8A 5SX5H 4BIKA 1QNZH 5I1AB 3H09A 4HKXB 3KWUA 3VXRD 4LIQH 3NSJA 4C83A 3G7LA 3VMOA 4DETA 4QHKI 1H9SA 1Y18A 1HFGA 2GY5A 1X9UA 2ICES 3KM2A 2VAJA 2ZOWA 4Y4HC 4P2QE 4DP0X 4KKCC 2EUWA 4PP2A 1GZHA 1F1AA 3IDJB 4PRHA 3MV8A 1TZHB 1QASA 3W37A 5IGEA 2HVBA 1QNUA 1F1DA 1QSEE 2ICCA 4IOFC 4UOJA 1KGIA 3NSXA 1HZBA 1FC2D 1AHMA 2WBXA 4OR1A 3MTXA 4JFFB 4XMKL 4RMWA 1W0WA 4O2FB 1X5IA 1QHOA 2HKFH 2GJ6A 5E1IA 1UWXH 3LXAA 5FUZH 2PP9A 4KY1H 1FP5A 2R7DA 1OE1A 4IUTA 2IAMC 4P46A 5EKLA 3GTLH 1PHJA 4AGQA 3LY6A 4OJCA 3P75A 2PWHA 4PTUB 4TVPH 3K81A 4QCIB 4RQQA 1Q90A 1IBML 5C0CD 4L18A 2OJZL 4CKBA 4YH6A 5J4MA 1FNGA 2DQHL 1QTYT 5DJ6B 3HAEA 4S1SL 3ZTEA 2K78A 4JK0D 3PWJA 3GNML 4QUOA 2NQCA 4C56D 5F7UA 3KL3A 1DDHB 1OV8A 2C8NA 4Z76B 4FDBA 1PG7X 3OAUH 3HJEA 1URIA 3VM5A 1S7UA 2P5WD 2W60A 4HUMB 3IN2A 4MB1A 4P5SA 4DPAX 3P4OB 1IC7H 1CGXA 3EH1A 3BPCB 1ORQB 5IW6B 2A77L 3FO0H 1JWUD 1CYWA 4YK4B 4ZFZA 1GOZA 3PIOA 4IOCA 1ZANH 4PRPB 1I82A 2EY1A 3TO4C 4KKAC 3CWGA 4DK1A 4JZNB 5AYTA 5C4XH 3HFZB 4KJYB 1E4XI 1C5CL 4O9HL 1KDAA 4CJ2C 3LRSB 1OEZW 5KANI 5JIQA 4LDEB 3F58L 1IGYA 4XNZC 3P77A 3VWKD 1RIUL 3F85A 4HKZA 1OANA 3VE0A 4WORA 3B2PA 3CH8A 4NC2B 3I2CL 1MREL 5CGYD 1FLTX 4JZJA 1SXNA 1VF7A 2F54D 2QPDB 4S10A 4DO5A 1KFAL 1TPXB 3IMSA 5EBGA 4BKSC 4X7TB 3FTYA 3DRTB 4FL4C 5C5LA 2OZ4H 4P0DA 3C5JA 4LF6L 2EH7H 1D5XC 4A3GB 1ESRA 4HCEA 4HX1B 3P7JA 4RMQA 2FWLB 3KYKL 2R23A 1WFQA 1NSNL 1OGAE 3DECA 3ZDYE 4ZYSA 1DO6A 4DR2L 3T6VA 4E42A 2WB1E 3GSQA 4MAYD 2EY2A 3J80L 2D7TH 3D1MC 4FXKB 4OJEH 4GUOA 2ZUUA 5JZ7D 4LPVA 2DWXA 3IXAA 4Y5VB 1PFMA 5E8OB 3VR3A 3HI1A 3BEWA 3GTNA 2R56H 3BWAB 4FQ1H 3WN5A 3WTUA 3I3BA 5MHSE 1B1ZA 4A3KH 2WXJA 3MRBB 4FQLH 1S72A 1A3UA 4PJEA 4PVMA 4WUUD 3BP4B 2K6YA 4JG5A 3TC9A 4NB7A 4Y0GA 2R9HD 3GPEA 4TNEA 5SWSE 5KAQG 3M4QA 4JHWL 3D08A 3SKJH 3WY2A 4EZJA 2DAVA 3LH2L 4ATWA 5DD0H 2PWDA 5SWZE 4FNTA 1D5IL 2NY5H 3W0WD 2Q7YB 1MI5A 4ZSOB 1CK1A 2X7LA 5G4OA 2DGYA 2EIZA 1WA0X 4U6TA 1TU2A 3QIWB 2CUMA 1CKOA 3D2UD 3OW7A 4LRIC 4HQQL 1GKEA 5JXEA 4QTIL 4KK9C 4LAAA 4KC3B 5BV7H 1II4E 1N7MH 4ODVH 1EY9A 1LT3D 2BNQE 3HHMA 4UT9A 4GYBA 1ZLUK 4CVXB 4YNYA 1NBYA 4RAUA 2F0KA 2C4FU 3LSOA 3C6SB 1TSHA 2CUAA 2ZWSA 3QQ4B 4CGUB 1EH9A 1J9QA 4XC1H 4DGVL 2NSQA 2A6DA 1TJIH 4YDZA 2E2DC 3DBSA 4X80H 3DJSA 1P1VA 4GXUN 4MNQA 4RDBA 2GK2A 1OAYH 4OTXH 1TCRB 4A3BG 5A2CA 3VRIA 3P3TA 3VB8A 4OUUA 4AZ8B 3AROA 2SDFA 1U8NB 3C75A 4QOKE 3QWOA 3SEPA 2Q8BL 1PH6A 3FPXA 2DUDA 2AQNA 3L5WB 4UINH 5T5NF 3VNYA 5C6PB 2E74C 3Q1SH 4N0UB 1A1OB 3QUYB 2BHFA 4U1KB 1R3IH