2QKKA

Human rnase h catalytic domain mutant d210n in complex with 14-mer rna/dna hybrid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
154
Chain Sequence
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna/rna
molecule keywords 5'-R(*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*CP*C)-3'
total genus 45
structure length 154
sequence length 154
chains with identical sequence B, E, F, I, J, M, N, R, S, W
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2qkkA00
2HNDA 1L3SA 2G8VA 1TAQA 1WAJA 5K14A 1CZBA 4CJUA 1U4BA 2JLEA 3L3UA 4ZTFA 3K5OA 3L2WA 1LW0A 1JXEA 3AO5A 4CJKA 2IC3A 4BACA 4DSKA 3WNFA 3ZSVA 4CERA 4J2AA 3BDPA 1NOYA 1MU2A 3NGYA 1BCOA 1ZBIA 1TL1A 3V9UA 5KRSA 4DU3A 1RILA 1ASWA 4DTOA 2XHBA 5SWMA 3AVBA 4CHZA 4O44A 5CZ1A 4CGDA 3KK1A 2A1RA 3SCXA 3SV3A 3ZT1A 3S3NA 3SUNA 1HJRA 3AA5X 3VQ7A 1ASUA 1LV5A 4CJ5A 3PX4A 4FK2A 3LZIA 4PY5A 3C94A 3KLHA 4JS5A 3TI0A 1GOAA 1HQUA 3S9HA 2VWJA 1N5YA 4KI6A 3TR8A 4HUFA 1REVA 2F8SA 5J2PA 4CJ3A 2VG5A 1NJZA 3VQAA 3PV8A 1WSEA 1WSFA 4G1QA 3MXMA 4M3TA 1TVRA 2I5JA 4CE9A 4OGEA 5J1EA 3NH2A 2QXFA 1TK0A 4HCBA 1IKXA 1IKWA 1RT7A 4CK1A 2D0AA 3S3MA 4FXDA 2D0CA 4FJKA 1KLNA 3UIQA 2ETJA 1G15A 3ISNC 1VSMA 4CJTA 5KGXA 1WN7A 4HTUA 3NHGA 2OPQA 3U6FA 1X9SA 4E0DA 2HHSA 3LWMA 4DFMA 3O3FA 1EKEA 2YKMA 3DRRA 1YTUA 2KFNA 4EZ6A 3ZCMA 4AHUA 1S9GA 1S1XA 4I9LA 4DG1A 4CJRA 4B9MA 4F3OA 5KGWA 4Z0UA 3ZSWA 1VRUA 1QSYA 3FFIA 2KFZA 1D5AA 4FJNA 1VSEA 3PO5A 4E89A 1SV5A 4M42A 3O3GA 1GOBA 1A5WA 4B9TA 3ITHA 1WSHA 3ZT3A 1U49A 3QINA 4ELVA 3KD1E 3AO1A 3F9KA 4DF8A 2G8IA 1UA1A 3IRXA 2E4LA 3DLEA 3D0PA 4CF9A 3T3FA 5HP1A 2OA8A 3WNEA 3ZT2A 3LP0A 2FBVA 3QLHA 4IKFA 1NK6A 1QQCA 2RKIA 1L3UA 3MEEA 3V9XA 1NK5A 4UQGA 2G8HA 4KTZA 4DTRA 1YVUA 1WLJA 1XHZA 1IKVA 3VQ8A 3A2FA 4I2PA 3KTQA 1B9FA 4I7FA 3RMBA 1BL3A 2ITGA 3ULDA 3C6TA 2HHWA 5HRNA 3EYZA 4F2RA 4CEQA 4FJIA 2OPRA 3ASMA 4NYNA 3ZSZA 4R5PA 1BGXT 1RTHA 1ZBLA 3KK2A 3LP1A 2O4GA 2XY8A 3MXJA 4IBNA 1VSIA 3ZSRA 4CHQA 5SZTA 4FLYA 3V9ZA 2BE2A 5FDLA 1CXUA 1S1UA 3PX6A 3RR7A 3I0SA 4OLBA 1VSDA 2KZZA 2D0BA 1TAUA 4DQPA 4JRPA 4LD0A 4CESA 3OYBA 2GV9A 1EXQA 1N6QA 2BANA 3OYKA 3KLGA 3QEVA 4AHCA 2NUBA 4FJLA 4DU4A 2X6NA 4B8AB 4O0IA 4DQSA 4B9VA 3PO4A 4KHUA 3TWHA 4KB1A 4K8XA 5I3UA 3VQEA 4KFBA 1CZ9A 1TK5A 2E6LA 3DLRA 4DLGA 1R0AA 4RW4A 3HP9A 3WNHA 4Z4GA 3HP6A 1RT5A 3SJJA 2VG7A 4DFJA 5JS1A 1ZBUA 3HXMA 2A1SA 1Q9YA 1EP4A 3ZSYA 2G8KA 3EZ5A 3HM9A 1UAXA 2XRIA 3HL8A 3VQBA 4GMJB 3KLFA 1W0HA 5CYMA 4CEBA 4JRQA 4FJGA 3AVAA 5FRMA 3LPUA 3HO1A 3U3YA 1HPZA 2X74A 3CG7A 3AO2A 2RF2A 1X9MA 3IG1A 3M8SA 4W5OA 1S5JA 4XIUA 3V9SA 1NJWA 1RDAA 3VQ4A 3K5LA 3MXIA 4C8MA 3VQ5A 2BDPA 5FRNA 2HW3A 3SUQA 1UA0A 4I2QA 1XWLA 4RW6A 2LSNA 4CHNA 1HNVA 1RT6A 4F8RA 4B3OA 4FM1A 4DS4A 4AILC 1B9DA 1WSGA 3DI6A 3HPOA 5D3GA 3T1AA 1NKBA 2HVIA 2ZE2A 4BDYA 1JLCA 4FJ5A 3T19A 2EHGA 3SPYA 3NBPA 1U48A 1RTJA 4FZYA 4HCCA 1EX4A 4OKJA 3SQ2A 4CHOA 4DFKA 2P5OA 4DSLA 2ATQA 3K2PA 1JL1A 1NOZA 2Z1HA 4HUEA 3P1GA 4ZHRA 1T7PA 3AV9A 3OYLA 3DLGA 4DLEA 4F3TA 1SKRA 2OYQA 4CGHA 5C42A 1NK0A 3OVNA 3ZSQA 1EETA 1TGOA 3QIOA 3TAFA 1J53A 4N47A 2ZD1A 1YT3A 2P5GA 3VQCA 4BWJA 4CFCA 1RTDA 4CEZA 1JLFA 4FJ7A 3HYFA 4Q0BA 3V1RA 1RDDA 1NJXA 1QSLA 5E41A 1SKSA 1BIZA 4CEAA 3HVTA 1S1TA 2RN2A 5DK5A 4H8KA 3SYZA 4KI4A 2KTQA 4DTXA 3QESA 3SQ4A 3O4QA 4FZZA 3NGZA 3THVA 1RT3A 3PY8A 1QE1A 2OPSA 1JL2A 3NE6A 3M8RA 3DMJA 2DFHA 4BDPA 3DLKA 4RW7A 3AVCA 2D5RA 4FM2A 4CJPA 2PZSA 3OY9A 2JGUA 1NKEA 4FJ9A 2BGGA 4QCLA 2HVHA 3PX0A 1NK7A 1BHLA 3AVHA 4OGCA 2G8UA 4KTWA 1SUQA 3DRSA 3TAEA 1J5OA 3MAQA 4O0JA 3KIOA 2DFFA 2Y1IA 1JLBA 3B6PA 4IG0A 3SNNA 2QKBA 4CJSA 3QEIA 5J2QA 4FZXC 1XI1A 3RMCA 1ZYQA 5KTQA 1TKXA 3M8PA 3P5JA 1IG9A 4FVMA 4FW2A 1DTQA 3HSTB 1LAVA 4ICLA 5I42A 4Q5VA 1Q9XA 3QERA 4FJJA 4CFBA 4DTJA 4FYDA 3KK3A 4CEDA 3LP2A 3ALYA 3OYDA 3VQ6A 2YNGA 1TL3A 1KVAA 3CFOA 4KHNA 1FXXA 3SUOA 4JLHA 1T05A 2B6AA 4CEEA 2IAJA 3LZJA 3AVGA 4AH9A 3P83D 4CJ4A 1QTMA 2HMIA 2YNIA 4DTNA 4M3XA 4KHYA 2YNFA 3K58A 3S3OA 4KRFA 4DQRA 2IOCA 3HPHA 3HT3A 1HYZA 3JSMA 2XY6A 1SL2A 3KLIA 3MEGA 4AHTA 4PQUA 3WNGA 4M3WA 1DTTA 4CIGA 1C1CA 1C0MA 4DWIA 4EZ9A 3TAGA 1ASVA 1DLOA 3OYCA 4CIEA 4NCBA 4RG8A 4Z4EA 1HRHA 4LY7A 2G8FA 4GW6A 2DY4A 4NCGA 1WAFA 1BQMA 1C0TA 1FKPA 4DSIA 2PYLA 3LALA 1JLQA 1T03A 1RT2A 3C95A 1IKYA 3SQ1A 4IFVA 4N76A 4KB0A 4ID5A 5CY4A 1U04A 4M3YA 2O4IA 2YV0X 4CF2A 3DOKA 3NCIA 4Z4IA 4CHPA 2HNYA 4JS4A 1T8EA 1LWFA 4DMNA 2Z1GA 1W9HA 4Z4FA 4DSFA 2Z1JA 1HQEA 3AVMA 3HVRA 2P51A 3RMAA 4B9NA 2IDOA 3LWLA 3SI6A 3DM2A 4CEFA 2DTUA 1BI4B 4N56A 1XC9A 4FK4A 1JLEA 3HK2A 1GOCA 3NDKA 3SQ0A 1NK9A 1RBTA 4W5RA 4YNQA 1TKDA 5HBMA 4QOZB 4HVJA 3L2QA 4CFAA 4E1MA 3OS1A 2E6MA 3JYTA 4C8OA 1O1WA 2Z1IA 4M3RA 3VQPA 1RTIA 4E7LA 2EX3A 4KREA 3CFPA 4CEOA 1ZBHA 4M45A 3CQ8A 4F4KA 4FJMA 4CJQA 2RPIA 3OYJA 2FBTA 4B08A 4CF1A 3L2UA 1A5XA 1X9WA 3AVIA 3CM6A 1HNIA 1RCHA 2OPPA 3O4NA 5HRPA 2HHTA 1VSHA 4RW9A 1TKTA 3OYFA 1BISA 4H4MA 4BDZA 1KFSA 3VN5A 2PY5A 4PWDA 2HHQA 1BI4A 3AVFA 4E1NA 4BE1A 4FJ8A 1LW2A 4KTQA 1VK0A 3K5NA 4C8KA 4BE0A 4CJLA 2Y1JA 3KKSA 3HJFA 1F21A 4FLXA 4NYFA 3LAKA 4E7IA 1C1BA 1S1WA 3QNOA 4EP5A 2WOMA 4DFPA 4DSJA 2VWKA 4ELUA 5HRSA 1RT1A 1KVCA 5DMRA 3VQQA 3OJUA 1L3VA 1BQNA 4B8CA 3SZ2A 1BCMA 1RBVA 3V1QA 3NFAA 1NK8A 4FK0A 2HHXA 1KTQA 4M41A 4C8NA 4CFDA 4W5TA 1Z26A 3L2VA 1K6YA 4KKOA 4FLUA 1NJYA 4DF4A 3V4IA 1D9FA 3AA2A 3NH1A 3V81A 4L8RB 3OYAA 4ID1A 4CJFA 4IDKA 4E19A 4CGJA 1QSSA 1I39A 4FCYA 1KRPA 3IAYA 3AVLA 3CYMA 1LAWA 3OYGA 4FM0A 1L5UA 1HMVA 3CFRA 3KLEA 3AVJA 1J9AA 1WNSA 2G8WA 2YHBA 3NF7A 4CGFA 1U47A 4ELTA 1HYVA 3L3VA 1D9DA 2PYJA 3G10A 2XY7A 3OYNA 4YFUA 1RT4A 3QETA 3OS2A 3TABA 3NF6A 4CIFA 1Z25A 1KVBA 4KHSA 4J2DA 4CK2A 5CYQA 2FBYA 5KRTA 2HB5A 4KHWA 2FBXA 4NCAA 4CECA 1RDCA 4EP4A 1S1VA 1X1PA 2HHUA 3LPTA 4N5SA 4DTUA 1TKZA 2QKKA 1VSLA 3AVNA 1J54A 1L3TA 2OZMA 1RDBA 1JXBA 2F96A 1LWEA 3AA3A 4RW8A 4Y1CA 5C24A 3F73A 3L8BA 1FK9A 1SKWA 4K8ZA 1JLGA 3O3HA 4J2BA 4OLAA 3AO4A 1CLQA 3QNNA 2KZMA 4FJXA 4DSEA 5HRRA 4BE2A 1C6VA 1VRTA 3MEDA 1U45A 4CCHA 3ZSXA 3RRHA 4LSNA 1Q8IA 1HYSA 1XHXA 3AO3A 1CXQA 4AHSA 1IH7A 4HUGA 1C0UA 3QEXA 2P1JA 2WONA 5J2MA 3TAPA 5HROA 2F8TA 1QHTA 4Z4CA 1A5VA 4OPKA 4IG3A 4PUOA 3HPGA 1B92A 3NF9A 4O55A 4O4GA 3TAMA 4CJVA 3AVKA 3KKRA 4OVLA 2YHAA 5C25A 3K59A 3PUFA 2R7YA 3LAMA 1TK8A 4FLZA 2W42A 1NKCA 5HLFA 4AHVA 4B9LA 4CHYA 3MECA 5CZ2A 3OYMA 4TSXA 3ZSOA 3AA4A 4C8LA 3ZT4A 4KV8A 4I9QA 1BIUA 4CGIA 1Y97A 4CK3A 4CF8A 4GVMA 3SUPA 4M3ZA 1RBRA 4N41A 1C1AA 1JLAA 4E7JA 4DQIA 4OKKA 1RNHA 4B9SA 3VA0A 3LP3A 1QS4A 2KW4A 3LDSA 2XY5A 3QEPA 2B4JA 5JS2A 3OYEA 2GBZA 2X6SA 5KI6A 3DRPA 3V1OA 5EU7A 1ZBFA 1S6PA 2Q3SA 1SL1A 3IS9A 4MFBA 5T7BA 4E7KA 3RTVA 4Z4HA 4DQQA 2YKNA 4LH4A 3L2RA 3CM5A 3E01A 2GUIA 2X78A 2VG6A 4DTMA 2FC0A 3OS0A 3OYHA 3K5MA 3B6OA 4LSLA 3I8DA 3NGIA 3TANA 3BGRA 1WSJA 1KSPA 4KHQA 3NF8A 1I3AA 4OKEA 3ZT0A 4BWMA 3DOLA 4FLVA 4PA1A 4KPYA 3EY1A 1UOCA 2HHVA 4O5BA 4CGGA 4W5QA 4FJHA 5J2NA 4ZTJA 4CJEA 2B5JA 4DU1A 3V6DA 3NAEA 4OJRA 4FW1A 4H4OA 2OZSA 3DLBA 4AHRA 3DLHA 4B9UA 3QEWA 3H08A 3KJVA 3C6UA 3VA3A 3NH0A 4OPJA 4M3UA 3RR8A 2HNZA 4W5NA 4FLWA 1D8YA 1VSFA 4J2EA 4WE1A 3RWUA 1TV6A 1S6QA 3LANA 2QK9A 2ZQBA 4MQ3A 1KCFA 1LWCA 4KO0A 3OYIA 3V9WA 3I0RA 1JKHA 3SPZA 1VSKA 3QO9A 1SL0A 1YTAA 3QIPA 4FLTA 2AJQA 3RRGA 3U3GA 3TARA 4E3SA 2IGIA 1RBSA 1FKOA 4IFYA 4DTPA 1NK4A 3M8QA 3RMDA 4CF0A 2YNHA 1KFDA 2XO7A 3TAQA 4QAGA 4CJWA 1VSJA 2KQ2A 1S9EA 3KD5E 4Y1DA 4LH5A 1KLMA 4DTSA 4DS5A 4KAZA 1WSIA 4HHTA 3K57A 3DYAA 2DFEA 3OJSA 1IO2A 5FROA 1RBUA 3VQDA 3SV4A 4F2SA 2IS3A 3D45A 4E7HA 3VQ9A 1UWBA 1ITGA 3G0ZA
chains in the Genus database with same CATH superfamily
2HNDA 1L3SA 3QDKA 1WAJA 5K14A 1CZBA 1VQON 4BACA 3ZSVA 1NOYA 1BCOA 4DU3A 5AQVA 4DTOA 3C6HA 3ZX0A 5CZ1A 2A1RA 3SCXA 3CCQN 3AA5X 2P9IA 5BN9A 4JI7K 3TI0A 4FWLA 4JI6K 3W3DA 3G4SN 4HUFA 4DV6K 1RDUA 1NJZA 1OVQA 3C7NB 3VQAA 2HMPA 4G1QA 5J1EA 4OGEA 1NGEA 1IKXA 1RT7A 3WXJA 4CK1A 1NGBA 2W6LA 3IFRA 3S3MA 2HBJA 1WN7A 1X9SA 3U6FA 3LWMA 3O3FA 1EKEA 1KAYA 2YKMA 4M63C 2IIRA 4AHUA 4NXNK 1OH7A 4CJRA 1QSYA 3P31A 3FFIA 1D5AA 4FJNA 4YHHK 3O3GA 1GOBA 1A5WA 4B9TA 3Q7BA 3THWA 4ELVA 3AO1A 3F9KA 3SBGA 1UA1A 2I7PA 1Q86O 3ID8A 4OX9K 4BC3A 3LP0A 1GLLO 4CBWA 4UQGA 2QEXN 4LF9K 4KTZA 3GBTA 5BRFA 1HUXA 3ULDA 4H5TA 4CEQA 2OPRA 3ASMA 3ZSZA 4R5PA 4DV4K 2XY8A 3MXJA 3ZSRA 5SZTA 5FDLA 1CXUA 3IDHA 4EAHD 3I0SA 2KZZA 3M1FA 4LD0A 4CESA 3OYBA 4K41A 5F1XA 1X3NA 2BANA 3LDOA 4AHCA 3HZ6A 3PO4A 4C23A 1IBLK 2YHWA 4Z4GA 4O8UA 1RT5A 3SJJA 2VG7A 3AAPA 1EP4A 4BRCA 2P9LB 2E1ZA 5CYMA 4JRQA 1S3XA 2KKZA 3LPUA 3HO1A 1HPZA 3AO2A 3IG1A 4W5OA 1S5JA 3ENHA 4XIUA 1NJWA 4QS8A 3K5LA 3UKRA 2HW3A 2GTDA 3M3ZA 4CHNA 4H03B 3E1YA 5M1NA 1RT6A 1HNWK 1VAZA 4B3OA 3MWPA 1WSGA 5AQOA 4I6MB 4IJAA 4WFAL 1VQKN 2ASOA 3T19A 2EHGA 3SPYA 1U48A 4HCCA 2P5OA 2QA4N 3KVGA 1WUAA 1NOZA 4M7YA 1MDUB 4DLEA 2UU9K 4CGHA 5C42A 4L3QA 3LL3A 3J7ZO 4KBOA 3NVKA 1EETA 3VTHA 2ZD1A 1YT3A 3AAQA 5BPNA 4BWJA 4CFCA 4JI8K 3EEQA 3V1RA 4CVNE 3EKSA 2UXBK 5E41A 1SKSA 4IO8A 3J8AA 3HVTA 1S1TA 5AQLA 2KTQA 5LMNK 3SQ4A 2CGJA 3K9KA 3D2EB 3F9MA 3N4PA 3RSEB 5AQHA 3NGZA 4JKAA 2PAVA 1QE1A 4H5NA 4IOCL 3M8RA 1VQ5N 4DQ8A 1JJ2M 3DLKA 3WEEA 2Q2RA 3HTVA 2W40A 3J7AP 5AZIB 3FZHA 2P9PB 4OGCA 2G8UA 2HOEA 3MAQA 4X64K 3A5MC 3B6PA 3SNNA 5GIPA 3O80A 4ISFA 4CJSA 3QEIA 1QVGM 4FZXC 1XI1A 5I9EB 3RMCA 5KTQA 3P5JA 3BUZB 5KPTA 5F2RA 1DTQA 2ZGYA 3HSTB 4ICLA 1VQNN 3GE1A 3QERA 4FJJA 4CEDA 2QWQA 2ITMA 3VERA 3LDNA 3OW2M 1FXXA 3D6RA 1T05A 2B6AA 4BGBA 2YNIA 4KRFA 3S3OA 4OO1J 4DQRA 3CXCM 2IOCA 3MEGA 4JKCA 3CCRN 1C0MA 4DWIA 3LM9A 1DLOA 2UUBK 4B1ZA 4BREA 1GLEG 4GW6A 4JHDB 1FKPA 1LCUA 4N76A 1FW6A 1U04A 2YV0X 3CERA 4X62K 3WXMB 4YOWA 4Z4IA 4FWOA 3LDQA 4G9ZA 2VGMA 3QICA 4JS4A 2O8EB 1T8EA 4DSFA 2OTLN 1HQEA 3HVRA 4B9NA 2IDOA 1GLJO 3SI6A 3OTOK 1XC9A 3CC2N 3S41A 3HK2A 2QXLA 5E26A 4W5RA 3MX2A 3JYTA 2ASMA 2YJEA 2EX3A 1W97L 3UB5A 1ZBHA 2RPIA 3OYJA 4BRMA 3FR0A 3AVIA 2OPPA 1HR0K 3OYFA 2GWJA 2PY5A 1BI4A 1DT9A 3RSEA 3J80O 4C1NK 3KKSA 3LAKA 1C1BA 1S1WA 2HF4A 1HX1A 3VQQA 1L3VA 4B8CA 3CCMN 1LOTB 2O8FB 2CH6A 1Z26A 1K6YA 1S22A 1YUWA 3HBTA 2ZJPL 3MK6A 3OYAA 4IDKA 4E19A 3DXMB 1KRPA 4FM0A 4ISGA 3CHWA 1HMVA 3ZLJA 1WNSA 4CZGA 3NF7A 4JK9A 1U47A 4ELTA 1D9DA 2PYJA 2XY7A 4YFUA 5KPZA 3FZKA 3NF6A 1Z25A 2I7NA 4BRDA 5CYQA 2QTDA 1BUPA 2QWPA 3LPTA 4DTUA 1VSLA 2A5XA 2O8EA 3IMXA 1L3TA 5C24A 1RDBA 1JXBA 1LWEA 3AA3A 3F73A 3L8BA 1YJNN 1CLQA 4LFAK 4FJXA 3R1XA 1ZBSA 4GV6A 4YOYA 1HYSA 3WXLA 4AHSA 1IH7A 1Q81O 4HUGA 5BREA 3SK3A 4JNEA 3MN5A 5AZJA 1SS6A 2O8DB 4Z4CA 1A5VA 1B92A 4O4GA 4O55A 2A40A 3AVKA 4OVLA 2YHAA 5C25A 3PUFA 4EFHA 1TK8A 1NMDA 2W42A 3MECA 3OYMA 4XEIA 3AGKA 2FXUA 4TSXA 4I9QA 1BIUA 4CF8A 1JLAA 4E7JA 4DQIA 3VA0A 1QS4A 2KW4A 2B4JA 3ZX3A 5EU7A 4MFBA 4BY9C 2Q97A 1VQ8N 5LMUK 3OS0A 3K5MA 4LSLA 1WSJA 1KSPA 3NF8A 4OPHA 3ZT0A 2NNWA 4BWMA 2P9NB 1K8KB 4GKJK 3ENOA 2HHVA 5C10A 4KH4A 4O5BA 4CGGA 3CCUN 2NRHA 3DLHA 3H08A 2H3GX 1HPMA 1M1KO 4WQ4C 4J2EA 1S6QA 2RE2A 3KZBA 3K0SA 3VEVA 3SPZA 4R79A 1VSKA 3QO9A 1YTAA 1XQSC 3U3GA 2ZJRL 4E3SA 1FKOA 4DTPA 1YVNA 2V51B 4CF0A 3TAQA 1S9EA 3CCSN 5IWAK 3K57A 1QQNA 2P9UB 2IS3A 3ATVA 4LC9B 3VQ9A 3OYCA 2G8VA 1U4BA 2CH5A 3CJAA 4ZTFA 3K5OA 3L2WA 1LW0A 4DSKA 3O9UA 3QMLA 3ZEUB 2P9LA 3IKMA 4CERA 4WFBL 5BPMA 4J2AA 1MU2A 4FWRA 4DV5K 3SMSA 1ZBIA 2FSKA 1ASWA 5SWMA 3AVBA 1ZC6A 4CHZA 5M1KA 3TTFA 3KK1A 1HJRA 5AFUH 1LV5A 3PX4A 3P38A 4KI6A 2VWJA 4GY2B 2F8SA 1BG3A 1TVRA 4K43A 4CE9A 4IJNA 4CZMA 4HCBA 1IKWA 3GDQA 5M1PA 2D0CA 1G15A 3MN9A 5GAEP 3B8AX 1NGJA 5KGXA 4HTUA 2OPQA 4B9QA 1YTUA 3THXA 1S1XA 4B9MA 4F3OA 5KGWA 1VRUA 3CMEN 5B8HA 1NNEA 4PKHA 4WQ4A 5JICA 1OH5A 1VSEA 4PKGA 4M42A 4IZ9A 3ITHA 1WSHA 3QINA 4JI3K 3KD1E 4DF8A 2G8IA 3IRXA 2E4LA 5JMVA 3ZT2A 3QLHA 3MEEA 4NLCA 2G8HA 2D1KA 4DTRA 1YVUA 4BR2A 3VGKA 3VQ8A 1GLFO 4PKIA 5ADXA 1BL3A 2ITGA 4GV9A 3C6TA 5HRNA 4ILGB 4NYNA 4BGAA 1BGXT 3VEWA 1YJ9N 4LFBK 4KHPK 2O4GA 4IBNA 5LL6Z 3V9ZA 1VSIA 2P9UA 1WBBA 1TAUA 3U9DA 4OLBA 1VSDA 2D0BA 2GV9A 3HOSA 3H45C 1HKBA 3KLGA 1K8AO 3SBTA 4FJLA 5AZIA 2X6NA 4B8AB 4DQSA 3WQTA 5I3UA 3VQEA 4KFBA 1CZ9A 3E9PA 3DLRA 3A0IX 3I8BA 3WNHA 5JS1A 4DFJA 1JCFA 4H5WA 3HL8A 1J6ZA 4CEBA 3FLCO 4A62A 3U3YA 3U4LA 4PHTX 2BDPA 2ZWHA 3SUQA 4RW6A 2LSNA 4BVOA 1HNVA 1VQ9N 2W41A 3BY5A 4AILC 1B9DA 3HPOA 5D3GA 3T1AA 1IJJA 2O8CB 1EX4A 4OKJA 4DFKA 1JL1A 2YCHA 3A5OC 5AQTA 4HUEA 4ZHRA 1T7PA 3OYLA 3DLGA 3ZSQA 3QIOA 4BG8A 1E3MA 3VQCA 3VEOA 2NRRA 4JKHA 1RTDA 1JLFA 4Q0BA 3OA9A 2E2NA 1NJXA 4JI4K 4GKKK 4H8KA 4AM6A 4KI4A 2HBLA 4DTXA 3QESA 4O5FA 1NM1A 1RT3A 4JI0K 4U7BA 5EY4A 3DMJA 4A5BA 2YJFA 4CJPA 2BGGA 3AVHA 3EE9A 3DRSA 4Y0WA 2DFFA 4BRQA 2BH1A 4IDHA 2QKBA 5J2QA 1ZYQA 4BRAA 1TKXA 5KQ8A 3KK7A 1IG9A 4FW2A 4FO0A 1LAVA 5I42A 4Q5VA 1Q9XA 4FYDA 4CFBA 3SAGA 4DTJA 3MX5A 3LP2A 4E1JA 3VQ6A 3C6AA 4JKBA 4KHNA 4V19S 4EIAA 2IAJA 3Q7CA 4BRNA 4AH9A 1QTMA 4CJ4A 4DTNA 2YNFA 3HOTA 3HPHA 3U8XA 3HT3A 2V7YA 3JSMA 2XY6A 4YOTA 2J4RA 3WNGA 4CIGA 1C1CA 3CJ9A 5AQYA 4GVEA 4A2BA 5FPMA 4Z4EA 4CIEA 1ATSA 4LY7A 3BZCA 4ILJA 3THWB 1NGCA 4BQLA 3PIPL 4DSIA 2PYLA 2NRTA 4DV7K 2UXCK 3C95A 1IKYA 3CCEN 4B1YB 4ID5A 3DXKA 3O4WA 2O4IA 3DOKA 5AQMA 3PIOL 4CHPA 2D4WA 1W9HA 2KHOA 2VWBA 3RMAA 3LWLA 1BI4B 3DXKB 2UYTA 3NDKA 4MLEA 3LDPA 1NK9A 1RBTA 1TKDA 3E9OA 4CFAA 2QW9A 2E6MA 4C8OA 1O1WA 4M3RA 5GINA 4KREA 3CFPA 2A3ZA 3CQ8A 3T1HK 4DR1K 2FBTA 4B1UB 1VSHA 4RW9A 4H4MA 4PWDA 3RVCA 3AVFA 4E1NA 1VK0A 1YIJN 4CJLA 1F21A 4FLXA 4NYFA 3QNOA 3BZKA 4RCHA 4BRIA 5HRSA 2QWMA 1KVCA 4IXCA 4JD2B 1BQNA 5JLHA 2QWLA 3V1QA 1NK8A 1VQPN 1DKGD 1KTQA 4M41A 4C8NA 3ZETB 3L2VA 1NJYA 4KKOA 3V4IA 1NMNA 3V81A 4CJFA 4AQYK 1QSSA 1I39A 3H6EA 3IAYA 1KQSM 3AVLA 3VGLA 5LJWA 4U67L 3CFRA 3KLEA 3AVJA 3CQYA 5C2FA 2YHBA 4CGFA 1OH8A 3CPEA 3JXUA 1RT4A 1Q82O 4LFCK 5KRTA 2Q0RA 1RDCA 1X1PA 3J81O 3WQUA 4N5SA 3FFKB 3AVNA 3CPWM 1SKWA 4K8ZA 3AGRA 4MO5A 2O8BA 3TSUA 4J2BA 4OLAA 3AO4A 4FSVA 3QNNA 1KAZA 3HRGA 1C6VA 1VRTA 1MWKA 4JV5K 1Q8IA 1XHXA 3AO3A 3WEEB 1CXQA 1V4SA 4MLHA 3VEYA 3QEXA 4CZKA 2WONA 4AF1A 3TAPA 2F8TA 4YDUA 5AQGA 3TAMA 4LF8K 1GLAG 2P9SB 1NKCA 4FLZA 5HLFA 1WOQA 4AHVA 4CHYA 4IOAL 3OBWA 4C8LA 3EL2A 3K9JA 1C1AA 4B9SA 3QEPA 3LP3A 5C2DA 5JS2A 4RWTA 1K8KA 1SL1A 3IS9A 4JK8A 2WTUA 4Z4HA 4DQQA 4CZJA 4WQ5C 4BR4A 3CM5A 2GUIA 2VG6A 3OYHA 3B6OA 1U2VB 3I8DA 3TANA 4KHQA 1XMQK 1I3AA 5JLFA 1RFQA 4X65K 4FLVA 4PA1A 4B3RK 3JS6A 3VESA 1ATRA 4FWSA 4FJHA 5J2NA 2B5JA 1VQLN 4OJRA 4H4OA 5FPDA 2HSTA 3BF1A 4AHRA 2HBKA 1WBDA 3VA3A 3NH0A 4OPJA 3O1WA 1GLDG 4M3UA 4W5NA 2E2QA 4BRPA 1NG9A 1TV6A 2QK9A 1NBWA 4MQ3A 3V9WA 5JVGL 3I0RA 1SL0A 3QIPA 2NLXA 5AZJB 2IGIA 1RBSA 4IFYA 4B3TK 2YNHA 3CJ7A 5GIOA 2XO7A 4QAGA 1VSJA 3F5TA 1JCEA 2BUPA 1KLMA 4HHTA 1QQMA 3DYAA 3T69A 3VF2A 3OJSA 1IO2A 5FROA 3EE8A 1RBUA 3VQDA 4MO4A 3SV4A 3D45A 4F2SA 3O9SA 4DR3K 3G0ZA 2WBNA 1TAQA 3THXB 4BROA 4CJUA 2JLEA 3L3UA 4CJKA 1JXEA 3AO5A 3CD6N 5BR8K 1EO1A 3WNFA 2ZF5O 5GADP 1YAGA 1Z6RA 1NU0A 3BDPA 1HJOA 1TL1A 3V9UA 1RILA 4A5AA 3SAHA 2XHBA 4CGDA 3S3NA 2E8AA 1V4TA 4CJ5A 4M7XA 4FK2A 3MN7A 4JKFA 3KLHA 1GOAA 3S9HA 2F9TA 1N5YA 5BPLA 3TR8A 1REVA 3VOVA 1YI2N 4CJ3A 2VG5A 1WSFA 4M3TA 3MXMA 1RGIA 2HF3A 3NH2A 2QXFA 1TK0A 3CJ1A 2D0AA 4FXDA 4FJKA 3UIQA 5MLCQ 4CJTA 3NHGA 4E0DA 4B1VA 3TPQA 2KFNA 4EZ6A 2KLAA 4I9LA 4DG1A 1I94K 4JK7A 2YHXA 3C65A 1N34K 2KFZA 1EWRA 1NGGA 3ZYYX 3PO5A 4E89A 1SV5A 1OVYA 1U49A 3VGMA 4CF9A 4IKFA 3WNEA 5E84A 1QQCA 2RKIA 3V9XA 2UUCK 2NRZA 1XHZA 3E66A 1IKVA 3QFUA 3L4QA 4WCEL 3A2FA 3CJBA 4CD1A 3MN6A 1B9FA 1OKJA 5FPNA 1EWQA 3ULEB 4FJIA 4J8FA 1RTHA 2JWKA 1ZBLA 2FSNA 4QS7A 4CBUA 3VTIA 3LP1A 3KK2A 3VETA 5AFUA 4CHQA 2QWOA 5C15A 4FL9A 1S1UA 3PX6A 1TUYA 3CCJN 4DQPA 4FPBA 3VPZA 4JRPA 1ILYA 1EXQA 1N6QA 2WC9A 3OYKA 3QEVA 2NUBA 4DU4A 4B9VA 4KHUA 4KB1A 5M1QA 4BC2A 4K8XA 3DWLA 1TK5A 2E6LA 4BRGA 4MDAA 4DLGA 3D2FA 1Q18A 3HP9A 1R0AA 1VQ6N 3HP6A 1ZBUA 3BEXA 1Q9YA 5KQDA 3ZSYA 2G8KA 4BR7A 2A41A 1UAXA 3HM9A 2XRIA 3VQBA 3H3NO 4HWIA 3THYA 3KLFA 1W0HA 5FRMA 3CG7A 2AA4A 2X74A 3KWGA 5DM7L 3M8SA 3G6EN 5JVHL 2PFUA 4YOXA 3VQ4A 3GOIA 3A5NC 3VQ5A 5FRNA 1XWLA 4FM1A 4DS4A 3DI6A 1NKBA 4CJ7A 4FZYA 1RTJA 3SQ2A 4CHOA 4DSLA 2ATQA 3K2PA 2WUSA 3AARA 2VQEK 2Z1HA 4CBXA 3D7EO 1NGFA 2HBMA 3AV9A 4F3TA 3SLCA 1SKRA 3FGUA 2OYQA 1NK0A 4BRHA 3TAFA 2P5GA 5DM6L 1T6CA 3O9TA 1VQMN 3HYFA 1RDDA 5AQNA 1QSLA 3VF4A 4CEAA 5AJ3K 3SYZA 2RN2A 2VGNA 5EOYA 4DUYK 5AQWA 2CGLA 3O4QA 3O9RA 2OPSA 1JL2A 3NE6A 3UKUB 1GLCG 4XH1A 4BC5A 4BDPA 2ZJQL 2D5RA 2PZSA 3OY9A 2JGUA 5AQZA 3U9ZA 4FJ9A 4QCLA 1BHLA 1SUQA 1XUPO 3TAEA 1J5OA 4O0JA 3VEZA 2Y1IA 4HTLA 2E2OA 3M8PA 4H5VA 1K9MO 3L6QA 4IWVA 1P90A 4FWKA 3OYDA 2Q31A 2YNGA 1TL3A 3SUOA 4JLHA 1W7AA 3LZJA 5LJVA 3P83D 2HMIA 2IVPA 4KHYA 1X3MA 3C7NA 1C0GA 2P9KB 3SMPA 3KLIA 4AHTA 1M90O 2Q36A 4M3WA 4EZ9A 3TAGA 3I33A 1ASVA 4RG8A 2G8FA 2DY4A 4NCGA 1BQMA 3LALA 3UE5A 1T03A 1RT2A 3FZLA 3SQ1A 2E20A 4IFVA 4KB0A 3G25A 3ZX2A 5BN8A 5AQRA 4DKWA 1QVFM 4CF2A 3A5LC 3NCIA 4B1WB 1GLBG 5IT9O 5BR9A 2YI1A 1LWFA 4DMNA 4Z4FA 4JKGB 3AVMA 3DM2A 2DTUA 2IVNA 4FK4A 4JI2K 5KPRA 3SQ0A 4CW7B 1XMOK 4YNQA 5HBMA 3L2QA 4E1MA 3CJCA 3VQPA 1RTIA 1VQ7N 1U6ZA 4F4KA 2HHQA 3L2UA 1HNIA 3G71N 3O4NA 1NGAA 5HRPA 2HHTA 4BDZA 1BISA 3VN5A 4A2AA 4KTQA 3K5NA 4C8KA 4BE0A 1FJGK 3OHRA 2AP1A 3HJFA 3CI5A 3GG4A 4DFPA 1X9JA 4ELUA 1RT1A 5DMRA 3CCVN 3SZ2A 1BCMA 4CZIA 3NFAA 2ZGZA 5GAGP 4Z94A 3CETA 4CFDA 4FLUA 4DF4A 4FWNA 4B3MK 3AA2A 1HNZK 4ID1A 4FCYA 5EX5A 1KAXA 1LAWA 4K25A 3OYGA 4H0OA 3H3OB 2P9IB 3H1QA 2P9KA 3TU5A 2VCPA 1Y64A 2BTFA 5TKWA 3TABA 4CIFA 3SAFA 4KHSA 1P8ZA 5AQSA 4CK2A 3EO3A 1CZAN 4NCAA 3BF3A 4EP4A 1S1VA 1XNQK 1N33K 1J54A 1T6DA 2F96A 4FWPA 4K0KK 5AQXA 3THYB 2NZTA 3CQXA 3VF6A 5F0XA 1G99A 3CIPA 1IBKK 5CR4A 5HRRA 3CMAN 3D2FB 4XH5A 4CCHA 3M6GA 3ZSXA 3RRHA 4LSNA 4FVUA 1H1VA 1IG8A 1YJWN 2P1JA 3I55N 5J2MA 1NLVA 4OPKA 4IG3A 3HI0A 3HPGA 3NF9A 3K59A 2R7YA 1NWKA 5CZ2A 4KV8A 4H0YB 3M5RA 3O6WA 5HL7L 4CK3A 1BA0A 1Y97A 3SUPA 2YHYA 4JI5K 4M3ZA 4N41A 3ULEA 5C0YA 2FF6A 4OKKA 4BR9A 1UA0A 2X6SA 5KI6A 3V1OA 5M1FA 3O08A 4B3SK 5T7BA 4CI6A 4E7KA 3RTVA 1MWMA 4JEPA 4DR2K 3E01A 4DV1K 1QZ5A 3KWIA 3BGRA 2QI2A 4OKEA 1MA9B 4KH6A 3DOLA 4KH5A 3EY1A 2JWLA 4WFNL 3QFPA 4O8KA 4ZTJA 3WT0A 3NAEA 3DLBA 3QEWA 5TKYA 4AM7A 3KJVA 4YORA 5CE3A 2HNZA 4FLWA 1D8YA 4WE1A 1NJIO 3MDQA 1IV0A 4BRFA 3DLLL 2ZQBA 1KCFA 1LWCA 1TYQB 4KO0A 3OYIA 1JKHA 3TARA 2Q1NA 2A6AA 5ELZA 1BO5O 3ATUA 4CJWA 2KQ2A 4NO7A 3KD5E 4LH5A 4FWMA 4DTSA 2QM1A 1YF5L 2DFEA 3WUHA 4NLBA 5FLXO 4E7HA 4JN4A 1UWBA 4JD2A 2IC3A 4IOXA 2GUPA 1HKCA 4H0XB 4YOUA 2E2PA 3EN9A 3NGYA 4DR4K 5KRSA 4JAXA 2GWKA 4O44A 3CC7N 3SV3A 4LF6K 3ZT1A 3SUNA 1NGIA 3VQ7A 1ASUA 5AQQA 3LZIA 1NGDA 1VHXA 4PY5A 3C94A 4JS5A 3DXMA 1HQUA 2QWNA 1QZ6A 5J2PA 1HKGA 2PBDA 3PV8A 1WSEA 4B1XB 2I5JA 1DGKN 1KLNA 2ETJA 3ISNC 1VSMA 5EVZA 2CGKA 2ZM6K 3A8YA 2HHSA 3WXKA 4DFMA 3ID6A 4BG9A 2VYPA 5AQJA 3DRRA 3ZCMA 5AQFA 1S9GA 4JHDA 4Z0UA 3ZSWA 3FZMA 3TSPA 1J5EK 2WFBA 3N4QA 4NB4A 3C0BA 3ZT3A 3CC4N 2D0OA 3DLEA 3D0PA 3T3FA 5HP1A 2OA8A 1S72N 2FBVA 5AQIA 1NK6A 1L3UA 1NK5A 1NGHA 1HNXK 2OCEA 5HOOA 1BDGA 1WLJA 4I2PA 3OBYA 3KTQA 4I7FA 3RMBA 3F2KA 2HHWA 4K42A 3EYZA 4F2RA 2E88A 4A61A 4DU1A 4FLYA 2BE2A 2W6KA 3RR7A 3O8MA 2YX6A 4MDBA 3CF5L 2O8DA 1YHQN 2FSJA 4OPAA 4O0IA 4WYBA 3TWHA 4F9OA 4RW4A 1TYQA 5A2QO 3IUCA 3O9QA 4PL8A 4IEIA 5AR0A 2GX9A 3HXMA 2A1SA 3TSQA 3J7YP 3EZ5A 2VQFK 4GMJB 2F4VK 1N32K 5BRDA 4FJGA 3AVAA 2UXDK 3O1BA 1C0FA 1X9MA 2RF2A 3V9SA 1RDAA 3R3LA 4H0TB 3MXIA 4C8MA 4I2QA 1U2VA 4F8RA 4JKDA 2HVIA 1YITN 2ZE2A 4BDYA 4YY3K 1JLCA 4QS9A 4FJ5A 1XNRK 3NBPA 3DJCA 4BVPA 4C1NI 3MMVA 3FE1A 4DCHA 3P1GA 3H1VX 1BA1A 3HM8A 4BR0A 3OVNA 4A57A 2ASPA 1TGOA 1J53A 2RHKA 4N47A 2A42A 4X66K 1BWFO 4CEZA 1Q7YO 4FJ7A 3ENBA 3L4IA 1Z05A 1BIZA 2IVOA 4FOIA 5DK5A 1T44A 3T7ZA 3CCLN 4FZZA 4FWQA 5M1OA 3THVA 3PY8A 2E1YA 2DFHA 4GNIA 4RW7A 4BQZA 3AVCA 3QBXA 2NRWA 4FM2A 2HVHA 1NKEA 3JAMO 3PX0A 1NK7A 3PSIA 1QQOA 4KTWA 4DV2K 4IO9L 1ATNA 3KIOA 1SQKA 1JLBA 4IG0A 3UKRB 4GV3A 4H0PA 2HHHK 4CZLA 4YDUC 4RTFD 4FVMA 4LF7K 3T1YK 3KK3A 3NMUA 3ALYA 3P39A 3BP8A 1KVAA 3CFOA 2P9SA 4CEEA 1N8RO 3AVGA 3VEXA 1JCGA 4M3XA 2GEMA 3K58A 1SL2A 1HYZA 1SZ2A 3FZFA 4PQUA 1DTTA 1N36K 4NCBA 1HRHA 2Q0UA 4CZFA 5AQPA 1WAFA 1C0TA 1K73O 5CHIA 1JLQA 1EQYA 2FF3B 3P4IA 5CY4A 4M3YA 2O8BB 4UY8O 4DR5K 2HNYA 1W2BM 3LM2A 2Z1GA 2Z1JA 2P51A 4A59A 4WQ5A 4CEFA 4DV3K 4N56A 1JLEA 4EHTA 1GOCA 4JI1K 4QOZB 4HVJA 3OS1A 4CD3A 2Z1IA 4E7LA 2P9PA 3O5BA 4CEOA 2E5LK 4M45A 4FJMA 4CJQA 1KC8O 4B08A 1A5XA 1X9WA 3CM6A 1RCHA 3EKUA 2GELA 4DV0K 1QHAA 1TUUA 1TKTA 4DB3A 1KFSA 4FJ8A 5EXWA 4BE1A 1LW2A 1D4XA 3TTCA 3ZETA 2Y1JA 4PL7A 3MCPA 2O8FA 4JKGA 3WXIA 4E7IA 3ZEUA 4H5RA 4EP5A 2WOMA 4WF9L 4DSJA 2VWKA 4DUZK 3OJUA 5AQKA 3HSCA 1RBVA 4FK0A 2HHXA 5H1SQ 4IEEA 1KXPA 1R59O 4W5TA 4BRKA 2V7ZA 3L0QA 1D9FA 3R9PA 3NH1A 4L8RB 2DPNA 4IFEA 4CGJA 3CYMA 1L5UA 3VENA 4DR7K 1J9AA 1YXQA 3W0LA 2G8WA 1WB9A 4I6MA 1HYVA 3L3VA 3G10A 4DHYA 3OYNA 3PLAA 4FPAA 3OS2A 3QETA 4ISEA 1KVBA 5ADXH 2V52B 4J2DA 2FBYA 1BOTO 2HB5A 4KHWA 2FBXA 4CECA 2HHUA 2OTJN 1TKZA 2QKKA 3I56N 1T3VA 2OZMA 2NRVA 4DR6K 4RW8A 4Y1CA 1VQ4N 2NRXA 5FPEA 1FK9A 1JLGA 3O3HA 1IBMK 1E4GT 2P9NA 2KZMA 4DSEA 4XH4A 4BE2A 1O13A 3MEDA 3R8EA 3MCAB 1U45A 4LF5K 1C0UA 3UKUA 4EHUA 3PSFA 5C12A 5HROA 1QHTA 4PUOA 1OH6A 3NVMA 4CJVA 4CZHA 4LF4K 1KD1O 4YOVA 3KKRA 4JYAK 3LAMA 4B9LA 4NXMK 3ZSOA 3AA4A 3ZT4A 5GAHP 3DAWA 4FOEA 4CGIA 4GVMA 1RBRA 1RNHA 3LDSA 3MWTA 2XY5A 3OYEA 2GBZA 3DRPA 3E9LA 1E4FT 1ZBFA 1S6PA 2Q3SA 1RDWX 3H46O 4ILHA 3KHYA 1DEJA 2QWRA 2YKNA 4LH4A 3L2RA 1HLUA 2X78A 4DTMA 4BRLA 3R6MA 3SJHA 2FC0A 3NGIA 4CZEA 1BU6O 2D0PA 4JKEA 3D2EA 4KPYA 1UOCA 1SAZA 4W5QA 4CJEA 3V6DA 1XC3A 2F7TA 2FLOA 4FW1A 2OZSA 5BRHA 5AQUA 4B9UA 3LDLA 3C6UA 3AY9A 2UUAK 3RR8A 1VSFA 3RWUA 2F9WA 3LANA 2OANA 1ZXOA 4BR5A 2AJQA 4FLTA 3RRGA 2EWSA 2O8CA 1NK4A 3M8QA 3RMDA 5LY3A 1KFDA 4BC4A 3EZWA 4H0VB 4Y1DA 3QBWA 3GL1A 1ESVA 4DS5A 3QB0A 4KAZA 1WSIA 3TTDA 3VMFB 4CF1A 1ITGA
chains in the Genus database with same CATH topology
2HNDA 1L3SA 2G8VA 1TAQA 1WAJA 5K14A 1CZBA 4CJUA 1U4BA 2JLEA 3L3UA 4ZTFA 3K5OA 3L2WA 1LW0A 1JXEA 3AO5A 4CJKA 2IC3A 4BACA 4DSKA 3WNFA 3ZSVA 4CERA 4J2AA 3BDPA 1NOYA 1MU2A 3NGYA 1BCOA 1ZBIA 1TL1A 3V9UA 5KRSA 4DU3A 1RILA 1ASWA 4DTOA 2XHBA 5SWMA 3AVBA 4CHZA 4O44A 5CZ1A 4CGDA 3KK1A 2A1RA 3SCXA 3SV3A 3ZT1A 3S3NA 3SUNA 1HJRA 3AA5X 3VQ7A 1ASUA 1LV5A 4CJ5A 3PX4A 4FK2A 3LZIA 4PY5A 3C94A 3KLHA 4JS5A 3TI0A 1GOAA 1HQUA 3S9HA 2VWJA 1N5YA 4KI6A 3TR8A 4HUFA 1REVA 2F8SA 5J2PA 4CJ3A 2VG5A 1NJZA 3VQAA 3PV8A 1WSEA 1WSFA 4G1QA 3MXMA 4M3TA 1TVRA 2I5JA 4CE9A 4OGEA 5J1EA 3NH2A 2QXFA 1TK0A 4HCBA 1IKXA 1IKWA 1RT7A 4CK1A 2D0AA 3S3MA 4FXDA 2D0CA 4FJKA 1KLNA 3UIQA 2ETJA 1G15A 3ISNC 1VSMA 4CJTA 5KGXA 1WN7A 4HTUA 3NHGA 2OPQA 3U6FA 1X9SA 4E0DA 2HHSA 3LWMA 4DFMA 3O3FA 1EKEA 2YKMA 3DRRA 1YTUA 2KFNA 4EZ6A 3ZCMA 4AHUA 1S9GA 1S1XA 4I9LA 4DG1A 4CJRA 4B9MA 4F3OA 5KGWA 4Z0UA 3ZSWA 1VRUA 1QSYA 3FFIA 2KFZA 1D5AA 4FJNA 1VSEA 3PO5A 4E89A 1SV5A 4M42A 3O3GA 1GOBA 1A5WA 4B9TA 3ITHA 1WSHA 3ZT3A 1U49A 3QINA 4ELVA 3KD1E 3AO1A 3F9KA 4DF8A 2G8IA 1UA1A 3IRXA 2E4LA 3DLEA 3D0PA 4CF9A 3T3FA 5HP1A 2OA8A 3WNEA 3ZT2A 3LP0A 2FBVA 3QLHA 4IKFA 1NK6A 1QQCA 2RKIA 1L3UA 3MEEA 3V9XA 1NK5A 4UQGA 2G8HA 4KTZA 4DTRA 1YVUA 1WLJA 1XHZA 1IKVA 3VQ8A 3A2FA 4I2PA 3KTQA 1B9FA 4I7FA 3RMBA 1BL3A 2ITGA 3ULDA 3C6TA 2HHWA 5HRNA 3EYZA 4F2RA 4CEQA 4FJIA 2OPRA 3ASMA 4NYNA 3ZSZA 4R5PA 1BGXT 1RTHA 1ZBLA 3KK2A 3LP1A 2O4GA 2XY8A 3MXJA 4IBNA 1VSIA 3ZSRA 4CHQA 5SZTA 4FLYA 3V9ZA 2BE2A 5FDLA 1CXUA 1S1UA 3PX6A 3RR7A 3I0SA 4OLBA 1VSDA 2KZZA 2D0BA 1TAUA 4DQPA 4JRPA 4LD0A 4CESA 3OYBA 2GV9A 1EXQA 1N6QA 2BANA 3OYKA 3KLGA 3QEVA 4AHCA 2NUBA 4FJLA 4DU4A 2X6NA 4B8AB 4O0IA 4DQSA 4B9VA 3PO4A 4KHUA 3TWHA 4KB1A 4K8XA 5I3UA 3VQEA 4KFBA 1CZ9A 1TK5A 2E6LA 3DLRA 4DLGA 1R0AA 4RW4A 3HP9A 3WNHA 4Z4GA 3HP6A 1RT5A 3SJJA 2VG7A 4DFJA 5JS1A 1ZBUA 3HXMA 2A1SA 1Q9YA 1EP4A 3ZSYA 2G8KA 3EZ5A 3HM9A 1UAXA 2XRIA 3HL8A 3VQBA 4GMJB 3KLFA 1W0HA 5CYMA 4CEBA 4JRQA 4FJGA 3AVAA 5FRMA 3LPUA 3HO1A 3U3YA 1HPZA 2X74A 3CG7A 3AO2A 2RF2A 1X9MA 3IG1A 3M8SA 4W5OA 1S5JA 4XIUA 3V9SA 1NJWA 1RDAA 3VQ4A 3K5LA 3MXIA 4C8MA 3VQ5A 2BDPA 5FRNA 2HW3A 3SUQA 1UA0A 4I2QA 1XWLA 4RW6A 2LSNA 4CHNA 1HNVA 1RT6A 4F8RA 4B3OA 4FM1A 4DS4A 4AILC 1B9DA 1WSGA 3DI6A 3HPOA 5D3GA 3T1AA 1NKBA 2HVIA 2ZE2A 4BDYA 1JLCA 4FJ5A 3T19A 2EHGA 3SPYA 3NBPA 1U48A 1RTJA 4FZYA 4HCCA 1EX4A 4OKJA 3SQ2A 4CHOA 4DFKA 2P5OA 4DSLA 2ATQA 3K2PA 1JL1A 1NOZA 2Z1HA 4HUEA 3P1GA 4ZHRA 1T7PA 3AV9A 3OYLA 3DLGA 4DLEA 4F3TA 1SKRA 2OYQA 4CGHA 5C42A 1NK0A 3OVNA 3ZSQA 1EETA 1TGOA 3QIOA 3TAFA 1J53A 4N47A 2ZD1A 1YT3A 2P5GA 3VQCA 4BWJA 4CFCA 1RTDA 4CEZA 1JLFA 4FJ7A 3HYFA 4Q0BA 3V1RA 1RDDA 1NJXA 1QSLA 5E41A 1SKSA 1BIZA 4CEAA 3HVTA 1S1TA 2RN2A 5DK5A 4H8KA 3SYZA 4KI4A 2KTQA 4DTXA 3QESA 3SQ4A 3O4QA 4FZZA 3NGZA 3THVA 1RT3A 3PY8A 1QE1A 2OPSA 1JL2A 3NE6A 3M8RA 3DMJA 2DFHA 4BDPA 3DLKA 4RW7A 3AVCA 2D5RA 4FM2A 4CJPA 2PZSA 3OY9A 2JGUA 1NKEA 4FJ9A 2BGGA 4QCLA 2HVHA 3PX0A 1NK7A 1BHLA 3AVHA 4OGCA 2G8UA 4KTWA 1SUQA 3DRSA 3TAEA 1J5OA 3MAQA 4O0JA 3KIOA 2DFFA 2Y1IA 1JLBA 3B6PA 4IG0A 3SNNA 2QKBA 4CJSA 3QEIA 5J2QA 4FZXC 1XI1A 3RMCA 1ZYQA 5KTQA 1TKXA 3M8PA 3P5JA 1IG9A 4FVMA 4FW2A 1DTQA 3HSTB 1LAVA 4ICLA 5I42A 4Q5VA 1Q9XA 3QERA 4FJJA 4CFBA 4DTJA 4FYDA 3KK3A 4CEDA 3LP2A 3ALYA 3OYDA 3VQ6A 2YNGA 1TL3A 1KVAA 3CFOA 4KHNA 1FXXA 3SUOA 4JLHA 1T05A 2B6AA 4CEEA 2IAJA 3LZJA 3AVGA 4AH9A 3P83D 4CJ4A 1QTMA 2HMIA 2YNIA 4DTNA 4M3XA 4KHYA 2YNFA 3K58A 3S3OA 4KRFA 4DQRA 2IOCA 3HPHA 3HT3A 1HYZA 3JSMA 2XY6A 1SL2A 3KLIA 3MEGA 4AHTA 4PQUA 3WNGA 4M3WA 1DTTA 4CIGA 1C1CA 1C0MA 4DWIA 4EZ9A 3TAGA 1ASVA 1DLOA 3OYCA 4CIEA 4NCBA 4RG8A 4Z4EA 1HRHA 4LY7A 2G8FA 4GW6A 2DY4A 4NCGA 1WAFA 1BQMA 1C0TA 1FKPA 4DSIA 2PYLA 3LALA 1JLQA 1T03A 1RT2A 3C95A 1IKYA 3SQ1A 4IFVA 4N76A 4KB0A 4ID5A 5CY4A 1U04A 4M3YA 2O4IA 2YV0X 4CF2A 3DOKA 3NCIA 4Z4IA 4CHPA 2HNYA 4JS4A 1T8EA 1LWFA 4DMNA 2Z1GA 1W9HA 4Z4FA 4DSFA 2Z1JA 1HQEA 3AVMA 3HVRA 2P51A 3RMAA 4B9NA 2IDOA 3LWLA 3SI6A 3DM2A 4CEFA 2DTUA 1BI4B 4N56A 1XC9A 4FK4A 1JLEA 3HK2A 1GOCA 3NDKA 3SQ0A 1NK9A 1RBTA 4W5RA 4YNQA 1TKDA 5HBMA 4QOZB 4HVJA 3L2QA 4CFAA 4E1MA 3OS1A 2E6MA 3JYTA 4C8OA 1O1WA 2Z1IA 4M3RA 3VQPA 1RTIA 4E7LA 2EX3A 4KREA 3CFPA 4CEOA 1ZBHA 4M45A 3CQ8A 4F4KA 4FJMA 4CJQA 2RPIA 3OYJA 2FBTA 4B08A 4CF1A 3L2UA 1A5XA 1X9WA 3AVIA 3CM6A 1HNIA 1RCHA 2OPPA 3O4NA 5HRPA 2HHTA 1VSHA 4RW9A 1TKTA 3OYFA 1BISA 4H4MA 4BDZA 1KFSA 3VN5A 2PY5A 4PWDA 2HHQA 1BI4A 3AVFA 4E1NA 4BE1A 4FJ8A 1LW2A 4KTQA 1VK0A 3K5NA 4C8KA 4BE0A 4CJLA 2Y1JA 3KKSA 3HJFA 1F21A 4FLXA 4NYFA 3LAKA 4E7IA 1C1BA 1S1WA 3QNOA 4EP5A 2WOMA 4DFPA 4DSJA 2VWKA 4ELUA 5HRSA 1RT1A 1KVCA 5DMRA 3VQQA 3OJUA 1L3VA 1BQNA 4B8CA 3SZ2A 1BCMA 1RBVA 3V1QA 3NFAA 1NK8A 4FK0A 2HHXA 1KTQA 4M41A 4C8NA 4CFDA 4W5TA 1Z26A 3L2VA 1K6YA 4KKOA 4FLUA 1NJYA 4DF4A 3V4IA 1D9FA 3AA2A 3NH1A 3V81A 4L8RB 3OYAA 4ID1A 4CJFA 4IDKA 4E19A 4CGJA 1QSSA 1I39A 4FCYA 1KRPA 3IAYA 3AVLA 3CYMA 1LAWA 3OYGA 4FM0A 1L5UA 1HMVA 3CFRA 3KLEA 3AVJA 1J9AA 1WNSA 2G8WA 2YHBA 3NF7A 4CGFA 1U47A 4ELTA 1HYVA 3L3VA 1D9DA 2PYJA 3G10A 2XY7A 3OYNA 4YFUA 1RT4A 3QETA 3OS2A 3TABA 3NF6A 4CIFA 1Z25A 1KVBA 4KHSA 4J2DA 4CK2A 5CYQA 2FBYA 5KRTA 2HB5A 4KHWA 2FBXA 4NCAA 4CECA 1RDCA 4EP4A 1S1VA 1X1PA 2HHUA 3LPTA 4N5SA 4DTUA 1TKZA 2QKKA 1VSLA 3AVNA 1J54A 1L3TA 2OZMA 1RDBA 1JXBA 2F96A 1LWEA 3AA3A 4RW8A 4Y1CA 5C24A 3F73A 3L8BA 1FK9A 1SKWA 4K8ZA 1JLGA 3O3HA 4J2BA 4OLAA 3AO4A 1CLQA 3QNNA 2KZMA 4FJXA 4DSEA 5HRRA 4BE2A 1C6VA 1VRTA 3MEDA 1U45A 4CCHA 3ZSXA 3RRHA 4LSNA 1Q8IA 1HYSA 1XHXA 3AO3A 1CXQA 4AHSA 1IH7A 4HUGA 1C0UA 3QEXA 2P1JA 2WONA 5J2MA 3TAPA 5HROA 2F8TA 1QHTA 4Z4CA 1A5VA 4OPKA 4IG3A 4PUOA 3HPGA 1B92A 3NF9A 4O55A 4O4GA 3TAMA 4CJVA 3AVKA 3KKRA 4OVLA 2YHAA 5C25A 3K59A 3PUFA 2R7YA 3LAMA 1TK8A 4FLZA 2W42A 1NKCA 5HLFA 4AHVA 4B9LA 4CHYA 3MECA 5CZ2A 3OYMA 4TSXA 3ZSOA 3AA4A 4C8LA 3ZT4A 4KV8A 4I9QA 1BIUA 4CGIA 1Y97A 4CK3A 4CF8A 4GVMA 3SUPA 4M3ZA 1RBRA 4N41A 1C1AA 1JLAA 4E7JA 4DQIA 4OKKA 1RNHA 4B9SA 3VA0A 3LP3A 1QS4A 2KW4A 3LDSA 2XY5A 3QEPA 2B4JA 5JS2A 3OYEA 2GBZA 2X6SA 5KI6A 3DRPA 3V1OA 5EU7A 1ZBFA 1S6PA 2Q3SA 1SL1A 3IS9A 4MFBA 5T7BA 4E7KA 3RTVA 4Z4HA 4DQQA 2YKNA 4LH4A 3L2RA 3CM5A 3E01A 2GUIA 2X78A 2VG6A 4DTMA 2FC0A 3OS0A 3OYHA 3K5MA 3B6OA 4LSLA 3I8DA 3NGIA 3TANA 3BGRA 1WSJA 1KSPA 4KHQA 3NF8A 1I3AA 4OKEA 3ZT0A 4BWMA 3DOLA 4FLVA 4PA1A 4KPYA 3EY1A 1UOCA 2HHVA 4O5BA 4CGGA 4W5QA 4FJHA 5J2NA 4ZTJA 4CJEA 2B5JA 4DU1A 3V6DA 3NAEA 4OJRA 4FW1A 4H4OA 2OZSA 3DLBA 4AHRA 3DLHA 4B9UA 3QEWA 3H08A 3KJVA 3C6UA 3VA3A 3NH0A 4OPJA 4M3UA 3RR8A 2HNZA 4W5NA 4FLWA 1D8YA 1VSFA 4J2EA 4WE1A 3RWUA 1TV6A 1S6QA 3LANA 2QK9A 2ZQBA 4MQ3A 1KCFA 1LWCA 4KO0A 3OYIA 3V9WA 3I0RA 1JKHA 3SPZA 1VSKA 3QO9A 1SL0A 1YTAA 3QIPA 4FLTA 2AJQA 3RRGA 3U3GA 3TARA 4E3SA 2IGIA 1RBSA 1FKOA 4IFYA 4DTPA 1NK4A 3M8QA 3RMDA 4CF0A 2YNHA 1KFDA 2XO7A 3TAQA 4QAGA 4CJWA 1VSJA 2KQ2A 1S9EA 3KD5E 4Y1DA 4LH5A 1KLMA 4DTSA 4DS5A 4KAZA 1WSIA 4HHTA 3K57A 3DYAA 2DFEA 3OJSA 1IO2A 5FROA 1RBUA 3VQDA 3SV4A 4F2SA 2IS3A 3D45A 4E7HA 3VQ9A 1UWBA 1ITGA 3G0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HND A;  1L3S A;  2G8V A;  1TAQ A;  1WAJ A;  5K14 A;  1CZB A;  4CJU A;  1U4B A;  2JLE A;  3L3U A;  4ZTF A;  3K5O A;  3L2W A;  1LW0 A;  1JXE A;  3AO5 A;  4CJK A;  2IC3 A;  4BAC A;  4DSK A;  3WNF A;  3ZSV A;  4CER A;  4J2A A;  3BDP A;  1NOY A;  1MU2 A;  3NGY A;  1BCO A;  1ZBI A;  1TL1 A;  3V9U A;  5KRS A;  4DU3 A;  1RIL A;  1ASW A;  4DTO A;  2XHB A;  5SWM A;  3AVB A;  4CHZ A;  4O44 A;  5CZ1 A;  4CGD A;  3KK1 A;  2A1R A;  3SCX A;  3SV3 A;  3ZT1 A;  3S3N A;  3SUN A;  1HJR A;  3AA5 X;  3VQ7 A;  1ASU A;  1LV5 A;  4CJ5 A;  3PX4 A;  4FK2 A;  3LZI A;  4PY5 A;  3C94 A;  3KLH A;  4JS5 A;  3TI0 A;  1GOA A;  1HQU A;  3S9H A;  2VWJ A;  1N5Y A;  4KI6 A;  3TR8 A;  4HUF A;  1REV A;  2F8S A;  5J2P A;  4CJ3 A;  2VG5 A;  1NJZ A;  3VQA A;  3PV8 A;  1WSE A;  1WSF A;  4G1Q A;  3MXM A;  4M3T A;  1TVR A;  2I5J A;  4CE9 A;  4OGE A;  5J1E A;  3NH2 A;  2QXF A;  1TK0 A;  4HCB A;  1IKX A;  1IKW A;  1RT7 A;  4CK1 A;  2D0A A;  3S3M A;  4FXD A;  2D0C A;  4FJK A;  1KLN A;  3UIQ A;  2ETJ A;  1G15 A;  3ISN C;  1VSM A;  4CJT A;  5KGX A;  1WN7 A;  4HTU A;  3NHG A;  2OPQ A;  3U6F A;  1X9S A;  4E0D A;  2HHS A;  3LWM A;  4DFM A;  3O3F A;  1EKE A;  2YKM A;  3DRR A;  1YTU A;  2KFN A;  4EZ6 A;  3ZCM A;  4AHU A;  1S9G A;  1S1X A;  4I9L A;  4DG1 A;  4CJR A;  4B9M A;  4F3O A;  5KGW A;  4Z0U A;  3ZSW A;  1VRU A;  1QSY A;  3FFI A;  2KFZ A;  1D5A A;  4FJN A;  1VSE A;  3PO5 A;  4E89 A;  1SV5 A;  4M42 A;  3O3G A;  1GOB A;  1A5W A;  4B9T A;  3ITH A;  1WSH A;  3ZT3 A;  1U49 A;  3QIN A;  4ELV A;  3KD1 E;  3AO1 A;  3F9K A;  4DF8 A;  2G8I A;  1UA1 A;  3IRX A;  2E4L A;  3DLE A;  3D0P A;  4CF9 A;  3T3F A;  5HP1 A;  2OA8 A;  3WNE A;  3ZT2 A;  3LP0 A;  2FBV A;  3QLH A;  4IKF A;  1NK6 A;  1QQC A;  2RKI A;  1L3U A;  3MEE A;  3V9X A;  1NK5 A;  4UQG A;  2G8H A;  4KTZ A;  4DTR A;  1YVU A;  1WLJ A;  1XHZ A;  1IKV A;  3VQ8 A;  3A2F A;  4I2P A;  3KTQ A;  1B9F A;  4I7F A;  3RMB A;  1BL3 A;  2ITG A;  3ULD A;  3C6T A;  2HHW A;  5HRN A;  3EYZ A;  4F2R A;  4CEQ A;  4FJI A;  2OPR A;  3ASM A;  4NYN A;  3ZSZ A;  4R5P A;  1BGX T;  1RTH A;  1ZBL A;  3KK2 A;  3LP1 A;  2O4G A;  2XY8 A;  3MXJ A;  4IBN A;  1VSI A;  3ZSR A;  4CHQ A;  5SZT A;  4FLY A;  3V9Z A;  2BE2 A;  5FDL A;  1CXU A;  1S1U A;  3PX6 A;  3RR7 A;  3I0S A;  4OLB A;  1VSD A;  2KZZ A;  2D0B A;  1TAU A;  4DQP A;  4JRP A;  4LD0 A;  4CES A;  3OYB A;  2GV9 A;  1EXQ A;  1N6Q A;  2BAN A;  3OYK A;  3KLG A;  3QEV A;  4AHC A;  2NUB A;  4FJL A;  4DU4 A;  2X6N A;  4B8A B;  4O0I A;  4DQS A;  4B9V A;  3PO4 A;  4KHU A;  3TWH A;  4KB1 A;  4K8X A;  5I3U A;  3VQE A;  4KFB A;  1CZ9 A;  1TK5 A;  2E6L A;  3DLR A;  4DLG A;  1R0A A;  4RW4 A;  3HP9 A;  3WNH A;  4Z4G A;  3HP6 A;  1RT5 A;  3SJJ A;  2VG7 A;  4DFJ A;  5JS1 A;  1ZBU A;  3HXM A;  2A1S A;  1Q9Y A;  1EP4 A;  3ZSY A;  2G8K A;  3EZ5 A;  3HM9 A;  1UAX A;  2XRI A;  3HL8 A;  3VQB A;  4GMJ B;  3KLF A;  1W0H A;  5CYM A;  4CEB A;  4JRQ A;  4FJG A;  3AVA A;  5FRM A;  3LPU A;  3HO1 A;  3U3Y A;  1HPZ A;  2X74 A;  3CG7 A;  3AO2 A;  2RF2 A;  1X9M A;  3IG1 A;  3M8S A;  4W5O A;  1S5J A;  4XIU A;  3V9S A;  1NJW A;  1RDA A;  3VQ4 A;  3K5L A;  3MXI A;  4C8M A;  3VQ5 A;  2BDP A;  5FRN A;  2HW3 A;  3SUQ A;  1UA0 A;  4I2Q A;  1XWL A;  4RW6 A;  2LSN A;  4CHN A;  1HNV A;  1RT6 A;  4F8R A;  4B3O A;  4FM1 A;  4DS4 A;  4AIL C;  1B9D A;  1WSG A;  3DI6 A;  3HPO A;  5D3G A;  3T1A A;  1NKB A;  2HVI A;  2ZE2 A;  4BDY A;  1JLC A;  4FJ5 A;  3T19 A;  2EHG A;  3SPY A;  3NBP A;  1U48 A;  1RTJ A;  4FZY A;  4HCC A;  1EX4 A;  4OKJ A;  3SQ2 A;  4CHO A;  4DFK A;  2P5O A;  4DSL A;  2ATQ A;  3K2P A;  1JL1 A;  1NOZ A;  2Z1H A;  4HUE A;  3P1G A;  4ZHR A;  1T7P A;  3AV9 A;  3OYL A;  3DLG A;  4DLE A;  4F3T A;  1SKR A;  2OYQ A;  4CGH A;  5C42 A;  1NK0 A;  3OVN A;  3ZSQ A;  1EET A;  1TGO A;  3QIO A;  3TAF A;  1J53 A;  4N47 A;  2ZD1 A;  1YT3 A;  2P5G A;  3VQC A;  4BWJ A;  4CFC A;  1RTD A;  4CEZ A;  1JLF A;  4FJ7 A;  3HYF A;  4Q0B A;  3V1R A;  1RDD A;  1NJX A;  1QSL A;  5E41 A;  1SKS A;  1BIZ A;  4CEA A;  3HVT A;  1S1T A;  2RN2 A;  5DK5 A;  4H8K A;  3SYZ A;  4KI4 A;  2KTQ A;  4DTX A;  3QES A;  3SQ4 A;  3O4Q A;  4FZZ A;  3NGZ A;  3THV A;  1RT3 A;  3PY8 A;  1QE1 A;  2OPS A;  1JL2 A;  3NE6 A;  3M8R A;  3DMJ A;  2DFH A;  4BDP A;  3DLK A;  4RW7 A;  3AVC A;  2D5R A;  4FM2 A;  4CJP A;  2PZS A;  3OY9 A;  2JGU A;  1NKE A;  4FJ9 A;  2BGG A;  4QCL A;  2HVH A;  3PX0 A;  1NK7 A;  1BHL A;  3AVH A;  4OGC A;  2G8U A;  4KTW A;  1SUQ A;  3DRS A;  3TAE A;  1J5O A;  3MAQ A;  4O0J A;  3KIO A;  2DFF A;  2Y1I A;  1JLB A;  3B6P A;  4IG0 A;  3SNN A;  2QKB A;  4CJS A;  3QEI A;  5J2Q A;  4FZX C;  1XI1 A;  3RMC A;  1ZYQ A;  5KTQ A;  1TKX A;  3M8P A;  3P5J A;  1IG9 A;  4FVM A;  4FW2 A;  1DTQ A;  3HST B;  1LAV A;  4ICL A;  5I42 A;  4Q5V A;  1Q9X A;  3QER A;  4FJJ A;  4CFB A;  4DTJ A;  4FYD A;  3KK3 A;  4CED A;  3LP2 A;  3ALY A;  3OYD A;  3VQ6 A;  2YNG A;  1TL3 A;  1KVA A;  3CFO A;  4KHN A;  1FXX A;  3SUO A;  4JLH A;  1T05 A;  2B6A A;  4CEE A;  2IAJ A;  3LZJ A;  3AVG A;  4AH9 A;  3P83 D;  4CJ4 A;  1QTM A;  2HMI A;  2YNI A;  4DTN A;  4M3X A;  4KHY A;  2YNF A;  3K58 A;  3S3O A;  4KRF A;  4DQR A;  2IOC A;  3HPH A;  3HT3 A;  1HYZ A;  3JSM A;  2XY6 A;  1SL2 A;  3KLI A;  3MEG A;  4AHT A;  4PQU A;  3WNG A;  4M3W A;  1DTT A;  4CIG A;  1C1C A;  1C0M A;  4DWI A;  4EZ9 A;  3TAG A;  1ASV A;  1DLO A;  3OYC A;  4CIE A;  4NCB A;  4RG8 A;  4Z4E A;  1HRH A;  4LY7 A;  2G8F A;  4GW6 A;  2DY4 A;  4NCG A;  1WAF A;  1BQM A;  1C0T A;  1FKP A;  4DSI A;  2PYL A;  3LAL A;  1JLQ A;  1T03 A;  1RT2 A;  3C95 A;  1IKY A;  3SQ1 A;  4IFV A;  4N76 A;  4KB0 A;  4ID5 A;  5CY4 A;  1U04 A;  4M3Y A;  2O4I A;  2YV0 X;  4CF2 A;  3DOK A;  3NCI A;  4Z4I A;  4CHP A;  2HNY A;  4JS4 A;  1T8E A;  1LWF A;  4DMN A;  2Z1G A;  1W9H A;  4Z4F A;  4DSF A;  2Z1J A;  1HQE A;  3AVM A;  3HVR A;  2P51 A;  3RMA A;  4B9N A;  2IDO A;  3LWL A;  3SI6 A;  3DM2 A;  4CEF A;  2DTU A;  1BI4 B;  4N56 A;  1XC9 A;  4FK4 A;  1JLE A;  3HK2 A;  1GOC A;  3NDK A;  3SQ0 A;  1NK9 A;  1RBT A;  4W5R A;  4YNQ A;  1TKD A;  5HBM A;  4QOZ B;  4HVJ A;  3L2Q A;  4CFA A;  4E1M A;  3OS1 A;  2E6M A;  3JYT A;  4C8O A;  1O1W A;  2Z1I A;  4M3R A;  3VQP A;  1RTI A;  4E7L A;  2EX3 A;  4KRE A;  3CFP A;  4CEO A;  1ZBH A;  4M45 A;  3CQ8 A;  4F4K A;  4FJM A;  4CJQ A;  2RPI A;  3OYJ A;  2FBT A;  4B08 A;  4CF1 A;  3L2U A;  1A5X A;  1X9W A;  3AVI A;  3CM6 A;  1HNI A;  1RCH A;  2OPP A;  3O4N A;  5HRP A;  2HHT A;  1VSH A;  4RW9 A;  1TKT A;  3OYF A;  1BIS A;  4H4M A;  4BDZ A;  1KFS A;  3VN5 A;  2PY5 A;  4PWD A;  2HHQ A;  1BI4 A;  3AVF A;  4E1N A;  4BE1 A;  4FJ8 A;  1LW2 A;  4KTQ A;  1VK0 A;  3K5N A;  4C8K A;  4BE0 A;  4CJL A;  2Y1J A;  3KKS A;  3HJF A;  1F21 A;  4FLX A;  4NYF A;  3LAK A;  4E7I A;  1C1B A;  1S1W A;  3QNO A;  4EP5 A;  2WOM A;  4DFP A;  4DSJ A;  2VWK A;  4ELU A;  5HRS A;  1RT1 A;  1KVC A;  5DMR A;  3VQQ A;  3OJU A;  1L3V A;  1BQN A;  4B8C A;  3SZ2 A;  1BCM A;  1RBV A;  3V1Q A;  3NFA A;  1NK8 A;  4FK0 A;  2HHX A;  1KTQ A;  4M41 A;  4C8N A;  4CFD A;  4W5T A;  1Z26 A;  3L2V A;  1K6Y A;  4KKO A;  4FLU A;  1NJY A;  4DF4 A;  3V4I A;  1D9F A;  3AA2 A;  3NH1 A;  3V81 A;  4L8R B;  3OYA A;  4ID1 A;  4CJF A;  4IDK A;  4E19 A;  4CGJ A;  1QSS A;  1I39 A;  4FCY A;  1KRP A;  3IAY A;  3AVL A;  3CYM A;  1LAW A;  3OYG A;  4FM0 A;  1L5U A;  1HMV A;  3CFR A;  3KLE A;  3AVJ A;  1J9A A;  1WNS A;  2G8W A;  2YHB A;  3NF7 A;  4CGF A;  1U47 A;  4ELT A;  1HYV A;  3L3V A;  1D9D A;  2PYJ A;  3G10 A;  2XY7 A;  3OYN A;  4YFU A;  1RT4 A;  3QET A;  3OS2 A;  3TAB A;  3NF6 A;  4CIF A;  1Z25 A;  1KVB A;  4KHS A;  4J2D A;  4CK2 A;  5CYQ A;  2FBY A;  5KRT A;  2HB5 A;  4KHW A;  2FBX A;  4NCA A;  4CEC A;  1RDC A;  4EP4 A;  1S1V A;  1X1P A;  2HHU A;  3LPT A;  4N5S A;  4DTU A;  1TKZ A;  2QKK A;  1VSL A;  3AVN A;  1J54 A;  1L3T A;  2OZM A;  1RDB A;  1JXB A;  2F96 A;  1LWE A;  3AA3 A;  4RW8 A;  4Y1C A;  5C24 A;  3F73 A;  3L8B A;  1FK9 A;  1SKW A;  4K8Z A;  1JLG A;  3O3H A;  4J2B A;  4OLA A;  3AO4 A;  1CLQ A;  3QNN A;  2KZM A;  4FJX A;  4DSE A;  5HRR A;  4BE2 A;  1C6V A;  1VRT A;  3MED A;  1U45 A;  4CCH A;  3ZSX A;  3RRH A;  4LSN A;  1Q8I A;  1HYS A;  1XHX A;  3AO3 A;  1CXQ A;  4AHS A;  1IH7 A;  4HUG A;  1C0U A;  3QEX A;  2P1J A;  2WON A;  5J2M A;  3TAP A;  5HRO A;  2F8T A;  1QHT A;  4Z4C A;  1A5V A;  4OPK A;  4IG3 A;  4PUO A;  3HPG A;  1B92 A;  3NF9 A;  4O55 A;  4O4G A;  3TAM A;  4CJV A;  3AVK A;  3KKR A;  4OVL A;  2YHA A;  5C25 A;  3K59 A;  3PUF A;  2R7Y A;  3LAM A;  1TK8 A;  4FLZ A;  2W42 A;  1NKC A;  5HLF A;  4AHV A;  4B9L A;  4CHY A;  3MEC A;  5CZ2 A;  3OYM A;  4TSX A;  3ZSO A;  3AA4 A;  4C8L A;  3ZT4 A;  4KV8 A;  4I9Q A;  1BIU A;  4CGI A;  1Y97 A;  4CK3 A;  4CF8 A;  4GVM A;  3SUP A;  4M3Z A;  1RBR A;  4N41 A;  1C1A A;  1JLA A;  4E7J A;  4DQI A;  4OKK A;  1RNH A;  4B9S A;  3VA0 A;  3LP3 A;  1QS4 A;  2KW4 A;  3LDS A;  2XY5 A;  3QEP A;  2B4J A;  5JS2 A;  3OYE A;  2GBZ A;  2X6S A;  5KI6 A;  3DRP A;  3V1O A;  5EU7 A;  1ZBF A;  1S6P A;  2Q3S A;  1SL1 A;  3IS9 A;  4MFB A;  5T7B A;  4E7K A;  3RTV A;  4Z4H A;  4DQQ A;  2YKN A;  4LH4 A;  3L2R A;  3CM5 A;  3E01 A;  2GUI A;  2X78 A;  2VG6 A;  4DTM A;  2FC0 A;  3OS0 A;  3OYH A;  3K5M A;  3B6O A;  4LSL A;  3I8D A;  3NGI A;  3TAN A;  3BGR A;  1WSJ A;  1KSP A;  4KHQ A;  3NF8 A;  1I3A A;  4OKE A;  3ZT0 A;  4BWM A;  3DOL A;  4FLV A;  4PA1 A;  4KPY A;  3EY1 A;  1UOC A;  2HHV A;  4O5B A;  4CGG A;  4W5Q A;  4FJH A;  5J2N A;  4ZTJ A;  4CJE A;  2B5J A;  4DU1 A;  3V6D A;  3NAE A;  4OJR A;  4FW1 A;  4H4O A;  2OZS A;  3DLB A;  4AHR A;  3DLH A;  4B9U A;  3QEW A;  3H08 A;  3KJV A;  3C6U A;  3VA3 A;  3NH0 A;  4OPJ A;  4M3U A;  3RR8 A;  2HNZ A;  4W5N A;  4FLW A;  1D8Y A;  1VSF A;  4J2E A;  4WE1 A;  3RWU A;  1TV6 A;  1S6Q A;  3LAN A;  2QK9 A;  2ZQB A;  4MQ3 A;  1KCF A;  1LWC A;  4KO0 A;  3OYI A;  3V9W A;  3I0R A;  1JKH A;  3SPZ A;  1VSK A;  3QO9 A;  1SL0 A;  1YTA A;  3QIP A;  4FLT A;  2AJQ A;  3RRG A;  3U3G A;  3TAR A;  4E3S A;  2IGI A;  1RBS A;  1FKO A;  4IFY A;  4DTP A;  1NK4 A;  3M8Q A;  3RMD A;  4CF0 A;  2YNH A;  1KFD A;  2XO7 A;  3TAQ A;  4QAG A;  4CJW A;  1VSJ A;  2KQ2 A;  1S9E A;  3KD5 E;  4Y1D A;  4LH5 A;  1KLM A;  4DTS A;  4DS5 A;  4KAZ A;  1WSI A;  4HHT A;  3K57 A;  3DYA A;  2DFE A;  3OJS A;  1IO2 A;  5FRO A;  1RBU A;  3VQD A;  3SV4 A;  4F2S A;  2IS3 A;  3D45 A;  4E7H A;  3VQ9 A;  1UWB A;  1ITG A;  3G0Z A; 
#chains in the Genus database with same CATH topology
 2HND A;  1L3S A;  3QDK A;  1WAJ A;  5K14 A;  1CZB A;  1VQO N;  4BAC A;  3ZSV A;  1NOY A;  1BCO A;  4DU3 A;  5AQV A;  4DTO A;  3C6H A;  3ZX0 A;  5CZ1 A;  2A1R A;  3SCX A;  3CCQ N;  3AA5 X;  2P9I A;  5BN9 A;  4JI7 K;  3TI0 A;  4FWL A;  4JI6 K;  3W3D A;  3G4S N;  4HUF A;  4DV6 K;  1RDU A;  1NJZ A;  1OVQ A;  3C7N B;  3VQA A;  2HMP A;  4G1Q A;  5J1E A;  4OGE A;  1NGE A;  1IKX A;  1RT7 A;  3WXJ A;  4CK1 A;  1NGB A;  2W6L A;  3IFR A;  3S3M A;  2HBJ A;  1WN7 A;  1X9S A;  3U6F A;  3LWM A;  3O3F A;  1EKE A;  1KAY A;  2YKM A;  4M63 C;  2IIR A;  4AHU A;  4NXN K;  1OH7 A;  4CJR A;  1QSY A;  3P31 A;  3FFI A;  1D5A A;  4FJN A;  4YHH K;  3O3G A;  1GOB A;  1A5W A;  4B9T A;  3Q7B A;  3THW A;  4ELV A;  3AO1 A;  3F9K A;  3SBG A;  1UA1 A;  2I7P A;  1Q86 O;  3ID8 A;  4OX9 K;  4BC3 A;  3LP0 A;  1GLL O;  4CBW A;  4UQG A;  2QEX N;  4LF9 K;  4KTZ A;  3GBT A;  5BRF A;  1HUX A;  3ULD A;  4H5T A;  4CEQ A;  2OPR A;  3ASM A;  3ZSZ A;  4R5P A;  4DV4 K;  2XY8 A;  3MXJ A;  3ZSR A;  5SZT A;  5FDL A;  1CXU A;  3IDH A;  4EAH D;  3I0S A;  2KZZ A;  3M1F A;  4LD0 A;  4CES A;  3OYB A;  4K41 A;  5F1X A;  1X3N A;  2BAN A;  3LDO A;  4AHC A;  3HZ6 A;  3PO4 A;  4C23 A;  1IBL K;  2YHW A;  4Z4G A;  4O8U A;  1RT5 A;  3SJJ A;  2VG7 A;  3AAP A;  1EP4 A;  4BRC A;  2P9L B;  2E1Z A;  5CYM A;  4JRQ A;  1S3X A;  2KKZ A;  3LPU A;  3HO1 A;  1HPZ A;  3AO2 A;  3IG1 A;  4W5O A;  1S5J A;  3ENH A;  4XIU A;  1NJW A;  4QS8 A;  3K5L A;  3UKR A;  2HW3 A;  2GTD A;  3M3Z A;  4CHN A;  4H03 B;  3E1Y A;  5M1N A;  1RT6 A;  1HNW K;  1VAZ A;  4B3O A;  3MWP A;  1WSG A;  5AQO A;  4I6M B;  4IJA A;  4WFA L;  1VQK N;  2ASO A;  3T19 A;  2EHG A;  3SPY A;  1U48 A;  4HCC A;  2P5O A;  2QA4 N;  3KVG A;  1WUA A;  1NOZ A;  4M7Y A;  1MDU B;  4DLE A;  2UU9 K;  4CGH A;  5C42 A;  4L3Q A;  3LL3 A;  3J7Z O;  4KBO A;  3NVK A;  1EET A;  3VTH A;  2ZD1 A;  1YT3 A;  3AAQ A;  5BPN A;  4BWJ A;  4CFC A;  4JI8 K;  3EEQ A;  3V1R A;  4CVN E;  3EKS A;  2UXB K;  5E41 A;  1SKS A;  4IO8 A;  3J8A A;  3HVT A;  1S1T A;  5AQL A;  2KTQ A;  5LMN K;  3SQ4 A;  2CGJ A;  3K9K A;  3D2E B;  3F9M A;  3N4P A;  3RSE B;  5AQH A;  3NGZ A;  4JKA A;  2PAV A;  1QE1 A;  4H5N A;  4IOC L;  3M8R A;  1VQ5 N;  4DQ8 A;  1JJ2 M;  3DLK A;  3WEE A;  2Q2R A;  3HTV A;  2W40 A;  3J7A P;  5AZI B;  3FZH A;  2P9P B;  4OGC A;  2G8U A;  2HOE A;  3MAQ A;  4X64 K;  3A5M C;  3B6P A;  3SNN A;  5GIP A;  3O80 A;  4ISF A;  4CJS A;  3QEI A;  1QVG M;  4FZX C;  1XI1 A;  5I9E B;  3RMC A;  5KTQ A;  3P5J A;  3BUZ B;  5KPT A;  5F2R A;  1DTQ A;  2ZGY A;  3HST B;  4ICL A;  1VQN N;  3GE1 A;  3QER A;  4FJJ A;  4CED A;  2QWQ A;  2ITM A;  3VER A;  3LDN A;  3OW2 M;  1FXX A;  3D6R A;  1T05 A;  2B6A A;  4BGB A;  2YNI A;  4KRF A;  3S3O A;  4OO1 J;  4DQR A;  3CXC M;  2IOC A;  3MEG A;  4JKC A;  3CCR N;  1C0M A;  4DWI A;  3LM9 A;  1DLO A;  2UUB K;  4B1Z A;  4BRE A;  1GLE G;  4GW6 A;  4JHD B;  1FKP A;  1LCU A;  4N76 A;  1FW6 A;  1U04 A;  2YV0 X;  3CER A;  4X62 K;  3WXM B;  4YOW A;  4Z4I A;  4FWO A;  3LDQ A;  4G9Z A;  2VGM A;  3QIC A;  4JS4 A;  2O8E B;  1T8E A;  4DSF A;  2OTL N;  1HQE A;  3HVR A;  4B9N A;  2IDO A;  1GLJ O;  3SI6 A;  3OTO K;  1XC9 A;  3CC2 N;  3S41 A;  3HK2 A;  2QXL A;  5E26 A;  4W5R A;  3MX2 A;  3JYT A;  2ASM A;  2YJE A;  2EX3 A;  1W97 L;  3UB5 A;  1ZBH A;  2RPI A;  3OYJ A;  4BRM A;  3FR0 A;  3AVI A;  2OPP A;  1HR0 K;  3OYF A;  2GWJ A;  2PY5 A;  1BI4 A;  1DT9 A;  3RSE A;  3J80 O;  4C1N K;  3KKS A;  3LAK A;  1C1B A;  1S1W A;  2HF4 A;  1HX1 A;  3VQQ A;  1L3V A;  4B8C A;  3CCM N;  1LOT B;  2O8F B;  2CH6 A;  1Z26 A;  1K6Y A;  1S22 A;  1YUW A;  3HBT A;  2ZJP L;  3MK6 A;  3OYA A;  4IDK A;  4E19 A;  3DXM B;  1KRP A;  4FM0 A;  4ISG A;  3CHW A;  1HMV A;  3ZLJ A;  1WNS A;  4CZG A;  3NF7 A;  4JK9 A;  1U47 A;  4ELT A;  1D9D A;  2PYJ A;  2XY7 A;  4YFU A;  5KPZ A;  3FZK A;  3NF6 A;  1Z25 A;  2I7N A;  4BRD A;  5CYQ A;  2QTD A;  1BUP A;  2QWP A;  3LPT A;  4DTU A;  1VSL A;  2A5X A;  2O8E A;  3IMX A;  1L3T A;  5C24 A;  1RDB A;  1JXB A;  1LWE A;  3AA3 A;  3F73 A;  3L8B A;  1YJN N;  1CLQ A;  4LFA K;  4FJX A;  3R1X A;  1ZBS A;  4GV6 A;  4YOY A;  1HYS A;  3WXL A;  4AHS A;  1IH7 A;  1Q81 O;  4HUG A;  5BRE A;  3SK3 A;  4JNE A;  3MN5 A;  5AZJ A;  1SS6 A;  2O8D B;  4Z4C A;  1A5V A;  1B92 A;  4O4G A;  4O55 A;  2A40 A;  3AVK A;  4OVL A;  2YHA A;  5C25 A;  3PUF A;  4EFH A;  1TK8 A;  1NMD A;  2W42 A;  3MEC A;  3OYM A;  4XEI A;  3AGK A;  2FXU A;  4TSX A;  4I9Q A;  1BIU A;  4CF8 A;  1JLA A;  4E7J A;  4DQI A;  3VA0 A;  1QS4 A;  2KW4 A;  2B4J A;  3ZX3 A;  5EU7 A;  4MFB A;  4BY9 C;  2Q97 A;  1VQ8 N;  5LMU K;  3OS0 A;  3K5M A;  4LSL A;  1WSJ A;  1KSP A;  3NF8 A;  4OPH A;  3ZT0 A;  2NNW A;  4BWM A;  2P9N B;  1K8K B;  4GKJ K;  3ENO A;  2HHV A;  5C10 A;  4KH4 A;  4O5B A;  4CGG A;  3CCU N;  2NRH A;  3DLH A;  3H08 A;  2H3G X;  1HPM A;  1M1K O;  4WQ4 C;  4J2E A;  1S6Q A;  2RE2 A;  3KZB A;  3K0S A;  3VEV A;  3SPZ A;  4R79 A;  1VSK A;  3QO9 A;  1YTA A;  1XQS C;  3U3G A;  2ZJR L;  4E3S A;  1FKO A;  4DTP A;  1YVN A;  2V51 B;  4CF0 A;  3TAQ A;  1S9E A;  3CCS N;  5IWA K;  3K57 A;  1QQN A;  2P9U B;  2IS3 A;  3ATV A;  4LC9 B;  3VQ9 A;  3OYC A;  2G8V A;  1U4B A;  2CH5 A;  3CJA A;  4ZTF A;  3K5O A;  3L2W A;  1LW0 A;  4DSK A;  3O9U A;  3QML A;  3ZEU B;  2P9L A;  3IKM A;  4CER A;  4WFB L;  5BPM A;  4J2A A;  1MU2 A;  4FWR A;  4DV5 K;  3SMS A;  1ZBI A;  2FSK A;  1ASW A;  5SWM A;  3AVB A;  1ZC6 A;  4CHZ A;  5M1K A;  3TTF A;  3KK1 A;  1HJR A;  5AFU H;  1LV5 A;  3PX4 A;  3P38 A;  4KI6 A;  2VWJ A;  4GY2 B;  2F8S A;  1BG3 A;  1TVR A;  4K43 A;  4CE9 A;  4IJN A;  4CZM A;  4HCB A;  1IKW A;  3GDQ A;  5M1P A;  2D0C A;  1G15 A;  3MN9 A;  5GAE P;  3B8A X;  1NGJ A;  5KGX A;  4HTU A;  2OPQ A;  4B9Q A;  1YTU A;  3THX A;  1S1X A;  4B9M A;  4F3O A;  5KGW A;  1VRU A;  3CME N;  5B8H A;  1NNE A;  4PKH A;  4WQ4 A;  5JIC A;  1OH5 A;  1VSE A;  4PKG A;  4M42 A;  4IZ9 A;  3ITH A;  1WSH A;  3QIN A;  4JI3 K;  3KD1 E;  4DF8 A;  2G8I A;  3IRX A;  2E4L A;  5JMV A;  3ZT2 A;  3QLH A;  3MEE A;  4NLC A;  2G8H A;  2D1K A;  4DTR A;  1YVU A;  4BR2 A;  3VGK A;  3VQ8 A;  1GLF O;  4PKI A;  5ADX A;  1BL3 A;  2ITG A;  4GV9 A;  3C6T A;  5HRN A;  4ILG B;  4NYN A;  4BGA A;  1BGX T;  3VEW A;  1YJ9 N;  4LFB K;  4KHP K;  2O4G A;  4IBN A;  5LL6 Z;  3V9Z A;  1VSI A;  2P9U A;  1WBB A;  1TAU A;  3U9D A;  4OLB A;  1VSD A;  2D0B A;  2GV9 A;  3HOS A;  3H45 C;  1HKB A;  3KLG A;  1K8A O;  3SBT A;  4FJL A;  5AZI A;  2X6N A;  4B8A B;  4DQS A;  3WQT A;  5I3U A;  3VQE A;  4KFB A;  1CZ9 A;  3E9P A;  3DLR A;  3A0I X;  3I8B A;  3WNH A;  5JS1 A;  4DFJ A;  1JCF A;  4H5W A;  3HL8 A;  1J6Z A;  4CEB A;  3FLC O;  4A62 A;  3U3Y A;  3U4L A;  4PHT X;  2BDP A;  2ZWH A;  3SUQ A;  4RW6 A;  2LSN A;  4BVO A;  1HNV A;  1VQ9 N;  2W41 A;  3BY5 A;  4AIL C;  1B9D A;  3HPO A;  5D3G A;  3T1A A;  1IJJ A;  2O8C B;  1EX4 A;  4OKJ A;  4DFK A;  1JL1 A;  2YCH A;  3A5O C;  5AQT A;  4HUE A;  4ZHR A;  1T7P A;  3OYL A;  3DLG A;  3ZSQ A;  3QIO A;  4BG8 A;  1E3M A;  3VQC A;  3VEO A;  2NRR A;  4JKH A;  1RTD A;  1JLF A;  4Q0B A;  3OA9 A;  2E2N A;  1NJX A;  4JI4 K;  4GKK K;  4H8K A;  4AM6 A;  4KI4 A;  2HBL A;  4DTX A;  3QES A;  4O5F A;  1NM1 A;  1RT3 A;  4JI0 K;  4U7B A;  5EY4 A;  3DMJ A;  4A5B A;  2YJF A;  4CJP A;  2BGG A;  3AVH A;  3EE9 A;  3DRS A;  4Y0W A;  2DFF A;  4BRQ A;  2BH1 A;  4IDH A;  2QKB A;  5J2Q A;  1ZYQ A;  4BRA A;  1TKX A;  5KQ8 A;  3KK7 A;  1IG9 A;  4FW2 A;  4FO0 A;  1LAV A;  5I42 A;  4Q5V A;  1Q9X A;  4FYD A;  4CFB A;  3SAG A;  4DTJ A;  3MX5 A;  3LP2 A;  4E1J A;  3VQ6 A;  3C6A A;  4JKB A;  4KHN A;  4V19 S;  4EIA A;  2IAJ A;  3Q7C A;  4BRN A;  4AH9 A;  1QTM A;  4CJ4 A;  4DTN A;  2YNF A;  3HOT A;  3HPH A;  3U8X A;  3HT3 A;  2V7Y A;  3JSM A;  2XY6 A;  4YOT A;  2J4R A;  3WNG A;  4CIG A;  1C1C A;  3CJ9 A;  5AQY A;  4GVE A;  4A2B A;  5FPM A;  4Z4E A;  4CIE A;  1ATS A;  4LY7 A;  3BZC A;  4ILJ A;  3THW B;  1NGC A;  4BQL A;  3PIP L;  4DSI A;  2PYL A;  2NRT A;  4DV7 K;  2UXC K;  3C95 A;  1IKY A;  3CCE N;  4B1Y B;  4ID5 A;  3DXK A;  3O4W A;  2O4I A;  3DOK A;  5AQM A;  3PIO L;  4CHP A;  2D4W A;  1W9H A;  2KHO A;  2VWB A;  3RMA A;  3LWL A;  1BI4 B;  3DXK B;  2UYT A;  3NDK A;  4MLE A;  3LDP A;  1NK9 A;  1RBT A;  1TKD A;  3E9O A;  4CFA A;  2QW9 A;  2E6M A;  4C8O A;  1O1W A;  4M3R A;  5GIN A;  4KRE A;  3CFP A;  2A3Z A;  3CQ8 A;  3T1H K;  4DR1 K;  2FBT A;  4B1U B;  1VSH A;  4RW9 A;  4H4M A;  4PWD A;  3RVC A;  3AVF A;  4E1N A;  1VK0 A;  1YIJ N;  4CJL A;  1F21 A;  4FLX A;  4NYF A;  3QNO A;  3BZK A;  4RCH A;  4BRI A;  5HRS A;  2QWM A;  1KVC A;  4IXC A;  4JD2 B;  1BQN A;  5JLH A;  2QWL A;  3V1Q A;  1NK8 A;  1VQP N;  1DKG D;  1KTQ A;  4M41 A;  4C8N A;  3ZET B;  3L2V A;  1NJY A;  4KKO A;  3V4I A;  1NMN A;  3V81 A;  4CJF A;  4AQY K;  1QSS A;  1I39 A;  3H6E A;  3IAY A;  1KQS M;  3AVL A;  3VGL A;  5LJW A;  4U67 L;  3CFR A;  3KLE A;  3AVJ A;  3CQY A;  5C2F A;  2YHB A;  4CGF A;  1OH8 A;  3CPE A;  3JXU A;  1RT4 A;  1Q82 O;  4LFC K;  5KRT A;  2Q0R A;  1RDC A;  1X1P A;  3J81 O;  3WQU A;  4N5S A;  3FFK B;  3AVN A;  3CPW M;  1SKW A;  4K8Z A;  3AGR A;  4MO5 A;  2O8B A;  3TSU A;  4J2B A;  4OLA A;  3AO4 A;  4FSV A;  3QNN A;  1KAZ A;  3HRG A;  1C6V A;  1VRT A;  1MWK A;  4JV5 K;  1Q8I A;  1XHX A;  3AO3 A;  3WEE B;  1CXQ A;  1V4S A;  4MLH A;  3VEY A;  3QEX A;  4CZK A;  2WON A;  4AF1 A;  3TAP A;  2F8T A;  4YDU A;  5AQG A;  3TAM A;  4LF8 K;  1GLA G;  2P9S B;  1NKC A;  4FLZ A;  5HLF A;  1WOQ A;  4AHV A;  4CHY A;  4IOA L;  3OBW A;  4C8L A;  3EL2 A;  3K9J A;  1C1A A;  4B9S A;  3QEP A;  3LP3 A;  5C2D A;  5JS2 A;  4RWT A;  1K8K A;  1SL1 A;  3IS9 A;  4JK8 A;  2WTU A;  4Z4H A;  4DQQ A;  4CZJ A;  4WQ5 C;  4BR4 A;  3CM5 A;  2GUI A;  2VG6 A;  3OYH A;  3B6O A;  1U2V B;  3I8D A;  3TAN A;  4KHQ A;  1XMQ K;  1I3A A;  5JLF A;  1RFQ A;  4X65 K;  4FLV A;  4PA1 A;  4B3R K;  3JS6 A;  3VES A;  1ATR A;  4FWS A;  4FJH A;  5J2N A;  2B5J A;  1VQL N;  4OJR A;  4H4O A;  5FPD A;  2HST A;  3BF1 A;  4AHR A;  2HBK A;  1WBD A;  3VA3 A;  3NH0 A;  4OPJ A;  3O1W A;  1GLD G;  4M3U A;  4W5N A;  2E2Q A;  4BRP A;  1NG9 A;  1TV6 A;  2QK9 A;  1NBW A;  4MQ3 A;  3V9W A;  5JVG L;  3I0R A;  1SL0 A;  3QIP A;  2NLX A;  5AZJ B;  2IGI A;  1RBS A;  4IFY A;  4B3T K;  2YNH A;  3CJ7 A;  5GIO A;  2XO7 A;  4QAG A;  1VSJ A;  3F5T A;  1JCE A;  2BUP A;  1KLM A;  4HHT A;  1QQM A;  3DYA A;  3T69 A;  3VF2 A;  3OJS A;  1IO2 A;  5FRO A;  3EE8 A;  1RBU A;  3VQD A;  4MO4 A;  3SV4 A;  3D45 A;  4F2S A;  3O9S A;  4DR3 K;  3G0Z A;  2WBN A;  1TAQ A;  3THX B;  4BRO A;  4CJU A;  2JLE A;  3L3U A;  4CJK A;  1JXE A;  3AO5 A;  3CD6 N;  5BR8 K;  1EO1 A;  3WNF A;  2ZF5 O;  5GAD P;  1YAG A;  1Z6R A;  1NU0 A;  3BDP A;  1HJO A;  1TL1 A;  3V9U A;  1RIL A;  4A5A A;  3SAH A;  2XHB A;  4CGD A;  3S3N A;  2E8A A;  1V4T A;  4CJ5 A;  4M7X A;  4FK2 A;  3MN7 A;  4JKF A;  3KLH A;  1GOA A;  3S9H A;  2F9T A;  1N5Y A;  5BPL A;  3TR8 A;  1REV A;  3VOV A;  1YI2 N;  4CJ3 A;  2VG5 A;  1WSF A;  4M3T A;  3MXM A;  1RGI A;  2HF3 A;  3NH2 A;  2QXF A;  1TK0 A;  3CJ1 A;  2D0A A;  4FXD A;  4FJK A;  3UIQ A;  5MLC Q;  4CJT A;  3NHG A;  4E0D A;  4B1V A;  3TPQ A;  2KFN A;  4EZ6 A;  2KLA A;  4I9L A;  4DG1 A;  1I94 K;  4JK7 A;  2YHX A;  3C65 A;  1N34 K;  2KFZ A;  1EWR A;  1NGG A;  3ZYY X;  3PO5 A;  4E89 A;  1SV5 A;  1OVY A;  1U49 A;  3VGM A;  4CF9 A;  4IKF A;  3WNE A;  5E84 A;  1QQC A;  2RKI A;  3V9X A;  2UUC K;  2NRZ A;  1XHZ A;  3E66 A;  1IKV A;  3QFU A;  3L4Q A;  4WCE L;  3A2F A;  3CJB A;  4CD1 A;  3MN6 A;  1B9F A;  1OKJ A;  5FPN A;  1EWQ A;  3ULE B;  4FJI A;  4J8F A;  1RTH A;  2JWK A;  1ZBL A;  2FSN A;  4QS7 A;  4CBU A;  3VTI A;  3LP1 A;  3KK2 A;  3VET A;  5AFU A;  4CHQ A;  2QWO A;  5C15 A;  4FL9 A;  1S1U A;  3PX6 A;  1TUY A;  3CCJ N;  4DQP A;  4FPB A;  3VPZ A;  4JRP A;  1ILY A;  1EXQ A;  1N6Q A;  2WC9 A;  3OYK A;  3QEV A;  2NUB A;  4DU4 A;  4B9V A;  4KHU A;  4KB1 A;  5M1Q A;  4BC2 A;  4K8X A;  3DWL A;  1TK5 A;  2E6L A;  4BRG A;  4MDA A;  4DLG A;  3D2F A;  1Q18 A;  3HP9 A;  1R0A A;  1VQ6 N;  3HP6 A;  1ZBU A;  3BEX A;  1Q9Y A;  5KQD A;  3ZSY A;  2G8K A;  4BR7 A;  2A41 A;  1UAX A;  3HM9 A;  2XRI A;  3VQB A;  3H3N O;  4HWI A;  3THY A;  3KLF A;  1W0H A;  5FRM A;  3CG7 A;  2AA4 A;  2X74 A;  3KWG A;  5DM7 L;  3M8S A;  3G6E N;  5JVH L;  2PFU A;  4YOX A;  3VQ4 A;  3GOI A;  3A5N C;  3VQ5 A;  5FRN A;  1XWL A;  4FM1 A;  4DS4 A;  3DI6 A;  1NKB A;  4CJ7 A;  4FZY A;  1RTJ A;  3SQ2 A;  4CHO A;  4DSL A;  2ATQ A;  3K2P A;  2WUS A;  3AAR A;  2VQE K;  2Z1H A;  4CBX A;  3D7E O;  1NGF A;  2HBM A;  3AV9 A;  4F3T A;  3SLC A;  1SKR A;  3FGU A;  2OYQ A;  1NK0 A;  4BRH A;  3TAF A;  2P5G A;  5DM6 L;  1T6C A;  3O9T A;  1VQM N;  3HYF A;  1RDD A;  5AQN A;  1QSL A;  3VF4 A;  4CEA A;  5AJ3 K;  3SYZ A;  2RN2 A;  2VGN A;  5EOY A;  4DUY K;  5AQW A;  2CGL A;  3O4Q A;  3O9R A;  2OPS A;  1JL2 A;  3NE6 A;  3UKU B;  1GLC G;  4XH1 A;  4BC5 A;  4BDP A;  2ZJQ L;  2D5R A;  2PZS A;  3OY9 A;  2JGU A;  5AQZ A;  3U9Z A;  4FJ9 A;  4QCL A;  1BHL A;  1SUQ A;  1XUP O;  3TAE A;  1J5O A;  4O0J A;  3VEZ A;  2Y1I A;  4HTL A;  2E2O A;  3M8P A;  4H5V A;  1K9M O;  3L6Q A;  4IWV A;  1P90 A;  4FWK A;  3OYD A;  2Q31 A;  2YNG A;  1TL3 A;  3SUO A;  4JLH A;  1W7A A;  3LZJ A;  5LJV A;  3P83 D;  2HMI A;  2IVP A;  4KHY A;  1X3M A;  3C7N A;  1C0G A;  2P9K B;  3SMP A;  3KLI A;  4AHT A;  1M90 O;  2Q36 A;  4M3W A;  4EZ9 A;  3TAG A;  3I33 A;  1ASV A;  4RG8 A;  2G8F A;  2DY4 A;  4NCG A;  1BQM A;  3LAL A;  3UE5 A;  1T03 A;  1RT2 A;  3FZL A;  3SQ1 A;  2E20 A;  4IFV A;  4KB0 A;  3G25 A;  3ZX2 A;  5BN8 A;  5AQR A;  4DKW A;  1QVF M;  4CF2 A;  3A5L C;  3NCI A;  4B1W B;  1GLB G;  5IT9 O;  5BR9 A;  2YI1 A;  1LWF A;  4DMN A;  4Z4F A;  4JKG B;  3AVM A;  3DM2 A;  2DTU A;  2IVN A;  4FK4 A;  4JI2 K;  5KPR A;  3SQ0 A;  4CW7 B;  1XMO K;  4YNQ A;  5HBM A;  3L2Q A;  4E1M A;  3CJC A;  3VQP A;  1RTI A;  1VQ7 N;  1U6Z A;  4F4K A;  2HHQ A;  3L2U A;  1HNI A;  3G71 N;  3O4N A;  1NGA A;  5HRP A;  2HHT A;  4BDZ A;  1BIS A;  3VN5 A;  4A2A A;  4KTQ A;  3K5N A;  4C8K A;  4BE0 A;  1FJG K;  3OHR A;  2AP1 A;  3HJF A;  3CI5 A;  3GG4 A;  4DFP A;  1X9J A;  4ELU A;  1RT1 A;  5DMR A;  3CCV N;  3SZ2 A;  1BCM A;  4CZI A;  3NFA A;  2ZGZ A;  5GAG P;  4Z94 A;  3CET A;  4CFD A;  4FLU A;  4DF4 A;  4FWN A;  4B3M K;  3AA2 A;  1HNZ K;  4ID1 A;  4FCY A;  5EX5 A;  1KAX A;  1LAW A;  4K25 A;  3OYG A;  4H0O A;  3H3O B;  2P9I B;  3H1Q A;  2P9K A;  3TU5 A;  2VCP A;  1Y64 A;  2BTF A;  5TKW A;  3TAB A;  4CIF A;  3SAF A;  4KHS A;  1P8Z A;  5AQS A;  4CK2 A;  3EO3 A;  1CZA N;  4NCA A;  3BF3 A;  4EP4 A;  1S1V A;  1XNQ K;  1N33 K;  1J54 A;  1T6D A;  2F96 A;  4FWP A;  4K0K K;  5AQX A;  3THY B;  2NZT A;  3CQX A;  3VF6 A;  5F0X A;  1G99 A;  3CIP A;  1IBK K;  5CR4 A;  5HRR A;  3CMA N;  3D2F B;  4XH5 A;  4CCH A;  3M6G A;  3ZSX A;  3RRH A;  4LSN A;  4FVU A;  1H1V A;  1IG8 A;  1YJW N;  2P1J A;  3I55 N;  5J2M A;  1NLV A;  4OPK A;  4IG3 A;  3HI0 A;  3HPG A;  3NF9 A;  3K59 A;  2R7Y A;  1NWK A;  5CZ2 A;  4KV8 A;  4H0Y B;  3M5R A;  3O6W A;  5HL7 L;  4CK3 A;  1BA0 A;  1Y97 A;  3SUP A;  2YHY A;  4JI5 K;  4M3Z A;  4N41 A;  3ULE A;  5C0Y A;  2FF6 A;  4OKK A;  4BR9 A;  1UA0 A;  2X6S A;  5KI6 A;  3V1O A;  5M1F A;  3O08 A;  4B3S K;  5T7B A;  4CI6 A;  4E7K A;  3RTV A;  1MWM A;  4JEP A;  4DR2 K;  3E01 A;  4DV1 K;  1QZ5 A;  3KWI A;  3BGR A;  2QI2 A;  4OKE A;  1MA9 B;  4KH6 A;  3DOL A;  4KH5 A;  3EY1 A;  2JWL A;  4WFN L;  3QFP A;  4O8K A;  4ZTJ A;  3WT0 A;  3NAE A;  3DLB A;  3QEW A;  5TKY A;  4AM7 A;  3KJV A;  4YOR A;  5CE3 A;  2HNZ A;  4FLW A;  1D8Y A;  4WE1 A;  1NJI O;  3MDQ A;  1IV0 A;  4BRF A;  3DLL L;  2ZQB A;  1KCF A;  1LWC A;  1TYQ B;  4KO0 A;  3OYI A;  1JKH A;  3TAR A;  2Q1N A;  2A6A A;  5ELZ A;  1BO5 O;  3ATU A;  4CJW A;  2KQ2 A;  4NO7 A;  3KD5 E;  4LH5 A;  4FWM A;  4DTS A;  2QM1 A;  1YF5 L;  2DFE A;  3WUH A;  4NLB A;  5FLX O;  4E7H A;  4JN4 A;  1UWB A;  4JD2 A;  2IC3 A;  4IOX A;  2GUP A;  1HKC A;  4H0X B;  4YOU A;  2E2P A;  3EN9 A;  3NGY A;  4DR4 K;  5KRS A;  4JAX A;  2GWK A;  4O44 A;  3CC7 N;  3SV3 A;  4LF6 K;  3ZT1 A;  3SUN A;  1NGI A;  3VQ7 A;  1ASU A;  5AQQ A;  3LZI A;  1NGD A;  1VHX A;  4PY5 A;  3C94 A;  4JS5 A;  3DXM A;  1HQU A;  2QWN A;  1QZ6 A;  5J2P A;  1HKG A;  2PBD A;  3PV8 A;  1WSE A;  4B1X B;  2I5J A;  1DGK N;  1KLN A;  2ETJ A;  3ISN C;  1VSM A;  5EVZ A;  2CGK A;  2ZM6 K;  3A8Y A;  2HHS A;  3WXK A;  4DFM A;  3ID6 A;  4BG9 A;  2VYP A;  5AQJ A;  3DRR A;  3ZCM A;  5AQF A;  1S9G A;  4JHD A;  4Z0U A;  3ZSW A;  3FZM A;  3TSP A;  1J5E K;  2WFB A;  3N4Q A;  4NB4 A;  3C0B A;  3ZT3 A;  3CC4 N;  2D0O A;  3DLE A;  3D0P A;  3T3F A;  5HP1 A;  2OA8 A;  1S72 N;  2FBV A;  5AQI A;  1NK6 A;  1L3U A;  1NK5 A;  1NGH A;  1HNX K;  2OCE A;  5HOO A;  1BDG A;  1WLJ A;  4I2P A;  3OBY A;  3KTQ A;  4I7F A;  3RMB A;  3F2K A;  2HHW A;  4K42 A;  3EYZ A;  4F2R A;  2E88 A;  4A61 A;  4DU1 A;  4FLY A;  2BE2 A;  2W6K A;  3RR7 A;  3O8M A;  2YX6 A;  4MDB A;  3CF5 L;  2O8D A;  1YHQ N;  2FSJ A;  4OPA A;  4O0I A;  4WYB A;  3TWH A;  4F9O A;  4RW4 A;  1TYQ A;  5A2Q O;  3IUC A;  3O9Q A;  4PL8 A;  4IEI A;  5AR0 A;  2GX9 A;  3HXM A;  2A1S A;  3TSQ A;  3J7Y P;  3EZ5 A;  2VQF K;  4GMJ B;  2F4V K;  1N32 K;  5BRD A;  4FJG A;  3AVA A;  2UXD K;  3O1B A;  1C0F A;  1X9M A;  2RF2 A;  3V9S A;  1RDA A;  3R3L A;  4H0T B;  3MXI A;  4C8M A;  4I2Q A;  1U2V A;  4F8R A;  4JKD A;  2HVI A;  1YIT N;  2ZE2 A;  4BDY A;  4YY3 K;  1JLC A;  4QS9 A;  4FJ5 A;  1XNR K;  3NBP A;  3DJC A;  4BVP A;  4C1N I;  3MMV A;  3FE1 A;  4DCH A;  3P1G A;  3H1V X;  1BA1 A;  3HM8 A;  4BR0 A;  3OVN A;  4A57 A;  2ASP A;  1TGO A;  1J53 A;  2RHK A;  4N47 A;  2A42 A;  4X66 K;  1BWF O;  4CEZ A;  1Q7Y O;  4FJ7 A;  3ENB A;  3L4I A;  1Z05 A;  1BIZ A;  2IVO A;  4FOI A;  5DK5 A;  1T44 A;  3T7Z A;  3CCL N;  4FZZ A;  4FWQ A;  5M1O A;  3THV A;  3PY8 A;  2E1Y A;  2DFH A;  4GNI A;  4RW7 A;  4BQZ A;  3AVC A;  3QBX A;  2NRW A;  4FM2 A;  2HVH A;  1NKE A;  3JAM O;  3PX0 A;  1NK7 A;  3PSI A;  1QQO A;  4KTW A;  4DV2 K;  4IO9 L;  1ATN A;  3KIO A;  1SQK A;  1JLB A;  4IG0 A;  3UKR B;  4GV3 A;  4H0P A;  2HHH K;  4CZL A;  4YDU C;  4RTF D;  4FVM A;  4LF7 K;  3T1Y K;  3KK3 A;  3NMU A;  3ALY A;  3P39 A;  3BP8 A;  1KVA A;  3CFO A;  2P9S A;  4CEE A;  1N8R O;  3AVG A;  3VEX A;  1JCG A;  4M3X A;  2GEM A;  3K58 A;  1SL2 A;  1HYZ A;  1SZ2 A;  3FZF A;  4PQU A;  1DTT A;  1N36 K;  4NCB A;  1HRH A;  2Q0U A;  4CZF A;  5AQP A;  1WAF A;  1C0T A;  1K73 O;  5CHI A;  1JLQ A;  1EQY A;  2FF3 B;  3P4I A;  5CY4 A;  4M3Y A;  2O8B B;  4UY8 O;  4DR5 K;  2HNY A;  1W2B M;  3LM2 A;  2Z1G A;  2Z1J A;  2P51 A;  4A59 A;  4WQ5 A;  4CEF A;  4DV3 K;  4N56 A;  1JLE A;  4EHT A;  1GOC A;  4JI1 K;  4QOZ B;  4HVJ A;  3OS1 A;  4CD3 A;  2Z1I A;  4E7L A;  2P9P A;  3O5B A;  4CEO A;  2E5L K;  4M45 A;  4FJM A;  4CJQ A;  1KC8 O;  4B08 A;  1A5X A;  1X9W A;  3CM6 A;  1RCH A;  3EKU A;  2GEL A;  4DV0 K;  1QHA A;  1TUU A;  1TKT A;  4DB3 A;  1KFS A;  4FJ8 A;  5EXW A;  4BE1 A;  1LW2 A;  1D4X A;  3TTC A;  3ZET A;  2Y1J A;  4PL7 A;  3MCP A;  2O8F A;  4JKG A;  3WXI A;  4E7I A;  3ZEU A;  4H5R A;  4EP5 A;  2WOM A;  4WF9 L;  4DSJ A;  2VWK A;  4DUZ K;  3OJU A;  5AQK A;  3HSC A;  1RBV A;  4FK0 A;  2HHX A;  5H1S Q;  4IEE A;  1KXP A;  1R59 O;  4W5T A;  4BRK A;  2V7Z A;  3L0Q A;  1D9F A;  3R9P A;  3NH1 A;  4L8R B;  2DPN A;  4IFE A;  4CGJ A;  3CYM A;  1L5U A;  3VEN A;  4DR7 K;  1J9A A;  1YXQ A;  3W0L A;  2G8W A;  1WB9 A;  4I6M A;  1HYV A;  3L3V A;  3G10 A;  4DHY A;  3OYN A;  3PLA A;  4FPA A;  3OS2 A;  3QET A;  4ISE A;  1KVB A;  5ADX H;  2V52 B;  4J2D A;  2FBY A;  1BOT O;  2HB5 A;  4KHW A;  2FBX A;  4CEC A;  2HHU A;  2OTJ N;  1TKZ A;  2QKK A;  3I56 N;  1T3V A;  2OZM A;  2NRV A;  4DR6 K;  4RW8 A;  4Y1C A;  1VQ4 N;  2NRX A;  5FPE A;  1FK9 A;  1JLG A;  3O3H A;  1IBM K;  1E4G T;  2P9N A;  2KZM A;  4DSE A;  4XH4 A;  4BE2 A;  1O13 A;  3MED A;  3R8E A;  3MCA B;  1U45 A;  4LF5 K;  1C0U A;  3UKU A;  4EHU A;  3PSF A;  5C12 A;  5HRO A;  1QHT A;  4PUO A;  1OH6 A;  3NVM A;  4CJV A;  4CZH A;  4LF4 K;  1KD1 O;  4YOV A;  3KKR A;  4JYA K;  3LAM A;  4B9L A;  4NXM K;  3ZSO A;  3AA4 A;  3ZT4 A;  5GAH P;  3DAW A;  4FOE A;  4CGI A;  4GVM A;  1RBR A;  1RNH A;  3LDS A;  3MWT A;  2XY5 A;  3OYE A;  2GBZ A;  3DRP A;  3E9L A;  1E4F T;  1ZBF A;  1S6P A;  2Q3S A;  1RDW X;  3H46 O;  4ILH A;  3KHY A;  1DEJ A;  2QWR A;  2YKN A;  4LH4 A;  3L2R A;  1HLU A;  2X78 A;  4DTM A;  4BRL A;  3R6M A;  3SJH A;  2FC0 A;  3NGI A;  4CZE A;  1BU6 O;  2D0P A;  4JKE A;  3D2E A;  4KPY A;  1UOC A;  1SAZ A;  4W5Q A;  4CJE A;  3V6D A;  1XC3 A;  2F7T A;  2FLO A;  4FW1 A;  2OZS A;  5BRH A;  5AQU A;  4B9U A;  3LDL A;  3C6U A;  3AY9 A;  2UUA K;  3RR8 A;  1VSF A;  3RWU A;  2F9W A;  3LAN A;  2OAN A;  1ZXO A;  4BR5 A;  2AJQ A;  4FLT A;  3RRG A;  2EWS A;  2O8C A;  1NK4 A;  3M8Q A;  3RMD A;  5LY3 A;  1KFD A;  4BC4 A;  3EZW A;  4H0V B;  4Y1D A;  3QBW A;  3GL1 A;  1ESV A;  4DS5 A;  3QB0 A;  4KAZ A;  1WSI A;  3TTD A;  3VMF B;  4CF1 A;  1ITG A; 
#chains in the Genus database with same CATH homology
 2HND A;  1L3S A;  2G8V A;  1TAQ A;  1WAJ A;  5K14 A;  1CZB A;  4CJU A;  1U4B A;  2JLE A;  3L3U A;  4ZTF A;  3K5O A;  3L2W A;  1LW0 A;  1JXE A;  3AO5 A;  4CJK A;  2IC3 A;  4BAC A;  4DSK A;  3WNF A;  3ZSV A;  4CER A;  4J2A A;  3BDP A;  1NOY A;  1MU2 A;  3NGY A;  1BCO A;  1ZBI A;  1TL1 A;  3V9U A;  5KRS A;  4DU3 A;  1RIL A;  1ASW A;  4DTO A;  2XHB A;  5SWM A;  3AVB A;  4CHZ A;  4O44 A;  5CZ1 A;  4CGD A;  3KK1 A;  2A1R A;  3SCX A;  3SV3 A;  3ZT1 A;  3S3N A;  3SUN A;  1HJR A;  3AA5 X;  3VQ7 A;  1ASU A;  1LV5 A;  4CJ5 A;  3PX4 A;  4FK2 A;  3LZI A;  4PY5 A;  3C94 A;  3KLH A;  4JS5 A;  3TI0 A;  1GOA A;  1HQU A;  3S9H A;  2VWJ A;  1N5Y A;  4KI6 A;  3TR8 A;  4HUF A;  1REV A;  2F8S A;  5J2P A;  4CJ3 A;  2VG5 A;  1NJZ A;  3VQA A;  3PV8 A;  1WSE A;  1WSF A;  4G1Q A;  3MXM A;  4M3T A;  1TVR A;  2I5J A;  4CE9 A;  4OGE A;  5J1E A;  3NH2 A;  2QXF A;  1TK0 A;  4HCB A;  1IKX A;  1IKW A;  1RT7 A;  4CK1 A;  2D0A A;  3S3M A;  4FXD A;  2D0C A;  4FJK A;  1KLN A;  3UIQ A;  2ETJ A;  1G15 A;  3ISN C;  1VSM A;  4CJT A;  5KGX A;  1WN7 A;  4HTU A;  3NHG A;  2OPQ A;  3U6F A;  1X9S A;  4E0D A;  2HHS A;  3LWM A;  4DFM A;  3O3F A;  1EKE A;  2YKM A;  3DRR A;  1YTU A;  2KFN A;  4EZ6 A;  3ZCM A;  4AHU A;  1S9G A;  1S1X A;  4I9L A;  4DG1 A;  4CJR A;  4B9M A;  4F3O A;  5KGW A;  4Z0U A;  3ZSW A;  1VRU A;  1QSY A;  3FFI A;  2KFZ A;  1D5A A;  4FJN A;  1VSE A;  3PO5 A;  4E89 A;  1SV5 A;  4M42 A;  3O3G A;  1GOB A;  1A5W A;  4B9T A;  3ITH A;  1WSH A;  3ZT3 A;  1U49 A;  3QIN A;  4ELV A;  3KD1 E;  3AO1 A;  3F9K A;  4DF8 A;  2G8I A;  1UA1 A;  3IRX A;  2E4L A;  3DLE A;  3D0P A;  4CF9 A;  3T3F A;  5HP1 A;  2OA8 A;  3WNE A;  3ZT2 A;  3LP0 A;  2FBV A;  3QLH A;  4IKF A;  1NK6 A;  1QQC A;  2RKI A;  1L3U A;  3MEE A;  3V9X A;  1NK5 A;  4UQG A;  2G8H A;  4KTZ A;  4DTR A;  1YVU A;  1WLJ A;  1XHZ A;  1IKV A;  3VQ8 A;  3A2F A;  4I2P A;  3KTQ A;  1B9F A;  4I7F A;  3RMB A;  1BL3 A;  2ITG A;  3ULD A;  3C6T A;  2HHW A;  5HRN A;  3EYZ A;  4F2R A;  4CEQ A;  4FJI A;  2OPR A;  3ASM A;  4NYN A;  3ZSZ A;  4R5P A;  1BGX T;  1RTH A;  1ZBL A;  3KK2 A;  3LP1 A;  2O4G A;  2XY8 A;  3MXJ A;  4IBN A;  1VSI A;  3ZSR A;  4CHQ A;  5SZT A;  4FLY A;  3V9Z A;  2BE2 A;  5FDL A;  1CXU A;  1S1U A;  3PX6 A;  3RR7 A;  3I0S A;  4OLB A;  1VSD A;  2KZZ A;  2D0B A;  1TAU A;  4DQP A;  4JRP A;  4LD0 A;  4CES A;  3OYB A;  2GV9 A;  1EXQ A;  1N6Q A;  2BAN A;  3OYK A;  3KLG A;  3QEV A;  4AHC A;  2NUB A;  4FJL A;  4DU4 A;  2X6N A;  4B8A B;  4O0I A;  4DQS A;  4B9V A;  3PO4 A;  4KHU A;  3TWH A;  4KB1 A;  4K8X A;  5I3U A;  3VQE A;  4KFB A;  1CZ9 A;  1TK5 A;  2E6L A;  3DLR A;  4DLG A;  1R0A A;  4RW4 A;  3HP9 A;  3WNH A;  4Z4G A;  3HP6 A;  1RT5 A;  3SJJ A;  2VG7 A;  4DFJ A;  5JS1 A;  1ZBU A;  3HXM A;  2A1S A;  1Q9Y A;  1EP4 A;  3ZSY A;  2G8K A;  3EZ5 A;  3HM9 A;  1UAX A;  2XRI A;  3HL8 A;  3VQB A;  4GMJ B;  3KLF A;  1W0H A;  5CYM A;  4CEB A;  4JRQ A;  4FJG A;  3AVA A;  5FRM A;  3LPU A;  3HO1 A;  3U3Y A;  1HPZ A;  2X74 A;  3CG7 A;  3AO2 A;  2RF2 A;  1X9M A;  3IG1 A;  3M8S A;  4W5O A;  1S5J A;  4XIU A;  3V9S A;  1NJW A;  1RDA A;  3VQ4 A;  3K5L A;  3MXI A;  4C8M A;  3VQ5 A;  2BDP A;  5FRN A;  2HW3 A;  3SUQ A;  1UA0 A;  4I2Q A;  1XWL A;  4RW6 A;  2LSN A;  4CHN A;  1HNV A;  1RT6 A;  4F8R A;  4B3O A;  4FM1 A;  4DS4 A;  4AIL C;  1B9D A;  1WSG A;  3DI6 A;  3HPO A;  5D3G A;  3T1A A;  1NKB A;  2HVI A;  2ZE2 A;  4BDY A;  1JLC A;  4FJ5 A;  3T19 A;  2EHG A;  3SPY A;  3NBP A;  1U48 A;  1RTJ A;  4FZY A;  4HCC A;  1EX4 A;  4OKJ A;  3SQ2 A;  4CHO A;  4DFK A;  2P5O A;  4DSL A;  2ATQ A;  3K2P A;  1JL1 A;  1NOZ A;  2Z1H A;  4HUE A;  3P1G A;  4ZHR A;  1T7P A;  3AV9 A;  3OYL A;  3DLG A;  4DLE A;  4F3T A;  1SKR A;  2OYQ A;  4CGH A;  5C42 A;  1NK0 A;  3OVN A;  3ZSQ A;  1EET A;  1TGO A;  3QIO A;  3TAF A;  1J53 A;  4N47 A;  2ZD1 A;  1YT3 A;  2P5G A;  3VQC A;  4BWJ A;  4CFC A;  1RTD A;  4CEZ A;  1JLF A;  4FJ7 A;  3HYF A;  4Q0B A;  3V1R A;  1RDD A;  1NJX A;  1QSL A;  5E41 A;  1SKS A;  1BIZ A;  4CEA A;  3HVT A;  1S1T A;  2RN2 A;  5DK5 A;  4H8K A;  3SYZ A;  4KI4 A;  2KTQ A;  4DTX A;  3QES A;  3SQ4 A;  3O4Q A;  4FZZ A;  3NGZ A;  3THV A;  1RT3 A;  3PY8 A;  1QE1 A;  2OPS A;  1JL2 A;  3NE6 A;  3M8R A;  3DMJ A;  2DFH A;  4BDP A;  3DLK A;  4RW7 A;  3AVC A;  2D5R A;  4FM2 A;  4CJP A;  2PZS A;  3OY9 A;  2JGU A;  1NKE A;  4FJ9 A;  2BGG A;  4QCL A;  2HVH A;  3PX0 A;  1NK7 A;  1BHL A;  3AVH A;  4OGC A;  2G8U A;  4KTW A;  1SUQ A;  3DRS A;  3TAE A;  1J5O A;  3MAQ A;  4O0J A;  3KIO A;  2DFF A;  2Y1I A;  1JLB A;  3B6P A;  4IG0 A;  3SNN A;  2QKB A;  4CJS A;  3QEI A;  5J2Q A;  4FZX C;  1XI1 A;  3RMC A;  1ZYQ A;  5KTQ A;  1TKX A;  3M8P A;  3P5J A;  1IG9 A;  4FVM A;  4FW2 A;  1DTQ A;  3HST B;  1LAV A;  4ICL A;  5I42 A;  4Q5V A;  1Q9X A;  3QER A;  4FJJ A;  4CFB A;  4DTJ A;  4FYD A;  3KK3 A;  4CED A;  3LP2 A;  3ALY A;  3OYD A;  3VQ6 A;  2YNG A;  1TL3 A;  1KVA A;  3CFO A;  4KHN A;  1FXX A;  3SUO A;  4JLH A;  1T05 A;  2B6A A;  4CEE A;  2IAJ A;  3LZJ A;  3AVG A;  4AH9 A;  3P83 D;  4CJ4 A;  1QTM A;  2HMI A;  2YNI A;  4DTN A;  4M3X A;  4KHY A;  2YNF A;  3K58 A;  3S3O A;  4KRF A;  4DQR A;  2IOC A;  3HPH A;  3HT3 A;  1HYZ A;  3JSM A;  2XY6 A;  1SL2 A;  3KLI A;  3MEG A;  4AHT A;  4PQU A;  3WNG A;  4M3W A;  1DTT A;  4CIG A;  1C1C A;  1C0M A;  4DWI A;  4EZ9 A;  3TAG A;  1ASV A;  1DLO A;  3OYC A;  4CIE A;  4NCB A;  4RG8 A;  4Z4E A;  1HRH A;  4LY7 A;  2G8F A;  4GW6 A;  2DY4 A;  4NCG A;  1WAF A;  1BQM A;  1C0T A;  1FKP A;  4DSI A;  2PYL A;  3LAL A;  1JLQ A;  1T03 A;  1RT2 A;  3C95 A;  1IKY A;  3SQ1 A;  4IFV A;  4N76 A;  4KB0 A;  4ID5 A;  5CY4 A;  1U04 A;  4M3Y A;  2O4I A;  2YV0 X;  4CF2 A;  3DOK A;  3NCI A;  4Z4I A;  4CHP A;  2HNY A;  4JS4 A;  1T8E A;  1LWF A;  4DMN A;  2Z1G A;  1W9H A;  4Z4F A;  4DSF A;  2Z1J A;  1HQE A;  3AVM A;  3HVR A;  2P51 A;  3RMA A;  4B9N A;  2IDO A;  3LWL A;  3SI6 A;  3DM2 A;  4CEF A;  2DTU A;  1BI4 B;  4N56 A;  1XC9 A;  4FK4 A;  1JLE A;  3HK2 A;  1GOC A;  3NDK A;  3SQ0 A;  1NK9 A;  1RBT A;  4W5R A;  4YNQ A;  1TKD A;  5HBM A;  4QOZ B;  4HVJ A;  3L2Q A;  4CFA A;  4E1M A;  3OS1 A;  2E6M A;  3JYT A;  4C8O A;  1O1W A;  2Z1I A;  4M3R A;  3VQP A;  1RTI A;  4E7L A;  2EX3 A;  4KRE A;  3CFP A;  4CEO A;  1ZBH A;  4M45 A;  3CQ8 A;  4F4K A;  4FJM A;  4CJQ A;  2RPI A;  3OYJ A;  2FBT A;  4B08 A;  4CF1 A;  3L2U A;  1A5X A;  1X9W A;  3AVI A;  3CM6 A;  1HNI A;  1RCH A;  2OPP A;  3O4N A;  5HRP A;  2HHT A;  1VSH A;  4RW9 A;  1TKT A;  3OYF A;  1BIS A;  4H4M A;  4BDZ A;  1KFS A;  3VN5 A;  2PY5 A;  4PWD A;  2HHQ A;  1BI4 A;  3AVF A;  4E1N A;  4BE1 A;  4FJ8 A;  1LW2 A;  4KTQ A;  1VK0 A;  3K5N A;  4C8K A;  4BE0 A;  4CJL A;  2Y1J A;  3KKS A;  3HJF A;  1F21 A;  4FLX A;  4NYF A;  3LAK A;  4E7I A;  1C1B A;  1S1W A;  3QNO A;  4EP5 A;  2WOM A;  4DFP A;  4DSJ A;  2VWK A;  4ELU A;  5HRS A;  1RT1 A;  1KVC A;  5DMR A;  3VQQ A;  3OJU A;  1L3V A;  1BQN A;  4B8C A;  3SZ2 A;  1BCM A;  1RBV A;  3V1Q A;  3NFA A;  1NK8 A;  4FK0 A;  2HHX A;  1KTQ A;  4M41 A;  4C8N A;  4CFD A;  4W5T A;  1Z26 A;  3L2V A;  1K6Y A;  4KKO A;  4FLU A;  1NJY A;  4DF4 A;  3V4I A;  1D9F A;  3AA2 A;  3NH1 A;  3V81 A;  4L8R B;  3OYA A;  4ID1 A;  4CJF A;  4IDK A;  4E19 A;  4CGJ A;  1QSS A;  1I39 A;  4FCY A;  1KRP A;  3IAY A;  3AVL A;  3CYM A;  1LAW A;  3OYG A;  4FM0 A;  1L5U A;  1HMV A;  3CFR A;  3KLE A;  3AVJ A;  1J9A A;  1WNS A;  2G8W A;  2YHB A;  3NF7 A;  4CGF A;  1U47 A;  4ELT A;  1HYV A;  3L3V A;  1D9D A;  2PYJ A;  3G10 A;  2XY7 A;  3OYN A;  4YFU A;  1RT4 A;  3QET A;  3OS2 A;  3TAB A;  3NF6 A;  4CIF A;  1Z25 A;  1KVB A;  4KHS A;  4J2D A;  4CK2 A;  5CYQ A;  2FBY A;  5KRT A;  2HB5 A;  4KHW A;  2FBX A;  4NCA A;  4CEC A;  1RDC A;  4EP4 A;  1S1V A;  1X1P A;  2HHU A;  3LPT A;  4N5S A;  4DTU A;  1TKZ A;  2QKK A;  1VSL A;  3AVN A;  1J54 A;  1L3T A;  2OZM A;  1RDB A;  1JXB A;  2F96 A;  1LWE A;  3AA3 A;  4RW8 A;  4Y1C A;  5C24 A;  3F73 A;  3L8B A;  1FK9 A;  1SKW A;  4K8Z A;  1JLG A;  3O3H A;  4J2B A;  4OLA A;  3AO4 A;  1CLQ A;  3QNN A;  2KZM A;  4FJX A;  4DSE A;  5HRR A;  4BE2 A;  1C6V A;  1VRT A;  3MED A;  1U45 A;  4CCH A;  3ZSX A;  3RRH A;  4LSN A;  1Q8I A;  1HYS A;  1XHX A;  3AO3 A;  1CXQ A;  4AHS A;  1IH7 A;  4HUG A;  1C0U A;  3QEX A;  2P1J A;  2WON A;  5J2M A;  3TAP A;  5HRO A;  2F8T A;  1QHT A;  4Z4C A;  1A5V A;  4OPK A;  4IG3 A;  4PUO A;  3HPG A;  1B92 A;  3NF9 A;  4O55 A;  4O4G A;  3TAM A;  4CJV A;  3AVK A;  3KKR A;  4OVL A;  2YHA A;  5C25 A;  3K59 A;  3PUF A;  2R7Y A;  3LAM A;  1TK8 A;  4FLZ A;  2W42 A;  1NKC A;  5HLF A;  4AHV A;  4B9L A;  4CHY A;  3MEC A;  5CZ2 A;  3OYM A;  4TSX A;  3ZSO A;  3AA4 A;  4C8L A;  3ZT4 A;  4KV8 A;  4I9Q A;  1BIU A;  4CGI A;  1Y97 A;  4CK3 A;  4CF8 A;  4GVM A;  3SUP A;  4M3Z A;  1RBR A;  4N41 A;  1C1A A;  1JLA A;  4E7J A;  4DQI A;  4OKK A;  1RNH A;  4B9S A;  3VA0 A;  3LP3 A;  1QS4 A;  2KW4 A;  3LDS A;  2XY5 A;  3QEP A;  2B4J A;  5JS2 A;  3OYE A;  2GBZ A;  2X6S A;  5KI6 A;  3DRP A;  3V1O A;  5EU7 A;  1ZBF A;  1S6P A;  2Q3S A;  1SL1 A;  3IS9 A;  4MFB A;  5T7B A;  4E7K A;  3RTV A;  4Z4H A;  4DQQ A;  2YKN A;  4LH4 A;  3L2R A;  3CM5 A;  3E01 A;  2GUI A;  2X78 A;  2VG6 A;  4DTM A;  2FC0 A;  3OS0 A;  3OYH A;  3K5M A;  3B6O A;  4LSL A;  3I8D A;  3NGI A;  3TAN A;  3BGR A;  1WSJ A;  1KSP A;  4KHQ A;  3NF8 A;  1I3A A;  4OKE A;  3ZT0 A;  4BWM A;  3DOL A;  4FLV A;  4PA1 A;  4KPY A;  3EY1 A;  1UOC A;  2HHV A;  4O5B A;  4CGG A;  4W5Q A;  4FJH A;  5J2N A;  4ZTJ A;  4CJE A;  2B5J A;  4DU1 A;  3V6D A;  3NAE A;  4OJR A;  4FW1 A;  4H4O A;  2OZS A;  3DLB A;  4AHR A;  3DLH A;  4B9U A;  3QEW A;  3H08 A;  3KJV A;  3C6U A;  3VA3 A;  3NH0 A;  4OPJ A;  4M3U A;  3RR8 A;  2HNZ A;  4W5N A;  4FLW A;  1D8Y A;  1VSF A;  4J2E A;  4WE1 A;  3RWU A;  1TV6 A;  1S6Q A;  3LAN A;  2QK9 A;  2ZQB A;  4MQ3 A;  1KCF A;  1LWC A;  4KO0 A;  3OYI A;  3V9W A;  3I0R A;  1JKH A;  3SPZ A;  1VSK A;  3QO9 A;  1SL0 A;  1YTA A;  3QIP A;  4FLT A;  2AJQ A;  3RRG A;  3U3G A;  3TAR A;  4E3S A;  2IGI A;  1RBS A;  1FKO A;  4IFY A;  4DTP A;  1NK4 A;  3M8Q A;  3RMD A;  4CF0 A;  2YNH A;  1KFD A;  2XO7 A;  3TAQ A;  4QAG A;  4CJW A;  1VSJ A;  2KQ2 A;  1S9E A;  3KD5 E;  4Y1D A;  4LH5 A;  1KLM A;  4DTS A;  4DS5 A;  4KAZ A;  1WSI A;  4HHT A;  3K57 A;  3DYA A;  2DFE A;  3OJS A;  1IO2 A;  5FRO A;  1RBU A;  3VQD A;  3SV4 A;  4F2S A;  2IS3 A;  3D45 A;  4E7H A;  3VQ9 A;  1UWB A;  1ITG A;  3G0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...