2QKQA

Structure of the sam domain of human ephrin type-b receptor 4
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
AFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title SAM Domain of Human Ephrin Type-B Receptor 4 (EPHB4)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-B receptor 4
total genus 21
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qkqA00
2KIVA 1WWVA 3BS5B 2E8MA 2EAOA 2EAMA 2ESEA 4IS7A 2F44A 3TACB 1B0XA 1OXJA 2JV3A 2KSOA 1V38A 4NL9A 5F3XB 1KW4A 2F8KA 3SENA 1LKYB 1X66A 4RQMA 2EANA 1Z1VA 3BQ7A 1PK1A 2QARA 3TADA 5JU5A 1UCVA 2L5YA 2E8PA 3HILA 2QKQA 1X9XA 2D3DA 1SGGA 2B6GA 1SV0A 4PZNA 2Y9UA 2QB1A 4PZOA 2KMDA 5J8YA 2D8CA 1SV0C 2K60A 4NL9C 1X40A 2DL0A 2ES6A 2LMRA 3TADC 1F0MA 2QB0B 2F3NA 2GLEA 2KG5A 5JRTA 1COKA 1WWUA 1LKYA 1RG6A 1SV4A 1OW5A 2EAPA 2KSOB 4MHVA 2QB0A 1PK1B 2DKXA 4RQNA 1JI7A 2DKZA 1UQVA 3BS5A 3KKAA 5J8YC 5KNIA 2YTUA 1SXEA 1SXDA 2E8OA 3H8MA 3BS7A 3KKAC 5JTIA 5L1MA 2LPEA 1V85A 2QARB 1B4FA 2K4PA 1DXSA 3SEIA 1PK3A 2KE7A 4NJ8A 3K1RB 2E8NA 2FE9A 2Y9TA 3IDWA
chains in the Genus database with same CATH superfamily
3RR7A 2BPFA 5AI8A 1ZQZA 4KLGA 2EAMA 1DGSA 8ICCA 1CEZA 3PMNA 5AKLA 4Y2TA 3N7SC 2K4IA 4O3NA 3TACB 4DOBA 3TKAA 3PX0A 7ICMA 2NRTA 5CJ7A 9ICLA 4KITB 3ZDEA 4I2DA 4P4PA 1KL9A 2RRDA 3EW9A 1QSYA 4CNQA 5AK5A 2DF4B 3ETLA 4EELA 3KHHA 2UVRA 4QZGA 5ALGA 2GWSA 3MR6A 2D8CA 3ISCA 3OGUA 4PHEA 1EXNA 1T94A 4DOAA 1ZQFA 2ZUDA 4M9LA 4O9MA 3WK7A 5DB8A 3PMLA 1HUZA 3IN5A 3SD7A 3TI0A 3ISDA 2AJQA 1A76A 1Z4NA 3KOOA 3NVVA 5KFWA 2MAXA 4QW8A 1XO1A 3V6JA 3HRDD 3M8RA 5DLGA 1HJPA 2QB0A 1PK1B 5KFPA 1X9MA 4R8UA 2BDUA 3ZD9A 1U4BA 4YR0A 4F4WA 1BGXT 5TISU 4BUGA 3GIJA 3JPOA 5KL1B 4RQ4A 2W8KA 7ICGA 1ZQMA 4ED0A 4I28A 5L1KA 1T3QA 3SEIA 3C5FA 3RJHA 1X9SA 4I2FA 2KICA 5KFGA 5JUMA 2C2DA 1MC8A 5KFHA 4DSFA 1KDHA 2DWQA 2AXTU 3F2BA 5DGAA 2EQYA 2Q4TA 1V38A 4Z6DA 1UA0A 1KW4A 3QX7A 4J9KA 1ZQAA 3CNHA 1VDVA 4F50A 4MFCA 2YX8A 4IRCA 2WB1F 8ICFA 2I9GA 2KZMA 2KIWA 3GDXA 1ZQCA 2C22A 2IA6A 4ELUA 2AH5A 2M9NA 1M6YA 4J9SA 5ALQA 5G5HA 5BPCA 1JUDA 1COOA 4FFDA 1FIQA 1C20A 1ZD4A 2W03A 1ZQIA 2ASDA 1X40A 5J2JA 2R8KA 2HBMA 2ATLA 3QXGA 3TADC 1ZQSA 1XSNA 2LKYA 4U6PA 1QTMA 4IR1A 5JRTA 4DEZA 2LI6A 5KG1A 4QWEA 5DDYA 3AL0B 2BDPA 2P6UA 3C23A 1HIWA 3LWLA 1KTQA 3HT3A 4J9LA 5GTIU 4DOCA 1OUQA 3GV7B 4YP3A 4R63A 4KX3A 5J8YC 3R9KA 5KNIA 4KLOA 3IP4B 4DFPA 1IIPA 3NUQA 5KFZA 4Y2YA 2XI9A 1DXSA 4Y2SA 3T5KA 1Z3EB 4OO1J 3UQ0A 2E3TA 4IC9A 4IRKA 3BZCA 1ZQNA 4EZ6A 2HSZA 3WK5A 3MDAA 1BPBA 1QQ6A 5KG7A 3V6KA 2GO7A 1NK9A 2DQNB 5KFRA 4DFDA 3M1YA 2FLNA 3JPPA 4GC7A 1ZJMA 3ZD8A 5DLFA 3H0LB 5F3XB 4DCCA 2P6RA 4XRHA 2H3IA 2NV3A 4F5OA 1N62A 1ZQVA 2W04A 4HAIA 4BX9C 9ICTA 4J9PA 3I76A 2E8PA 3WKBA 5J2BA 1ZQ1C 1BPDA 1DOQA 2NO4A 3E2EA 8ICKA 1U47A 3FC4A 3RB3A 2FLLA 2W9AA 5J2HA 5HMLA 3RR8A 4AYBF 2R8HA 3T3FA 5AKZA 3T79A 3RTVA 4I2AA 5ALZA 2LMRA 1PVPA 9ICOA 3N7PD 5IIMA 3RJKA 2PMZC 3G6XA 5ALKA 3JPQA 1LKYA 4ZOHC 4TQRA 2VKQA 4ECXA 5CWRA 4FE3A 3VCBA 2EAPA 5ALHA 5HHIA 2KKPA 1QSLA 5AKJA 4RUAA 5J0WA 2HBKA 4US9A 3RH6A 1NKEA 2KV2A 1SXEA 2H3FA 4J9QA 2IOHA 5ALSA 1T8EA 9ICXA 1AROP 3SAHA 4JK1A 1S0MA 4J9OA 4YMMA 1NI3A 3MC1A 3KTQA 1NJZA 1WYGA 4NJ8A 2P66A 2WFAA 3FM9A 3OJUA 2BPCA 4RQ0A 3HPOA 4TUQA 2F77X 3ZDAA 4M9NA 4CGZA 4P0PA 3AU2A 2BCRA 5H2FU 3KFUF 2VANA 5J0QA 1KN5A 4CF5A 5IIKA 5AK6A 1Q3UA 3GIKA 3PO5A 3V7LA 1URJA 1SKWA 2FMPA 2VJ4A 5EWGA 2L5YA 1D8YA 3HILA 2HHSA 4TUPA 5AHXA 3OSPA 5HHHA 4MF2A 1X6IA 5KFQA 2MSNA 1A0PA 4KLTA 8ICGA 4M04A 4DSKA 3K75D 1NJXA 4R8UB 3QUTA 4FS2A 1LB2B 1V97A 1NK8A 4JB3A 4OD0A 3GU3A 2ASJA 3GIIA 4DFMA 1S97A 3B0YA 1RG6A 3WK9A 5KFOA 4KMUA 2RDIA 4UQGA 3PX6A 2ZTEA 5AM4A 2HOQA 3QU5A 4Q43A 2NRVA 9ICAA 2W9MA 2JXJA 4FZNA 1FFUA 4US8A 2K89A 1DK2A 7ICVA 3MDCA 3RJEA 3LVWA 8ICOA 2E5SA 2BHNA 1XS9D 3AMZA 1UT8A 5DKWA 4BXOA 4KLSA 1KFTA 5ALOA 1D9DA 2HW3A 4DS4A 2WB1C 1YT3A 3A0HU 1UA1A 1D8LA 2A1AA 1Q3VA 4ECQA 4YCXA 8ICRA 2XIDA 4GFJA 1QQ7A 1YZ7A 3IDWA 7ICHA 4CF4A 4NLZA 1KQQA 2HMXA 5KT4A 2W11A 1B43A 2F44A 4YD2A 5IIIA 7ICQA 2F8KA 4K4GA 2MA1A 4ACOA 5DDMA 1NK4A 2G08A 2ZIVB 4KLIA 7ICFA 4DF4A 1JIHA 2KNJA 2XY5A 4LZGA 4ECZA 5ALEA 4MEXA 2C2EA 3WKAA 2KVCA 1TAMA 3QEBZ 1XSPA 2OH2A 3WK4A 4FBTA 1WCLA 2K60A 4O0IA 2W8LA 5J2IA 5CP2A 5BOMA 1TV9A 2BCQA 3ISBA 2OYYA 1XC9A 3MBYA 2QB0B 2F3NA 3HW8A 3MGIA 3WK8A 5DGBA 8ICEA 9ICHA 5B66U 3GQCA 1SKRA 2B0CA 4C8OA 1CI4A 5E79U 1PZNA 9ICKA 3RRGA 4NLNA 4QWBA 4RPZA 1SL0A 4QIWC 4J9RA 1CRXA 2UVWA 3TQ1A 4ELVA 3M6ZA 4DL4A 3UQ2A 2B21A 1L3TA 3Q8SB 5KFVA 3Q8QB 1C7YA 5HNKA 1S9FA 4Q44A 2DPIA 5F9LA 2YTUA 3H4BA 1FO4A 2G5IB 4QZBA 2LHTA 5D46A 2LM4A 3MGHA 1JRPA 3SV3A 4OJOA 4UAUA 4NLGA 4QZIA 4F4YA 4UB2A 2W9BB 4F71A 2V9WA 4C4RA 5KFJA 3HWTA 2HHWA 3PZPA 5J29A 5DQHA 5KG2A 3H8WA 1X9WA 4C8NA 3C21A 3SQIA 3ONNA 5KT6A 3I1YA 1NJWA 5KAFU 4NM1A 2ZG6A 2JV3A 1L5UA 2WF9A 4EX7A 3RBDA 1ZD3A 4Q8EA 3H4DA 2PFNA 1CUKA 2QARA 3TADA 4RPXA 5AI9A 4IQUA 3PV8A 5KFMA 5TZVA 1ZQBA 1Q46A 1JN3A 4F8RA 3N4MB 3NGDA 2IHNA 1S0OA 1Y88A 3NVZA 4NL9C 2WF6A 2G07A 1MQ3A 4AYBC 5CA7A 3GIMA 4B6JA 1ZQKA 2DUYA 3WKCA 1WG8A 7ICEA 4KLFA 5D49A 1BVSA 3PW0A 1QSSA 1Q8KA 4P4MA 2F1JA 2W7OA 2PFPA 3L5KA 2JH7A 3Q8PB 4UATA 2HI0A 2ZIUB 4F5NA 2I6XA 4YMNA 1NK5A 1S0NA 4J9NA 4M9GA 5J2AA 4DL7A 4RZRA 2BCUA 3PY8A 2MU2A 3PVXA 3G6VA 3SAGA 2Q0ZX 1MN8A 3Q8MA 3HX0A 1D9FA 3PW7A 4TURA 4UASA 4PGQA 2CXYA 4EYHB 2D6FC 4UB6U 4O3MA 5ALRA 3C1ZA 4ELTA 2BQUA 1DGJA 1GO3F 1S8OA 3TAPA 2F1HA 2E8MA 1N63A 3C2LA 2ZIUA 2H3VA 2FPLA 2HCFA 2HOFA 2EH9A 3FAHA 3JPRA 3RJJA 4F5PA 4Y2VA 1T7PA 3SENA 1D8BA 5KFAA 2KK0A 4QZAA 3F5AA 5AKYA 2HVHA 3QU4A 2HHVA 1ZOLA 2BR0A 5KG4A 3H8JA 4J9MA 4UAVA 4I2CA 5KG6A 2D3DA 2FJ6A 4C4TA 5AM1A 4AP9A 4ECYA 4EYIB 2KMDA 5KFTA 4RQ2A 1ED1A 1JMSA 1L6NA 2WHEA 7ICNA 1WUDA 9ICMA 1J2NA 2ALZA 2AGPA 4DSJA 4EBEA 3LYSA 1UHUA 5C5JA 2KP7A 2ZIXB 1WCNA 3MR5A 4RQ5A 3BS5A 5KL8B 2BQ3A 5AIAA 8ICSA 5KG0A 1YZ6A 4Y2QA 1IM4A 3AQFA 1S5LU 3KKAC 2JZBA 4BJQA 4Y2XA 5AKKA 1RYRA 2FPMA 3F53A 3QZ7A 3WKDA 2JGAA 3DDHA 4RUCA 2CRXA 5KT5A 7ICOA 1L8OA 2XY7A 1JX4A 3QZ8A 2JEIA 2KN7A 3UXNA 2WF8A 2RP5A 2G06A 3AM9A 4NLKA 2O6KA 4EZ9A 4LJXA 4OJ6A 3IM1A 2EANA 3EWAA 1RDFA 2ZIXA 4IS7A 2PMZF 3V72A 2WAQC 5AM2A 1Z4OA 3T5LA 1Z19A 2BKEA 4I2IA 5EE3A 2IBKA 4NL9A 3BQ2A 4JWMA 7ICPA 3IRUA 5GTHU 1LKYB 3SV4A 1VLBA 1Z1VA 3AN1A 3PW5A 4M6WA 3C29A 4G9BA 1Z1BA 2BPGA 1ZQHA 3GV8B 4CDGA 1S10A 4B9VA 2OCEA 4QWCA 2Y9UA 3E58A 4F4XA 4GXJA 1P7DA 2JHDA 2VA3A 4YQWA 5ALPA 5AK3A 2ASLA 5KFEA 1VJ5A 7ICLA 2R8JA 2DL0A 2ZXIA 2AQ4A 2W9CB 2NRXA 8ICVA 1N60A 1WWUA 2N1RA 3I28A 1NKBA 5AKGA 2UVVA 4UBCA 2JMGA 5HP4A 1ZJNA 2ZTDA 4B9SA 9ICEA 1ZQPA 3ALRA 1BPYA 2G09A 2JR5A 5ALNA 2DBYA 3TAQA 1SB3C 3RBEA 2MRLA 2YB4A 5T14A 3NVYA 4F5RA 1BPZA 3EYZA 2A19A 1KFSA 2FMQA 1PK3A 2RQ5A 4PGXA 3H0MB 4CCHA 1PUZA 1RXVA 1S76D 4C8MA 8ICLA 2W7PA 4F2SA 3O0FA 3S6JA 1HEKA 3RH5A 4PH5A 4ED3A 2KZ3A 1L8LA 3C1YA 1ZXIA 4DSEA 1RM6C 3MGVA 3Q8KA 3F5EA 3DV9A 3ICXA 1BPEA 1XO0A 9ICFA 4MEYA 5KG3A 2I1QA 2YMLA 2IHMA 5IILA 4RQMA 2P35A 3PR5B 5DQGA 4UAZA 4ECRA 3FDSA 4OJLA 4X5VA 4G3IA 7ICSA 1N56A 1X9XA 2V4QA 1SV0A 1XSLA 2J6SA 4UB5A 8ICBA 5AKIA 2H5XA 4EBCA 1SV0C 3PO4A 2YMPA 5FP0A 4C7ZA 1JALA 4OCZA 2MUTB 4O3QA 2R18A 4KLDA 1RYSA 3KHGA 2ZUBA 4YR3A 2WF5A 5KFKA 4YMOA 1ZQLA 4P2HA 4FBUA 8ICMA 1NKCA 1JI7A 2DKZA 1NZPA 1N48A 1Z00B 2KFZA 1SZHA 5DB7A 4O3SA 4YR2A 3L3FX 5AM3A 3N7RC 3CYMA 2AHOB 1ECWA 4ECUA 4WJ3B 5IINA 3BS7A 3F2DA 3LVVA 8ICZA 1XU4A 4EBDA 5CR0A 3N28A 3SR6A 2F76X 4F91B 3CW2C 2ZIVA 2KZZA 2YY6A 4F2RA 3IV6A 4PHAA 2FE9A 4MF8A 3N97B 1JXLA 4LVSA 5AK4A 4UB4A 5ALMA 2XCAA 3C2MA 4GLXA 3QUCA 3JPTA 2ESEA 2M0NA 3UMCA 5AM5A 1B0XA 4Y2UA 1U49A 4KLQA 2KOBA 2ZJAA 4Y2JA 2R8IA 2A1JB 8ICPA 4PL1A 1KRPA 3NASA 3ZI4A 4ED6A 4Z6FA 4RT2A 2JEFA 2J6UA 1U9LA 1U45A 2K8AA 1TK0A 3V6HA 5KFYA 3D2QA 5CRXA 5AICA 4DL6A 2CN1A 3BQTA 4OJPA 2VA2A 2KJ9A 2C28A 3PSTA 5KFBA 4YXJA 2G0AA 5HMMA 2LBOA 4ED1A 2J6TA 5AI6A 2E1EA 3PSPA 1QQ5A 3BJYA 1KEJA 4RQ6A 5F9NA 4QZCA 4IQWA 4ED8A 2JZBB 1TE2A 2W9CA 2KSOB 4NY8A 2DKXA 1UQVA 2LYAA 3C28A 3QYPA 5ALFA 3SI8A 1SWWA 5J0TA 4GXKA 5KFFA 4O5KA 1L3UA 3RJGA 4KLLA 3NRWA 2E8OA 2W3SA 2DPJA 4KN4A 5CB1A 5HR7A 8ICNA 3H8MA 1A6SA 4JMUA 3SYZA 3B9JA 9ICJA 2LPEA 1ZD2P 5ALVA 3CRXA 5D4BA 4Y2RA 4XQ8A 4GXIA 4ED2A 2YMMA 4TUSA 1NK0A 4QZDA 5KFSA 4C8LA 1X2IA 4ICAA 5DG7A 4DLGA 3EPIA 2WTFA 1WWVA 1PVRA 5KT7A 1PVQA 3BS5B 9ICNA 3WU2U 5IIOA 4B9NA 2DFLA 3Q8RB 1H38A 1FFVA 2PKEA 5HR6A 3AEVA 4HYKA 4R66A 2BCSA 8ICXA 4O5EA 3UMBA 3KHRA 4UW9A 1NNLA 4I2EA 4O3PA 9ICUA 1ZYQA 1S77D 1K1SA 2YN4A 2F2AB 2OM6A 4PL2A 2W43A 5KFDA 3K1ZA 3ZDBA 1SWVA 4RNNA 2QB1A 2V4RA 1RZTA 5J8YA 9ICWA 3ORYA 4RQ1A 2YB1A 3PSIA 4DSLA 2ES6A 1L7MA 3G6YA 5AKXA 2XICA 2H3ZA 1IG6A 5J0SA 2CPRA 3OJSA 1A77A 1ZQXA 1UT5A 3THVA 5L1LA 4RQNA 3E0FA 1RPLA 3TFSA 3QEAZ 1MQ2A 5AI5A 2JRZA 1ZETA 3RJIA 3OHAA 4P0PB 2PI5A 5ALTA 3MR2A 5L1MA 5EE1A 2NRZA 2VIXA 3C5GA 3CP8A 3PR4A 1SIJA 3UMGA 5AI0A 5CHGA 2VA8A 3UXPA 4KLJA 2EZZA 3QU2A 2ZJ5A 4XUSA 4FO6A 3QE9Y 2KIVA 2XVTA 4MFAA 4QW9A 4KLUA 2HBJA 5J0OA 3KBBA 1DRGA 2Z7JA 2KSOA 3TARA 2WF7A 5ALUA 4CE6A 1L7PA 9ICCA 3KZXA 4JV1A 1ZQUA 1T4GA 4QWAA 1B22A 2AQ0A 2A3VA 4C80A 5ALLA 5JU5A 4FS1A 4RQ3A 4XA5A 1K5OA 4KMOB 5J2EA 4KLEA 8ICTA 4IQVA 3M9OB 5J0XA 2B6GA 1S0VA 3ETRA 3IHQB 3J81j 5DQIA 2IOFK 2NRWA 8ICHA 5AKHA 4B9MA 4U7CA 5L1IA 7ICUA 5AKEA 2GLEA 4C0ZA 8ICJA 9ICGA 5J2KA 3F2CA 2KD1A 2Y0SC 3TANA 4BDPA 3GZFA 1ZQJA 2JH1A 2AU0A 2K8BB 5J0UA 5ALJA 3IG5A 2W54A 4NV0A 1SZPA 2KHQA 3OPXA 2EZXA 1QH9A 1XNSA 4PGYA 1SXDA 4DSIA 4BGDA 1NOMA 4C4SA 4F3OA 4UB1A 4NLBA 3H7IA 4KLMA 7ICKA 4QZ8A 3L4PA 5ALWA 2KVSA 1TFRA 5AI4A 2NO5A 4QZFA 4UBBA 4I2HA 3K1RB 4QWDA 2W3RA 1N2XA 3SZ2A 4RPYA 3PW4A 3RH4A 4P4OA 4BWJA 3OHBA 5EE0A 3PNCA 2HHQA 3U26A 4I2GA 1KLNA 4B9UA 2JEGA 1DK3A 4O3OA 3UXOA 4ED7A 3PX4A 5KFIA 5DB9A 2F1IA 2XC9A 3V7KA 4JV2A 5ALDA 1N61A 2OWOA 5KFXA 1ZQOA 3MABA 4DQRA 3FYHA 4P0QA 1UCVA 1TVAA 4CF3A 2K4HA 4QJFB 4F4ZA 4F4KA 3D2SA 3JPSA 2RHFA 3BZKA 1ZRMA 4J03A 3RAQA 8ICQA 3OSNA 2OXOA 2UVUA 2AGQA 3M8SA 1F0MA 2EDUA 2PI4A 3LDAA 1L3VA 3GFKB 1COKA 2ZTCA 1SV4A 4YD1A 1Z00A 7ICIA 2GOLA 4NXZA 3QNMA 3C2KA 3WKEA 4FZLA 3NVWA 4NWIA 4RNOA 2HOIA 8ICYA 9ICRA 4IQTA 1K1QA 2JEJA 3M9NB 3KD3A 2AGOA 3LK9A 4DQIA 4NLCA 2BZFA 2IOFA 4QIWF 2BCVA 4PHDA 3K4GA 2Y1JA 2K8CB 4R64A 4O5CA 4F5QA 1V85A 3B0XA 4UARA 5ALXA 1F5SA 1B4FA 4K4IA 2K4PA 3QUQA 2KE7A 1ZQEA 2E8NA 4UB3A 4DQPA 1U48A 1LVHA 2Y9TA 5EWEA 5KFLA 2ODGA 4Q45A 2HHXA 4K4HA 5J2DA 1X6JA 2EAOA 2LM1A 2PFOA 2KJ5A 3M9MB 2E1FA 7ICTA 4UAYA 2H3QA 2FPKA 2FI1A 1OXJA 1TK5A 1AQ6A 2ZUCA 1BNOA 4NM2A 2ZIWB 3QUBA 8ICAA 1PK1A 3D6JA 1NK6A 1L7OA 4USAA 3ZDCA 4YFKA 2BGWA 1F44A 1V9PA 4F72A 1N5XA 5DBBA 1SGGA 2YMQA 1ZQYA 2ISPA 3A0BU 5KT2A 8ICWA 7ICJA 2GH1A 3AU6A 4KN7A 4DLEA 1HUOA 3H8SA 4LZDA 1KKXA 2HHUA 5J0PA 1ZQTA 3RFAA 5EOZA 4OJ5A 4C8KA 1TAQA 1T3NA 2A1JA 4DL2A 4DL3A 1KBUA 1TK8A 2ZIWA 4QZ9A 4MFFA 1RYUA 1UPHA 3Q8LA 4BWMA 2W9BA 1ZQRA 2NYVA 5K4LA 4F92B 3VC8A 4RQ7A 2LYBA 2WAQF 5ALIA 5JTIA 2FLPA 2KFNA 3DEEA 3WK6A 5CEHA 2BQRA 3EUB2 2R8GA 3KZIU 4GC6A 4KTQA 2ISOA 3MR3A 4B9TA 1NK7A 1NZBA 2PXIA 2HVIA 3H0RB 1LV5A 1KSPA 4QZHA 1IV8A 4DF8A 4ECTA 1RQLA 3LWMA 5DG8A 1ZQGA 8ICUA 1IXRA 3QU7A 2PFQA 5AIBA 2RLTA 5L9XA 1ZQWA 1FEZA 4M9JA 4E0DA 4EX6A 1TKDA 2DGZA 3NRZA 5J0RA 4PPXA 4C7YA 2FDRA 2LYHA 1X66A 2OHFA 1KFDA 5KG5A 3BQ7A 4PJ0U 5AM0A 1J2MA 1SL1A 4O3RA 4EEYA 3UPQA 4ECVA 2XCPA 2QKQA 4Z6CA 5DBCA 2FMSA 4RNMA 1QCKA 9ICVA 2XGQA 4JWNA 4DWIA 5KAIU 3BDPA 4YN4A 4DS5A 5BOLA 3H40A 2G5HB 9ICPA 4KLHA 5J0YA 1BPXA 4M6WB 3NS1A 4Y2PA 3D2NA 4FZMA 3QU9A 3MFHA 2KG5A 4DQSA 1ZD5A 1JROA 4P0QB 2K4EA 3T5JA 4MHVA 2KKVA 4JUZA 1X42A 4CRXA 1RQNA 5EE9A 4IL6U 1ZRNA 4Q8FA 3KKAA 4R65A 4DQQA 3RB4A 4DFJA 3OTQA 1MA7A 1J97A 3NTUA 3RJFA 5J2CA 5L1JA 5G5GA 3RRHA 3SAFA 4UB8U 1L7NA 1NJYA 3PSFA 2XY6A 2ZJ8A 2IMWP 1SL2A 5KFNA 5J2FA 4M47A 9ICIA 2XGPA 5KT3A 3GV5B 2Y1IA 3EPGA 5KTQA 2HHTA 4IR9A 3V7JA 4M9HA 1QLNA 5IIJA 1JXEA 3T5HA 1MSWD 3RF9A 4RU9A 5C0YA 1SKSA 9ICBA 4DO9A 2I5HA 4PHPA 4F93B 2KTQA 3PW2A 3RAXA 7ICRA 4A8EA 5DG9A 3BQ1A 1RXWA 5B5EU 1O08A 4YVZA 5KFCA 4JV0A 3ED5A 3HKZF 2KHVA 3BQ0A 3RB6A 4PZNA 5EWFA 4PZOA 3AUOA 3KHLA 4BXOB 2HDOA 4KX5A 1O03A 4YG2A 3HJEA 4M0AA 1ZQDA 3MFIA 2QLTA 2W55A 4ECSA 3JPNA 4I27A 3EZ5A 3HP6A 4RT3A 1BNPA 4IRDA 4DL5A 3AQEA 4QZEA 4EEKA 2KJ8A 4I2JA 1OW5A 1N5WA 3TFRA 2VJ5A 4B9LA 4QNLA 4Z6EA 3RB0A 5KFUA 2C2RA 1XWLA 3SMVA 4UAWA 4I2BA 2MUTA 5DB6A 4DFKA 4GIBA 4I29A 3M6KA 9ICQA 2ZXHA 3GILA 4ZH4A 2XO7A 2EZYA 2Y0SF 2OEHA 2RDJA 8ICIA 2F8LA 1L3SA 4YXMA 4M2YA 3HKZC 9ICSA 2KEYA 2QARB 4TQSA 4RQ8A 2HBLA 4ECWA 2YQEA 3IG8A 3ZDDA 4EENA 3M7DA 3UM9A 5A0LA 1ZQQA 1TAUA 5ALYA 5DBAA 5J2GA
chains in the Genus database with same CATH topology
2KIVA 1WWVA 3BS5B 2E8MA 2EAOA 2EAMA 2ESEA 4IS7A 2F44A 3TACB 1B0XA 1OXJA 2JV3A 2KSOA 1V38A 4NL9A 5F3XB 1KW4A 2F8KA 3SENA 1LKYB 1X66A 4RQMA 2EANA 1Z1VA 3BQ7A 1PK1A 2QARA 3TADA 5JU5A 1UCVA 2L5YA 2E8PA 3HILA 2QKQA 1X9XA 2D3DA 1SGGA 2B6GA 1SV0A 4PZNA 2Y9UA 2QB1A 4PZOA 2KMDA 5J8YA 2D8CA 1SV0C 2K60A 4NL9C 1X40A 2DL0A 2ES6A 2LMRA 3TADC 1F0MA 2QB0B 2F3NA 2GLEA 2KG5A 5JRTA 1COKA 1WWUA 1LKYA 1RG6A 1SV4A 1OW5A 2EAPA 2KSOB 4MHVA 2QB0A 1PK1B 2DKXA 4RQNA 1JI7A 2DKZA 1UQVA 3BS5A 3KKAA 5J8YC 5KNIA 2YTUA 1SXEA 1SXDA 2E8OA 3H8MA 3BS7A 3KKAC 5JTIA 5L1MA 2LPEA 1V85A 2QARB 1B4FA 2K4PA 1DXSA 3SEIA 1PK3A 2KE7A 4NJ8A 3K1RB 2E8NA 2FE9A 2Y9TA 3IDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIV A;  1WWV A;  3BS5 B;  2E8M A;  2EAO A;  2EAM A;  2ESE A;  4IS7 A;  2F44 A;  3TAC B;  1B0X A;  1OXJ A;  2JV3 A;  2KSO A;  1V38 A;  4NL9 A;  5F3X B;  1KW4 A;  2F8K A;  3SEN A;  1LKY B;  1X66 A;  4RQM A;  2EAN A;  1Z1V A;  3BQ7 A;  1PK1 A;  2QAR A;  3TAD A;  5JU5 A;  1UCV A;  2L5Y A;  2E8P A;  3HIL A;  2QKQ A;  1X9X A;  2D3D A;  1SGG A;  2B6G A;  1SV0 A;  4PZN A;  2Y9U A;  2QB1 A;  4PZO A;  2KMD A;  5J8Y A;  2D8C A;  1SV0 C;  2K60 A;  4NL9 C;  1X40 A;  2DL0 A;  2ES6 A;  2LMR A;  3TAD C;  1F0M A;  2QB0 B;  2F3N A;  2GLE A;  2KG5 A;  5JRT A;  1COK A;  1WWU A;  1LKY A;  1RG6 A;  1SV4 A;  1OW5 A;  2EAP A;  2KSO B;  4MHV A;  2QB0 A;  1PK1 B;  2DKX A;  4RQN A;  1JI7 A;  2DKZ A;  1UQV A;  3BS5 A;  3KKA A;  5J8Y C;  5KNI A;  2YTU A;  1SXE A;  1SXD A;  2E8O A;  3H8M A;  3BS7 A;  3KKA C;  5JTI A;  5L1M A;  2LPE A;  1V85 A;  2QAR B;  1B4F A;  2K4P A;  1DXS A;  3SEI A;  1PK3 A;  2KE7 A;  4NJ8 A;  3K1R B;  2E8N A;  2FE9 A;  2Y9T A;  3IDW A; 
#chains in the Genus database with same CATH topology
 3RR7 A;  2BPF A;  5AI8 A;  1ZQZ A;  4KLG A;  2EAM A;  1DGS A;  8ICC A;  1CEZ A;  3PMN A;  5AKL A;  4Y2T A;  3N7S C;  2K4I A;  4O3N A;  3TAC B;  4DOB A;  3TKA A;  3PX0 A;  7ICM A;  2NRT A;  5CJ7 A;  9ICL A;  4KIT B;  3ZDE A;  4I2D A;  4P4P A;  1KL9 A;  2RRD A;  3EW9 A;  1QSY A;  4CNQ A;  5AK5 A;  2DF4 B;  3ETL A;  4EEL A;  3KHH A;  2UVR A;  4QZG A;  5ALG A;  2GWS A;  3MR6 A;  2D8C A;  3ISC A;  3OGU A;  4PHE A;  1EXN A;  1T94 A;  4DOA A;  1ZQF A;  2ZUD A;  4M9L A;  4O9M A;  3WK7 A;  5DB8 A;  3PML A;  1HUZ A;  3IN5 A;  3SD7 A;  3TI0 A;  3ISD A;  2AJQ A;  1A76 A;  1Z4N A;  3KOO A;  3NVV A;  5KFW A;  2MAX A;  4QW8 A;  1XO1 A;  3V6J A;  3HRD D;  3M8R A;  5DLG A;  1HJP A;  2QB0 A;  1PK1 B;  5KFP A;  1X9M A;  4R8U A;  2BDU A;  3ZD9 A;  1U4B A;  4YR0 A;  4F4W A;  1BGX T;  5TIS U;  4BUG A;  3GIJ A;  3JPO A;  5KL1 B;  4RQ4 A;  2W8K A;  7ICG A;  1ZQM A;  4ED0 A;  4I28 A;  5L1K A;  1T3Q A;  3SEI A;  3C5F A;  3RJH A;  1X9S A;  4I2F A;  2KIC A;  5KFG A;  5JUM A;  2C2D A;  1MC8 A;  5KFH A;  4DSF A;  1KDH A;  2DWQ A;  2AXT U;  3F2B A;  5DGA A;  2EQY A;  2Q4T A;  1V38 A;  4Z6D A;  1UA0 A;  1KW4 A;  3QX7 A;  4J9K A;  1ZQA A;  3CNH A;  1VDV A;  4F50 A;  4MFC A;  2YX8 A;  4IRC A;  2WB1 F;  8ICF A;  2I9G A;  2KZM A;  2KIW A;  3GDX A;  1ZQC A;  2C22 A;  2IA6 A;  4ELU A;  2AH5 A;  2M9N A;  1M6Y A;  4J9S A;  5ALQ A;  5G5H A;  5BPC A;  1JUD A;  1COO A;  4FFD A;  1FIQ A;  1C20 A;  1ZD4 A;  2W03 A;  1ZQI A;  2ASD A;  1X40 A;  5J2J A;  2R8K A;  2HBM A;  2ATL A;  3QXG A;  3TAD C;  1ZQS A;  1XSN A;  2LKY A;  4U6P A;  1QTM A;  4IR1 A;  5JRT A;  4DEZ A;  2LI6 A;  5KG1 A;  4QWE A;  5DDY A;  3AL0 B;  2BDP A;  2P6U A;  3C23 A;  1HIW A;  3LWL A;  1KTQ A;  3HT3 A;  4J9L A;  5GTI U;  4DOC A;  1OUQ A;  3GV7 B;  4YP3 A;  4R63 A;  4KX3 A;  5J8Y C;  3R9K A;  5KNI A;  4KLO A;  3IP4 B;  4DFP A;  1IIP A;  3NUQ A;  5KFZ A;  4Y2Y A;  2XI9 A;  1DXS A;  4Y2S A;  3T5K A;  1Z3E B;  4OO1 J;  3UQ0 A;  2E3T A;  4IC9 A;  4IRK A;  3BZC A;  1ZQN A;  4EZ6 A;  2HSZ A;  3WK5 A;  3MDA A;  1BPB A;  1QQ6 A;  5KG7 A;  3V6K A;  2GO7 A;  1NK9 A;  2DQN B;  5KFR A;  4DFD A;  3M1Y A;  2FLN A;  3JPP A;  4GC7 A;  1ZJM A;  3ZD8 A;  5DLF A;  3H0L B;  5F3X B;  4DCC A;  2P6R A;  4XRH A;  2H3I A;  2NV3 A;  4F5O A;  1N62 A;  1ZQV A;  2W04 A;  4HAI A;  4BX9 C;  9ICT A;  4J9P A;  3I76 A;  2E8P A;  3WKB A;  5J2B A;  1ZQ1 C;  1BPD A;  1DOQ A;  2NO4 A;  3E2E A;  8ICK A;  1U47 A;  3FC4 A;  3RB3 A;  2FLL A;  2W9A A;  5J2H A;  5HML A;  3RR8 A;  4AYB F;  2R8H A;  3T3F A;  5AKZ A;  3T79 A;  3RTV A;  4I2A A;  5ALZ A;  2LMR A;  1PVP A;  9ICO A;  3N7P D;  5IIM A;  3RJK A;  2PMZ C;  3G6X A;  5ALK A;  3JPQ A;  1LKY A;  4ZOH C;  4TQR A;  2VKQ A;  4ECX A;  5CWR A;  4FE3 A;  3VCB A;  2EAP A;  5ALH A;  5HHI A;  2KKP A;  1QSL A;  5AKJ A;  4RUA A;  5J0W A;  2HBK A;  4US9 A;  3RH6 A;  1NKE A;  2KV2 A;  1SXE A;  2H3F A;  4J9Q A;  2IOH A;  5ALS A;  1T8E A;  9ICX A;  1ARO P;  3SAH A;  4JK1 A;  1S0M A;  4J9O A;  4YMM A;  1NI3 A;  3MC1 A;  3KTQ A;  1NJZ A;  1WYG A;  4NJ8 A;  2P66 A;  2WFA A;  3FM9 A;  3OJU A;  2BPC A;  4RQ0 A;  3HPO A;  4TUQ A;  2F77 X;  3ZDA A;  4M9N A;  4CGZ A;  4P0P A;  3AU2 A;  2BCR A;  5H2F U;  3KFU F;  2VAN A;  5J0Q A;  1KN5 A;  4CF5 A;  5IIK A;  5AK6 A;  1Q3U A;  3GIK A;  3PO5 A;  3V7L A;  1URJ A;  1SKW A;  2FMP A;  2VJ4 A;  5EWG A;  2L5Y A;  1D8Y A;  3HIL A;  2HHS A;  4TUP A;  5AHX A;  3OSP A;  5HHH A;  4MF2 A;  1X6I A;  5KFQ A;  2MSN A;  1A0P A;  4KLT A;  8ICG A;  4M04 A;  4DSK A;  3K75 D;  1NJX A;  4R8U B;  3QUT A;  4FS2 A;  1LB2 B;  1V97 A;  1NK8 A;  4JB3 A;  4OD0 A;  3GU3 A;  2ASJ A;  3GII A;  4DFM A;  1S97 A;  3B0Y A;  1RG6 A;  3WK9 A;  5KFO A;  4KMU A;  2RDI A;  4UQG A;  3PX6 A;  2ZTE A;  5AM4 A;  2HOQ A;  3QU5 A;  4Q43 A;  2NRV A;  9ICA A;  2W9M A;  2JXJ A;  4FZN A;  1FFU A;  4US8 A;  2K89 A;  1DK2 A;  7ICV A;  3MDC A;  3RJE A;  3LVW A;  8ICO A;  2E5S A;  2BHN A;  1XS9 D;  3AMZ A;  1UT8 A;  5DKW A;  4BXO A;  4KLS A;  1KFT A;  5ALO A;  1D9D A;  2HW3 A;  4DS4 A;  2WB1 C;  1YT3 A;  3A0H U;  1UA1 A;  1D8L A;  2A1A A;  1Q3V A;  4ECQ A;  4YCX A;  8ICR A;  2XID A;  4GFJ A;  1QQ7 A;  1YZ7 A;  3IDW A;  7ICH A;  4CF4 A;  4NLZ A;  1KQQ A;  2HMX A;  5KT4 A;  2W11 A;  1B43 A;  2F44 A;  4YD2 A;  5III A;  7ICQ A;  2F8K A;  4K4G A;  2MA1 A;  4ACO A;  5DDM A;  1NK4 A;  2G08 A;  2ZIV B;  4KLI A;  7ICF A;  4DF4 A;  1JIH A;  2KNJ A;  2XY5 A;  4LZG A;  4ECZ A;  5ALE A;  4MEX A;  2C2E A;  3WKA A;  2KVC A;  1TAM A;  3QEB Z;  1XSP A;  2OH2 A;  3WK4 A;  4FBT A;  1WCL A;  2K60 A;  4O0I A;  2W8L A;  5J2I A;  5CP2 A;  5BOM A;  1TV9 A;  2BCQ A;  3ISB A;  2OYY A;  1XC9 A;  3MBY A;  2QB0 B;  2F3N A;  3HW8 A;  3MGI A;  3WK8 A;  5DGB A;  8ICE A;  9ICH A;  5B66 U;  3GQC A;  1SKR A;  2B0C A;  4C8O A;  1CI4 A;  5E79 U;  1PZN A;  9ICK A;  3RRG A;  4NLN A;  4QWB A;  4RPZ A;  1SL0 A;  4QIW C;  4J9R A;  1CRX A;  2UVW A;  3TQ1 A;  4ELV A;  3M6Z A;  4DL4 A;  3UQ2 A;  2B21 A;  1L3T A;  3Q8S B;  5KFV A;  3Q8Q B;  1C7Y A;  5HNK A;  1S9F A;  4Q44 A;  2DPI A;  5F9L A;  2YTU A;  3H4B A;  1FO4 A;  2G5I B;  4QZB A;  2LHT A;  5D46 A;  2LM4 A;  3MGH A;  1JRP A;  3SV3 A;  4OJO A;  4UAU A;  4NLG A;  4QZI A;  4F4Y A;  4UB2 A;  2W9B B;  4F71 A;  2V9W A;  4C4R A;  5KFJ A;  3HWT A;  2HHW A;  3PZP A;  5J29 A;  5DQH A;  5KG2 A;  3H8W A;  1X9W A;  4C8N A;  3C21 A;  3SQI A;  3ONN A;  5KT6 A;  3I1Y A;  1NJW A;  5KAF U;  4NM1 A;  2ZG6 A;  2JV3 A;  1L5U A;  2WF9 A;  4EX7 A;  3RBD A;  1ZD3 A;  4Q8E A;  3H4D A;  2PFN A;  1CUK A;  2QAR A;  3TAD A;  4RPX A;  5AI9 A;  4IQU A;  3PV8 A;  5KFM A;  5TZV A;  1ZQB A;  1Q46 A;  1JN3 A;  4F8R A;  3N4M B;  3NGD A;  2IHN A;  1S0O A;  1Y88 A;  3NVZ A;  4NL9 C;  2WF6 A;  2G07 A;  1MQ3 A;  4AYB C;  5CA7 A;  3GIM A;  4B6J A;  1ZQK A;  2DUY A;  3WKC A;  1WG8 A;  7ICE A;  4KLF A;  5D49 A;  1BVS A;  3PW0 A;  1QSS A;  1Q8K A;  4P4M A;  2F1J A;  2W7O A;  2PFP A;  3L5K A;  2JH7 A;  3Q8P B;  4UAT A;  2HI0 A;  2ZIU B;  4F5N A;  2I6X A;  4YMN A;  1NK5 A;  1S0N A;  4J9N A;  4M9G A;  5J2A A;  4DL7 A;  4RZR A;  2BCU A;  3PY8 A;  2MU2 A;  3PVX A;  3G6V A;  3SAG A;  2Q0Z X;  1MN8 A;  3Q8M A;  3HX0 A;  1D9F A;  3PW7 A;  4TUR A;  4UAS A;  4PGQ A;  2CXY A;  4EYH B;  2D6F C;  4UB6 U;  4O3M A;  5ALR A;  3C1Z A;  4ELT A;  2BQU A;  1DGJ A;  1GO3 F;  1S8O A;  3TAP A;  2F1H A;  2E8M A;  1N63 A;  3C2L A;  2ZIU A;  2H3V A;  2FPL A;  2HCF A;  2HOF A;  2EH9 A;  3FAH A;  3JPR A;  3RJJ A;  4F5P A;  4Y2V A;  1T7P A;  3SEN A;  1D8B A;  5KFA A;  2KK0 A;  4QZA A;  3F5A A;  5AKY A;  2HVH A;  3QU4 A;  2HHV A;  1ZOL A;  2BR0 A;  5KG4 A;  3H8J A;  4J9M A;  4UAV A;  4I2C A;  5KG6 A;  2D3D A;  2FJ6 A;  4C4T A;  5AM1 A;  4AP9 A;  4ECY A;  4EYI B;  2KMD A;  5KFT A;  4RQ2 A;  1ED1 A;  1JMS A;  1L6N A;  2WHE A;  7ICN A;  1WUD A;  9ICM A;  1J2N A;  2ALZ A;  2AGP A;  4DSJ A;  4EBE A;  3LYS A;  1UHU A;  5C5J A;  2KP7 A;  2ZIX B;  1WCN A;  3MR5 A;  4RQ5 A;  3BS5 A;  5KL8 B;  2BQ3 A;  5AIA A;  8ICS A;  5KG0 A;  1YZ6 A;  4Y2Q A;  1IM4 A;  3AQF A;  1S5L U;  3KKA C;  2JZB A;  4BJQ A;  4Y2X A;  5AKK A;  1RYR A;  2FPM A;  3F53 A;  3QZ7 A;  3WKD A;  2JGA A;  3DDH A;  4RUC A;  2CRX A;  5KT5 A;  7ICO A;  1L8O A;  2XY7 A;  1JX4 A;  3QZ8 A;  2JEI A;  2KN7 A;  3UXN A;  2WF8 A;  2RP5 A;  2G06 A;  3AM9 A;  4NLK A;  2O6K A;  4EZ9 A;  4LJX A;  4OJ6 A;  3IM1 A;  2EAN A;  3EWA A;  1RDF A;  2ZIX A;  4IS7 A;  2PMZ F;  3V72 A;  2WAQ C;  5AM2 A;  1Z4O A;  3T5L A;  1Z19 A;  2BKE A;  4I2I A;  5EE3 A;  2IBK A;  4NL9 A;  3BQ2 A;  4JWM A;  7ICP A;  3IRU A;  5GTH U;  1LKY B;  3SV4 A;  1VLB A;  1Z1V A;  3AN1 A;  3PW5 A;  4M6W A;  3C29 A;  4G9B A;  1Z1B A;  2BPG A;  1ZQH A;  3GV8 B;  4CDG A;  1S10 A;  4B9V A;  2OCE A;  4QWC A;  2Y9U A;  3E58 A;  4F4X A;  4GXJ A;  1P7D A;  2JHD A;  2VA3 A;  4YQW A;  5ALP A;  5AK3 A;  2ASL A;  5KFE A;  1VJ5 A;  7ICL A;  2R8J A;  2DL0 A;  2ZXI A;  2AQ4 A;  2W9C B;  2NRX A;  8ICV A;  1N60 A;  1WWU A;  2N1R A;  3I28 A;  1NKB A;  5AKG A;  2UVV A;  4UBC A;  2JMG A;  5HP4 A;  1ZJN A;  2ZTD A;  4B9S A;  9ICE A;  1ZQP A;  3ALR A;  1BPY A;  2G09 A;  2JR5 A;  5ALN A;  2DBY A;  3TAQ A;  1SB3 C;  3RBE A;  2MRL A;  2YB4 A;  5T14 A;  3NVY A;  4F5R A;  1BPZ A;  3EYZ A;  2A19 A;  1KFS A;  2FMQ A;  1PK3 A;  2RQ5 A;  4PGX A;  3H0M B;  4CCH A;  1PUZ A;  1RXV A;  1S76 D;  4C8M A;  8ICL A;  2W7P A;  4F2S A;  3O0F A;  3S6J A;  1HEK A;  3RH5 A;  4PH5 A;  4ED3 A;  2KZ3 A;  1L8L A;  3C1Y A;  1ZXI A;  4DSE A;  1RM6 C;  3MGV A;  3Q8K A;  3F5E A;  3DV9 A;  3ICX A;  1BPE A;  1XO0 A;  9ICF A;  4MEY A;  5KG3 A;  2I1Q A;  2YML A;  2IHM A;  5IIL A;  4RQM A;  2P35 A;  3PR5 B;  5DQG A;  4UAZ A;  4ECR A;  3FDS A;  4OJL A;  4X5V A;  4G3I A;  7ICS A;  1N56 A;  1X9X A;  2V4Q A;  1SV0 A;  1XSL A;  2J6S A;  4UB5 A;  8ICB A;  5AKI A;  2H5X A;  4EBC A;  1SV0 C;  3PO4 A;  2YMP A;  5FP0 A;  4C7Z A;  1JAL A;  4OCZ A;  2MUT B;  4O3Q A;  2R18 A;  4KLD A;  1RYS A;  3KHG A;  2ZUB A;  4YR3 A;  2WF5 A;  5KFK A;  4YMO A;  1ZQL A;  4P2H A;  4FBU A;  8ICM A;  1NKC A;  1JI7 A;  2DKZ A;  1NZP A;  1N48 A;  1Z00 B;  2KFZ A;  1SZH A;  5DB7 A;  4O3S A;  4YR2 A;  3L3F X;  5AM3 A;  3N7R C;  3CYM A;  2AHO B;  1ECW A;  4ECU A;  4WJ3 B;  5IIN A;  3BS7 A;  3F2D A;  3LVV A;  8ICZ A;  1XU4 A;  4EBD A;  5CR0 A;  3N28 A;  3SR6 A;  2F76 X;  4F91 B;  3CW2 C;  2ZIV A;  2KZZ A;  2YY6 A;  4F2R A;  3IV6 A;  4PHA A;  2FE9 A;  4MF8 A;  3N97 B;  1JXL A;  4LVS A;  5AK4 A;  4UB4 A;  5ALM A;  2XCA A;  3C2M A;  4GLX A;  3QUC A;  3JPT A;  2ESE A;  2M0N A;  3UMC A;  5AM5 A;  1B0X A;  4Y2U A;  1U49 A;  4KLQ A;  2KOB A;  2ZJA A;  4Y2J A;  2R8I A;  2A1J B;  8ICP A;  4PL1 A;  1KRP A;  3NAS A;  3ZI4 A;  4ED6 A;  4Z6F A;  4RT2 A;  2JEF A;  2J6U A;  1U9L A;  1U45 A;  2K8A A;  1TK0 A;  3V6H A;  5KFY A;  3D2Q A;  5CRX A;  5AIC A;  4DL6 A;  2CN1 A;  3BQT A;  4OJP A;  2VA2 A;  2KJ9 A;  2C28 A;  3PST A;  5KFB A;  4YXJ A;  2G0A A;  5HMM A;  2LBO A;  4ED1 A;  2J6T A;  5AI6 A;  2E1E A;  3PSP A;  1QQ5 A;  3BJY A;  1KEJ A;  4RQ6 A;  5F9N A;  4QZC A;  4IQW A;  4ED8 A;  2JZB B;  1TE2 A;  2W9C A;  2KSO B;  4NY8 A;  2DKX A;  1UQV A;  2LYA A;  3C28 A;  3QYP A;  5ALF A;  3SI8 A;  1SWW A;  5J0T A;  4GXK A;  5KFF A;  4O5K A;  1L3U A;  3RJG A;  4KLL A;  3NRW A;  2E8O A;  2W3S A;  2DPJ A;  4KN4 A;  5CB1 A;  5HR7 A;  8ICN A;  3H8M A;  1A6S A;  4JMU A;  3SYZ A;  3B9J A;  9ICJ A;  2LPE A;  1ZD2 P;  5ALV A;  3CRX A;  5D4B A;  4Y2R A;  4XQ8 A;  4GXI A;  4ED2 A;  2YMM A;  4TUS A;  1NK0 A;  4QZD A;  5KFS A;  4C8L A;  1X2I A;  4ICA A;  5DG7 A;  4DLG A;  3EPI A;  2WTF A;  1WWV A;  1PVR A;  5KT7 A;  1PVQ A;  3BS5 B;  9ICN A;  3WU2 U;  5IIO A;  4B9N A;  2DFL A;  3Q8R B;  1H38 A;  1FFV A;  2PKE A;  5HR6 A;  3AEV A;  4HYK A;  4R66 A;  2BCS A;  8ICX A;  4O5E A;  3UMB A;  3KHR A;  4UW9 A;  1NNL A;  4I2E A;  4O3P A;  9ICU A;  1ZYQ A;  1S77 D;  1K1S A;  2YN4 A;  2F2A B;  2OM6 A;  4PL2 A;  2W43 A;  5KFD A;  3K1Z A;  3ZDB A;  1SWV A;  4RNN A;  2QB1 A;  2V4R A;  1RZT A;  5J8Y A;  9ICW A;  3ORY A;  4RQ1 A;  2YB1 A;  3PSI A;  4DSL A;  2ES6 A;  1L7M A;  3G6Y A;  5AKX A;  2XIC A;  2H3Z A;  1IG6 A;  5J0S A;  2CPR A;  3OJS A;  1A77 A;  1ZQX A;  1UT5 A;  3THV A;  5L1L A;  4RQN A;  3E0F A;  1RPL A;  3TFS A;  3QEA Z;  1MQ2 A;  5AI5 A;  2JRZ A;  1ZET A;  3RJI A;  3OHA A;  4P0P B;  2PI5 A;  5ALT A;  3MR2 A;  5L1M A;  5EE1 A;  2NRZ A;  2VIX A;  3C5G A;  3CP8 A;  3PR4 A;  1SIJ A;  3UMG A;  5AI0 A;  5CHG A;  2VA8 A;  3UXP A;  4KLJ A;  2EZZ A;  3QU2 A;  2ZJ5 A;  4XUS A;  4FO6 A;  3QE9 Y;  2KIV A;  2XVT A;  4MFA A;  4QW9 A;  4KLU A;  2HBJ A;  5J0O A;  3KBB A;  1DRG A;  2Z7J A;  2KSO A;  3TAR A;  2WF7 A;  5ALU A;  4CE6 A;  1L7P A;  9ICC A;  3KZX A;  4JV1 A;  1ZQU A;  1T4G A;  4QWA A;  1B22 A;  2AQ0 A;  2A3V A;  4C80 A;  5ALL A;  5JU5 A;  4FS1 A;  4RQ3 A;  4XA5 A;  1K5O A;  4KMO B;  5J2E A;  4KLE A;  8ICT A;  4IQV A;  3M9O B;  5J0X A;  2B6G A;  1S0V A;  3ETR A;  3IHQ B;  3J81 j;  5DQI A;  2IOF K;  2NRW A;  8ICH A;  5AKH A;  4B9M A;  4U7C A;  5L1I A;  7ICU A;  5AKE A;  2GLE A;  4C0Z A;  8ICJ A;  9ICG A;  5J2K A;  3F2C A;  2KD1 A;  2Y0S C;  3TAN A;  4BDP A;  3GZF A;  1ZQJ A;  2JH1 A;  2AU0 A;  2K8B B;  5J0U A;  5ALJ A;  3IG5 A;  2W54 A;  4NV0 A;  1SZP A;  2KHQ A;  3OPX A;  2EZX A;  1QH9 A;  1XNS A;  4PGY A;  1SXD A;  4DSI A;  4BGD A;  1NOM A;  4C4S A;  4F3O A;  4UB1 A;  4NLB A;  3H7I A;  4KLM A;  7ICK A;  4QZ8 A;  3L4P A;  5ALW A;  2KVS A;  1TFR A;  5AI4 A;  2NO5 A;  4QZF A;  4UBB A;  4I2H A;  3K1R B;  4QWD A;  2W3R A;  1N2X A;  3SZ2 A;  4RPY A;  3PW4 A;  3RH4 A;  4P4O A;  4BWJ A;  3OHB A;  5EE0 A;  3PNC A;  2HHQ A;  3U26 A;  4I2G A;  1KLN A;  4B9U A;  2JEG A;  1DK3 A;  4O3O A;  3UXO A;  4ED7 A;  3PX4 A;  5KFI A;  5DB9 A;  2F1I A;  2XC9 A;  3V7K A;  4JV2 A;  5ALD A;  1N61 A;  2OWO A;  5KFX A;  1ZQO A;  3MAB A;  4DQR A;  3FYH A;  4P0Q A;  1UCV A;  1TVA A;  4CF3 A;  2K4H A;  4QJF B;  4F4Z A;  4F4K A;  3D2S A;  3JPS A;  2RHF A;  3BZK A;  1ZRM A;  4J03 A;  3RAQ A;  8ICQ A;  3OSN A;  2OXO A;  2UVU A;  2AGQ A;  3M8S A;  1F0M A;  2EDU A;  2PI4 A;  3LDA A;  1L3V A;  3GFK B;  1COK A;  2ZTC A;  1SV4 A;  4YD1 A;  1Z00 A;  7ICI A;  2GOL A;  4NXZ A;  3QNM A;  3C2K A;  3WKE A;  4FZL A;  3NVW A;  4NWI A;  4RNO A;  2HOI A;  8ICY A;  9ICR A;  4IQT A;  1K1Q A;  2JEJ A;  3M9N B;  3KD3 A;  2AGO A;  3LK9 A;  4DQI A;  4NLC A;  2BZF A;  2IOF A;  4QIW F;  2BCV A;  4PHD A;  3K4G A;  2Y1J A;  2K8C B;  4R64 A;  4O5C A;  4F5Q A;  1V85 A;  3B0X A;  4UAR A;  5ALX A;  1F5S A;  1B4F A;  4K4I A;  2K4P A;  3QUQ A;  2KE7 A;  1ZQE A;  2E8N A;  4UB3 A;  4DQP A;  1U48 A;  1LVH A;  2Y9T A;  5EWE A;  5KFL A;  2ODG A;  4Q45 A;  2HHX A;  4K4H A;  5J2D A;  1X6J A;  2EAO A;  2LM1 A;  2PFO A;  2KJ5 A;  3M9M B;  2E1F A;  7ICT A;  4UAY A;  2H3Q A;  2FPK A;  2FI1 A;  1OXJ A;  1TK5 A;  1AQ6 A;  2ZUC A;  1BNO A;  4NM2 A;  2ZIW B;  3QUB A;  8ICA A;  1PK1 A;  3D6J A;  1NK6 A;  1L7O A;  4USA A;  3ZDC A;  4YFK A;  2BGW A;  1F44 A;  1V9P A;  4F72 A;  1N5X A;  5DBB A;  1SGG A;  2YMQ A;  1ZQY A;  2ISP A;  3A0B U;  5KT2 A;  8ICW A;  7ICJ A;  2GH1 A;  3AU6 A;  4KN7 A;  4DLE A;  1HUO A;  3H8S A;  4LZD A;  1KKX A;  2HHU A;  5J0P A;  1ZQT A;  3RFA A;  5EOZ A;  4OJ5 A;  4C8K A;  1TAQ A;  1T3N A;  2A1J A;  4DL2 A;  4DL3 A;  1KBU A;  1TK8 A;  2ZIW A;  4QZ9 A;  4MFF A;  1RYU A;  1UPH A;  3Q8L A;  4BWM A;  2W9B A;  1ZQR A;  2NYV A;  5K4L A;  4F92 B;  3VC8 A;  4RQ7 A;  2LYB A;  2WAQ F;  5ALI A;  5JTI A;  2FLP A;  2KFN A;  3DEE A;  3WK6 A;  5CEH A;  2BQR A;  3EUB 2;  2R8G A;  3KZI U;  4GC6 A;  4KTQ A;  2ISO A;  3MR3 A;  4B9T A;  1NK7 A;  1NZB A;  2PXI A;  2HVI A;  3H0R B;  1LV5 A;  1KSP A;  4QZH A;  1IV8 A;  4DF8 A;  4ECT A;  1RQL A;  3LWM A;  5DG8 A;  1ZQG A;  8ICU A;  1IXR A;  3QU7 A;  2PFQ A;  5AIB A;  2RLT A;  5L9X A;  1ZQW A;  1FEZ A;  4M9J A;  4E0D A;  4EX6 A;  1TKD A;  2DGZ A;  3NRZ A;  5J0R A;  4PPX A;  4C7Y A;  2FDR A;  2LYH A;  1X66 A;  2OHF A;  1KFD A;  5KG5 A;  3BQ7 A;  4PJ0 U;  5AM0 A;  1J2M A;  1SL1 A;  4O3R A;  4EEY A;  3UPQ A;  4ECV A;  2XCP A;  2QKQ A;  4Z6C A;  5DBC A;  2FMS A;  4RNM A;  1QCK A;  9ICV A;  2XGQ A;  4JWN A;  4DWI A;  5KAI U;  3BDP A;  4YN4 A;  4DS5 A;  5BOL A;  3H40 A;  2G5H B;  9ICP A;  4KLH A;  5J0Y A;  1BPX A;  4M6W B;  3NS1 A;  4Y2P A;  3D2N A;  4FZM A;  3QU9 A;  3MFH A;  2KG5 A;  4DQS A;  1ZD5 A;  1JRO A;  4P0Q B;  2K4E A;  3T5J A;  4MHV A;  2KKV A;  4JUZ A;  1X42 A;  4CRX A;  1RQN A;  5EE9 A;  4IL6 U;  1ZRN A;  4Q8F A;  3KKA A;  4R65 A;  4DQQ A;  3RB4 A;  4DFJ A;  3OTQ A;  1MA7 A;  1J97 A;  3NTU A;  3RJF A;  5J2C A;  5L1J A;  5G5G A;  3RRH A;  3SAF A;  4UB8 U;  1L7N A;  1NJY A;  3PSF A;  2XY6 A;  2ZJ8 A;  2IMW P;  1SL2 A;  5KFN A;  5J2F A;  4M47 A;  9ICI A;  2XGP A;  5KT3 A;  3GV5 B;  2Y1I A;  3EPG A;  5KTQ A;  2HHT A;  4IR9 A;  3V7J A;  4M9H A;  1QLN A;  5IIJ A;  1JXE A;  3T5H A;  1MSW D;  3RF9 A;  4RU9 A;  5C0Y A;  1SKS A;  9ICB A;  4DO9 A;  2I5H A;  4PHP A;  4F93 B;  2KTQ A;  3PW2 A;  3RAX A;  7ICR A;  4A8E A;  5DG9 A;  3BQ1 A;  1RXW A;  5B5E U;  1O08 A;  4YVZ A;  5KFC A;  4JV0 A;  3ED5 A;  3HKZ F;  2KHV A;  3BQ0 A;  3RB6 A;  4PZN A;  5EWF A;  4PZO A;  3AUO A;  3KHL A;  4BXO B;  2HDO A;  4KX5 A;  1O03 A;  4YG2 A;  3HJE A;  4M0A A;  1ZQD A;  3MFI A;  2QLT A;  2W55 A;  4ECS A;  3JPN A;  4I27 A;  3EZ5 A;  3HP6 A;  4RT3 A;  1BNP A;  4IRD A;  4DL5 A;  3AQE A;  4QZE A;  4EEK A;  2KJ8 A;  4I2J A;  1OW5 A;  1N5W A;  3TFR A;  2VJ5 A;  4B9L A;  4QNL A;  4Z6E A;  3RB0 A;  5KFU A;  2C2R A;  1XWL A;  3SMV A;  4UAW A;  4I2B A;  2MUT A;  5DB6 A;  4DFK A;  4GIB A;  4I29 A;  3M6K A;  9ICQ A;  2ZXH A;  3GIL A;  4ZH4 A;  2XO7 A;  2EZY A;  2Y0S F;  2OEH A;  2RDJ A;  8ICI A;  2F8L A;  1L3S A;  4YXM A;  4M2Y A;  3HKZ C;  9ICS A;  2KEY A;  2QAR B;  4TQS A;  4RQ8 A;  2HBL A;  4ECW A;  2YQE A;  3IG8 A;  3ZDD A;  4EEN A;  3M7D A;  3UM9 A;  5A0L A;  1ZQQ A;  1TAU A;  5ALY A;  5DBA A;  5J2G A; 
#chains in the Genus database with same CATH homology
 2KIV A;  1WWV A;  3BS5 B;  2E8M A;  2EAO A;  2EAM A;  2ESE A;  4IS7 A;  2F44 A;  3TAC B;  1B0X A;  1OXJ A;  2JV3 A;  2KSO A;  1V38 A;  4NL9 A;  5F3X B;  1KW4 A;  2F8K A;  3SEN A;  1LKY B;  1X66 A;  4RQM A;  2EAN A;  1Z1V A;  3BQ7 A;  1PK1 A;  2QAR A;  3TAD A;  5JU5 A;  1UCV A;  2L5Y A;  2E8P A;  3HIL A;  2QKQ A;  1X9X A;  2D3D A;  1SGG A;  2B6G A;  1SV0 A;  4PZN A;  2Y9U A;  2QB1 A;  4PZO A;  2KMD A;  5J8Y A;  2D8C A;  1SV0 C;  2K60 A;  4NL9 C;  1X40 A;  2DL0 A;  2ES6 A;  2LMR A;  3TAD C;  1F0M A;  2QB0 B;  2F3N A;  2GLE A;  2KG5 A;  5JRT A;  1COK A;  1WWU A;  1LKY A;  1RG6 A;  1SV4 A;  1OW5 A;  2EAP A;  2KSO B;  4MHV A;  2QB0 A;  1PK1 B;  2DKX A;  4RQN A;  1JI7 A;  2DKZ A;  1UQV A;  3BS5 A;  3KKA A;  5J8Y C;  5KNI A;  2YTU A;  1SXE A;  1SXD A;  2E8O A;  3H8M A;  3BS7 A;  3KKA C;  5JTI A;  5L1M A;  2LPE A;  1V85 A;  2QAR B;  1B4F A;  2K4P A;  1DXS A;  3SEI A;  1PK3 A;  2KE7 A;  4NJ8 A;  3K1R B;  2E8N A;  2FE9 A;  2Y9T A;  3IDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...