2QKKA

Human rnase h catalytic domain mutant d210n in complex with 14-mer rna/dna hybrid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
154
Chain Sequence
b'GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*CP*C)-3'
publication title Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna/rna
total genus 45
structure length 154
sequence length 154
chains with identical sequence B, E, F, I, J, M, N, R, S, W
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2qkkA00
1HNVA 4JRQA 4DF4A 2PYJA 4B9TA 1C1AA 4KO0A 4Y1DA 3C95A 4DTNA 1XC9A 5C25A 3HL8A 1NKCA 2XHBA 2YNHA 3KLIA 4DF8A 2D5RA 1A5XA 1N5YA 5HLFA 3MECA 3NF9A 3OYCA 4CEAA 1EKEA 4CJLA 3THVA 4CGJA 2D0CA 3SUPA 4CECA 2O4IA 1CXQA 1SL1A 1RDCA 3K57A 3OYNA 1ZYQA 3QERA 4CEDA 1KLNA 1TKZA 2G8FA 2ETJA 4CGDA 1SL0A 4C8KA 4ID1A 4DFJA 4BDPA 3K5LA 4KTZA 1ITGA 4Z4CA 3PY8A 2HHVA 1X9WA 4CHOA 3RR8A 1ZBHA 3NGIA 4M3UA 5KTQA 1LAVA 2QKBA 3B6PA 1Z26A 3P1GA 3OY9A 5C24A 4DSKA 2OPPA 4CJ4A 4CIGA 3M8PA 1WSGA 3JSMA 3G0ZA 4H4OA 4DU4A 5J2QA 1JXEA 4BWJA 4DQIA 1BIZA 1ZBUA 4CFDA 4N56A 3HM9A 1TAUA 4E19A 3F9KA 4W5TA 1NK4A 1C0MA 1RBRA 3O4NA 3V1OA 1LWEA 1Z25A 1LV5A 3QETA 4AH9A 3S3NA 4KHUA 1Y97A 4AHCA 4CCHA 1S1VA 1U48A 4OPJA 4KHWA 4BACA 1NK9A 3OYIA 1T03A 1J53A 4E89A 3OYGA 4FJKA 5HRPA 2HHQA 2WONA 3K59A 1TVRA 2FBTA 4ZHRA 3LZJA 1TK5A 3L2RA 1BI4A 1BIUA 3LANA 3EYZA 4CJ3A 1RDBA 2DFEA 3K5OA 3HO1A 4N76A 4FXDA 2D0BA 1HMVA 1HQUA 3HP9A 1DTTA 1FKOA 4JRPA 1TL1A 3MEDA 4M3YA 4DSFA 1W9HA 3HYFA 3SNNA 3ZT1A 4CERA 2HHUA 2DTUA 4K8ZA 1JLFA 3AVKA 3SUOA 3IAYA 3ZCMA 1YT3A 1BL3A 1IKWA 3DM2A 1NK6A 2HNYA 3CFPA 1Q9YA 4KI4A 4F3TA 1KCFA 1O1WA 3WNHA 4HCCA 3RWUA 1RILA 4IBNA 1TKDA 1TL3A 2GBZA 1X1PA 3ITHA 1UOCA 2YV0X 3V81A 4AHRA 4XIUA 1JLCA 1UWBA 3VQ4A 1F21A 2EX3A 3RRHA 4FJHA 4KI6A 3HP6A 4Z0UA 2W42A 1EX4A 2GV9A 3SZ2A 3OS0A 4FLTA 1C0UA 1G15A 3L8BA 4FLYA 3SUNA 4I9QA 1S1TA 1S6PA 1VSEA 3U3GA 1LW0A 3QEIA 4PQUA 2X6NA 3DOLA 4DMNA 1RNHA 4BDYA 5KRTA 2FBVA 1VK0A 2OYQA 2ZD1A 3TANA 3BDPA 1EETA 3G10A 4C8MA 4CEZA 4HVJA 5D3GA 3V9XA 1WSFA 3V1QA 2BANA 3AO4A 3NCIA 1W0HA 4CJSA 2Z1IA 3O3FA 1IKVA 3SJJA 1I3AA 1RBUA 1D8YA 1NOZA 3WNFA 3VQPA 2OZMA 3BGRA 3IG1A 3AVHA 3SPZA 4NCBA 1DLOA 1B9FA 3HT3A 1YTAA 4CEOA 4DTPA 3C6TA 2G8KA 4HUFA 1RDAA 4DSEA 4CHYA 3AO5A 5CZ2A 4HHTA 4FJIA 3RR7A 4OKJA 1ZBIA 2XO7A 4N47A 2IC3A 2IOCA 4KB0A 2YKNA 2JGUA 3DLRA 1U04A 3ZSQA 1VSLA 4DSLA 3B6OA 3LAMA 3DLGA 4FJXA 2XY5A 4OKKA 1T05A 3DRPA 1RT6A 4CESA 2RPIA 3L2VA 1RT4A 1HYSA 4IDKA 4YNQA 1L3UA 4B9NA 1J9AA 4B9VA 4OGCA 1HYZA 2QK9A 3T19A 4I2QA 4FYDA 4FM0A 1RTJA 3AVBA 4RW6A 5C42A 3O3HA 4Z4FA 4TSXA 4B8CA 4W5RA 1NJWA 5FRMA 4PWDA 3AA5X 4DTJA 3PV8A 1C0TA 2KZZA 2PY5A 4FZZA 3PX4A 3IS9A 2P5GA 1SV5A 1NK0A 2F8SA 4OLAA 2HNDA 1J54A 3LP1A 3VQ5A 4LSNA 4MQ3A 3KLGA 4FLXA 4DQPA 4F2SA 3D0PA 4FK4A 1UAXA 4M3RA 2F8TA 3KLFA 2Z1JA 4DTRA 2XY7A 3DRSA 4PUOA 3LAKA 3QIPA 3KK1A 3OYFA 4O44A 1IKXA 4FLVA 3S9HA 3NF6A 4DLGA 2XY6A 5HRSA 3PO4A 4CFCA 2Z1GA 2IDOA 3MEEA 5J2PA 3CFOA 1WN7A 3NF8A 1RTHA 4G1QA 4CEQA 3SV3A 1HJRA 3QEXA 1SKSA 4EZ6A 4FJGA 3E01A 4FK2A 2XRIA 1KVBA 3DMJA 2FC0A 4DU1A 3OS2A 1NKBA 2IS3A 4W5OA 4O55A 1KFDA 3DYAA 4ID5A 1L5UA 4KV8A 1QSSA 4F2RA 1VRUA 1YTUA 3AV9A 4DQRA 4B9MA 2ZE2A 3QNOA 4CF0A 3MAQA 1U45A 2X74A 1RT5A 4DSJA 4J2BA 3LWLA 1JLQA 1QSYA 4RG8A 3AA3A 3S3MA 3HPHA 4M41A 2P1JA 4Q0BA 1U49A 2KZMA 1TGOA 2KQ2A 2VG6A 4OJRA 1BCMA 3TAPA 3RMCA 1RT7A 3CM5A 4CJTA 3JYTA 4PY5A 4B9SA 4LD0A 2YNFA 4FZYA 2F96A 3SCXA 5CYMA 3I0SA 3WNGA 1HPZA 4BDZA 3SQ4A 4KHYA 5HP1A 4KHNA 1NK5A 3RMAA 1RBSA 4E7KA 3DLKA 2ATQA 4DFPA 2VG5A 4BE1A 1NJYA 4C8LA 4UQGA 1MU2A 1QQCA 4Y1CA 4BE0A 4ELTA 4FJMA 1Q8IA 4DFKA 1U47A 3ZT0A 4ICLA 4CEEA 3HJFA 2RN2A 4CJPA 3OYBA 1QS4A 3VN5A 3TAQA 3L2UA 1D5AA 3I0RA 4FLUA 2G8HA 4KAZA 1RT1A 3RRGA 4CEBA 2EHGA 3LDSA 1IO2A 2G8IA 2FBYA 3HPOA 2O4GA 1UA1A 1LAWA 4M3TA 3DLHA 3SV4A 3DOKA 4L8RB 1KLMA 5DK5A 1X9SA 3VQQA 1S5JA 2B5JA 3OYJA 4H4MA 2HHXA 1WSEA 1DTQA 1XWLA 3HK2A 2OPRA 2KTQA 1D9DA 3KKSA 1FKPA 1WAJA 2A1SA 1NOYA 1FK9A 4B8AB 1TV6A 2AJQA 4KREA 1TKXA 1L3SA 4OPKA 4E7LA 4M3ZA 1T7PA 3KIOA 1S1UA 3WNEA 2E6LA 4CF1A 1L3VA 1WSHA 1T8EA 4OKEA 4Z4EA 3ZSYA 5CYQA 1SUQA 4DSIA 4JLHA 4WE1A 3KKRA 2VG7A 3OVNA 1CLQA 1IKYA 3KJVA 3HXMA 1KVCA 3O3GA 1SL2A 1ASVA 4OVLA 3T1AA 3TAGA 2ITGA 3I8DA 4EP4A 3VQBA 5SZTA 3NF7A 2E6MA 1WSIA 4B9LA 1CZBA 4KFBA 1U4BA 1NK7A 3QEPA 3PO5A 1RTDA 1LWCA 3K2PA 4CJRA 4E7IA 3OJSA 3KK2A 4FLWA 2HMIA 4B08A 4DS5A 1JL2A 4DS4A 4DWIA 3SUQA 3NAEA 2X78A 3SQ2A 4EP5A 2P5OA 2ZQBA 3NBPA 5T7BA 1EP4A 1RTIA 5EU7A 3MEGA 3T3FA 3KTQA 4FJ5A 1QHTA 3LALA 3QINA 3NH2A 3OYHA 3ZSOA 3ISNC 4GMJB 3TAMA 2DY4A 1C1CA 3K5MA 2HW3A 1RCHA 4LY7A 3RTVA 1JLBA 4ZTJA 2E4LA 4NCAA 4Z4GA 2D0AA 5J2MA 4CJWA 4HCBA 1VSDA 3LP2A 3PUFA 4E1MA 5DMRA 4CIFA 3U6FA 1KFSA 4F8RA 3AO2A 3M8SA 2OZSA 4W5NA 3TARA 3V4IA 2PZSA 4C8OA 3NH0A 1NJZA 1TAQA 4B9UA 1JLGA 1N6QA 2DFHA 2VWKA 1BQMA 2Z1HA 5E41A 2GUIA 4AHSA 4CE9A 1HRHA 4FJ7A 3SQ0A 5SWMA 1VSHA 1FXXA 3EY1A 3QEWA 4E1NA 1SKWA 3NFAA 2OA8A 1BHLA 4JS5A 3DI6A 4CJ5A 3ZSZA 2NUBA 4O5BA 3AVGA 3LZIA 3FFIA 5I3UA 3QO9A 3ZSWA 3OYEA 3UIQA 2A1RA 2YNIA 4K8XA 4Q5VA 3AO3A 2YNGA 3IRXA 3M8QA 5JS2A 2Y1JA 3K5NA 3S3OA 4HUGA 1WSJA 4FLZA 2HVIA 4IFVA 1A5VA 4CGIA 3C94A 4LH4A 3VA0A 1L3TA 3DLBA 4FJJA 3QEVA 3NE6A 3HSTB 4I7FA 4CF9A 3NGZA 1VSIA 4M45A 1RBTA 3ULDA 1I39A 4PA1A 4CHPA 3ZSRA 2HNZA 3SPYA 3DRRA 3SQ1A 3TI0A 3CYMA 3OYMA 1QTMA 1VRTA 3F73A 1HYVA 1BISA 2XY8A 4KTWA 1LWFA 4E3SA 3KLEA 3LP3A 5KGWA 4HTUA 2HHSA 2WOMA 4DQSA 2YHAA 1S9EA 1B9DA 4CGGA 3V9ZA 2Y1IA 4FJLA 4I2PA 1GOAA 1RT3A 4IG3A 4C8NA 4N5SA 3L2QA 4AHTA 3SI6A 3OS1A 2G8VA 5KGXA 3ALYA 3K58A 3AVAA 5HBMA 4CFAA 1NK8A 1JLEA 1S6QA 1RT2A 1JKHA 1IG9A 4KHSA 2B6AA 3AVLA 3OYDA 2G8WA 1JL1A 3AVCA 2KFZA 3AVMA 4KKOA 2RF2A 4CGHA 1KVAA 4RW8A 3V9SA 4J2DA 4KTQA 1BCOA 2X6SA 3ZSVA 4KB1A 4DG1A 5HROA 4FJ9A 3PX6A 4Z4HA 3OYAA 1S9GA 3AA4A 3RMDA 1XI1A 3TWHA 4W5QA 4CF2A 3LP0A 4FM1A 5I42A 4ZTFA 4KRFA 4NCGA 3TR8A 3PX0A 4LH5A 1R0AA 3L3VA 1S1WA 2QXFA 4IKFA 4FK0A 4O0IA 2G8UA 4YFUA 3CG7A 3P5JA 3V1RA 2QKKA 1RBVA 2IAJA 3ASMA 1TK8A 1ZBLA 2DFFA 3KD1E 3VQCA 4ELUA 4OLBA 2HHTA 4EZ9A 5J1EA 2KFNA 1X9MA 4CK3A 1GOCA 1LW2A 1ASWA 4CK2A 1C6VA 1VSJA 1J5OA 3ZT3A 3ZT4A 3CFRA 3AVNA 4N41A 3TAEA 3M8RA 3MXMA 2HB5A 3D45A 4AHUA 4CK1A 4KPYA 2BGGA 1B92A 3OYLA 1VSMA 5CY4A 1KTQA 1QE1A 5K14A 1QSLA 3AVJA 4IG0A 1TK0A 3O4QA 4CJQA 3P83D 3ZSXA 1ZBFA 3VA3A 3NHGA 4FJ8A 3DLEA 4CHQA 3HVRA 3AVIA 4I9LA 3NDKA 4FJNA 3MXJA 4DTSA 3VQDA 2Q3SA 4CF8A 2VWJA 2PYLA 1K6YA 3KK3A 3RMBA 4CJVA 4FM2A 2HHWA 5JS1A 3CM6A 1WAFA 3H08A 3LWMA 1NJXA 4FVMA 1JLAA 4Z4IA 1A5WA 2YHBA 3MXIA 1JXBA 3HVTA 4ELVA 4AILC 4FW2A 1SKRA 1CZ9A 1XHZA 2RKIA 2I5JA 4RW9A 5KI6A 4RW7A 4H8KA 3V9UA 1BI4B 3VQAA 2BDPA 1GOBA 2R7YA 3V6DA 5FROA 4GVMA 3LPUA 4CJUA 4CIEA 4JS4A 2IGIA 4DQQA 3TAFA 4E0DA 4M3XA 4B3OA 3HPGA 4OGEA 1IH7A 4DTOA 4IFYA 1ASUA 1VSFA 3NH1A 3AVFA 4CJFA 1KRPA 3L3UA 4KHQA 4AHVA 1WNSA 1VSKA 2P51A 3AO1A 4BWMA 1NKEA 4CFBA 3ZT2A 1CXUA 3QNNA 4J2EA 4M3WA 4FW1A 3NGYA 4FCYA 2KW4A 3U3YA 4FZXC 5CZ1A 4CEFA 1TKTA 3A2FA 3CQ8A 5HRRA 1BGXT 4LSLA 1UA0A 4MFBA 4CJKA 3AA2A 1D9FA 5FRNA 2BE2A 4CHNA 1HQEA 4CHZA 3EZ5A 3LPTA 3QIOA 2JLEA 3QLHA 3VQ6A 4F4KA 4R5PA 1REVA 4DU3A 1EXQA 4QOZB 2FBXA 4F3OA 1YVUA 4GW6A 1BQNA 3VQ7A 3VQEA 4DTUA 3OYKA 4DTXA 4CJEA 4E7HA 4NYNA 3KLHA 1RDDA 1WLJA 4E7JA 4DTMA 1S1XA 4O4GA 2LSNA 5KRSA 4BE2A 1HNIA 2OPSA 3QESA 3KD5E 3L2WA 3VQ8A 4CGFA 3SYZA 2YKMA 1KSPA 5HRNA 4J2AA 2HVHA 5J2NA 3OJUA 4O0JA 4DFMA 2B4JA 4QCLA 4M42A 4DLEA 3C6UA 1Q9XA 4QAGA 5FDLA 4RW4A 3TABA 2OPQA 3V9WA 4NYFA 1C1BA 3VQ9A 1XHXA 4HUEA
chains in the Genus database with same CATH superfamily
2P9KB 4PL8A 4DF4A 2PYJA 3CCRN 4YOXA 1C1AA 2PBDA 4KO0A 4Y1DA 3IKMA 3DWLA 1NKCA 3KLIA 3GBTA 5HLFA 3NF9A 3OYCA 4KHPK 2D0CA 4PHTX 5AQFA 4CVNE 1KLNA 2ETJA 4CGDA 1SL0A 1N34K 3P31A 4RCHA 1ITGA 3PY8A 2O8CB 4CHOA 2GUPA 5KTQA 5C0YA 3B6PA 3OY9A 4DSKA 4CIGA 1WSGA 3G0ZA 1JXEA 1ATRA 2VGMA 1ZBUA 1ILYA 2A42A 4JEPA 1LV5A 3S3NA 1Y97A 3A5NC 4CCHA 1U48A 1YF5L 3OYIA 3CCUN 1T03A 4E89A 3MN9A 2HHQA 2WONA 4PKHA 3K59A 1TVRA 4DB3A 1TK5A 3VEYA 3L2RA 1BIUA 3LANA 3EYZA 3K5OA 3ZX2A 3L0QA 2UU9K 3O5BA 4WFBL 4M3YA 3LDLA 2YJFA 1YT3A 4X65K 4L3QA 4YY3K 3CFPA 1ATNA 4I6MA 4IOAL 2PAVA 3UKRA 3A8YA 2BH1A 3ITHA 1UOCA 4XIUA 3VQ4A 1F21A 3HP6A 2W42A 1H1VA 4GY2B 2W41A 1G15A 3D2FA 3L8BA 3SUNA 1GLCG 4I9QA 1P90A 2X6NA 4DMNA 4LFAK 3EZWA 3BDPA 4C8MA 4CEZA 1BA1A 1WSFA 3AO4A 4K0KK 3G25A 2ZM6K 2NRTA 3IG1A 3THXB 1DLOA 1B9FA 1YTAA 4DTPA 2QW9A 4JI1K 4DSEA 2YJEA 2JWLA 1HX1A 4FJIA 1ZBIA 4N47A 3C6HA 2YHYA 3NVKA 2IOCA 5LMNK 4KB0A 1VSLA 4H5WA 3VERA 2Q31A 3DLGA 4GV3A 1JCGA 4OKKA 1K8KB 3W3DA 3L2VA 1RT4A 1XUPO 4YNQA 3HOSA 2QK9A 4FM0A 4B8CA 5JMVA 4Y0WA 1NJWA 5HL7L 4A2AA 4BRMA 2PY5A 4FZZA 1HLUA 1SV5A 1NK0A 4DV4K 3VESA 3ID6A 3VQ5A 4HTLA 4F2SA 2QI2A 4M3RA 2XY7A 3AGRA 3UKUA 3CJBA 5H1SQ 1VQPN 3OTOK 3CPWM 3MEEA 5KPRA 3CFOA 3L6QA 3QEXA 3ZETA 4CBUA 3JXUA 4FK2A 2XRIA 1KVBA 3DMJA 1NKBA 4KV8A 5AQNA 4DUZK 3ENBA 3M5RA 3VTHA 1RT5A 4DSJA 3LWLA 1IV0A 1QSYA 2F9TA 4CZMA 4WQ4A 2KZMA 5BREA 4OJRA 3TAPA 4JD2A 2O8EA 2CGLA 5ELZA 3KK7A 4ISGA 3R3LA 4B9SA 1NGEA 4LD0A 2WC9A 3LDNA 5CYMA 3EKUA 4KHYA 5HP1A 4QS7A 3RMAA 4E7KA 4DFPA 2VG5A 4BE1A 5BN9A 4A57A 4C8LA 2A40A 5BRDA 1U47A 4CEEA 2RN2A 3C7NB 4H5VA 5AQHA 4CJPA 2D1KA 1GLDG 3L2UA 1D5AA 2CGKA 4KAZA 4BRAA 1RT1A 3RRGA 2EHGA 4R79A 3VETA 3OW2M 1WB9A 5AQGA 2IVPA 2O4GA 1UA1A 3DLHA 3DOKA 1X9SA 1S5JA 3OYJA 3G6EN 1WSEA 3EL2A 4X66K 1D9DA 1FKPA 2YCHA 4B8AB 2NRZA 1TV6A 3R9PA 1VQ8N 1TKXA 1L3SA 4E7LA 3KIOA 4FWQA 1WSHA 4JKCA 4Z4EA 1SUQA 4FO0A 4JLHA 4CBWA 3O9SA 3KKRA 1CLQA 3HXMA 4JKDA 2ITGA 5SZTA 2V7ZA 4Z94A 4B9LA 1WSIA 3MK6A 4LFCK 5DM7L 4NCAA 1RTDA 2HMIA 3KK2A 3GE1A 4DS5A 4DS4A 1GLBG 3NAEA 4GKJK 4AQYK 2P5OA 2WBNA 2HMPA 4JHDB 4FJ5A 2P9KA 4CBXA 2HBKA 1QHTA 4BQLA 3QINA 3OYHA 3MCPA 3QFUA 3TAMA 2DY4A 3WXLA 1C1CA 1RCHA 3FZHA 4FWRA 1T6DA 4H5NA 2D0AA 3PUFA 3AO2A 2PZSA 3NH0A 4B9UA 1TAQA 1N33K 2DFHA 5TKYA 4A2BA 2GUIA 4DV2K 1NG9A 3SQ0A 5SWMA 1EO1A 1BHLA 3DI6A 3P38A 4O5BA 3LZIA 3AVGA 3QO9A 3E9LA 2ZWHA 2A1RA 3H3OB 4Q5VA 2Y1JA 1NLVA 4A62A 1A5VA 3R6MA 3CXCM 1OVYA 4H0YB 1RBTA 1MA9B 3J8AA 3SPYA 3DRRA 3TI0A 4DV0K 2ASPA 1QTMA 1MWKA 4KTWA 1BUPA 3D6RA 4HTUA 2HHSA 4CGGA 3V9ZA 3U8XA 4FJLA 4IG3A 4GNIA 4AHTA 1ATSA 3SBTA 3K58A 1TUYA 1JLEA 1S6QA 1ZC6A 5AZJB 3O80A 2B6AA 4JI8K 3O9RA 4MO4A 3OBYA 1IBMK 2RF2A 2Q97A 4ILHA 3FZMA 3OYAA 1S9GA 3AA4A 4W5QA 4NCGA 1R0AA 2QXFA 4IKFA 3ENHA 2G8UA 1RBVA 1QQOA 4EIAA 3CCMN 2DFFA 3SK3A 3VQCA 4ELUA 1IJJA 1KAYA 4CK2A 1C6VA 3AVNA 3IUCA 3D45A 2AA4A 2A3ZA 1C0FA 5AQPA 3O4WA 4NXMK 2WTUA 3Q7BA 5CY4A 2NLXA 4M7XA 1YJ9N 1QSLA 1TK0A 4IG0A 4CJQA 1ZBFA 3DLEA 1GLJO 3HVRA 2FSNA 3VENA 5IT9O 2PYLA 4DTSA 2Q3SA 5M1PA 5AQWA 4FM2A 2HHWA 3H08A 3LWMA 1VQNN 4CZKA 3O1WA 2FF3B 2YHBA 3HVTA 4ELVA 4AILC 1CZ9A 5KI6A 2CH5A 1ESVA 4LF9K 4BG8A 3V6DA 5FROA 4DQQA 2P9NA 5FPMA 4H0PA 3VGMA 5CE3A 4DTOA 1VSFA 4CJFA 3FE1A 3L3UA 1WNSA 2P51A 1CXUA 3QNNA 3J7ZO 4FW1A 3BZCA 2KW4A 4I6MB 4CEFA 1TKTA 3QBWA 4A59A 2CH6A 4MFBA 4CJKA 3AA2A 4LF6K 3EZ5A 3QLHA 4F4KA 1N8RO 4GVEA 1WBDA 1REVA 1HNXK 4JI3K 3D2FB 4DTMA 1WLJA 4O4GA 4XH4A 2LSNA 1W2BM 1HNIA 2OPSA 1OH8A 3VQ8A 4CGFA 3SYZA 2YKMA 1KSPA 5HRNA 2FXUA 3AAPA 5J2NA 3TSUA 2HF3A 1Q9XA 3MX2A 5C2FA 1EWQA 1C1BA 1HNVA 4BROA 4QS8A 4IJNA 3C95A 5C25A 4J8FA 5BR8K 1N5YA 2QWPA 3MECA 3E9OA 5AQZA 4CEAA 3THVA 2O8FA 2FSKA 5GAGP 2O4IA 1CXQA 1RDCA 3K57A 3MCAB 3QERA 5TKWA 1TKZA 3TTFA 1NGGA 2ZGYA 2HBLA 4JK9A 5FLXO 4BDPA 4Z4CA 3CC2N 1X9WA 1ZBHA 1VHXA 4M7YA 4B1ZA 2QKBA 1ZBSA 1LAVA 3WXKA 1YXQA 3P1GA 5C24A 3HRGA 4CJ4A 4OX9K 1NM1A 3JSMA 4DU4A 5J2QA 4BWJA 4K43A 4CFDA 3UKUB 4E19A 3F9KA 4W5TA 1NK4A 1C0MA 3V1OA 1LWEA 1Z25A 3VEXA 1NK9A 3ZETB 4FJKA 2NRXA 2QXLA 3OYGA 5HRPA 4ZHRA 3LZJA 4B1UB 1BI4A 5BR9A 2FF6A 1RDBA 2DFEA 4CJ3A 3HO1A 4N76A 4FXDA 2D0BA 2VQFK 3HP9A 4MLHA 3HYFA 3SNNA 2HHUA 5LJWA 5AQOA 3AVKA 4OPAA 1BL3A 4JD2B 2HNYA 4F3TA 1O1WA 3WNHA 4HCCA 4BR2A 3ENOA 3CQXA 1RILA 1TKDA 2YV0X 1UWBA 5JVGL 4FJHA 3IFRA 3GG4A 2GV9A 5JVHL 4FLTA 4FLYA 1S1TA 1NGAA 1VSEA 2GX9A 3ZX3A 4PQUA 4YDUA 3TANA 1EETA 3FZFA 3V9XA 1ZXOA 3NCIA 1W0HA 2ZF5O 1HPMA 3O3FA 3T7ZA 3SJJA 1GLLO 1I3AA 4DR4K 1RBUA 4JI7K 2OZMA 3L4IA 2OANA 3G71N 3C6TA 2G8KA 1O13A 1OKJA 3AO5A 2OCEA 2IC3A 2QM1A 3CI5A 2YKNA 4BRDA 3DLRA 5EX5A 5AR0A 1QVGM 3B6OA 4FWKA 3OBWA 1XMOK 1RT6A 4CESA 1HYSA 5BRFA 3O08A 5KQ8A 4OGCA 2HHVA 4FYDA 4Z4FA 4RW6A 1G99A 4TSXA 5FRMA 3FGUA 3AA5X 1C0TA 4MLEA 3IS9A 3HBTA 3PX4A 2P5GA 5GAEP 2F8SA 1NGDA 3LP1A 1Q18A 3D0PA 3DRSA 3OYFA 4O44A 1IKXA 4DHYA 3S9HA 3NF6A 2XY6A 1M1KO 2IDOA 3NF8A 4CEQA 1HJRA 1SKSA 4BY9C 4IEEA 4O55A 1L5UA 2QWRA 3AV9A 4NLCA 4DQRA 3A5LC 3MAQA 2X74A 3L4QA 5E26A 1X9JA 1SZ2A 4RG8A 1OH6A 1KAZA 3HPHA 4IO8A 4H5TA 4M41A 4U67L 1FW6A 3J7YP 2VGNA 2KQ2A 3WXMB 4YHHK 1YJNN 1BCMA 3RMCA 1RT7A 4WQ5C 4YOVA 4CJTA 4X64K 3WQUA 2F96A 4FZYA 2NNWA 3H1QA 3DXKA 4IEIA 4KHNA 3VTIA 2ATQA 2E2PA 1NJYA 4NXNK 4Y1CA 4BE0A 4FJMA 3HJFA 3TAQA 1QQMA 3H6EA 3CF5L 2UXDK 3LM2A 2E20A 3D2EA 1LAWA 4H0TB 4L8RB 1GLFO 2P9IA 2B5JA 5FPNA 4H4MA 3MN5A 1DTQA 2E5LK 3HK2A 1N32K 2KTQA 2WUSA 1HNWK 1FK9A 2AJQA 4OPKA 4M3ZA 3CIPA 3OA9A 3PSFA 1L3VA 3ZSYA 3OVNA 1IKYA 4XH1A 4A5BA 1S3XA 4OPHA 4EP4A 1CZBA 1U4BA 1LWCA 3K2PA 4CJRA 3OJSA 4FLWA 3SAFA 4X62K 3FR0A 1R59O 1W97L 5EU7A 3MEGA 1S22A 3T3FA 2WFBA 3I8BA 4LF8K 3ISNC 4FWOA 5AQMA 4O8KA 4B1XB 3K5MA 2HW3A 4LC9B 4NLBA 3VOVA 2E4LA 4Z4GA 2P9LA 5DMRA 4CIFA 3U6FA 1W7AA 2D0OA 4FWNA 1NJZA 1JLGA 1YHQN 2VWKA 1NGFA 2Z1HA 3R1XA 1YVNA 5IWAK 4JI5K 2E2NA 2NRWA 4XH5A 2A41A 1SKWA 3QEWA 5AQXA 3RSEA 3EO3A 4JS5A 4GKKK 4B3SK 3FFIA 3ZSWA 1K73O 4JAXA 3BP8A 2P9NB 3VF2A 2YNGA 5JS2A 4HUGA 1WSJA 4IFVA 2GELA 4LH4A 3DLBA 4B1YB 4FJJA 1BOTO 3SAGA 2EWSA 4M45A 2IVOA 4PA1A 2HNZA 1VQ9N 2ZJQL 3KLEA 3LP3A 1YI2N 1IBLK 2WOMA 4DQSA 1S9EA 1B9DA 1HNZK 4I2PA 1GOAA 4N5SA 3K0SA 1NGIA 3SI6A 2G8VA 5AQIA 1NK8A 5AQJA 3HOTA 4CW7B 5EY4A 1JL1A 4WYBA 3AVMA 4B3MK 2Q0UA 4CGHA 1KVAA 4RW8A 3V9SA 4J2DA 3U9ZA 1QHAA 1BDGA 4DG1A 3VGKA 2QWLA 4ILJA 4Z4HA 4C1NI 3RMDA 5LMUK 5GIPA 3WXIA 2P9PA 3LP0A 4FM1A 2IIRA 4JK7A 5I42A 4BVOA 2Q1NA 2HSTA 3PX0A 4LH5A 4FK0A 4O0IA 4YFUA 3P5JA 3O9QA 1WBBA 2O8FB 3KD1E 4EZ9A 1KD1O 1X9MA 3DLLL 1VSJA 4O8UA 3M8RA 4CK1A 4AHUA 3VPZA 4KPYA 4JV5K 3K9KA 3OYLA 1VSMA 2KHOA 5K14A 2F4VK 2GWJA 3VF6A 3WUHA 3AVJA 3SBGA 3VA3A 3ZSXA 1YITN 3GOIA 3GL1A 4I9LA 3NDKA 3O9UA 4FJNA 3CD6N 3CCVN 4CF8A 2VWJA 2OTJN 4B1WB 2NRHA 1JLAA 4RTFD 4UY8O 3MXIA 2ITMA 3I33A 2I5JA 1Q86O 1BI4B 3VQAA 4FOIA 4YORA 3LPUA 4BVPA 4JS4A 3HPGA 4OGEA 1Q81O 4LF5K 1QQNA 1IH7A 4DV1K 5AQRA 1KRPA 4KHQA 1VSKA 4DQ8A 3NGYA 4BQZA 4ILGB 1UA0A 4LSLA 4LF4K 5LY3A 1HQEA 2O8BA 3VQ6A 4DU3A 4QOZB 2FBXA 1MWMA 2YHXA 1BQNA 4JKHA 3KLHA 2QWOA 3CCSN 3HTVA 3KZBA 2QWMA 4QCLA 4O0JA 2B4JA 1VQMN 4QAGA 1VQON 5FDLA 1Y64A 2OPQA 4ISEA 4NYFA 3VQ9A 2BUPA 2Q36A 2ZJPL 4EAHD 4HUEA 4DCHA 2VQEK 4JRQA 2FLOA 4DR3K 4DTNA 1XC9A 1WOQA 2XHBA 3E66A 1A5XA 3UE5A 3TTCA 4CJLA 4CGJA 4DUYK 1HKBA 2V7YA 5AQLA 1GLEG 1BG3A 1ZYQA 3QICA 4CEDA 3QBXA 4C8KA 4ID1A 4DFJA 3MMVA 3RR8A 4M3UA 3NMUA 4LF7K 2OPPA 1IBKK 2PFUA 3M8PA 2UUCK 2A5XA 4H4OA 4FWSA 4DQIA 4FOEA 3G4SN 1BIZA 5AFUA 2KKZA 4DV7K 4BC5A 4N56A 3O4NA 3QETA 4AH9A 2NZTA 4OPJA 4KHWA 4BACA 4MDAA 1Q7YO 1NMDA 4CZGA 2FBTA 3TU5A 1SAZA 3QDKA 2QA4N 1GLAG 1QZ6A 1DT9A 3I55N 1FKOA 3CERA 4JRPA 2IVNA 3NVMA 3ZT1A 4CERA 2DTUA 3SUOA 1OH7A 3IAYA 1TYQA 4K25A 1NK6A 1Q9YA 4KI4A 1RDUA 1KCFA 1T6CA 3HZ6A 2GBZA 3DXKB 3V81A 4AHRA 1OH5A 3VGLA 4Z0UA 3SZ2A 1EX4A 4CJ7A 3OS0A 3BY5A 5BPLA 4IOXA 4JI6K 1X3NA 4JKEA 1RGIA 3PLAA 1S6PA 3U3GA 2E1ZA 5KRTA 2FBVA 3LM9A 2ZD1A 2HHHK 3Q7CA 1NWKA 3D2EB 4K41A 3CJ7A 3QMLA 4CJSA 2Z1IA 1C0GA 2P9IB 1T44A 4CZFA 4CZHA 1NOZA 3WNFA 5DM6L 2RE2A 4CEOA 1XNRK 4HUFA 1RDAA 5EXWA 5CZ2A 3RR7A 4OKJA 2XO7A 2ZJRL 3ZSQA 4KBOA 3LAMA 4DKWA 4AF1A 2XY5A 3CETA 3DRPA 4JKAA 1L3UA 5AJ3K 2ASOA 4B9NA 4B9VA 1HYZA 3T19A 4I2QA 3O3HA 3AVBA 2KZZA 4PWDA 1BA0A 1NGHA 3PIOL 3CQYA 4BC3A 1BO5O 2HNDA 1J54A 4FLXA 4FK4A 4MQ3A 2F8TA 3H1VX 2Z1JA 4PUOA 1VQ5N 5EOYA 3KK1A 3PO4A 3SMSA 4CFCA 3BF1A 2V51B 2P9LB 5J2PA 3SV3A 4FJGA 3E01A 2FC0A 2IS3A 5M1NA 4W5OA 4ID5A 4F2RA 1QSSA 1YTUA 4LFBK 4B9MA 4YOUA 2GEMA 2ZE2A 4CF0A 3BEXA 3QNOA 1U45A 4YOYA 4K42A 3BF3A 3RSEB 1JLQA 4KH4A 3AA3A 2P1JA 4Q0BA 1U49A 1TGOA 4FVUA 3CM5A 1KXPA 1LOTB 2E2QA 4BREA 3SCXA 3WNGA 2CGJA 4BDZA 3CCLN 1NK5A 5EVZA 3JS6A 5FPEA 1E4FT 3RVCA 3AGKA 4UQGA 1MU2A 4ELTA 1Q8IA 3O6WA 4DFKA 3CPEA 3ZT0A 4ICLA 3ATVA 2UXBK 3VN5A 2QTDA 4FLUA 2G8HA 2G8IA 4B1VA 4CEBA 3P4IA 2P9SA 2O8DA 2FBYA 1MDUB 2OTLN 4FWPA 4M3TA 3AARA 1KLMA 5DK5A 3VQQA 4CI6A 2HHXA 1HJOA 2OPRA 3LDQA 1NOYA 1NGBA 4KREA 1NJIO 3WNEA 2E6LA 1T8EA 1NGJA 2RHKA 5CYQA 5GAHP 1LCUA 4WE1A 1J5EK 2P9PB 3KJVA 3O3GA 1ASVA 4OVLA 4IFEA 3J80O 2E6MA 3TSQA 4KFBA 4M63C 3ZEUA 4IJAA 1OVQA 4DWIA 3SUQA 1Z05A 2X78A 4EP5A 2ZQBA 3NBPA 5T7BA 3MN6A 1RTIA 4JNEA 4GMJB 4IDHA 5LJVA 1NU0A 3THYA 1JLBA 5M1FA 3LP2A 4CZEA 1KFSA 4PKIA 5AQSA 2OZSA 4W5NA 3TARA 2DPNA 5A2QO 1N6QA 5BPNA 5JICA 1BQMA 5E41A 4AHSA 1JCFA 4CE9A 4FJ7A 3EKSA 1FJGK 3EY1A 4H5RA 3O9TA 5C2DA 5M1OA 5AFUH 1VAZA 4CJ5A 2NUBA 2I7PA 3UIQA 4DR5K 3BUZB 5AZIA 4K8XA 3AO3A 3IRXA 3M8QA 2GTDA 1XNQK 3K5NA 4JKGA 4WQ5A 3CHWA 3C94A 3VA0A 1L3TA 3C0BA 3NE6A 4CF9A 3ULDA 3NGZA 3QFPA 1J6ZA 3DJCA 3OYMA 1VRTA 4JI2K 1HYVA 1BISA 4E3SA 3PIPL 2O8BB 2YHAA 2VCPA 1DGKN 5KGXA 4BGAA 3AVAA 5HBMA 4WFAL 1RT2A 3MDQA 3AVLA 4EHTA 3OYDA 2JWKA 2G8WA 2KFZA 4KKOA 1DEJA 1BCOA 3CJCA 3ZSVA 4KB1A 4FJ9A 1KQSM 3EE9A 3ZYYX 4WFNL 3TWHA 4CF2A 4ZTFA 5AQYA 3TR8A 3ULEB 3L3VA 1U2VA 4BC4A 2QKKA 1KC8O 3ASMA 1TK8A 2H3GX 3EEQA 4BR4A 2HHTA 5J1EA 4BC2A 2KFNA 4CK3A 1GOCA 3LDOA 3DXMA 1LW2A 1VQKN 2E8AA 2NRVA 3ZT3A 3ZT4A 3TAEA 2HB5A 3GDQA 1V4TA 2BGGA 1B92A 3LL3A 1KTQA 3CMEN 3CCEN 3P83D 3W0LA 4FJ8A 3H46O 5AQVA 4CHQA 1XMQK 1U6ZA 3MXJA 3VQDA 4A5AA 1K6YA 3FZLA 3RMBA 4CJVA 3CMAN 3CM6A 1WAFA 5AQUA 1NJXA 5F0XA 3CCQN 4Z4IA 1A5WA 4EHUA 3KHYA 3H3NO 4GV9A 1HKGA 4FW2A 1SKRA 1XHZA 2RKIA 4RW9A 2BDPA 4H8KA 3V9UA 1K8AO 4GVMA 4CJUA 4CIEA 3TAFA 2IGIA 3ID8A 4E0DA 5C12A 5AQTA 4RWTA 4IFYA 3AVFA 1TYQB 2GWKA 3U9DA 2VWBA 1NKEA 4CFBA 3ZT2A 4J2EA 4M3WA 2UYTA 4H0VB 3A0IX 3EN9A 3A2FA 4E1JA 5HRRA 1BGXT 3QB0A 1VQ4N 1D9FA 4OO1J 5FRNA 2BE2A 4CHNA 4C1NK 3QIOA 2JLEA 2ZGZA 5BN8A 5C10A 2F9WA 1EXQA 1YVUA 3VQEA 1I94K 3OYKA 1NNEA 3AY9A 3SLCA 3DAWA 4CJEA 4E7HA 4E7JA 1RDDA 4BR7A 5AQKA 1S1XA 3MN7A 1QVFM 3QESA 3OHRA 4J2AA 5F1XA 1YUWA 4DFMA 4M42A 2UXCK 1V4SA 3C6UA 1EWRA 4RW4A 3TABA 3C65A 4BRHA 5GADP 2UUBK 1RNHA 4FL9A 4B9TA 3SAHA 2J4RA 4YOTA 3KWIA 3HL8A 3THWA 2P9UA 4H0OA 2YNHA 4DF8A 2D5RA 4G9ZA 1EKEA 4CZLA 3SUPA 3CC7N 4NO7A 4CECA 1YAGA 3HM8A 1SL1A 3T69A 3OYNA 2YX6A 2G8FA 4CD3A 1E4GT 3A5MC 5ADXA 3K5LA 4KTZA 3ZLJA 1XC3A 1EQYA 3NGIA 2HOEA 1Z26A 4JKFA 4B9QA 1SQKA 4H0XB 2W6LA 4IWVA 3HM9A 1TAUA 5GIOA 1RBRA 4KH6A 4BRQA 3E1YA 4KHUA 4AHCA 1S1VA 3PSIA 3VEWA 3WQTA 1J53A 4BR5A 2W40A 5BRHA 4V19S 4BRPA 4O5FA 3VF4A 3WXJA 4WQ4C 1HMVA 1HQUA 1DTTA 1TL1A 1NMNA 3MEDA 4DSFA 4XEIA 1W9HA 2V52B 3VEOA 4K8ZA 1JLFA 3ZCMA 1NBWA 3WEEA 3DM2A 1IKWA 4WF9L 1BU6O 1SS6A 3RWUA 2I7NA 4U7BA 4IBNA 1M90O 1TL3A 1X1PA 3UB5A 4CZJA 1JLCA 4JKBA 3RRHA 2EX3A 1VQ7N 4KI6A 4B3TK 4BGBA 3KVGA 4IO9L 1C0UA 4C23A 1LW0A 3QEIA 3DOLA 3N4PA 4BDYA 1VK0A 2P9SB 3CJAA 2OYQA 2O8DB 3G10A 4HVJA 4QS9A 4JI0K 5D3GA 3V1QA 2BANA 1HKCA 1IKVA 1D8YA 4FWLA 3VQPA 4ISFA 3BGRA 3AVHA 3M6GA 3SPZA 4NCBA 4IOCL 3HT3A 2QWQA 4HWIA 3ATUA 4CHYA 3F2KA 4HHTA 3BZKA 5I9EB 1P8ZA 4FWMA 2JGUA 1E3MA 1U04A 3S41A 4DSLA 3ZEUB 1T05A 2RPIA 4IDKA 3WT0A 1J9AA 3F9MA 2O8CA 4BRLA 3CC4N 1RTJA 4BG9A 5C42A 4W5RA 4CD1A 4DTJA 4DR7K 3PV8A 1QZ5A 3M3ZA 4OLAA 4H03B 4LSNA 3KLGA 4DQPA 1UAXA 3ULEA 3KLFA 4DTRA 3MWTA 3LAKA 3QIPA 4FLVA 3THYB 4FJXA 3T1HK 4DLGA 5HRSA 3KWGA 2Z1GA 1WN7A 4G1QA 1RTHA 4BRFA 3SJHA 4EZ6A 4JYAK 4DU1A 3OS2A 1KFDA 3DYAA 5MLCQ 3VMFB 1VRUA 3VEVA 4B3RK 5F2RA 3CJ9A 4KH5A 2HBJA 1XQSC 5GINA 4J2BA 3S3MA 4IXCA 2VG6A 5AZIB 4IZ9A 3JYTA 4PY5A 2YNFA 3SMPA 3I0SA 4JKGB 1HPZA 3C6AA 4JK8A 3SQ4A 1RBSA 3DLKA 3P39A 1QQCA 3OYBA 1QS4A 4FPBA 3T1YK 3I0RA 3JAMO 3E9PA 3LDSA 1IO2A 3VEZA 3HPOA 1D4XA 3SV4A 4PL7A 2HBMA 1XWLA 1CZAN 5C15A 3THXA 3KKSA 1WAJA 2A1SA 1TUUA 1T7PA 2E1YA 1S1UA 2Q2RA 4CF1A 4BRIA 4BRKA 3R8EA 4OKEA 5B8HA 4DSIA 2VG7A 5CR4A 2VYPA 1KVCA 1SL2A 3T1AA 2UUAK 3TAGA 3I8DA 3VQBA 3NF7A 2A6AA 1U2VB 4BRGA 1K8KA 1NK7A 3QEPA 3F5TA 3PO5A 1JCEA 4E7IA 4B08A 4GV6A 1JL2A 3SQ2A 3U4LA 1EP4A 4JN4A 3DXMB 3KTQA 4MO5A 3LALA 3NH2A 3ZSOA 4BRNA 1N36K 4A61A 4DR6K 4DR2K 5BPMA 4LY7A 3RTVA 4ZTJA 5J2MA 4CJWA 4HCBA 1VSDA 3HSCA 3AAQA 3TTDA 3K9JA 4E1MA 5ADXH 4F8RA 3M8SA 3V4IA 4C8OA 5LL6Z 4WCEL 3UKRB 3I56N 1HRHA 1VSHA 1FXXA 4E1NA 3J81O 3NFAA 2OA8A 3ZSZA 3HI0A 5I3UA 3OYEA 1RFQA 4F9OA 2YNIA 3O1BA 2BTFA 3S3OA 2HVIA 4FLZA 3ZX0A 1S72N 3FZKA 4CGIA 2NRRA 1JJ2M 3QEVA 3HSTB 1WUAA 4I7FA 1VSIA 4AM7A 3MWPA 5E84A 3O8MA 1I39A 3FLCO 4CHPA 3C7NA 3ZSRA 3SQ1A 3CYMA 2FSJA 3F73A 2XY8A 1LWFA 5KGWA 4BR9A 2KLAA 2Y1IA 1RT3A 4C8NA 1X3MA 3L2QA 3OS1A 2YHWA 3ALYA 4CFAA 3TPQA 1Q82O 1IG9A 1JKHA 4KHSA 1VQLN 5M1QA 3B8AX 1IG8A 3AVCA 1YIJN 4PKGA 4KTQA 5FPDA 2X6SA 2D4WA 5AQQA 5HROA 2E88A 3FFKB 3PX6A 1XI1A 1K9MO 4KRFA 1S1WA 1HUXA 2ASMA 3CG7A 3THWB 3V1RA 2P9UB 2IAJA 1ZBLA 5JLFA 4OLBA 1KAXA 4MDBA 4JHDA 3CJ1A 1ASWA 5KPZA 1J5OA 3CFRA 5CHIA 4DV3K 4N41A 3MXMA 1T3VA 1NGCA 2QWNA 3LDPA 1QE1A 3O4QA 2D0PA 3M1FA 3NHGA 4EFHA 3AVIA 4BRCA 4DV6K 1BWFO 4BR0A 4YOWA 2O8EB 3EE8A 5KQDA 3KK3A 5JS1A 4FVMA 1JXBA 5HOOA 3H45C 5M1KA 2YI1A 2F7TA 1DKGD 2QEXN 3IMXA 4JI4K 4RW7A 1GOBA 2R7YA 4DR1K 3N4QA 1RDWX 4M3XA 4B3OA 4NB4A 3A5OC 2W6KA 1ASUA 1HR0K 3NH1A 3WEEB 4FSVA 4AHVA 1YJWN 3AO1A 4BWMA 4FCYA 3U3YA 4FZXC 5CZ1A 5KPTA 3CQ8A 4DV5K 4CHZA 3LPTA 2HF4A 4R5PA 4YDUC 4F3OA 2E2OA 4GW6A 3VQ7A 4AM6A 3D7EO 4DTUA 4DTXA 4FPAA 4NYNA 2AP1A 5AZJA 3MX5A 3IDHA 4BE2A 1Z6RA 3TSPA 5KRSA 3CCJN 3KD5E 1VQ6N 3L2WA 2HVHA 4CZIA 3OJUA 4DLEA 2Q0RA 3J7AP 5JLHA 3V9WA 1XHXA
chains in the Genus database with same CATH topology
1HNVA 4JRQA 4DF4A 2PYJA 4B9TA 1C1AA 4KO0A 4Y1DA 3C95A 4DTNA 1XC9A 5C25A 3HL8A 1NKCA 2XHBA 2YNHA 3KLIA 4DF8A 2D5RA 1A5XA 1N5YA 5HLFA 3MECA 3NF9A 3OYCA 4CEAA 1EKEA 4CJLA 3THVA 4CGJA 2D0CA 3SUPA 4CECA 2O4IA 1CXQA 1SL1A 1RDCA 3K57A 3OYNA 1ZYQA 3QERA 4CEDA 1KLNA 1TKZA 2G8FA 2ETJA 4CGDA 1SL0A 4C8KA 4ID1A 4DFJA 4BDPA 3K5LA 4KTZA 1ITGA 4Z4CA 3PY8A 2HHVA 1X9WA 4CHOA 3RR8A 1ZBHA 3NGIA 4M3UA 5KTQA 1LAVA 2QKBA 3B6PA 1Z26A 3P1GA 3OY9A 5C24A 4DSKA 2OPPA 4CJ4A 4CIGA 3M8PA 1WSGA 3JSMA 3G0ZA 4H4OA 4DU4A 5J2QA 1JXEA 4BWJA 4DQIA 1BIZA 1ZBUA 4CFDA 4N56A 3HM9A 1TAUA 4E19A 3F9KA 4W5TA 1NK4A 1C0MA 1RBRA 3O4NA 3V1OA 1LWEA 1Z25A 1LV5A 3QETA 4AH9A 3S3NA 4KHUA 1Y97A 4AHCA 4CCHA 1S1VA 1U48A 4OPJA 4KHWA 4BACA 1NK9A 3OYIA 1T03A 1J53A 4E89A 3OYGA 4FJKA 5HRPA 2HHQA 2WONA 3K59A 1TVRA 2FBTA 4ZHRA 3LZJA 1TK5A 3L2RA 1BI4A 1BIUA 3LANA 3EYZA 4CJ3A 1RDBA 2DFEA 3K5OA 3HO1A 4N76A 4FXDA 2D0BA 1HMVA 1HQUA 3HP9A 1DTTA 1FKOA 4JRPA 1TL1A 3MEDA 4M3YA 4DSFA 1W9HA 3HYFA 3SNNA 3ZT1A 4CERA 2HHUA 2DTUA 4K8ZA 1JLFA 3AVKA 3SUOA 3IAYA 3ZCMA 1YT3A 1BL3A 1IKWA 3DM2A 1NK6A 2HNYA 3CFPA 1Q9YA 4KI4A 4F3TA 1KCFA 1O1WA 3WNHA 4HCCA 3RWUA 1RILA 4IBNA 1TKDA 1TL3A 2GBZA 1X1PA 3ITHA 1UOCA 2YV0X 3V81A 4AHRA 4XIUA 1JLCA 1UWBA 3VQ4A 1F21A 2EX3A 3RRHA 4FJHA 4KI6A 3HP6A 4Z0UA 2W42A 1EX4A 2GV9A 3SZ2A 3OS0A 4FLTA 1C0UA 1G15A 3L8BA 4FLYA 3SUNA 4I9QA 1S1TA 1S6PA 1VSEA 3U3GA 1LW0A 3QEIA 4PQUA 2X6NA 3DOLA 4DMNA 1RNHA 4BDYA 5KRTA 2FBVA 1VK0A 2OYQA 2ZD1A 3TANA 3BDPA 1EETA 3G10A 4C8MA 4CEZA 4HVJA 5D3GA 3V9XA 1WSFA 3V1QA 2BANA 3AO4A 3NCIA 1W0HA 4CJSA 2Z1IA 3O3FA 1IKVA 3SJJA 1I3AA 1RBUA 1D8YA 1NOZA 3WNFA 3VQPA 2OZMA 3BGRA 3IG1A 3AVHA 3SPZA 4NCBA 1DLOA 1B9FA 3HT3A 1YTAA 4CEOA 4DTPA 3C6TA 2G8KA 4HUFA 1RDAA 4DSEA 4CHYA 3AO5A 5CZ2A 4HHTA 4FJIA 3RR7A 4OKJA 1ZBIA 2XO7A 4N47A 2IC3A 2IOCA 4KB0A 2YKNA 2JGUA 3DLRA 1U04A 3ZSQA 1VSLA 4DSLA 3B6OA 3LAMA 3DLGA 4FJXA 2XY5A 4OKKA 1T05A 3DRPA 1RT6A 4CESA 2RPIA 3L2VA 1RT4A 1HYSA 4IDKA 4YNQA 1L3UA 4B9NA 1J9AA 4B9VA 4OGCA 1HYZA 2QK9A 3T19A 4I2QA 4FYDA 4FM0A 1RTJA 3AVBA 4RW6A 5C42A 3O3HA 4Z4FA 4TSXA 4B8CA 4W5RA 1NJWA 5FRMA 4PWDA 3AA5X 4DTJA 3PV8A 1C0TA 2KZZA 2PY5A 4FZZA 3PX4A 3IS9A 2P5GA 1SV5A 1NK0A 2F8SA 4OLAA 2HNDA 1J54A 3LP1A 3VQ5A 4LSNA 4MQ3A 3KLGA 4FLXA 4DQPA 4F2SA 3D0PA 4FK4A 1UAXA 4M3RA 2F8TA 3KLFA 2Z1JA 4DTRA 2XY7A 3DRSA 4PUOA 3LAKA 3QIPA 3KK1A 3OYFA 4O44A 1IKXA 4FLVA 3S9HA 3NF6A 4DLGA 2XY6A 5HRSA 3PO4A 4CFCA 2Z1GA 2IDOA 3MEEA 5J2PA 3CFOA 1WN7A 3NF8A 1RTHA 4G1QA 4CEQA 3SV3A 1HJRA 3QEXA 1SKSA 4EZ6A 4FJGA 3E01A 4FK2A 2XRIA 1KVBA 3DMJA 2FC0A 4DU1A 3OS2A 1NKBA 2IS3A 4W5OA 4O55A 1KFDA 3DYAA 4ID5A 1L5UA 4KV8A 1QSSA 4F2RA 1VRUA 1YTUA 3AV9A 4DQRA 4B9MA 2ZE2A 3QNOA 4CF0A 3MAQA 1U45A 2X74A 1RT5A 4DSJA 4J2BA 3LWLA 1JLQA 1QSYA 4RG8A 3AA3A 3S3MA 3HPHA 4M41A 2P1JA 4Q0BA 1U49A 2KZMA 1TGOA 2KQ2A 2VG6A 4OJRA 1BCMA 3TAPA 3RMCA 1RT7A 3CM5A 4CJTA 3JYTA 4PY5A 4B9SA 4LD0A 2YNFA 4FZYA 2F96A 3SCXA 5CYMA 3I0SA 3WNGA 1HPZA 4BDZA 3SQ4A 4KHYA 5HP1A 4KHNA 1NK5A 3RMAA 1RBSA 4E7KA 3DLKA 2ATQA 4DFPA 2VG5A 4BE1A 1NJYA 4C8LA 4UQGA 1MU2A 1QQCA 4Y1CA 4BE0A 4ELTA 4FJMA 1Q8IA 4DFKA 1U47A 3ZT0A 4ICLA 4CEEA 3HJFA 2RN2A 4CJPA 3OYBA 1QS4A 3VN5A 3TAQA 3L2UA 1D5AA 3I0RA 4FLUA 2G8HA 4KAZA 1RT1A 3RRGA 4CEBA 2EHGA 3LDSA 1IO2A 2G8IA 2FBYA 3HPOA 2O4GA 1UA1A 1LAWA 4M3TA 3DLHA 3SV4A 3DOKA 4L8RB 1KLMA 5DK5A 1X9SA 3VQQA 1S5JA 2B5JA 3OYJA 4H4MA 2HHXA 1WSEA 1DTQA 1XWLA 3HK2A 2OPRA 2KTQA 1D9DA 3KKSA 1FKPA 1WAJA 2A1SA 1NOYA 1FK9A 4B8AB 1TV6A 2AJQA 4KREA 1TKXA 1L3SA 4OPKA 4E7LA 4M3ZA 1T7PA 3KIOA 1S1UA 3WNEA 2E6LA 4CF1A 1L3VA 1WSHA 1T8EA 4OKEA 4Z4EA 3ZSYA 5CYQA 1SUQA 4DSIA 4JLHA 4WE1A 3KKRA 2VG7A 3OVNA 1CLQA 1IKYA 3KJVA 3HXMA 1KVCA 3O3GA 1SL2A 1ASVA 4OVLA 3T1AA 3TAGA 2ITGA 3I8DA 4EP4A 3VQBA 5SZTA 3NF7A 2E6MA 1WSIA 4B9LA 1CZBA 4KFBA 1U4BA 1NK7A 3QEPA 3PO5A 1RTDA 1LWCA 3K2PA 4CJRA 4E7IA 3OJSA 3KK2A 4FLWA 2HMIA 4B08A 4DS5A 1JL2A 4DS4A 4DWIA 3SUQA 3NAEA 2X78A 3SQ2A 4EP5A 2P5OA 2ZQBA 3NBPA 5T7BA 1EP4A 1RTIA 5EU7A 3MEGA 3T3FA 3KTQA 4FJ5A 1QHTA 3LALA 3QINA 3NH2A 3OYHA 3ZSOA 3ISNC 4GMJB 3TAMA 2DY4A 1C1CA 3K5MA 2HW3A 1RCHA 4LY7A 3RTVA 1JLBA 4ZTJA 2E4LA 4NCAA 4Z4GA 2D0AA 5J2MA 4CJWA 4HCBA 1VSDA 3LP2A 3PUFA 4E1MA 5DMRA 4CIFA 3U6FA 1KFSA 4F8RA 3AO2A 3M8SA 2OZSA 4W5NA 3TARA 3V4IA 2PZSA 4C8OA 3NH0A 1NJZA 1TAQA 4B9UA 1JLGA 1N6QA 2DFHA 2VWKA 1BQMA 2Z1HA 5E41A 2GUIA 4AHSA 4CE9A 1HRHA 4FJ7A 3SQ0A 5SWMA 1VSHA 1FXXA 3EY1A 3QEWA 4E1NA 1SKWA 3NFAA 2OA8A 1BHLA 4JS5A 3DI6A 4CJ5A 3ZSZA 2NUBA 4O5BA 3AVGA 3LZIA 3FFIA 5I3UA 3QO9A 3ZSWA 3OYEA 3UIQA 2A1RA 2YNIA 4K8XA 4Q5VA 3AO3A 2YNGA 3IRXA 3M8QA 5JS2A 2Y1JA 3K5NA 3S3OA 4HUGA 1WSJA 4FLZA 2HVIA 4IFVA 1A5VA 4CGIA 3C94A 4LH4A 3VA0A 1L3TA 3DLBA 4FJJA 3QEVA 3NE6A 3HSTB 4I7FA 4CF9A 3NGZA 1VSIA 4M45A 1RBTA 3ULDA 1I39A 4PA1A 4CHPA 3ZSRA 2HNZA 3SPYA 3DRRA 3SQ1A 3TI0A 3CYMA 3OYMA 1QTMA 1VRTA 3F73A 1HYVA 1BISA 2XY8A 4KTWA 1LWFA 4E3SA 3KLEA 3LP3A 5KGWA 4HTUA 2HHSA 2WOMA 4DQSA 2YHAA 1S9EA 1B9DA 4CGGA 3V9ZA 2Y1IA 4FJLA 4I2PA 1GOAA 1RT3A 4IG3A 4C8NA 4N5SA 3L2QA 4AHTA 3SI6A 3OS1A 2G8VA 5KGXA 3ALYA 3K58A 3AVAA 5HBMA 4CFAA 1NK8A 1JLEA 1S6QA 1RT2A 1JKHA 1IG9A 4KHSA 2B6AA 3AVLA 3OYDA 2G8WA 1JL1A 3AVCA 2KFZA 3AVMA 4KKOA 2RF2A 4CGHA 1KVAA 4RW8A 3V9SA 4J2DA 4KTQA 1BCOA 2X6SA 3ZSVA 4KB1A 4DG1A 5HROA 4FJ9A 3PX6A 4Z4HA 3OYAA 1S9GA 3AA4A 3RMDA 1XI1A 3TWHA 4W5QA 4CF2A 3LP0A 4FM1A 5I42A 4ZTFA 4KRFA 4NCGA 3TR8A 3PX0A 4LH5A 1R0AA 3L3VA 1S1WA 2QXFA 4IKFA 4FK0A 4O0IA 2G8UA 4YFUA 3CG7A 3P5JA 3V1RA 2QKKA 1RBVA 2IAJA 3ASMA 1TK8A 1ZBLA 2DFFA 3KD1E 3VQCA 4ELUA 4OLBA 2HHTA 4EZ9A 5J1EA 2KFNA 1X9MA 4CK3A 1GOCA 1LW2A 1ASWA 4CK2A 1C6VA 1VSJA 1J5OA 3ZT3A 3ZT4A 3CFRA 3AVNA 4N41A 3TAEA 3M8RA 3MXMA 2HB5A 3D45A 4AHUA 4CK1A 4KPYA 2BGGA 1B92A 3OYLA 1VSMA 5CY4A 1KTQA 1QE1A 5K14A 1QSLA 3AVJA 4IG0A 1TK0A 3O4QA 4CJQA 3P83D 3ZSXA 1ZBFA 3VA3A 3NHGA 4FJ8A 3DLEA 4CHQA 3HVRA 3AVIA 4I9LA 3NDKA 4FJNA 3MXJA 4DTSA 3VQDA 2Q3SA 4CF8A 2VWJA 2PYLA 1K6YA 3KK3A 3RMBA 4CJVA 4FM2A 2HHWA 5JS1A 3CM6A 1WAFA 3H08A 3LWMA 1NJXA 4FVMA 1JLAA 4Z4IA 1A5WA 2YHBA 3MXIA 1JXBA 3HVTA 4ELVA 4AILC 4FW2A 1SKRA 1CZ9A 1XHZA 2RKIA 2I5JA 4RW9A 5KI6A 4RW7A 4H8KA 3V9UA 1BI4B 3VQAA 2BDPA 1GOBA 2R7YA 3V6DA 5FROA 4GVMA 3LPUA 4CJUA 4CIEA 4JS4A 2IGIA 4DQQA 3TAFA 4E0DA 4M3XA 4B3OA 3HPGA 4OGEA 1IH7A 4DTOA 4IFYA 1ASUA 1VSFA 3NH1A 3AVFA 4CJFA 1KRPA 3L3UA 4KHQA 4AHVA 1WNSA 1VSKA 2P51A 3AO1A 4BWMA 1NKEA 4CFBA 3ZT2A 1CXUA 3QNNA 4J2EA 4M3WA 4FW1A 3NGYA 4FCYA 2KW4A 3U3YA 4FZXC 5CZ1A 4CEFA 1TKTA 3A2FA 3CQ8A 5HRRA 1BGXT 4LSLA 1UA0A 4MFBA 4CJKA 3AA2A 1D9FA 5FRNA 2BE2A 4CHNA 1HQEA 4CHZA 3EZ5A 3LPTA 3QIOA 2JLEA 3QLHA 3VQ6A 4F4KA 4R5PA 1REVA 4DU3A 1EXQA 4QOZB 2FBXA 4F3OA 1YVUA 4GW6A 1BQNA 3VQ7A 3VQEA 4DTUA 3OYKA 4DTXA 4CJEA 4E7HA 4NYNA 3KLHA 1RDDA 1WLJA 4E7JA 4DTMA 1S1XA 4O4GA 2LSNA 5KRSA 4BE2A 1HNIA 2OPSA 3QESA 3KD5E 3L2WA 3VQ8A 4CGFA 3SYZA 2YKMA 1KSPA 5HRNA 4J2AA 2HVHA 5J2NA 3OJUA 4O0JA 4DFMA 2B4JA 4QCLA 4M42A 4DLEA 3C6UA 1Q9XA 4QAGA 5FDLA 4RW4A 3TABA 2OPQA 3V9WA 4NYFA 1C1BA 3VQ9A 1XHXA 4HUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNV A;  4JRQ A;  4DF4 A;  2PYJ A;  4B9T A;  1C1A A;  4KO0 A;  4Y1D A;  3C95 A;  4DTN A;  1XC9 A;  5C25 A;  3HL8 A;  1NKC A;  2XHB A;  2YNH A;  3KLI A;  4DF8 A;  2D5R A;  1A5X A;  1N5Y A;  5HLF A;  3MEC A;  3NF9 A;  3OYC A;  4CEA A;  1EKE A;  4CJL A;  3THV A;  4CGJ A;  2D0C A;  3SUP A;  4CEC A;  2O4I A;  1CXQ A;  1SL1 A;  1RDC A;  3K57 A;  3OYN A;  1ZYQ A;  3QER A;  4CED A;  1KLN A;  1TKZ A;  2G8F A;  2ETJ A;  4CGD A;  1SL0 A;  4C8K A;  4ID1 A;  4DFJ A;  4BDP A;  3K5L A;  4KTZ A;  1ITG A;  4Z4C A;  3PY8 A;  2HHV A;  1X9W A;  4CHO A;  3RR8 A;  1ZBH A;  3NGI A;  4M3U A;  5KTQ A;  1LAV A;  2QKB A;  3B6P A;  1Z26 A;  3P1G A;  3OY9 A;  5C24 A;  4DSK A;  2OPP A;  4CJ4 A;  4CIG A;  3M8P A;  1WSG A;  3JSM A;  3G0Z A;  4H4O A;  4DU4 A;  5J2Q A;  1JXE A;  4BWJ A;  4DQI A;  1BIZ A;  1ZBU A;  4CFD A;  4N56 A;  3HM9 A;  1TAU A;  4E19 A;  3F9K A;  4W5T A;  1NK4 A;  1C0M A;  1RBR A;  3O4N A;  3V1O A;  1LWE A;  1Z25 A;  1LV5 A;  3QET A;  4AH9 A;  3S3N A;  4KHU A;  1Y97 A;  4AHC A;  4CCH A;  1S1V A;  1U48 A;  4OPJ A;  4KHW A;  4BAC A;  1NK9 A;  3OYI A;  1T03 A;  1J53 A;  4E89 A;  3OYG A;  4FJK A;  5HRP A;  2HHQ A;  2WON A;  3K59 A;  1TVR A;  2FBT A;  4ZHR A;  3LZJ A;  1TK5 A;  3L2R A;  1BI4 A;  1BIU A;  3LAN A;  3EYZ A;  4CJ3 A;  1RDB A;  2DFE A;  3K5O A;  3HO1 A;  4N76 A;  4FXD A;  2D0B A;  1HMV A;  1HQU A;  3HP9 A;  1DTT A;  1FKO A;  4JRP A;  1TL1 A;  3MED A;  4M3Y A;  4DSF A;  1W9H A;  3HYF A;  3SNN A;  3ZT1 A;  4CER A;  2HHU A;  2DTU A;  4K8Z A;  1JLF A;  3AVK A;  3SUO A;  3IAY A;  3ZCM A;  1YT3 A;  1BL3 A;  1IKW A;  3DM2 A;  1NK6 A;  2HNY A;  3CFP A;  1Q9Y A;  4KI4 A;  4F3T A;  1KCF A;  1O1W A;  3WNH A;  4HCC A;  3RWU A;  1RIL A;  4IBN A;  1TKD A;  1TL3 A;  2GBZ A;  1X1P A;  3ITH A;  1UOC A;  2YV0 X;  3V81 A;  4AHR A;  4XIU A;  1JLC A;  1UWB A;  3VQ4 A;  1F21 A;  2EX3 A;  3RRH A;  4FJH A;  4KI6 A;  3HP6 A;  4Z0U A;  2W42 A;  1EX4 A;  2GV9 A;  3SZ2 A;  3OS0 A;  4FLT A;  1C0U A;  1G15 A;  3L8B A;  4FLY A;  3SUN A;  4I9Q A;  1S1T A;  1S6P A;  1VSE A;  3U3G A;  1LW0 A;  3QEI A;  4PQU A;  2X6N A;  3DOL A;  4DMN A;  1RNH A;  4BDY A;  5KRT A;  2FBV A;  1VK0 A;  2OYQ A;  2ZD1 A;  3TAN A;  3BDP A;  1EET A;  3G10 A;  4C8M A;  4CEZ A;  4HVJ A;  5D3G A;  3V9X A;  1WSF A;  3V1Q A;  2BAN A;  3AO4 A;  3NCI A;  1W0H A;  4CJS A;  2Z1I A;  3O3F A;  1IKV A;  3SJJ A;  1I3A A;  1RBU A;  1D8Y A;  1NOZ A;  3WNF A;  3VQP A;  2OZM A;  3BGR A;  3IG1 A;  3AVH A;  3SPZ A;  4NCB A;  1DLO A;  1B9F A;  3HT3 A;  1YTA A;  4CEO A;  4DTP A;  3C6T A;  2G8K A;  4HUF A;  1RDA A;  4DSE A;  4CHY A;  3AO5 A;  5CZ2 A;  4HHT A;  4FJI A;  3RR7 A;  4OKJ A;  1ZBI A;  2XO7 A;  4N47 A;  2IC3 A;  2IOC A;  4KB0 A;  2YKN A;  2JGU A;  3DLR A;  1U04 A;  3ZSQ A;  1VSL A;  4DSL A;  3B6O A;  3LAM A;  3DLG A;  4FJX A;  2XY5 A;  4OKK A;  1T05 A;  3DRP A;  1RT6 A;  4CES A;  2RPI A;  3L2V A;  1RT4 A;  1HYS A;  4IDK A;  4YNQ A;  1L3U A;  4B9N A;  1J9A A;  4B9V A;  4OGC A;  1HYZ A;  2QK9 A;  3T19 A;  4I2Q A;  4FYD A;  4FM0 A;  1RTJ A;  3AVB A;  4RW6 A;  5C42 A;  3O3H A;  4Z4F A;  4TSX A;  4B8C A;  4W5R A;  1NJW A;  5FRM A;  4PWD A;  3AA5 X;  4DTJ A;  3PV8 A;  1C0T A;  2KZZ A;  2PY5 A;  4FZZ A;  3PX4 A;  3IS9 A;  2P5G A;  1SV5 A;  1NK0 A;  2F8S A;  4OLA A;  2HND A;  1J54 A;  3LP1 A;  3VQ5 A;  4LSN A;  4MQ3 A;  3KLG A;  4FLX A;  4DQP A;  4F2S A;  3D0P A;  4FK4 A;  1UAX A;  4M3R A;  2F8T A;  3KLF A;  2Z1J A;  4DTR A;  2XY7 A;  3DRS A;  4PUO A;  3LAK A;  3QIP A;  3KK1 A;  3OYF A;  4O44 A;  1IKX A;  4FLV A;  3S9H A;  3NF6 A;  4DLG A;  2XY6 A;  5HRS A;  3PO4 A;  4CFC A;  2Z1G A;  2IDO A;  3MEE A;  5J2P A;  3CFO A;  1WN7 A;  3NF8 A;  1RTH A;  4G1Q A;  4CEQ A;  3SV3 A;  1HJR A;  3QEX A;  1SKS A;  4EZ6 A;  4FJG A;  3E01 A;  4FK2 A;  2XRI A;  1KVB A;  3DMJ A;  2FC0 A;  4DU1 A;  3OS2 A;  1NKB A;  2IS3 A;  4W5O A;  4O55 A;  1KFD A;  3DYA A;  4ID5 A;  1L5U A;  4KV8 A;  1QSS A;  4F2R A;  1VRU A;  1YTU A;  3AV9 A;  4DQR A;  4B9M A;  2ZE2 A;  3QNO A;  4CF0 A;  3MAQ A;  1U45 A;  2X74 A;  1RT5 A;  4DSJ A;  4J2B A;  3LWL A;  1JLQ A;  1QSY A;  4RG8 A;  3AA3 A;  3S3M A;  3HPH A;  4M41 A;  2P1J A;  4Q0B A;  1U49 A;  2KZM A;  1TGO A;  2KQ2 A;  2VG6 A;  4OJR A;  1BCM A;  3TAP A;  3RMC A;  1RT7 A;  3CM5 A;  4CJT A;  3JYT A;  4PY5 A;  4B9S A;  4LD0 A;  2YNF A;  4FZY A;  2F96 A;  3SCX A;  5CYM A;  3I0S A;  3WNG A;  1HPZ A;  4BDZ A;  3SQ4 A;  4KHY A;  5HP1 A;  4KHN A;  1NK5 A;  3RMA A;  1RBS A;  4E7K A;  3DLK A;  2ATQ A;  4DFP A;  2VG5 A;  4BE1 A;  1NJY A;  4C8L A;  4UQG A;  1MU2 A;  1QQC A;  4Y1C A;  4BE0 A;  4ELT A;  4FJM A;  1Q8I A;  4DFK A;  1U47 A;  3ZT0 A;  4ICL A;  4CEE A;  3HJF A;  2RN2 A;  4CJP A;  3OYB A;  1QS4 A;  3VN5 A;  3TAQ A;  3L2U A;  1D5A A;  3I0R A;  4FLU A;  2G8H A;  4KAZ A;  1RT1 A;  3RRG A;  4CEB A;  2EHG A;  3LDS A;  1IO2 A;  2G8I A;  2FBY A;  3HPO A;  2O4G A;  1UA1 A;  1LAW A;  4M3T A;  3DLH A;  3SV4 A;  3DOK A;  4L8R B;  1KLM A;  5DK5 A;  1X9S A;  3VQQ A;  1S5J A;  2B5J A;  3OYJ A;  4H4M A;  2HHX A;  1WSE A;  1DTQ A;  1XWL A;  3HK2 A;  2OPR A;  2KTQ A;  1D9D A;  3KKS A;  1FKP A;  1WAJ A;  2A1S A;  1NOY A;  1FK9 A;  4B8A B;  1TV6 A;  2AJQ A;  4KRE A;  1TKX A;  1L3S A;  4OPK A;  4E7L A;  4M3Z A;  1T7P A;  3KIO A;  1S1U A;  3WNE A;  2E6L A;  4CF1 A;  1L3V A;  1WSH A;  1T8E A;  4OKE A;  4Z4E A;  3ZSY A;  5CYQ A;  1SUQ A;  4DSI A;  4JLH A;  4WE1 A;  3KKR A;  2VG7 A;  3OVN A;  1CLQ A;  1IKY A;  3KJV A;  3HXM A;  1KVC A;  3O3G A;  1SL2 A;  1ASV A;  4OVL A;  3T1A A;  3TAG A;  2ITG A;  3I8D A;  4EP4 A;  3VQB A;  5SZT A;  3NF7 A;  2E6M A;  1WSI A;  4B9L A;  1CZB A;  4KFB A;  1U4B A;  1NK7 A;  3QEP A;  3PO5 A;  1RTD A;  1LWC A;  3K2P A;  4CJR A;  4E7I A;  3OJS A;  3KK2 A;  4FLW A;  2HMI A;  4B08 A;  4DS5 A;  1JL2 A;  4DS4 A;  4DWI A;  3SUQ A;  3NAE A;  2X78 A;  3SQ2 A;  4EP5 A;  2P5O A;  2ZQB A;  3NBP A;  5T7B A;  1EP4 A;  1RTI A;  5EU7 A;  3MEG A;  3T3F A;  3KTQ A;  4FJ5 A;  1QHT A;  3LAL A;  3QIN A;  3NH2 A;  3OYH A;  3ZSO A;  3ISN C;  4GMJ B;  3TAM A;  2DY4 A;  1C1C A;  3K5M A;  2HW3 A;  1RCH A;  4LY7 A;  3RTV A;  1JLB A;  4ZTJ A;  2E4L A;  4NCA A;  4Z4G A;  2D0A A;  5J2M A;  4CJW A;  4HCB A;  1VSD A;  3LP2 A;  3PUF A;  4E1M A;  5DMR A;  4CIF A;  3U6F A;  1KFS A;  4F8R A;  3AO2 A;  3M8S A;  2OZS A;  4W5N A;  3TAR A;  3V4I A;  2PZS A;  4C8O A;  3NH0 A;  1NJZ A;  1TAQ A;  4B9U A;  1JLG A;  1N6Q A;  2DFH A;  2VWK A;  1BQM A;  2Z1H A;  5E41 A;  2GUI A;  4AHS A;  4CE9 A;  1HRH A;  4FJ7 A;  3SQ0 A;  5SWM A;  1VSH A;  1FXX A;  3EY1 A;  3QEW A;  4E1N A;  1SKW A;  3NFA A;  2OA8 A;  1BHL A;  4JS5 A;  3DI6 A;  4CJ5 A;  3ZSZ A;  2NUB A;  4O5B A;  3AVG A;  3LZI A;  3FFI A;  5I3U A;  3QO9 A;  3ZSW A;  3OYE A;  3UIQ A;  2A1R A;  2YNI A;  4K8X A;  4Q5V A;  3AO3 A;  2YNG A;  3IRX A;  3M8Q A;  5JS2 A;  2Y1J A;  3K5N A;  3S3O A;  4HUG A;  1WSJ A;  4FLZ A;  2HVI A;  4IFV A;  1A5V A;  4CGI A;  3C94 A;  4LH4 A;  3VA0 A;  1L3T A;  3DLB A;  4FJJ A;  3QEV A;  3NE6 A;  3HST B;  4I7F A;  4CF9 A;  3NGZ A;  1VSI A;  4M45 A;  1RBT A;  3ULD A;  1I39 A;  4PA1 A;  4CHP A;  3ZSR A;  2HNZ A;  3SPY A;  3DRR A;  3SQ1 A;  3TI0 A;  3CYM A;  3OYM A;  1QTM A;  1VRT A;  3F73 A;  1HYV A;  1BIS A;  2XY8 A;  4KTW A;  1LWF A;  4E3S A;  3KLE A;  3LP3 A;  5KGW A;  4HTU A;  2HHS A;  2WOM A;  4DQS A;  2YHA A;  1S9E A;  1B9D A;  4CGG A;  3V9Z A;  2Y1I A;  4FJL A;  4I2P A;  1GOA A;  1RT3 A;  4IG3 A;  4C8N A;  4N5S A;  3L2Q A;  4AHT A;  3SI6 A;  3OS1 A;  2G8V A;  5KGX A;  3ALY A;  3K58 A;  3AVA A;  5HBM A;  4CFA A;  1NK8 A;  1JLE A;  1S6Q A;  1RT2 A;  1JKH A;  1IG9 A;  4KHS A;  2B6A A;  3AVL A;  3OYD A;  2G8W A;  1JL1 A;  3AVC A;  2KFZ A;  3AVM A;  4KKO A;  2RF2 A;  4CGH A;  1KVA A;  4RW8 A;  3V9S A;  4J2D A;  4KTQ A;  1BCO A;  2X6S A;  3ZSV A;  4KB1 A;  4DG1 A;  5HRO A;  4FJ9 A;  3PX6 A;  4Z4H A;  3OYA A;  1S9G A;  3AA4 A;  3RMD A;  1XI1 A;  3TWH A;  4W5Q A;  4CF2 A;  3LP0 A;  4FM1 A;  5I42 A;  4ZTF A;  4KRF A;  4NCG A;  3TR8 A;  3PX0 A;  4LH5 A;  1R0A A;  3L3V A;  1S1W A;  2QXF A;  4IKF A;  4FK0 A;  4O0I A;  2G8U A;  4YFU A;  3CG7 A;  3P5J A;  3V1R A;  2QKK A;  1RBV A;  2IAJ A;  3ASM A;  1TK8 A;  1ZBL A;  2DFF A;  3KD1 E;  3VQC A;  4ELU A;  4OLB A;  2HHT A;  4EZ9 A;  5J1E A;  2KFN A;  1X9M A;  4CK3 A;  1GOC A;  1LW2 A;  1ASW A;  4CK2 A;  1C6V A;  1VSJ A;  1J5O A;  3ZT3 A;  3ZT4 A;  3CFR A;  3AVN A;  4N41 A;  3TAE A;  3M8R A;  3MXM A;  2HB5 A;  3D45 A;  4AHU A;  4CK1 A;  4KPY A;  2BGG A;  1B92 A;  3OYL A;  1VSM A;  5CY4 A;  1KTQ A;  1QE1 A;  5K14 A;  1QSL A;  3AVJ A;  4IG0 A;  1TK0 A;  3O4Q A;  4CJQ A;  3P83 D;  3ZSX A;  1ZBF A;  3VA3 A;  3NHG A;  4FJ8 A;  3DLE A;  4CHQ A;  3HVR A;  3AVI A;  4I9L A;  3NDK A;  4FJN A;  3MXJ A;  4DTS A;  3VQD A;  2Q3S A;  4CF8 A;  2VWJ A;  2PYL A;  1K6Y A;  3KK3 A;  3RMB A;  4CJV A;  4FM2 A;  2HHW A;  5JS1 A;  3CM6 A;  1WAF A;  3H08 A;  3LWM A;  1NJX A;  4FVM A;  1JLA A;  4Z4I A;  1A5W A;  2YHB A;  3MXI A;  1JXB A;  3HVT A;  4ELV A;  4AIL C;  4FW2 A;  1SKR A;  1CZ9 A;  1XHZ A;  2RKI A;  2I5J A;  4RW9 A;  5KI6 A;  4RW7 A;  4H8K A;  3V9U A;  1BI4 B;  3VQA A;  2BDP A;  1GOB A;  2R7Y A;  3V6D A;  5FRO A;  4GVM A;  3LPU A;  4CJU A;  4CIE A;  4JS4 A;  2IGI A;  4DQQ A;  3TAF A;  4E0D A;  4M3X A;  4B3O A;  3HPG A;  4OGE A;  1IH7 A;  4DTO A;  4IFY A;  1ASU A;  1VSF A;  3NH1 A;  3AVF A;  4CJF A;  1KRP A;  3L3U A;  4KHQ A;  4AHV A;  1WNS A;  1VSK A;  2P51 A;  3AO1 A;  4BWM A;  1NKE A;  4CFB A;  3ZT2 A;  1CXU A;  3QNN A;  4J2E A;  4M3W A;  4FW1 A;  3NGY A;  4FCY A;  2KW4 A;  3U3Y A;  4FZX C;  5CZ1 A;  4CEF A;  1TKT A;  3A2F A;  3CQ8 A;  5HRR A;  1BGX T;  4LSL A;  1UA0 A;  4MFB A;  4CJK A;  3AA2 A;  1D9F A;  5FRN A;  2BE2 A;  4CHN A;  1HQE A;  4CHZ A;  3EZ5 A;  3LPT A;  3QIO A;  2JLE A;  3QLH A;  3VQ6 A;  4F4K A;  4R5P A;  1REV A;  4DU3 A;  1EXQ A;  4QOZ B;  2FBX A;  4F3O A;  1YVU A;  4GW6 A;  1BQN A;  3VQ7 A;  3VQE A;  4DTU A;  3OYK A;  4DTX A;  4CJE A;  4E7H A;  4NYN A;  3KLH A;  1RDD A;  1WLJ A;  4E7J A;  4DTM A;  1S1X A;  4O4G A;  2LSN A;  5KRS A;  4BE2 A;  1HNI A;  2OPS A;  3QES A;  3KD5 E;  3L2W A;  3VQ8 A;  4CGF A;  3SYZ A;  2YKM A;  1KSP A;  5HRN A;  4J2A A;  2HVH A;  5J2N A;  3OJU A;  4O0J A;  4DFM A;  2B4J A;  4QCL A;  4M42 A;  4DLE A;  3C6U A;  1Q9X A;  4QAG A;  5FDL A;  4RW4 A;  3TAB A;  2OPQ A;  3V9W A;  4NYF A;  1C1B A;  3VQ9 A;  1XHX A;  4HUE A; 
#chains in the Genus database with same CATH topology
 2P9K B;  4PL8 A;  4DF4 A;  2PYJ A;  3CCR N;  4YOX A;  1C1A A;  2PBD A;  4KO0 A;  4Y1D A;  3IKM A;  3DWL A;  1NKC A;  3KLI A;  3GBT A;  5HLF A;  3NF9 A;  3OYC A;  4KHP K;  2D0C A;  4PHT X;  5AQF A;  4CVN E;  1KLN A;  2ETJ A;  4CGD A;  1SL0 A;  1N34 K;  3P31 A;  4RCH A;  1ITG A;  3PY8 A;  2O8C B;  4CHO A;  2GUP A;  5KTQ A;  5C0Y A;  3B6P A;  3OY9 A;  4DSK A;  4CIG A;  1WSG A;  3G0Z A;  1JXE A;  1ATR A;  2VGM A;  1ZBU A;  1ILY A;  2A42 A;  4JEP A;  1LV5 A;  3S3N A;  1Y97 A;  3A5N C;  4CCH A;  1U48 A;  1YF5 L;  3OYI A;  3CCU N;  1T03 A;  4E89 A;  3MN9 A;  2HHQ A;  2WON A;  4PKH A;  3K59 A;  1TVR A;  4DB3 A;  1TK5 A;  3VEY A;  3L2R A;  1BIU A;  3LAN A;  3EYZ A;  3K5O A;  3ZX2 A;  3L0Q A;  2UU9 K;  3O5B A;  4WFB L;  4M3Y A;  3LDL A;  2YJF A;  1YT3 A;  4X65 K;  4L3Q A;  4YY3 K;  3CFP A;  1ATN A;  4I6M A;  4IOA L;  2PAV A;  3UKR A;  3A8Y A;  2BH1 A;  3ITH A;  1UOC A;  4XIU A;  3VQ4 A;  1F21 A;  3HP6 A;  2W42 A;  1H1V A;  4GY2 B;  2W41 A;  1G15 A;  3D2F A;  3L8B A;  3SUN A;  1GLC G;  4I9Q A;  1P90 A;  2X6N A;  4DMN A;  4LFA K;  3EZW A;  3BDP A;  4C8M A;  4CEZ A;  1BA1 A;  1WSF A;  3AO4 A;  4K0K K;  3G25 A;  2ZM6 K;  2NRT A;  3IG1 A;  3THX B;  1DLO A;  1B9F A;  1YTA A;  4DTP A;  2QW9 A;  4JI1 K;  4DSE A;  2YJE A;  2JWL A;  1HX1 A;  4FJI A;  1ZBI A;  4N47 A;  3C6H A;  2YHY A;  3NVK A;  2IOC A;  5LMN K;  4KB0 A;  1VSL A;  4H5W A;  3VER A;  2Q31 A;  3DLG A;  4GV3 A;  1JCG A;  4OKK A;  1K8K B;  3W3D A;  3L2V A;  1RT4 A;  1XUP O;  4YNQ A;  3HOS A;  2QK9 A;  4FM0 A;  4B8C A;  5JMV A;  4Y0W A;  1NJW A;  5HL7 L;  4A2A A;  4BRM A;  2PY5 A;  4FZZ A;  1HLU A;  1SV5 A;  1NK0 A;  4DV4 K;  3VES A;  3ID6 A;  3VQ5 A;  4HTL A;  4F2S A;  2QI2 A;  4M3R A;  2XY7 A;  3AGR A;  3UKU A;  3CJB A;  5H1S Q;  1VQP N;  3OTO K;  3CPW M;  3MEE A;  5KPR A;  3CFO A;  3L6Q A;  3QEX A;  3ZET A;  4CBU A;  3JXU A;  4FK2 A;  2XRI A;  1KVB A;  3DMJ A;  1NKB A;  4KV8 A;  5AQN A;  4DUZ K;  3ENB A;  3M5R A;  3VTH A;  1RT5 A;  4DSJ A;  3LWL A;  1IV0 A;  1QSY A;  2F9T A;  4CZM A;  4WQ4 A;  2KZM A;  5BRE A;  4OJR A;  3TAP A;  4JD2 A;  2O8E A;  2CGL A;  5ELZ A;  3KK7 A;  4ISG A;  3R3L A;  4B9S A;  1NGE A;  4LD0 A;  2WC9 A;  3LDN A;  5CYM A;  3EKU A;  4KHY A;  5HP1 A;  4QS7 A;  3RMA A;  4E7K A;  4DFP A;  2VG5 A;  4BE1 A;  5BN9 A;  4A57 A;  4C8L A;  2A40 A;  5BRD A;  1U47 A;  4CEE A;  2RN2 A;  3C7N B;  4H5V A;  5AQH A;  4CJP A;  2D1K A;  1GLD G;  3L2U A;  1D5A A;  2CGK A;  4KAZ A;  4BRA A;  1RT1 A;  3RRG A;  2EHG A;  4R79 A;  3VET A;  3OW2 M;  1WB9 A;  5AQG A;  2IVP A;  2O4G A;  1UA1 A;  3DLH A;  3DOK A;  1X9S A;  1S5J A;  3OYJ A;  3G6E N;  1WSE A;  3EL2 A;  4X66 K;  1D9D A;  1FKP A;  2YCH A;  4B8A B;  2NRZ A;  1TV6 A;  3R9P A;  1VQ8 N;  1TKX A;  1L3S A;  4E7L A;  3KIO A;  4FWQ A;  1WSH A;  4JKC A;  4Z4E A;  1SUQ A;  4FO0 A;  4JLH A;  4CBW A;  3O9S A;  3KKR A;  1CLQ A;  3HXM A;  4JKD A;  2ITG A;  5SZT A;  2V7Z A;  4Z94 A;  4B9L A;  1WSI A;  3MK6 A;  4LFC K;  5DM7 L;  4NCA A;  1RTD A;  2HMI A;  3KK2 A;  3GE1 A;  4DS5 A;  4DS4 A;  1GLB G;  3NAE A;  4GKJ K;  4AQY K;  2P5O A;  2WBN A;  2HMP A;  4JHD B;  4FJ5 A;  2P9K A;  4CBX A;  2HBK A;  1QHT A;  4BQL A;  3QIN A;  3OYH A;  3MCP A;  3QFU A;  3TAM A;  2DY4 A;  3WXL A;  1C1C A;  1RCH A;  3FZH A;  4FWR A;  1T6D A;  4H5N A;  2D0A A;  3PUF A;  3AO2 A;  2PZS A;  3NH0 A;  4B9U A;  1TAQ A;  1N33 K;  2DFH A;  5TKY A;  4A2B A;  2GUI A;  4DV2 K;  1NG9 A;  3SQ0 A;  5SWM A;  1EO1 A;  1BHL A;  3DI6 A;  3P38 A;  4O5B A;  3LZI A;  3AVG A;  3QO9 A;  3E9L A;  2ZWH A;  2A1R A;  3H3O B;  4Q5V A;  2Y1J A;  1NLV A;  4A62 A;  1A5V A;  3R6M A;  3CXC M;  1OVY A;  4H0Y B;  1RBT A;  1MA9 B;  3J8A A;  3SPY A;  3DRR A;  3TI0 A;  4DV0 K;  2ASP A;  1QTM A;  1MWK A;  4KTW A;  1BUP A;  3D6R A;  4HTU A;  2HHS A;  4CGG A;  3V9Z A;  3U8X A;  4FJL A;  4IG3 A;  4GNI A;  4AHT A;  1ATS A;  3SBT A;  3K58 A;  1TUY A;  1JLE A;  1S6Q A;  1ZC6 A;  5AZJ B;  3O80 A;  2B6A A;  4JI8 K;  3O9R A;  4MO4 A;  3OBY A;  1IBM K;  2RF2 A;  2Q97 A;  4ILH A;  3FZM A;  3OYA A;  1S9G A;  3AA4 A;  4W5Q A;  4NCG A;  1R0A A;  2QXF A;  4IKF A;  3ENH A;  2G8U A;  1RBV A;  1QQO A;  4EIA A;  3CCM N;  2DFF A;  3SK3 A;  3VQC A;  4ELU A;  1IJJ A;  1KAY A;  4CK2 A;  1C6V A;  3AVN A;  3IUC A;  3D45 A;  2AA4 A;  2A3Z A;  1C0F A;  5AQP A;  3O4W A;  4NXM K;  2WTU A;  3Q7B A;  5CY4 A;  2NLX A;  4M7X A;  1YJ9 N;  1QSL A;  1TK0 A;  4IG0 A;  4CJQ A;  1ZBF A;  3DLE A;  1GLJ O;  3HVR A;  2FSN A;  3VEN A;  5IT9 O;  2PYL A;  4DTS A;  2Q3S A;  5M1P A;  5AQW A;  4FM2 A;  2HHW A;  3H08 A;  3LWM A;  1VQN N;  4CZK A;  3O1W A;  2FF3 B;  2YHB A;  3HVT A;  4ELV A;  4AIL C;  1CZ9 A;  5KI6 A;  2CH5 A;  1ESV A;  4LF9 K;  4BG8 A;  3V6D A;  5FRO A;  4DQQ A;  2P9N A;  5FPM A;  4H0P A;  3VGM A;  5CE3 A;  4DTO A;  1VSF A;  4CJF A;  3FE1 A;  3L3U A;  1WNS A;  2P51 A;  1CXU A;  3QNN A;  3J7Z O;  4FW1 A;  3BZC A;  2KW4 A;  4I6M B;  4CEF A;  1TKT A;  3QBW A;  4A59 A;  2CH6 A;  4MFB A;  4CJK A;  3AA2 A;  4LF6 K;  3EZ5 A;  3QLH A;  4F4K A;  1N8R O;  4GVE A;  1WBD A;  1REV A;  1HNX K;  4JI3 K;  3D2F B;  4DTM A;  1WLJ A;  4O4G A;  4XH4 A;  2LSN A;  1W2B M;  1HNI A;  2OPS A;  1OH8 A;  3VQ8 A;  4CGF A;  3SYZ A;  2YKM A;  1KSP A;  5HRN A;  2FXU A;  3AAP A;  5J2N A;  3TSU A;  2HF3 A;  1Q9X A;  3MX2 A;  5C2F A;  1EWQ A;  1C1B A;  1HNV A;  4BRO A;  4QS8 A;  4IJN A;  3C95 A;  5C25 A;  4J8F A;  5BR8 K;  1N5Y A;  2QWP A;  3MEC A;  3E9O A;  5AQZ A;  4CEA A;  3THV A;  2O8F A;  2FSK A;  5GAG P;  2O4I A;  1CXQ A;  1RDC A;  3K57 A;  3MCA B;  3QER A;  5TKW A;  1TKZ A;  3TTF A;  1NGG A;  2ZGY A;  2HBL A;  4JK9 A;  5FLX O;  4BDP A;  4Z4C A;  3CC2 N;  1X9W A;  1ZBH A;  1VHX A;  4M7Y A;  4B1Z A;  2QKB A;  1ZBS A;  1LAV A;  3WXK A;  1YXQ A;  3P1G A;  5C24 A;  3HRG A;  4CJ4 A;  4OX9 K;  1NM1 A;  3JSM A;  4DU4 A;  5J2Q A;  4BWJ A;  4K43 A;  4CFD A;  3UKU B;  4E19 A;  3F9K A;  4W5T A;  1NK4 A;  1C0M A;  3V1O A;  1LWE A;  1Z25 A;  3VEX A;  1NK9 A;  3ZET B;  4FJK A;  2NRX A;  2QXL A;  3OYG A;  5HRP A;  4ZHR A;  3LZJ A;  4B1U B;  1BI4 A;  5BR9 A;  2FF6 A;  1RDB A;  2DFE A;  4CJ3 A;  3HO1 A;  4N76 A;  4FXD A;  2D0B A;  2VQF K;  3HP9 A;  4MLH A;  3HYF A;  3SNN A;  2HHU A;  5LJW A;  5AQO A;  3AVK A;  4OPA A;  1BL3 A;  4JD2 B;  2HNY A;  4F3T A;  1O1W A;  3WNH A;  4HCC A;  4BR2 A;  3ENO A;  3CQX A;  1RIL A;  1TKD A;  2YV0 X;  1UWB A;  5JVG L;  4FJH A;  3IFR A;  3GG4 A;  2GV9 A;  5JVH L;  4FLT A;  4FLY A;  1S1T A;  1NGA A;  1VSE A;  2GX9 A;  3ZX3 A;  4PQU A;  4YDU A;  3TAN A;  1EET A;  3FZF A;  3V9X A;  1ZXO A;  3NCI A;  1W0H A;  2ZF5 O;  1HPM A;  3O3F A;  3T7Z A;  3SJJ A;  1GLL O;  1I3A A;  4DR4 K;  1RBU A;  4JI7 K;  2OZM A;  3L4I A;  2OAN A;  3G71 N;  3C6T A;  2G8K A;  1O13 A;  1OKJ A;  3AO5 A;  2OCE A;  2IC3 A;  2QM1 A;  3CI5 A;  2YKN A;  4BRD A;  3DLR A;  5EX5 A;  5AR0 A;  1QVG M;  3B6O A;  4FWK A;  3OBW A;  1XMO K;  1RT6 A;  4CES A;  1HYS A;  5BRF A;  3O08 A;  5KQ8 A;  4OGC A;  2HHV A;  4FYD A;  4Z4F A;  4RW6 A;  1G99 A;  4TSX A;  5FRM A;  3FGU A;  3AA5 X;  1C0T A;  4MLE A;  3IS9 A;  3HBT A;  3PX4 A;  2P5G A;  5GAE P;  2F8S A;  1NGD A;  3LP1 A;  1Q18 A;  3D0P A;  3DRS A;  3OYF A;  4O44 A;  1IKX A;  4DHY A;  3S9H A;  3NF6 A;  2XY6 A;  1M1K O;  2IDO A;  3NF8 A;  4CEQ A;  1HJR A;  1SKS A;  4BY9 C;  4IEE A;  4O55 A;  1L5U A;  2QWR A;  3AV9 A;  4NLC A;  4DQR A;  3A5L C;  3MAQ A;  2X74 A;  3L4Q A;  5E26 A;  1X9J A;  1SZ2 A;  4RG8 A;  1OH6 A;  1KAZ A;  3HPH A;  4IO8 A;  4H5T A;  4M41 A;  4U67 L;  1FW6 A;  3J7Y P;  2VGN A;  2KQ2 A;  3WXM B;  4YHH K;  1YJN N;  1BCM A;  3RMC A;  1RT7 A;  4WQ5 C;  4YOV A;  4CJT A;  4X64 K;  3WQU A;  2F96 A;  4FZY A;  2NNW A;  3H1Q A;  3DXK A;  4IEI A;  4KHN A;  3VTI A;  2ATQ A;  2E2P A;  1NJY A;  4NXN K;  4Y1C A;  4BE0 A;  4FJM A;  3HJF A;  3TAQ A;  1QQM A;  3H6E A;  3CF5 L;  2UXD K;  3LM2 A;  2E20 A;  3D2E A;  1LAW A;  4H0T B;  4L8R B;  1GLF O;  2P9I A;  2B5J A;  5FPN A;  4H4M A;  3MN5 A;  1DTQ A;  2E5L K;  3HK2 A;  1N32 K;  2KTQ A;  2WUS A;  1HNW K;  1FK9 A;  2AJQ A;  4OPK A;  4M3Z A;  3CIP A;  3OA9 A;  3PSF A;  1L3V A;  3ZSY A;  3OVN A;  1IKY A;  4XH1 A;  4A5B A;  1S3X A;  4OPH A;  4EP4 A;  1CZB A;  1U4B A;  1LWC A;  3K2P A;  4CJR A;  3OJS A;  4FLW A;  3SAF A;  4X62 K;  3FR0 A;  1R59 O;  1W97 L;  5EU7 A;  3MEG A;  1S22 A;  3T3F A;  2WFB A;  3I8B A;  4LF8 K;  3ISN C;  4FWO A;  5AQM A;  4O8K A;  4B1X B;  3K5M A;  2HW3 A;  4LC9 B;  4NLB A;  3VOV A;  2E4L A;  4Z4G A;  2P9L A;  5DMR A;  4CIF A;  3U6F A;  1W7A A;  2D0O A;  4FWN A;  1NJZ A;  1JLG A;  1YHQ N;  2VWK A;  1NGF A;  2Z1H A;  3R1X A;  1YVN A;  5IWA K;  4JI5 K;  2E2N A;  2NRW A;  4XH5 A;  2A41 A;  1SKW A;  3QEW A;  5AQX A;  3RSE A;  3EO3 A;  4JS5 A;  4GKK K;  4B3S K;  3FFI A;  3ZSW A;  1K73 O;  4JAX A;  3BP8 A;  2P9N B;  3VF2 A;  2YNG A;  5JS2 A;  4HUG A;  1WSJ A;  4IFV A;  2GEL A;  4LH4 A;  3DLB A;  4B1Y B;  4FJJ A;  1BOT O;  3SAG A;  2EWS A;  4M45 A;  2IVO A;  4PA1 A;  2HNZ A;  1VQ9 N;  2ZJQ L;  3KLE A;  3LP3 A;  1YI2 N;  1IBL K;  2WOM A;  4DQS A;  1S9E A;  1B9D A;  1HNZ K;  4I2P A;  1GOA A;  4N5S A;  3K0S A;  1NGI A;  3SI6 A;  2G8V A;  5AQI A;  1NK8 A;  5AQJ A;  3HOT A;  4CW7 B;  5EY4 A;  1JL1 A;  4WYB A;  3AVM A;  4B3M K;  2Q0U A;  4CGH A;  1KVA A;  4RW8 A;  3V9S A;  4J2D A;  3U9Z A;  1QHA A;  1BDG A;  4DG1 A;  3VGK A;  2QWL A;  4ILJ A;  4Z4H A;  4C1N I;  3RMD A;  5LMU K;  5GIP A;  3WXI A;  2P9P A;  3LP0 A;  4FM1 A;  2IIR A;  4JK7 A;  5I42 A;  4BVO A;  2Q1N A;  2HST A;  3PX0 A;  4LH5 A;  4FK0 A;  4O0I A;  4YFU A;  3P5J A;  3O9Q A;  1WBB A;  2O8F B;  3KD1 E;  4EZ9 A;  1KD1 O;  1X9M A;  3DLL L;  1VSJ A;  4O8U A;  3M8R A;  4CK1 A;  4AHU A;  3VPZ A;  4KPY A;  4JV5 K;  3K9K A;  3OYL A;  1VSM A;  2KHO A;  5K14 A;  2F4V K;  2GWJ A;  3VF6 A;  3WUH A;  3AVJ A;  3SBG A;  3VA3 A;  3ZSX A;  1YIT N;  3GOI A;  3GL1 A;  4I9L A;  3NDK A;  3O9U A;  4FJN A;  3CD6 N;  3CCV N;  4CF8 A;  2VWJ A;  2OTJ N;  4B1W B;  2NRH A;  1JLA A;  4RTF D;  4UY8 O;  3MXI A;  2ITM A;  3I33 A;  2I5J A;  1Q86 O;  1BI4 B;  3VQA A;  4FOI A;  4YOR A;  3LPU A;  4BVP A;  4JS4 A;  3HPG A;  4OGE A;  1Q81 O;  4LF5 K;  1QQN A;  1IH7 A;  4DV1 K;  5AQR A;  1KRP A;  4KHQ A;  1VSK A;  4DQ8 A;  3NGY A;  4BQZ A;  4ILG B;  1UA0 A;  4LSL A;  4LF4 K;  5LY3 A;  1HQE A;  2O8B A;  3VQ6 A;  4DU3 A;  4QOZ B;  2FBX A;  1MWM A;  2YHX A;  1BQN A;  4JKH A;  3KLH A;  2QWO A;  3CCS N;  3HTV A;  3KZB A;  2QWM A;  4QCL A;  4O0J A;  2B4J A;  1VQM N;  4QAG A;  1VQO N;  5FDL A;  1Y64 A;  2OPQ A;  4ISE A;  4NYF A;  3VQ9 A;  2BUP A;  2Q36 A;  2ZJP L;  4EAH D;  4HUE A;  4DCH A;  2VQE K;  4JRQ A;  2FLO A;  4DR3 K;  4DTN A;  1XC9 A;  1WOQ A;  2XHB A;  3E66 A;  1A5X A;  3UE5 A;  3TTC A;  4CJL A;  4CGJ A;  4DUY K;  1HKB A;  2V7Y A;  5AQL A;  1GLE G;  1BG3 A;  1ZYQ A;  3QIC A;  4CED A;  3QBX A;  4C8K A;  4ID1 A;  4DFJ A;  3MMV A;  3RR8 A;  4M3U A;  3NMU A;  4LF7 K;  2OPP A;  1IBK K;  2PFU A;  3M8P A;  2UUC K;  2A5X A;  4H4O A;  4FWS A;  4DQI A;  4FOE A;  3G4S N;  1BIZ A;  5AFU A;  2KKZ A;  4DV7 K;  4BC5 A;  4N56 A;  3O4N A;  3QET A;  4AH9 A;  2NZT A;  4OPJ A;  4KHW A;  4BAC A;  4MDA A;  1Q7Y O;  1NMD A;  4CZG A;  2FBT A;  3TU5 A;  1SAZ A;  3QDK A;  2QA4 N;  1GLA G;  1QZ6 A;  1DT9 A;  3I55 N;  1FKO A;  3CER A;  4JRP A;  2IVN A;  3NVM A;  3ZT1 A;  4CER A;  2DTU A;  3SUO A;  1OH7 A;  3IAY A;  1TYQ A;  4K25 A;  1NK6 A;  1Q9Y A;  4KI4 A;  1RDU A;  1KCF A;  1T6C A;  3HZ6 A;  2GBZ A;  3DXK B;  3V81 A;  4AHR A;  1OH5 A;  3VGL A;  4Z0U A;  3SZ2 A;  1EX4 A;  4CJ7 A;  3OS0 A;  3BY5 A;  5BPL A;  4IOX A;  4JI6 K;  1X3N A;  4JKE A;  1RGI A;  3PLA A;  1S6P A;  3U3G A;  2E1Z A;  5KRT A;  2FBV A;  3LM9 A;  2ZD1 A;  2HHH K;  3Q7C A;  1NWK A;  3D2E B;  4K41 A;  3CJ7 A;  3QML A;  4CJS A;  2Z1I A;  1C0G A;  2P9I B;  1T44 A;  4CZF A;  4CZH A;  1NOZ A;  3WNF A;  5DM6 L;  2RE2 A;  4CEO A;  1XNR K;  4HUF A;  1RDA A;  5EXW A;  5CZ2 A;  3RR7 A;  4OKJ A;  2XO7 A;  2ZJR L;  3ZSQ A;  4KBO A;  3LAM A;  4DKW A;  4AF1 A;  2XY5 A;  3CET A;  3DRP A;  4JKA A;  1L3U A;  5AJ3 K;  2ASO A;  4B9N A;  4B9V A;  1HYZ A;  3T19 A;  4I2Q A;  3O3H A;  3AVB A;  2KZZ A;  4PWD A;  1BA0 A;  1NGH A;  3PIO L;  3CQY A;  4BC3 A;  1BO5 O;  2HND A;  1J54 A;  4FLX A;  4FK4 A;  4MQ3 A;  2F8T A;  3H1V X;  2Z1J A;  4PUO A;  1VQ5 N;  5EOY A;  3KK1 A;  3PO4 A;  3SMS A;  4CFC A;  3BF1 A;  2V51 B;  2P9L B;  5J2P A;  3SV3 A;  4FJG A;  3E01 A;  2FC0 A;  2IS3 A;  5M1N A;  4W5O A;  4ID5 A;  4F2R A;  1QSS A;  1YTU A;  4LFB K;  4B9M A;  4YOU A;  2GEM A;  2ZE2 A;  4CF0 A;  3BEX A;  3QNO A;  1U45 A;  4YOY A;  4K42 A;  3BF3 A;  3RSE B;  1JLQ A;  4KH4 A;  3AA3 A;  2P1J A;  4Q0B A;  1U49 A;  1TGO A;  4FVU A;  3CM5 A;  1KXP A;  1LOT B;  2E2Q A;  4BRE A;  3SCX A;  3WNG A;  2CGJ A;  4BDZ A;  3CCL N;  1NK5 A;  5EVZ A;  3JS6 A;  5FPE A;  1E4F T;  3RVC A;  3AGK A;  4UQG A;  1MU2 A;  4ELT A;  1Q8I A;  3O6W A;  4DFK A;  3CPE A;  3ZT0 A;  4ICL A;  3ATV A;  2UXB K;  3VN5 A;  2QTD A;  4FLU A;  2G8H A;  2G8I A;  4B1V A;  4CEB A;  3P4I A;  2P9S A;  2O8D A;  2FBY A;  1MDU B;  2OTL N;  4FWP A;  4M3T A;  3AAR A;  1KLM A;  5DK5 A;  3VQQ A;  4CI6 A;  2HHX A;  1HJO A;  2OPR A;  3LDQ A;  1NOY A;  1NGB A;  4KRE A;  1NJI O;  3WNE A;  2E6L A;  1T8E A;  1NGJ A;  2RHK A;  5CYQ A;  5GAH P;  1LCU A;  4WE1 A;  1J5E K;  2P9P B;  3KJV A;  3O3G A;  1ASV A;  4OVL A;  4IFE A;  3J80 O;  2E6M A;  3TSQ A;  4KFB A;  4M63 C;  3ZEU A;  4IJA A;  1OVQ A;  4DWI A;  3SUQ A;  1Z05 A;  2X78 A;  4EP5 A;  2ZQB A;  3NBP A;  5T7B A;  3MN6 A;  1RTI A;  4JNE A;  4GMJ B;  4IDH A;  5LJV A;  1NU0 A;  3THY A;  1JLB A;  5M1F A;  3LP2 A;  4CZE A;  1KFS A;  4PKI A;  5AQS A;  2OZS A;  4W5N A;  3TAR A;  2DPN A;  5A2Q O;  1N6Q A;  5BPN A;  5JIC A;  1BQM A;  5E41 A;  4AHS A;  1JCF A;  4CE9 A;  4FJ7 A;  3EKS A;  1FJG K;  3EY1 A;  4H5R A;  3O9T A;  5C2D A;  5M1O A;  5AFU H;  1VAZ A;  4CJ5 A;  2NUB A;  2I7P A;  3UIQ A;  4DR5 K;  3BUZ B;  5AZI A;  4K8X A;  3AO3 A;  3IRX A;  3M8Q A;  2GTD A;  1XNQ K;  3K5N A;  4JKG A;  4WQ5 A;  3CHW A;  3C94 A;  3VA0 A;  1L3T A;  3C0B A;  3NE6 A;  4CF9 A;  3ULD A;  3NGZ A;  3QFP A;  1J6Z A;  3DJC A;  3OYM A;  1VRT A;  4JI2 K;  1HYV A;  1BIS A;  4E3S A;  3PIP L;  2O8B B;  2YHA A;  2VCP A;  1DGK N;  5KGX A;  4BGA A;  3AVA A;  5HBM A;  4WFA L;  1RT2 A;  3MDQ A;  3AVL A;  4EHT A;  3OYD A;  2JWK A;  2G8W A;  2KFZ A;  4KKO A;  1DEJ A;  1BCO A;  3CJC A;  3ZSV A;  4KB1 A;  4FJ9 A;  1KQS M;  3EE9 A;  3ZYY X;  4WFN L;  3TWH A;  4CF2 A;  4ZTF A;  5AQY A;  3TR8 A;  3ULE B;  3L3V A;  1U2V A;  4BC4 A;  2QKK A;  1KC8 O;  3ASM A;  1TK8 A;  2H3G X;  3EEQ A;  4BR4 A;  2HHT A;  5J1E A;  4BC2 A;  2KFN A;  4CK3 A;  1GOC A;  3LDO A;  3DXM A;  1LW2 A;  1VQK N;  2E8A A;  2NRV A;  3ZT3 A;  3ZT4 A;  3TAE A;  2HB5 A;  3GDQ A;  1V4T A;  2BGG A;  1B92 A;  3LL3 A;  1KTQ A;  3CME N;  3CCE N;  3P83 D;  3W0L A;  4FJ8 A;  3H46 O;  5AQV A;  4CHQ A;  1XMQ K;  1U6Z A;  3MXJ A;  3VQD A;  4A5A A;  1K6Y A;  3FZL A;  3RMB A;  4CJV A;  3CMA N;  3CM6 A;  1WAF A;  5AQU A;  1NJX A;  5F0X A;  3CCQ N;  4Z4I A;  1A5W A;  4EHU A;  3KHY A;  3H3N O;  4GV9 A;  1HKG A;  4FW2 A;  1SKR A;  1XHZ A;  2RKI A;  4RW9 A;  2BDP A;  4H8K A;  3V9U A;  1K8A O;  4GVM A;  4CJU A;  4CIE A;  3TAF A;  2IGI A;  3ID8 A;  4E0D A;  5C12 A;  5AQT A;  4RWT A;  4IFY A;  3AVF A;  1TYQ B;  2GWK A;  3U9D A;  2VWB A;  1NKE A;  4CFB A;  3ZT2 A;  4J2E A;  4M3W A;  2UYT A;  4H0V B;  3A0I X;  3EN9 A;  3A2F A;  4E1J A;  5HRR A;  1BGX T;  3QB0 A;  1VQ4 N;  1D9F A;  4OO1 J;  5FRN A;  2BE2 A;  4CHN A;  4C1N K;  3QIO A;  2JLE A;  2ZGZ A;  5BN8 A;  5C10 A;  2F9W A;  1EXQ A;  1YVU A;  3VQE A;  1I94 K;  3OYK A;  1NNE A;  3AY9 A;  3SLC A;  3DAW A;  4CJE A;  4E7H A;  4E7J A;  1RDD A;  4BR7 A;  5AQK A;  1S1X A;  3MN7 A;  1QVF M;  3QES A;  3OHR A;  4J2A A;  5F1X A;  1YUW A;  4DFM A;  4M42 A;  2UXC K;  1V4S A;  3C6U A;  1EWR A;  4RW4 A;  3TAB A;  3C65 A;  4BRH A;  5GAD P;  2UUB K;  1RNH A;  4FL9 A;  4B9T A;  3SAH A;  2J4R A;  4YOT A;  3KWI A;  3HL8 A;  3THW A;  2P9U A;  4H0O A;  2YNH A;  4DF8 A;  2D5R A;  4G9Z A;  1EKE A;  4CZL A;  3SUP A;  3CC7 N;  4NO7 A;  4CEC A;  1YAG A;  3HM8 A;  1SL1 A;  3T69 A;  3OYN A;  2YX6 A;  2G8F A;  4CD3 A;  1E4G T;  3A5M C;  5ADX A;  3K5L A;  4KTZ A;  3ZLJ A;  1XC3 A;  1EQY A;  3NGI A;  2HOE A;  1Z26 A;  4JKF A;  4B9Q A;  1SQK A;  4H0X B;  2W6L A;  4IWV A;  3HM9 A;  1TAU A;  5GIO A;  1RBR A;  4KH6 A;  4BRQ A;  3E1Y A;  4KHU A;  4AHC A;  1S1V A;  3PSI A;  3VEW A;  3WQT A;  1J53 A;  4BR5 A;  2W40 A;  5BRH A;  4V19 S;  4BRP A;  4O5F A;  3VF4 A;  3WXJ A;  4WQ4 C;  1HMV A;  1HQU A;  1DTT A;  1TL1 A;  1NMN A;  3MED A;  4DSF A;  4XEI A;  1W9H A;  2V52 B;  3VEO A;  4K8Z A;  1JLF A;  3ZCM A;  1NBW A;  3WEE A;  3DM2 A;  1IKW A;  4WF9 L;  1BU6 O;  1SS6 A;  3RWU A;  2I7N A;  4U7B A;  4IBN A;  1M90 O;  1TL3 A;  1X1P A;  3UB5 A;  4CZJ A;  1JLC A;  4JKB A;  3RRH A;  2EX3 A;  1VQ7 N;  4KI6 A;  4B3T K;  4BGB A;  3KVG A;  4IO9 L;  1C0U A;  4C23 A;  1LW0 A;  3QEI A;  3DOL A;  3N4P A;  4BDY A;  1VK0 A;  2P9S B;  3CJA A;  2OYQ A;  2O8D B;  3G10 A;  4HVJ A;  4QS9 A;  4JI0 K;  5D3G A;  3V1Q A;  2BAN A;  1HKC A;  1IKV A;  1D8Y A;  4FWL A;  3VQP A;  4ISF A;  3BGR A;  3AVH A;  3M6G A;  3SPZ A;  4NCB A;  4IOC L;  3HT3 A;  2QWQ A;  4HWI A;  3ATU A;  4CHY A;  3F2K A;  4HHT A;  3BZK A;  5I9E B;  1P8Z A;  4FWM A;  2JGU A;  1E3M A;  1U04 A;  3S41 A;  4DSL A;  3ZEU B;  1T05 A;  2RPI A;  4IDK A;  3WT0 A;  1J9A A;  3F9M A;  2O8C A;  4BRL A;  3CC4 N;  1RTJ A;  4BG9 A;  5C42 A;  4W5R A;  4CD1 A;  4DTJ A;  4DR7 K;  3PV8 A;  1QZ5 A;  3M3Z A;  4OLA A;  4H03 B;  4LSN A;  3KLG A;  4DQP A;  1UAX A;  3ULE A;  3KLF A;  4DTR A;  3MWT A;  3LAK A;  3QIP A;  4FLV A;  3THY B;  4FJX A;  3T1H K;  4DLG A;  5HRS A;  3KWG A;  2Z1G A;  1WN7 A;  4G1Q A;  1RTH A;  4BRF A;  3SJH A;  4EZ6 A;  4JYA K;  4DU1 A;  3OS2 A;  1KFD A;  3DYA A;  5MLC Q;  3VMF B;  1VRU A;  3VEV A;  4B3R K;  5F2R A;  3CJ9 A;  4KH5 A;  2HBJ A;  1XQS C;  5GIN A;  4J2B A;  3S3M A;  4IXC A;  2VG6 A;  5AZI B;  4IZ9 A;  3JYT A;  4PY5 A;  2YNF A;  3SMP A;  3I0S A;  4JKG B;  1HPZ A;  3C6A A;  4JK8 A;  3SQ4 A;  1RBS A;  3DLK A;  3P39 A;  1QQC A;  3OYB A;  1QS4 A;  4FPB A;  3T1Y K;  3I0R A;  3JAM O;  3E9P A;  3LDS A;  1IO2 A;  3VEZ A;  3HPO A;  1D4X A;  3SV4 A;  4PL7 A;  2HBM A;  1XWL A;  1CZA N;  5C15 A;  3THX A;  3KKS A;  1WAJ A;  2A1S A;  1TUU A;  1T7P A;  2E1Y A;  1S1U A;  2Q2R A;  4CF1 A;  4BRI A;  4BRK A;  3R8E A;  4OKE A;  5B8H A;  4DSI A;  2VG7 A;  5CR4 A;  2VYP A;  1KVC A;  1SL2 A;  3T1A A;  2UUA K;  3TAG A;  3I8D A;  3VQB A;  3NF7 A;  2A6A A;  1U2V B;  4BRG A;  1K8K A;  1NK7 A;  3QEP A;  3F5T A;  3PO5 A;  1JCE A;  4E7I A;  4B08 A;  4GV6 A;  1JL2 A;  3SQ2 A;  3U4L A;  1EP4 A;  4JN4 A;  3DXM B;  3KTQ A;  4MO5 A;  3LAL A;  3NH2 A;  3ZSO A;  4BRN A;  1N36 K;  4A61 A;  4DR6 K;  4DR2 K;  5BPM A;  4LY7 A;  3RTV A;  4ZTJ A;  5J2M A;  4CJW A;  4HCB A;  1VSD A;  3HSC A;  3AAQ A;  3TTD A;  3K9J A;  4E1M A;  5ADX H;  4F8R A;  3M8S A;  3V4I A;  4C8O A;  5LL6 Z;  4WCE L;  3UKR B;  3I56 N;  1HRH A;  1VSH A;  1FXX A;  4E1N A;  3J81 O;  3NFA A;  2OA8 A;  3ZSZ A;  3HI0 A;  5I3U A;  3OYE A;  1RFQ A;  4F9O A;  2YNI A;  3O1B A;  2BTF A;  3S3O A;  2HVI A;  4FLZ A;  3ZX0 A;  1S72 N;  3FZK A;  4CGI A;  2NRR A;  1JJ2 M;  3QEV A;  3HST B;  1WUA A;  4I7F A;  1VSI A;  4AM7 A;  3MWP A;  5E84 A;  3O8M A;  1I39 A;  3FLC O;  4CHP A;  3C7N A;  3ZSR A;  3SQ1 A;  3CYM A;  2FSJ A;  3F73 A;  2XY8 A;  1LWF A;  5KGW A;  4BR9 A;  2KLA A;  2Y1I A;  1RT3 A;  4C8N A;  1X3M A;  3L2Q A;  3OS1 A;  2YHW A;  3ALY A;  4CFA A;  3TPQ A;  1Q82 O;  1IG9 A;  1JKH A;  4KHS A;  1VQL N;  5M1Q A;  3B8A X;  1IG8 A;  3AVC A;  1YIJ N;  4PKG A;  4KTQ A;  5FPD A;  2X6S A;  2D4W A;  5AQQ A;  5HRO A;  2E88 A;  3FFK B;  3PX6 A;  1XI1 A;  1K9M O;  4KRF A;  1S1W A;  1HUX A;  2ASM A;  3CG7 A;  3THW B;  3V1R A;  2P9U B;  2IAJ A;  1ZBL A;  5JLF A;  4OLB A;  1KAX A;  4MDB A;  4JHD A;  3CJ1 A;  1ASW A;  5KPZ A;  1J5O A;  3CFR A;  5CHI A;  4DV3 K;  4N41 A;  3MXM A;  1T3V A;  1NGC A;  2QWN A;  3LDP A;  1QE1 A;  3O4Q A;  2D0P A;  3M1F A;  3NHG A;  4EFH A;  3AVI A;  4BRC A;  4DV6 K;  1BWF O;  4BR0 A;  4YOW A;  2O8E B;  3EE8 A;  5KQD A;  3KK3 A;  5JS1 A;  4FVM A;  1JXB A;  5HOO A;  3H45 C;  5M1K A;  2YI1 A;  2F7T A;  1DKG D;  2QEX N;  3IMX A;  4JI4 K;  4RW7 A;  1GOB A;  2R7Y A;  4DR1 K;  3N4Q A;  1RDW X;  4M3X A;  4B3O A;  4NB4 A;  3A5O C;  2W6K A;  1ASU A;  1HR0 K;  3NH1 A;  3WEE B;  4FSV A;  4AHV A;  1YJW N;  3AO1 A;  4BWM A;  4FCY A;  3U3Y A;  4FZX C;  5CZ1 A;  5KPT A;  3CQ8 A;  4DV5 K;  4CHZ A;  3LPT A;  2HF4 A;  4R5P A;  4YDU C;  4F3O A;  2E2O A;  4GW6 A;  3VQ7 A;  4AM6 A;  3D7E O;  4DTU A;  4DTX A;  4FPA A;  4NYN A;  2AP1 A;  5AZJ A;  3MX5 A;  3IDH A;  4BE2 A;  1Z6R A;  3TSP A;  5KRS A;  3CCJ N;  3KD5 E;  1VQ6 N;  3L2W A;  2HVH A;  4CZI A;  3OJU A;  4DLE A;  2Q0R A;  3J7A P;  5JLH A;  3V9W A;  1XHX A; 
#chains in the Genus database with same CATH homology
 1HNV A;  4JRQ A;  4DF4 A;  2PYJ A;  4B9T A;  1C1A A;  4KO0 A;  4Y1D A;  3C95 A;  4DTN A;  1XC9 A;  5C25 A;  3HL8 A;  1NKC A;  2XHB A;  2YNH A;  3KLI A;  4DF8 A;  2D5R A;  1A5X A;  1N5Y A;  5HLF A;  3MEC A;  3NF9 A;  3OYC A;  4CEA A;  1EKE A;  4CJL A;  3THV A;  4CGJ A;  2D0C A;  3SUP A;  4CEC A;  2O4I A;  1CXQ A;  1SL1 A;  1RDC A;  3K57 A;  3OYN A;  1ZYQ A;  3QER A;  4CED A;  1KLN A;  1TKZ A;  2G8F A;  2ETJ A;  4CGD A;  1SL0 A;  4C8K A;  4ID1 A;  4DFJ A;  4BDP A;  3K5L A;  4KTZ A;  1ITG A;  4Z4C A;  3PY8 A;  2HHV A;  1X9W A;  4CHO A;  3RR8 A;  1ZBH A;  3NGI A;  4M3U A;  5KTQ A;  1LAV A;  2QKB A;  3B6P A;  1Z26 A;  3P1G A;  3OY9 A;  5C24 A;  4DSK A;  2OPP A;  4CJ4 A;  4CIG A;  3M8P A;  1WSG A;  3JSM A;  3G0Z A;  4H4O A;  4DU4 A;  5J2Q A;  1JXE A;  4BWJ A;  4DQI A;  1BIZ A;  1ZBU A;  4CFD A;  4N56 A;  3HM9 A;  1TAU A;  4E19 A;  3F9K A;  4W5T A;  1NK4 A;  1C0M A;  1RBR A;  3O4N A;  3V1O A;  1LWE A;  1Z25 A;  1LV5 A;  3QET A;  4AH9 A;  3S3N A;  4KHU A;  1Y97 A;  4AHC A;  4CCH A;  1S1V A;  1U48 A;  4OPJ A;  4KHW A;  4BAC A;  1NK9 A;  3OYI A;  1T03 A;  1J53 A;  4E89 A;  3OYG A;  4FJK A;  5HRP A;  2HHQ A;  2WON A;  3K59 A;  1TVR A;  2FBT A;  4ZHR A;  3LZJ A;  1TK5 A;  3L2R A;  1BI4 A;  1BIU A;  3LAN A;  3EYZ A;  4CJ3 A;  1RDB A;  2DFE A;  3K5O A;  3HO1 A;  4N76 A;  4FXD A;  2D0B A;  1HMV A;  1HQU A;  3HP9 A;  1DTT A;  1FKO A;  4JRP A;  1TL1 A;  3MED A;  4M3Y A;  4DSF A;  1W9H A;  3HYF A;  3SNN A;  3ZT1 A;  4CER A;  2HHU A;  2DTU A;  4K8Z A;  1JLF A;  3AVK A;  3SUO A;  3IAY A;  3ZCM A;  1YT3 A;  1BL3 A;  1IKW A;  3DM2 A;  1NK6 A;  2HNY A;  3CFP A;  1Q9Y A;  4KI4 A;  4F3T A;  1KCF A;  1O1W A;  3WNH A;  4HCC A;  3RWU A;  1RIL A;  4IBN A;  1TKD A;  1TL3 A;  2GBZ A;  1X1P A;  3ITH A;  1UOC A;  2YV0 X;  3V81 A;  4AHR A;  4XIU A;  1JLC A;  1UWB A;  3VQ4 A;  1F21 A;  2EX3 A;  3RRH A;  4FJH A;  4KI6 A;  3HP6 A;  4Z0U A;  2W42 A;  1EX4 A;  2GV9 A;  3SZ2 A;  3OS0 A;  4FLT A;  1C0U A;  1G15 A;  3L8B A;  4FLY A;  3SUN A;  4I9Q A;  1S1T A;  1S6P A;  1VSE A;  3U3G A;  1LW0 A;  3QEI A;  4PQU A;  2X6N A;  3DOL A;  4DMN A;  1RNH A;  4BDY A;  5KRT A;  2FBV A;  1VK0 A;  2OYQ A;  2ZD1 A;  3TAN A;  3BDP A;  1EET A;  3G10 A;  4C8M A;  4CEZ A;  4HVJ A;  5D3G A;  3V9X A;  1WSF A;  3V1Q A;  2BAN A;  3AO4 A;  3NCI A;  1W0H A;  4CJS A;  2Z1I A;  3O3F A;  1IKV A;  3SJJ A;  1I3A A;  1RBU A;  1D8Y A;  1NOZ A;  3WNF A;  3VQP A;  2OZM A;  3BGR A;  3IG1 A;  3AVH A;  3SPZ A;  4NCB A;  1DLO A;  1B9F A;  3HT3 A;  1YTA A;  4CEO A;  4DTP A;  3C6T A;  2G8K A;  4HUF A;  1RDA A;  4DSE A;  4CHY A;  3AO5 A;  5CZ2 A;  4HHT A;  4FJI A;  3RR7 A;  4OKJ A;  1ZBI A;  2XO7 A;  4N47 A;  2IC3 A;  2IOC A;  4KB0 A;  2YKN A;  2JGU A;  3DLR A;  1U04 A;  3ZSQ A;  1VSL A;  4DSL A;  3B6O A;  3LAM A;  3DLG A;  4FJX A;  2XY5 A;  4OKK A;  1T05 A;  3DRP A;  1RT6 A;  4CES A;  2RPI A;  3L2V A;  1RT4 A;  1HYS A;  4IDK A;  4YNQ A;  1L3U A;  4B9N A;  1J9A A;  4B9V A;  4OGC A;  1HYZ A;  2QK9 A;  3T19 A;  4I2Q A;  4FYD A;  4FM0 A;  1RTJ A;  3AVB A;  4RW6 A;  5C42 A;  3O3H A;  4Z4F A;  4TSX A;  4B8C A;  4W5R A;  1NJW A;  5FRM A;  4PWD A;  3AA5 X;  4DTJ A;  3PV8 A;  1C0T A;  2KZZ A;  2PY5 A;  4FZZ A;  3PX4 A;  3IS9 A;  2P5G A;  1SV5 A;  1NK0 A;  2F8S A;  4OLA A;  2HND A;  1J54 A;  3LP1 A;  3VQ5 A;  4LSN A;  4MQ3 A;  3KLG A;  4FLX A;  4DQP A;  4F2S A;  3D0P A;  4FK4 A;  1UAX A;  4M3R A;  2F8T A;  3KLF A;  2Z1J A;  4DTR A;  2XY7 A;  3DRS A;  4PUO A;  3LAK A;  3QIP A;  3KK1 A;  3OYF A;  4O44 A;  1IKX A;  4FLV A;  3S9H A;  3NF6 A;  4DLG A;  2XY6 A;  5HRS A;  3PO4 A;  4CFC A;  2Z1G A;  2IDO A;  3MEE A;  5J2P A;  3CFO A;  1WN7 A;  3NF8 A;  1RTH A;  4G1Q A;  4CEQ A;  3SV3 A;  1HJR A;  3QEX A;  1SKS A;  4EZ6 A;  4FJG A;  3E01 A;  4FK2 A;  2XRI A;  1KVB A;  3DMJ A;  2FC0 A;  4DU1 A;  3OS2 A;  1NKB A;  2IS3 A;  4W5O A;  4O55 A;  1KFD A;  3DYA A;  4ID5 A;  1L5U A;  4KV8 A;  1QSS A;  4F2R A;  1VRU A;  1YTU A;  3AV9 A;  4DQR A;  4B9M A;  2ZE2 A;  3QNO A;  4CF0 A;  3MAQ A;  1U45 A;  2X74 A;  1RT5 A;  4DSJ A;  4J2B A;  3LWL A;  1JLQ A;  1QSY A;  4RG8 A;  3AA3 A;  3S3M A;  3HPH A;  4M41 A;  2P1J A;  4Q0B A;  1U49 A;  2KZM A;  1TGO A;  2KQ2 A;  2VG6 A;  4OJR A;  1BCM A;  3TAP A;  3RMC A;  1RT7 A;  3CM5 A;  4CJT A;  3JYT A;  4PY5 A;  4B9S A;  4LD0 A;  2YNF A;  4FZY A;  2F96 A;  3SCX A;  5CYM A;  3I0S A;  3WNG A;  1HPZ A;  4BDZ A;  3SQ4 A;  4KHY A;  5HP1 A;  4KHN A;  1NK5 A;  3RMA A;  1RBS A;  4E7K A;  3DLK A;  2ATQ A;  4DFP A;  2VG5 A;  4BE1 A;  1NJY A;  4C8L A;  4UQG A;  1MU2 A;  1QQC A;  4Y1C A;  4BE0 A;  4ELT A;  4FJM A;  1Q8I A;  4DFK A;  1U47 A;  3ZT0 A;  4ICL A;  4CEE A;  3HJF A;  2RN2 A;  4CJP A;  3OYB A;  1QS4 A;  3VN5 A;  3TAQ A;  3L2U A;  1D5A A;  3I0R A;  4FLU A;  2G8H A;  4KAZ A;  1RT1 A;  3RRG A;  4CEB A;  2EHG A;  3LDS A;  1IO2 A;  2G8I A;  2FBY A;  3HPO A;  2O4G A;  1UA1 A;  1LAW A;  4M3T A;  3DLH A;  3SV4 A;  3DOK A;  4L8R B;  1KLM A;  5DK5 A;  1X9S A;  3VQQ A;  1S5J A;  2B5J A;  3OYJ A;  4H4M A;  2HHX A;  1WSE A;  1DTQ A;  1XWL A;  3HK2 A;  2OPR A;  2KTQ A;  1D9D A;  3KKS A;  1FKP A;  1WAJ A;  2A1S A;  1NOY A;  1FK9 A;  4B8A B;  1TV6 A;  2AJQ A;  4KRE A;  1TKX A;  1L3S A;  4OPK A;  4E7L A;  4M3Z A;  1T7P A;  3KIO A;  1S1U A;  3WNE A;  2E6L A;  4CF1 A;  1L3V A;  1WSH A;  1T8E A;  4OKE A;  4Z4E A;  3ZSY A;  5CYQ A;  1SUQ A;  4DSI A;  4JLH A;  4WE1 A;  3KKR A;  2VG7 A;  3OVN A;  1CLQ A;  1IKY A;  3KJV A;  3HXM A;  1KVC A;  3O3G A;  1SL2 A;  1ASV A;  4OVL A;  3T1A A;  3TAG A;  2ITG A;  3I8D A;  4EP4 A;  3VQB A;  5SZT A;  3NF7 A;  2E6M A;  1WSI A;  4B9L A;  1CZB A;  4KFB A;  1U4B A;  1NK7 A;  3QEP A;  3PO5 A;  1RTD A;  1LWC A;  3K2P A;  4CJR A;  4E7I A;  3OJS A;  3KK2 A;  4FLW A;  2HMI A;  4B08 A;  4DS5 A;  1JL2 A;  4DS4 A;  4DWI A;  3SUQ A;  3NAE A;  2X78 A;  3SQ2 A;  4EP5 A;  2P5O A;  2ZQB A;  3NBP A;  5T7B A;  1EP4 A;  1RTI A;  5EU7 A;  3MEG A;  3T3F A;  3KTQ A;  4FJ5 A;  1QHT A;  3LAL A;  3QIN A;  3NH2 A;  3OYH A;  3ZSO A;  3ISN C;  4GMJ B;  3TAM A;  2DY4 A;  1C1C A;  3K5M A;  2HW3 A;  1RCH A;  4LY7 A;  3RTV A;  1JLB A;  4ZTJ A;  2E4L A;  4NCA A;  4Z4G A;  2D0A A;  5J2M A;  4CJW A;  4HCB A;  1VSD A;  3LP2 A;  3PUF A;  4E1M A;  5DMR A;  4CIF A;  3U6F A;  1KFS A;  4F8R A;  3AO2 A;  3M8S A;  2OZS A;  4W5N A;  3TAR A;  3V4I A;  2PZS A;  4C8O A;  3NH0 A;  1NJZ A;  1TAQ A;  4B9U A;  1JLG A;  1N6Q A;  2DFH A;  2VWK A;  1BQM A;  2Z1H A;  5E41 A;  2GUI A;  4AHS A;  4CE9 A;  1HRH A;  4FJ7 A;  3SQ0 A;  5SWM A;  1VSH A;  1FXX A;  3EY1 A;  3QEW A;  4E1N A;  1SKW A;  3NFA A;  2OA8 A;  1BHL A;  4JS5 A;  3DI6 A;  4CJ5 A;  3ZSZ A;  2NUB A;  4O5B A;  3AVG A;  3LZI A;  3FFI A;  5I3U A;  3QO9 A;  3ZSW A;  3OYE A;  3UIQ A;  2A1R A;  2YNI A;  4K8X A;  4Q5V A;  3AO3 A;  2YNG A;  3IRX A;  3M8Q A;  5JS2 A;  2Y1J A;  3K5N A;  3S3O A;  4HUG A;  1WSJ A;  4FLZ A;  2HVI A;  4IFV A;  1A5V A;  4CGI A;  3C94 A;  4LH4 A;  3VA0 A;  1L3T A;  3DLB A;  4FJJ A;  3QEV A;  3NE6 A;  3HST B;  4I7F A;  4CF9 A;  3NGZ A;  1VSI A;  4M45 A;  1RBT A;  3ULD A;  1I39 A;  4PA1 A;  4CHP A;  3ZSR A;  2HNZ A;  3SPY A;  3DRR A;  3SQ1 A;  3TI0 A;  3CYM A;  3OYM A;  1QTM A;  1VRT A;  3F73 A;  1HYV A;  1BIS A;  2XY8 A;  4KTW A;  1LWF A;  4E3S A;  3KLE A;  3LP3 A;  5KGW A;  4HTU A;  2HHS A;  2WOM A;  4DQS A;  2YHA A;  1S9E A;  1B9D A;  4CGG A;  3V9Z A;  2Y1I A;  4FJL A;  4I2P A;  1GOA A;  1RT3 A;  4IG3 A;  4C8N A;  4N5S A;  3L2Q A;  4AHT A;  3SI6 A;  3OS1 A;  2G8V A;  5KGX A;  3ALY A;  3K58 A;  3AVA A;  5HBM A;  4CFA A;  1NK8 A;  1JLE A;  1S6Q A;  1RT2 A;  1JKH A;  1IG9 A;  4KHS A;  2B6A A;  3AVL A;  3OYD A;  2G8W A;  1JL1 A;  3AVC A;  2KFZ A;  3AVM A;  4KKO A;  2RF2 A;  4CGH A;  1KVA A;  4RW8 A;  3V9S A;  4J2D A;  4KTQ A;  1BCO A;  2X6S A;  3ZSV A;  4KB1 A;  4DG1 A;  5HRO A;  4FJ9 A;  3PX6 A;  4Z4H A;  3OYA A;  1S9G A;  3AA4 A;  3RMD A;  1XI1 A;  3TWH A;  4W5Q A;  4CF2 A;  3LP0 A;  4FM1 A;  5I42 A;  4ZTF A;  4KRF A;  4NCG A;  3TR8 A;  3PX0 A;  4LH5 A;  1R0A A;  3L3V A;  1S1W A;  2QXF A;  4IKF A;  4FK0 A;  4O0I A;  2G8U A;  4YFU A;  3CG7 A;  3P5J A;  3V1R A;  2QKK A;  1RBV A;  2IAJ A;  3ASM A;  1TK8 A;  1ZBL A;  2DFF A;  3KD1 E;  3VQC A;  4ELU A;  4OLB A;  2HHT A;  4EZ9 A;  5J1E A;  2KFN A;  1X9M A;  4CK3 A;  1GOC A;  1LW2 A;  1ASW A;  4CK2 A;  1C6V A;  1VSJ A;  1J5O A;  3ZT3 A;  3ZT4 A;  3CFR A;  3AVN A;  4N41 A;  3TAE A;  3M8R A;  3MXM A;  2HB5 A;  3D45 A;  4AHU A;  4CK1 A;  4KPY A;  2BGG A;  1B92 A;  3OYL A;  1VSM A;  5CY4 A;  1KTQ A;  1QE1 A;  5K14 A;  1QSL A;  3AVJ A;  4IG0 A;  1TK0 A;  3O4Q A;  4CJQ A;  3P83 D;  3ZSX A;  1ZBF A;  3VA3 A;  3NHG A;  4FJ8 A;  3DLE A;  4CHQ A;  3HVR A;  3AVI A;  4I9L A;  3NDK A;  4FJN A;  3MXJ A;  4DTS A;  3VQD A;  2Q3S A;  4CF8 A;  2VWJ A;  2PYL A;  1K6Y A;  3KK3 A;  3RMB A;  4CJV A;  4FM2 A;  2HHW A;  5JS1 A;  3CM6 A;  1WAF A;  3H08 A;  3LWM A;  1NJX A;  4FVM A;  1JLA A;  4Z4I A;  1A5W A;  2YHB A;  3MXI A;  1JXB A;  3HVT A;  4ELV A;  4AIL C;  4FW2 A;  1SKR A;  1CZ9 A;  1XHZ A;  2RKI A;  2I5J A;  4RW9 A;  5KI6 A;  4RW7 A;  4H8K A;  3V9U A;  1BI4 B;  3VQA A;  2BDP A;  1GOB A;  2R7Y A;  3V6D A;  5FRO A;  4GVM A;  3LPU A;  4CJU A;  4CIE A;  4JS4 A;  2IGI A;  4DQQ A;  3TAF A;  4E0D A;  4M3X A;  4B3O A;  3HPG A;  4OGE A;  1IH7 A;  4DTO A;  4IFY A;  1ASU A;  1VSF A;  3NH1 A;  3AVF A;  4CJF A;  1KRP A;  3L3U A;  4KHQ A;  4AHV A;  1WNS A;  1VSK A;  2P51 A;  3AO1 A;  4BWM A;  1NKE A;  4CFB A;  3ZT2 A;  1CXU A;  3QNN A;  4J2E A;  4M3W A;  4FW1 A;  3NGY A;  4FCY A;  2KW4 A;  3U3Y A;  4FZX C;  5CZ1 A;  4CEF A;  1TKT A;  3A2F A;  3CQ8 A;  5HRR A;  1BGX T;  4LSL A;  1UA0 A;  4MFB A;  4CJK A;  3AA2 A;  1D9F A;  5FRN A;  2BE2 A;  4CHN A;  1HQE A;  4CHZ A;  3EZ5 A;  3LPT A;  3QIO A;  2JLE A;  3QLH A;  3VQ6 A;  4F4K A;  4R5P A;  1REV A;  4DU3 A;  1EXQ A;  4QOZ B;  2FBX A;  4F3O A;  1YVU A;  4GW6 A;  1BQN A;  3VQ7 A;  3VQE A;  4DTU A;  3OYK A;  4DTX A;  4CJE A;  4E7H A;  4NYN A;  3KLH A;  1RDD A;  1WLJ A;  4E7J A;  4DTM A;  1S1X A;  4O4G A;  2LSN A;  5KRS A;  4BE2 A;  1HNI A;  2OPS A;  3QES A;  3KD5 E;  3L2W A;  3VQ8 A;  4CGF A;  3SYZ A;  2YKM A;  1KSP A;  5HRN A;  4J2A A;  2HVH A;  5J2N A;  3OJU A;  4O0J A;  4DFM A;  2B4J A;  4QCL A;  4M42 A;  4DLE A;  3C6U A;  1Q9X A;  4QAG A;  5FDL A;  4RW4 A;  3TAB A;  2OPQ A;  3V9W A;  4NYF A;  1C1B A;  3VQ9 A;  1XHX A;  4HUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...