2QKQA

Structure of the sam domain of human ephrin type-b receptor 4
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
AFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-B receptor 4
publication title SAM Domain of Human Ephrin Type-B Receptor 4 (EPHB4)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qkqA00
1B4FA 1PK3A 5JTIA 2KE7A 3KKAC 1COKA 1LKYA 2QARA 3K1RB 1V85A 1SXDA 4IS7A 5J8YA 2E8PA 2D3DA 2FE9A 5KNIA 2QB0A 2KIVA 2Y9UA 2D8CA 2KSOB 4RQNA 1SV0C 3H8MA 3HILA 3BQ7A 2EAPA 2EAMA 5F3XB 2Y9TA 2E8MA 2ESEA 2GLEA 1SXEA 2E8NA 4NL9A 1RG6A 3TACB 1OW5A 3TADC 2DKZA 1OXJA 3KKAA 2QB1A 2YTUA 1Z1VA 4MHVA 2F3NA 5L1MA 5JRTA 3SEIA 1UQVA 2KSOA 1UCVA 2K60A 1PK1B 2K4PA 2QKQA 3IDWA 1X66A 3BS5B 1F0MA 1X9XA 1JI7A 2B6GA 1SV0A 3SENA 1SV4A 1X40A 2KMDA 2EANA 1KW4A 2LMRA 1V38A 5J8YC 2F44A 2DKXA 2F8KA 1LKYB 2QARB 2EAOA 4PZNA 3TADA 5JU5A 1B0XA 2DL0A 2QB0B 2LPEA 2L5YA 1PK1A 2KG5A 3BS5A 2ES6A 2JV3A 1WWVA 1DXSA 2E8OA 1WWUA 3BS7A 1SGGA 4NJ8A 4NL9C 4RQMA 4PZOA
chains in the Genus database with same CATH superfamily
2W7OA 5DGAA 1PZNA 3IP4B 5KFOA 4PHAA 5ALGA 3ISCA 4EBEA 4DLEA 4M9JA 2P6RA 4O5CA 4P2HA 8ICQA 2W9MA 1DOQA 4DCCA 1TVAA 2FE9A 1ZQUA 4FO6A 5DB9A 3G6XA 5J0PA 1SKRA 2DGZA 4UAVA 7ICLA 3ISDA 1ZQVA 3TQ1A 4YQWA 2XCAA 3UM9A 2Y9TA 4M9HA 3PZPA 4RQ2A 4KN7A 1KFSA 2E8NA 4ZH4A 3KTQA 4M9GA 1ZD3A 1SKSA 2KN7A 3KZXA 1JXEA 1OXJA 4PGYA 4NLNA 1S0VA 3AUOA 4P4PA 1F44A 4Y2PA 5KFSA 1ZQSA 2MUTA 5AM1A 5CR0A 1PK1B 1SL0A 3AU2A 3PSFA 2JH7A 3BS5B 3GIJA 1HIWA 2B6GA 2I9GA 2ZXIA 3MABA 5DB7A 2LMRA 1CRXA 2HI0A 4J9OA 4NY8A 2HHUA 2FLPA 4Q45A 2W7PA 2F8KA 5ALSA 2HHXA 3IG5A 4RNOA 2W11A 4TQSA 1N2XA 1NKBA 5KG1A 7ICJA 4GC7A 4EX7A 4ED2A 4BDPA 2LPEA 2KKPA 1UHUA 9ICSA 4QWAA 3C28A 3NS1A 3TKAA 5AKKA 2YY6A 2NYVA 1X42A 3QX7A 4MFFA 4QZGA 5DLFA 4C8KA 3QU4A 2PKEA 4ED1A 2JR5A 9ICPA 4F2RA 3WU2U 4O3NA 1DGJA 3T5HA 2RDIA 3NTUA 3L5KA 4RQNA 3ISBA 4QNLA 4IRKA 4IQVA 5DG7A 4C7YA 2EAPA 2DWQA 2EAMA 2ZJ8A 4EZ9A 3WK9A 2I6XA 3NVZA 4ACOA 3RJJA 2HBJA 2CPRA 4AP9A 2AQ4A 2HHQA 1KQQA 4RQ3A 3RJIA 5HMLA 5ALPA 5DDMA 1ED1A 2PFQA 1Y88A 2BPFA 3RJFA 2BCUA 2JEIA 4EZ6A 2YMMA 2Y1JA 4PGQA 3J81j 2MA1A 4GIBA 2BCQA 1IM4A 1ZQPA 5GTHU 4UAWA 9ICKA 2RRDA 3PV8A 2LKYA 4C80A 4XRHA 1KEJA 1UA0A 4QJFB 4KLSA 2BCRA 7ICKA 2BR0A 2KIWA 3GIKA 3NVYA 2ASLA 8ICNA 1N62A 4R8UA 2YQEA 5KFTA 1KKXA 3PO5A 5JU5A 1BNOA 1IXRA 3V7JA 4RU9A 2ES6A 4YXJA 2RLTA 5B66U 4TURA 2JMGA 4J9KA 4F4WA 1SGGA 2HBKA 3PY8A 3Q8QB 1JALA 1X6JA 1SL2A 2AXTU 3CW2C 5J2DA 4DQRA 1A0PA 1SZPA 5J8YA 1CI4A 2E8PA 1K1QA 2K8BB 4CGZA 3JPOA 9ICWA 3PW5A 3QZ8A 3M9NB 1RDFA 4ECSA 4UASA 1S9FA 4CCHA 1V9PA 2FDRA 2F1IA 3AM9A 1N60A 5KG3A 5F9NA 2FJ6A 1WUDA 5EE0A 3RH5A 3RJGA 4I2FA 1M6YA 2NO5A 2EDUA 4Q8EA 2BCVA 2UVVA 2WF6A 1RG6A 5HHHA 1NI3A 3OJUA 4QWCA 3GV7B 1BPXA 5KFUA 4EBCA 2V9WA 2F3NA 5L1MA 3UXOA 4LVSA 1PVRA 1IIPA 1QH9A 2W43A 1UCVA 4DO9A 2KZ3A 4NXZA 1OUQA 2VA8A 3N7RC 2DPJA 3V7KA 1ZQQA 3KHHA 3PMLA 4IR9A 1ZQRA 4LZDA 3WKAA 2MAXA 2VANA 3TFSA 2OXOA 4U7CA 4M9NA 1X6IA 3VCBA 1ZYQA 2ZXHA 4CNQA 3LDAA 1ZQMA 3TADA 4G3IA 5D46A 3TAQA 5DBBA 3EW9A 3A0BU 4YVZA 1O08A 1K1SA 5KT4A 4KLEA 5ALVA 3PX0A 1IG6A 5J2BA 2AU0A 1L5UA 1FIQA 4QIWC 5KT3A 4Z6FA 1RXWA 4F4KA 5KFYA 1T7PA 5J0RA 5KFWA 2IHMA 3JPRA 3SI8A 2GWSA 2YN4A 3RRHA 4QIWF 4DL5A 1WCNA 2RDJA 2LM1A 2QARA 4NLGA 1V85A 4IQUA 1SXDA 4IS7A 2C2DA 4ED0A 2P66A 4BWMA 4KX5A 3G6VA 8ICCA 4Z6CA 4F71A 4K4HA 3F53A 2JZBA 1PVPA 5KFQA 2Z7JA 1HUOA 8ICHA 4QZDA 5KFZA 2DPIA 2MUTB 3MFHA 2PMZC 4XA5A 4UB1A 3RTVA 1Q3UA 5FP0A 4DSLA 3OSNA 2WTFA 5EWGA 5KFPA 5J2GA 2F1HA 4XQ8A 1XO1A 1K5OA 5KFHA 2PMZF 5AKLA 5DKWA 4Y2YA 4KLLA 1OW5A 4JV1A 1JRPA 4YMNA 1A6SA 1J2MA 4IC9A 1Z1VA 1KBUA 5B5EU 2FMPA 4NLKA 4UAZA 1YZ7A 4F5OA 1L7OA 4DL6A 5AK5A 3MGHA 3IDWA 5G5HA 3RB3A 4QZCA 3RBEA 1X66A 3CRXA 2AGPA 1U4BA 4I2EA 2KZMA 1Z4NA 3SAHA 5BOMA 2A1JA 9ICJA 4JWNA 3CP8A 2R8JA 4GC6A 1L7NA 3QU9A 1TAQA 4DFMA 3NRWA 5J2JA 2WF8A 1NK0A 2PFOA 4OD0A 5KFGA 5CP2A 5E79U 4AYBC 4IRCA 5IINA 5F9LA 5ALWA 4I2AA 3OGUA 5KFIA 2JV3A 4AYBF 3JPTA 1QTMA 4QW8A 2NRZA 5KAFU 1QQ6A 3OJSA 1VJ5A 4RQMA 4J9SA 4O0IA 5J0YA 1Q46A 2J6SA 3RH6A 4M04A 3RF9A 3M7DA 1ZJMA 2R8KA 5KG5A 8ICWA 1RM6C 1ZQAA 4F5NA 2JEJA 5KT5A 1ZETA 5KNIA 5L1LA 3RBDA 2F77X 2KEYA 2XY7A 4DL2A 4Y2QA 5DG9A 4F5QA 4UAYA 5EE1A 2H5XA 4I2BA 3H8MA 5KFJA 1U47A 2KHQA 1DRGA 5J2HA 3RFAA 3MFIA 2FMSA 1NJZA 2GLEA 4QWDA 3V6HA 4ECTA 1ZQKA 3WK4A 2FLLA 7ICTA 2VA3A 4JK1A 1ZQJA 3D6JA 1T4GA 3O0FA 2MU2A 3KBBA 1KL9A 4DWIA 4R8UB 3RB6A 7ICUA 5DBAA 7ICNA 3ED5A 3V6JA 2KTQA 3I1YA 2BGWA 5AM2A 4RT3A 4C4SA 1NJWA 2HVIA 4UATA 2ZIWA 2F44A 5CWRA 2AGQA 3Q8RB 4TUQA 3AU6A 3MGIA 1TE2A 4M0AA 5KFBA 1ZQZA 5KFKA 5KG2A 4QZHA 4QWEA 4UB8U 1B0XA 5J0XA 2AHOB 2ZIXA 4NV0A 4I2CA 1S77D 2R8IA 1BGXT 2GOLA 9ICNA 3UQ0A 9ICEA 4O3QA 4QZ9A 5JTIA 1LKYA 4KLQA 4YP3A 5AI8A 5KG7A 4ELTA 2YX8A 5ALYA 1VDVA 4K4IA 3MR6A 1L7MA 4BX9C 4ECZA 5AKJA 2BQRA 2QLTA 4C7ZA 4EEKA 3C23A 4J03A 3BZCA 8ICJA 4QWBA 2W9BA 5CJ7A 5L1JA 5ALXA 5DQHA 3HWTA 5C0YA 4NL9A 4F5RA 2ZJ5A 4NLZA 4GXIA 1X9SA 3E58A 1LB2B 2WF7A 3GIMA 3EUB2 4NM1A 1EXNA 4J9PA 2OCEA 1Q8KA 5ALEA 4DL7A 3UXPA 5IIMA 2Q0ZX 4YD1A 4DFKA 8ICLA 1XC9A 2HHVA 5AM4A 5HP4A 4I2GA 1KW4A 1JMSA 5HHIA 2UVWA 4F72A 2XIDA 2QARB 3M6ZA 1U48A 3B0XA 3NASA 3C1YA 2BQ3A 2OHFA 4Q43A 1ZQEA 1MC8A 3SAGA 3TAPA 4NLBA 2G08A 1L3TA 2JZBB 2JHDA 1WWVA 2E8OA 1WWUA 1Q3VA 4PPXA 4F50A 2GO7A 4YD2A 7ICHA 1NKEA 3KKAC 2W9CA 3SV3A 5TISU 1TFRA 3JPSA 3QUTA 3OHAA 3H4BA 4O3SA 4KLDA 4J9MA 4Y2VA 3UMGA 5KL8B 3HPOA 4DFPA 5KT2A 4TUPA 3PW4A 1TKDA 4LZGA 4M9LA 3N7PD 3WKDA 1Z3EB 1N61A 4O3RA 1KSPA 4Q8FA 3SZ2A 1SV0C 2KVCA 2EZXA 3F2CA 1ZOLA 1ZQTA 2HOFA 8ICGA 2A1JB 2E1FA 1BPZA 1ZD2P 5T14A 3CNHA 5C5JA 2IOHA 2W8LA 4NM2A 4RQ5A 4YR3A 2FI1A 4EELA 5KL1B 3UPQA 2KKVA 4DL4A 3GILA 2IMWP 3SEIA 2Y1IA 3AMZA 4DSIA 3EPGA 4DOCA 4OJOA 4F3OA 3WKEA 3SAFA 4KITB 4F93B 2WFAA 3QUCA 3HW8A 3RR7A 1SV4A 4QZBA 1ZQFA 5ALRA 4YR0A 2Q4TA 4O3MA 2RP5A 4RT2A 2DKXA 1B22A 2F1JA 3NVVA 4RZRA 2HW3A 1GO3F 3AQFA 4J9NA 3F2BA 5ALDA 2BHNA 5AK4A 5D49A 2ZIVA 2JEGA 8ICOA 2HHSA 2KG5A 3E2EA 4DEZA 5H2FU 4C8LA 4YMOA 4JV0A 2KFNA 4ELVA 1BPYA 3M9OB 5EOZA 3PSTA 4Y2XA 8ICBA 2BCSA 1URJA 3E0FA 2HHTA 1MQ2A 3FM9A 2IOFA 2AGOA 1SZHA 2CRXA 4BJQA 3H0LB 1UA1A 1TV9A 5J0UA 2JH1A 8ICMA 5J0OA 3C21A 1AQ6A 2BKEA 8ICRA 3IN5A 3BQ7A 5L1KA 3PX6A 5F3XB 1XU4A 3AN1A 4I2IA 4PHDA 5KFEA 2FPMA 4KLGA 3EPIA 3KHRA 2ZIWB 3T3FA 1CEZA 3IHQB 2H3IA 2PFNA 2HSZA 2PI5A 2HBMA 1NK6A 3ALRA 3R9KA 3ZI4A 2KD1A 1HJPA 1JX4A 4PH5A 3ZDDA 5DBCA 3UMBA 2OH2A 2ZIXB 4P0PA 5KFLA 2HCFA 1N5WA 1ZQIA 1DK2A 2WF9A 4CE6A 8ICZA 1L6NA 3M1YA 3MR5A 1SWVA 5KTQA 1DK3A 1LKYB 2VIXA 3IG8A 1ZJNA 4C8OA 4DQIA 4E0DA 4DFDA 5AKYA 3MBYA 1T94A 2ISOA 4KN4A 4EX6A 3EYZA 4UB3A 4I27A 2HOQA 3K1ZA 3T5LA 1NK5A 4YFKA 4RPZA 3C2KA 2W9BB 8ICIA 2XCPA 5KFMA 4PZOA 5CA7A 4EENA 5ALTA 1JIHA 1KFTA 4PL2A 1X2IA 3LWLA 4YN4A 3RJEA 1N56A 5ALLA 5AIBA 3B9JA 5EWEA 3SR6A 4C0ZA 2XGQA 1IV8A 4FBUA 2NO4A 4OJPA 9ICTA 4JV2A 5J0WA 3HX0A 3HRDD 2HMXA 5ALFA 1XS9D 3QYPA 4JWMA 1PUZA 5ALOA 2BPCA 4F92B 1SXEA 4ED7A 2A1AA 3RAXA 2LYHA 3TACB 3PR5B 2AH5A 2XVTA 1AROP 1ZD4A 4QZFA 2KV2A 4RUAA 3GIIA 3CYMA 1QLNA 1ZQWA 2HOIA 4QZIA 2K60A 1MA7A 4YG2A 4ED8A 1JROA 3DV9A 5ALUA 4ICAA 1D9DA 1D8BA 5D4BA 1JXLA 5AI0A 3ZD8A 1X40A 2KMDA 3RJHA 3PVXA 2ZUDA 5KAIU 2XC9A 2EQYA 1V38A 4FS1A 2K8AA 3GDXA 3PMNA 7ICSA 1A76A 3GZFA 2CXYA 3PNCA 4ED6A 2KP7A 9ICMA 3F2DA 4U6PA 3THVA 5J2AA 4DS5A 1KTQA 2DUYA 3V7LA 2LM4A 3QEAZ 3BJYA 5KG4A 5AKEA 5KFNA 4KLOA 2VJ4A 4KLMA 3N7SC 1T3NA 4MEYA 4MF2A 2B0CA 1KRPA 3M8RA 3VC8A 5ALZA 1BVSA 1J97A 4FFDA 2QB0A 3RRGA 5ALHA 1FFUA 2KJ8A 4FZMA 2C2EA 4RPXA 3PX4A 4UB5A 5ALNA 4CF3A 2ASDA 3MDCA 4YMMA 5J2IA 4Q44A 1ZRMA 1BPEA 2MSNA 3H8WA 3QUBA 1X9WA 4O9MA 4DF4A 3QZ7A 2JEFA 5CEHA 2WB1C 2DFLA 5AICA 3RJKA 5AI5A 5J2FA 3HT3A 3WK7A 3TANA 2LYBA 2QB1A 4O3OA 4FBTA 4F8RA 9ICXA 1S0NA 5JRTA 5DLGA 3TI0A 3PW7A 9ICIA 1MSWD 3NRZA 1D8LA 4DQQA 2ZIVB 5HR6A 2VKQA 3UMCA 3WK5A 1ZRNA 4ECWA 8ICAA 4UW9A 5J2CA 5IILA 3SENA 2ATLA 1C20A 3K75D 5AKZA 5J8YC 2OM6A 2O6KA 1WYGA 5IIIA 4ECVA 2KICA 2C2RA 4YCXA 5BPCA 2KFZA 2EZZA 1YT3A 1C7YA 3MC1A 8ICYA 3ZDBA 1KN5A 4RQ7A 1ECWA 2FPLA 1MN8A 1COOA 9ICHA 1Z00A 2DL0A 5EE3A 1ZD5A 2ZJAA 1DGSA 4US9A 1B43A 4RQ0A 2HBLA 4B9TA 3EZ5A 1NZBA 5ALQA 4DLGA 7ICIA 4F91B 4RPYA 3JPNA 4DFJA 4M47A 4QZEA 9ICRA 2I5HA 1ZQYA 1ZQOA 4X5VA 5ALKA 2W04A 1KFDA 9ICCA 4RNMA 4PHPA 3N28A 3BDPA 1TK5A 4RQ8A 3OTQA 4PJ0U 4K4GA 1WG8A 3UXNA 4P0PB 4UARA 5IIJA 5J0QA 2IBKA 5L9XA 1YZ6A 5EE9A 4ECYA 1S76D 1PVQA 1L3SA 3TADC 1NJYA 2DKZA 4F5PA 4F2SA 4EYHB 2YTUA 1NJXA 1SKWA 1UQVA 5KT7A 4OO1J 2H3VA 2KSOA 1HUZA 4CF5A 2P35A 4TQRA 7ICMA 2QKQA 8ICUA 3H0RB 4J9QA 5AKIA 4RNNA 3QNMA 1JI7A 1RYUA 5GTIU 4C8MA 2KK0A 9ICOA 2HVHA 7ICFA 2MRLA 3B0YA 3BQTA 4ECQA 3C2MA 1XNSA 3FC4A 4I2JA 3H4DA 3WKBA 2ZIUA 3M6KA 2VA2A 3QUQA 5KFFA 2V4QA 4UBBA 2D6FC 2B21A 2W3RA 1TAMA 1BPBA 9ICQA 2W9AA 1RYSA 5CHGA 3BQ1A 3QE9Y 3A0HU 4M6WA 2BQUA 3ETRA 3DDHA 4NJ8A 1ZQCA 2C22A 2E3TA 4FS2A 4EEYA 2FMQA 5KG0A 2R18A 1H38A 2J6UA 5KFVA 5J0TA 5HMMA 2KNJA 5KFRA 1TK8A 3K1RB 4KMOB 4MFAA 3Q8SB 4DL3A 1KLNA 3BQ2A 3D2NA 5AK6A 2M0NA 4Z6DA 4IQWA 1HEKA 5AKHA 4P0QA 2FLNA 1LVHA 2ZTEA 2G5HB 4OCZA 4DQPA 1D8YA 4B6JA 3L4PA 5ALIA 2NV3A 2ALZA 3KHLA 5DB8A 3C5FA 1ZQDA 1S5LU 2W03A 3QU2A 1V97A 7ICVA 5CB1A 2CN1A 1ZQXA 2KOBA 3MDAA 3DEEA 1FFVA 4NWIA 4UAUA 9ICGA 5IIKA 2FPKA 2UVUA 3NVWA 1N63A 3WKCA 4P4MA 4BXOA 1F5SA 5AK3A 5KG6A 4Y2RA 2W8KA 3K4GA 1F0MA 5DQGA 4MF8A 7ICOA 1LV5A 4WJ3B 2A3VA 5CRXA 3H8SA 3RAQA 1S10A 4Y2UA 4TUSA 2NRXA 1CUKA 2H3QA 4NLCA 1RXVA 4XUSA 3L3FX 4PZNA 5KFCA 2XICA 2AQ0A 4IRDA 2YB4A 3QU7A 2QB0B 3PW0A 2DQNB 3RB0A 5DG8A 1XSPA 4F4XA 3T79A 1P7DA 3S6JA 4I2HA 3ZDEA 3QEBZ 4UB2A 4B9NA 3WK6A 1SWWA 5ALJA 4KLHA 4OJLA 5AM0A 3U26A 5KT6A 8ICFA 5AM5A 1O03A 2JXJA 5AI6A 1UPHA 3GFKB 3NUQA 3OSPA 2HDOA 2RQ5A 4DSKA 3UQ2A 1XWLA 4GFJA 4DOBA 5K4LA 1S97A 2KIVA 1SB3C 4HYKA 2BDPA 2D8CA 3PW2A 3T5KA 4RQ1A 3V6KA 5J2EA 7ICEA 1QCKA 1WCLA 2K4IA 3RR8A 2V4RA 1XO0A 3ZDCA 1J2NA 2E8MA 4I29A 2BDUA 3BZKA 3MR2A 4QW9A 2ASJA 4LJXA 3PR4A 4IR1A 2LI6A 8ICKA 1QSYA 2PXIA 3LVVA 4ED3A 5L1IA 4FZNA 9ICFA 3SV4A 5AKGA 4P4OA 2K8CB 3IM1A 3MR3A 2OYYA 4R66A 2XO7A 9ICAA 5TZVA 4QZ8A 3C5GA 4KLUA 1Z00B 2HHWA 1JUDA 3ETLA 5AM3A 1NOMA 7ICGA 2G5IB 4F4ZA 4B9MA 2W55A 1X9XA 2G09A 2WAQC 1S8OA 1MQ3A 1S0MA 1QSSA 4OJ5A 8ICEA 3KZIU 1L3UA 2K4HA 2WAQF 4GXJA 9ICLA 4M2YA 2XGPA 2W3SA 3NGDA 4BWJA 3ZDAA 1SL1A 2W54A 1Z4OA 2ZG6A 3F5AA 4C8NA 3GV8B 1RZTA 2YMLA 3AQEA 3D2QA 5KFDA 4JUZA 1ZQHA 4OJ6A 3I28A 4DF8A 2Y0SC 3FDSA 1U9LA 2JGAA 1TK0A 4NL9C 4BGDA 1PK3A 5KFAA 4PHEA 2Y0SF 2M9NA 1X9MA 5AI9A 4KLTA 2A19A 1COKA 1KDHA 3H40A 2D3DA 2JRZA 4KTQA 3AL0B 4R65A 3GV5B 3SYZA 2EZYA 4YXMA 1XSLA 2YB1A 4MEXA 2KSOB 2H3FA 3GU3A 2AJQA 5IIOA 4RQ4A 1S0OA 5AIAA 2KZZA 4B9UA 1ZXIA 4B9VA 8ICSA 1A77A 2F76X 3LVWA 2XY5A 4B9SA 4ELUA 2NRWA 2YMQA 7ICPA 1FO4A 4UBCA 2R8GA 2ZIUB 2P6UA 2J6TA 3V72A 4KLJA 4ECUA 4O5EA 4US8A 2G0AA 2F8LA 3OPXA 7ICRA 4G9BA 4IQTA 3C2LA 2EH9A 4FE3A 1BNPA 3PSIA 4M6WB 5AHXA 1FEZA 3AEVA 8ICPA 3QU5A 4QZAA 1UT5A 2DBYA 3Q8KA 4I28A 4DSEA 4YR2A 5DB6A 3MGVA 2EAOA 3PO4A 3ORYA 5EWFA 4JMUA 4DSFA 4DSJA 2ZUBA 4J9LA 5J0SA 2L5YA 4P0QB 1PK1A 3Q8MA 2K89A 3C1ZA 5HNKA 3FYHA 1L8LA 3BS5A 4KX3A 4C4TA 5ALMA 3F5EA 1RQNA 1NZPA 2G06A 4RQ6A 1U45A 3ONNA 4GXKA 2W9CB 3Q8LA 4I2DA 3TFRA 4KMUA 2KE7A 4GLXA 3SQIA 4UB4A 5AI4A 2F2AB 2BPGA 1ZQLA 2IA6A 3JPQA 1D9FA 7ICQA 9ICVA 1SIJA 4JB3A 2ZTCA 2Y9UA 8ICXA 2H3ZA 3C29A 4BXOB 4RUCA 1RPLA 4EYIB 4B9LA 4UB6U 4J9RA 3HILA 1QQ5A 5BOLA 1Z19A 1L3VA 3N4MB 2ISPA 2RHFA 4PL1A 2WF5A 5JUMA 2ODGA 4O5KA 3EWAA 2E1EA 2K4EA 1N5XA 5DDYA 2PFPA 3KKAA 1RYRA 4BUGA 4ECRA 5DGBA 2KHVA 4Y2SA 3N97B 3WK8A 1ZQBA 3BQ0A 4F4YA 2ZTDA 3ICXA 4DQSA 3H7IA 2KVSA 3OHBA 2OEHA 4IL6U 2LHTA 1SV0A 3HKZC 2IHNA 2WHEA 1NK9A 3HJEA 3LK9A 4FZLA 2E5SA 2WB1F 3M8SA 3HKZF 4DOAA 2G07A 3KFUF 3Q8PB 3IV6A 1VLBA 2YMPA 2OWOA 5G5GA 3FAHA 2PI4A 1NKCA 3H8JA 1DXSA 4KLIA 2UVRA 2R8HA 5J29A 3SD7A 2IOFK 3LWMA 1B4FA 1BPDA 1NK4A 1NK8A 4Y2TA 1NNLA 1TAUA 2N1RA 9ICUA 4CF4A 4PGXA 5HR7A 1N48A 1Z1BA 9ICBA 3M9MB 4USAA 3G6YA 2VJ5A 2NRVA 1XSNA 1T3QA 8ICTA 1L8OA 4HAIA 4UQGA 2ESEA 4Y2JA 3D2SA 4CDGA 1ZQNA 4ECXA 3PSPA 2KJ5A 4R64A 2NRTA 4C4RA 4DS4A 2I1QA 1QSLA 4MHVA 3QXGA 4EBDA 1ZQGA 5KFXA 3TARA 4Z6EA 4R63A 3RB4A 2K4PA 1U49A 1QQ7A 2C28A 3RH4A 1UT8A 4A8EA 4O3PA 4KLFA 1L7PA 1JN3A 2BZFA 5DQIA 1T8EA 2XI9A 3IRUA 3JPPA 2EANA 2ZUCA 3KD3A 3T5JA 1RQLA 1ZQ1C 3KHGA 1NK7A 2DF4B 3SMVA 4CRXA 3KOOA 3LYSA 3GQCA 5A0LA 2KJ9A 3ZD9A 5J2KA 8ICVA 2GH1A 3H0MB 3HP6A 2LBOA 2XY6A 4ZOHC 2LYAA 5AKXA 3BS7A 4MFCA 3I76A
chains in the Genus database with same CATH topology
1B4FA 1PK3A 5JTIA 2KE7A 3KKAC 1COKA 1LKYA 2QARA 3K1RB 1V85A 1SXDA 4IS7A 5J8YA 2E8PA 2D3DA 2FE9A 5KNIA 2QB0A 2KIVA 2Y9UA 2D8CA 2KSOB 4RQNA 1SV0C 3H8MA 3HILA 3BQ7A 2EAPA 2EAMA 5F3XB 2Y9TA 2E8MA 2ESEA 2GLEA 1SXEA 2E8NA 4NL9A 1RG6A 3TACB 1OW5A 3TADC 2DKZA 1OXJA 3KKAA 2QB1A 2YTUA 1Z1VA 4MHVA 2F3NA 5L1MA 5JRTA 3SEIA 1UQVA 2KSOA 1UCVA 2K60A 1PK1B 2K4PA 2QKQA 3IDWA 1X66A 3BS5B 1F0MA 1X9XA 1JI7A 2B6GA 1SV0A 3SENA 1SV4A 1X40A 2KMDA 2EANA 1KW4A 2LMRA 1V38A 5J8YC 2F44A 2DKXA 2F8KA 1LKYB 2QARB 2EAOA 4PZNA 3TADA 5JU5A 1B0XA 2DL0A 2QB0B 2LPEA 2L5YA 1PK1A 2KG5A 3BS5A 2ES6A 2JV3A 1WWVA 1DXSA 2E8OA 1WWUA 3BS7A 1SGGA 4NJ8A 4NL9C 4RQMA 4PZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4F A;  1PK3 A;  5JTI A;  2KE7 A;  3KKA C;  1COK A;  1LKY A;  2QAR A;  3K1R B;  1V85 A;  1SXD A;  4IS7 A;  5J8Y A;  2E8P A;  2D3D A;  2FE9 A;  5KNI A;  2QB0 A;  2KIV A;  2Y9U A;  2D8C A;  2KSO B;  4RQN A;  1SV0 C;  3H8M A;  3HIL A;  3BQ7 A;  2EAP A;  2EAM A;  5F3X B;  2Y9T A;  2E8M A;  2ESE A;  2GLE A;  1SXE A;  2E8N A;  4NL9 A;  1RG6 A;  3TAC B;  1OW5 A;  3TAD C;  2DKZ A;  1OXJ A;  3KKA A;  2QB1 A;  2YTU A;  1Z1V A;  4MHV A;  2F3N A;  5L1M A;  5JRT A;  3SEI A;  1UQV A;  2KSO A;  1UCV A;  2K60 A;  1PK1 B;  2K4P A;  2QKQ A;  3IDW A;  1X66 A;  3BS5 B;  1F0M A;  1X9X A;  1JI7 A;  2B6G A;  1SV0 A;  3SEN A;  1SV4 A;  1X40 A;  2KMD A;  2EAN A;  1KW4 A;  2LMR A;  1V38 A;  5J8Y C;  2F44 A;  2DKX A;  2F8K A;  1LKY B;  2QAR B;  2EAO A;  4PZN A;  3TAD A;  5JU5 A;  1B0X A;  2DL0 A;  2QB0 B;  2LPE A;  2L5Y A;  1PK1 A;  2KG5 A;  3BS5 A;  2ES6 A;  2JV3 A;  1WWV A;  1DXS A;  2E8O A;  1WWU A;  3BS7 A;  1SGG A;  4NJ8 A;  4NL9 C;  4RQM A;  4PZO A; 
#chains in the Genus database with same CATH topology
 2W7O A;  5DGA A;  1PZN A;  3IP4 B;  5KFO A;  4PHA A;  5ALG A;  3ISC A;  4EBE A;  4DLE A;  4M9J A;  2P6R A;  4O5C A;  4P2H A;  8ICQ A;  2W9M A;  1DOQ A;  4DCC A;  1TVA A;  2FE9 A;  1ZQU A;  4FO6 A;  5DB9 A;  3G6X A;  5J0P A;  1SKR A;  2DGZ A;  4UAV A;  7ICL A;  3ISD A;  1ZQV A;  3TQ1 A;  4YQW A;  2XCA A;  3UM9 A;  2Y9T A;  4M9H A;  3PZP A;  4RQ2 A;  4KN7 A;  1KFS A;  2E8N A;  4ZH4 A;  3KTQ A;  4M9G A;  1ZD3 A;  1SKS A;  2KN7 A;  3KZX A;  1JXE A;  1OXJ A;  4PGY A;  4NLN A;  1S0V A;  3AUO A;  4P4P A;  1F44 A;  4Y2P A;  5KFS A;  1ZQS A;  2MUT A;  5AM1 A;  5CR0 A;  1PK1 B;  1SL0 A;  3AU2 A;  3PSF A;  2JH7 A;  3BS5 B;  3GIJ A;  1HIW A;  2B6G A;  2I9G A;  2ZXI A;  3MAB A;  5DB7 A;  2LMR A;  1CRX A;  2HI0 A;  4J9O A;  4NY8 A;  2HHU A;  2FLP A;  4Q45 A;  2W7P A;  2F8K A;  5ALS A;  2HHX A;  3IG5 A;  4RNO A;  2W11 A;  4TQS A;  1N2X A;  1NKB A;  5KG1 A;  7ICJ A;  4GC7 A;  4EX7 A;  4ED2 A;  4BDP A;  2LPE A;  2KKP A;  1UHU A;  9ICS A;  4QWA A;  3C28 A;  3NS1 A;  3TKA A;  5AKK A;  2YY6 A;  2NYV A;  1X42 A;  3QX7 A;  4MFF A;  4QZG A;  5DLF A;  4C8K A;  3QU4 A;  2PKE A;  4ED1 A;  2JR5 A;  9ICP A;  4F2R A;  3WU2 U;  4O3N A;  1DGJ A;  3T5H A;  2RDI A;  3NTU A;  3L5K A;  4RQN A;  3ISB A;  4QNL A;  4IRK A;  4IQV A;  5DG7 A;  4C7Y A;  2EAP A;  2DWQ A;  2EAM A;  2ZJ8 A;  4EZ9 A;  3WK9 A;  2I6X A;  3NVZ A;  4ACO A;  3RJJ A;  2HBJ A;  2CPR A;  4AP9 A;  2AQ4 A;  2HHQ A;  1KQQ A;  4RQ3 A;  3RJI A;  5HML A;  5ALP A;  5DDM A;  1ED1 A;  2PFQ A;  1Y88 A;  2BPF A;  3RJF A;  2BCU A;  2JEI A;  4EZ6 A;  2YMM A;  2Y1J A;  4PGQ A;  3J81 j;  2MA1 A;  4GIB A;  2BCQ A;  1IM4 A;  1ZQP A;  5GTH U;  4UAW A;  9ICK A;  2RRD A;  3PV8 A;  2LKY A;  4C80 A;  4XRH A;  1KEJ A;  1UA0 A;  4QJF B;  4KLS A;  2BCR A;  7ICK A;  2BR0 A;  2KIW A;  3GIK A;  3NVY A;  2ASL A;  8ICN A;  1N62 A;  4R8U A;  2YQE A;  5KFT A;  1KKX A;  3PO5 A;  5JU5 A;  1BNO A;  1IXR A;  3V7J A;  4RU9 A;  2ES6 A;  4YXJ A;  2RLT A;  5B66 U;  4TUR A;  2JMG A;  4J9K A;  4F4W A;  1SGG A;  2HBK A;  3PY8 A;  3Q8Q B;  1JAL A;  1X6J A;  1SL2 A;  2AXT U;  3CW2 C;  5J2D A;  4DQR A;  1A0P A;  1SZP A;  5J8Y A;  1CI4 A;  2E8P A;  1K1Q A;  2K8B B;  4CGZ A;  3JPO A;  9ICW A;  3PW5 A;  3QZ8 A;  3M9N B;  1RDF A;  4ECS A;  4UAS A;  1S9F A;  4CCH A;  1V9P A;  2FDR A;  2F1I A;  3AM9 A;  1N60 A;  5KG3 A;  5F9N A;  2FJ6 A;  1WUD A;  5EE0 A;  3RH5 A;  3RJG A;  4I2F A;  1M6Y A;  2NO5 A;  2EDU A;  4Q8E A;  2BCV A;  2UVV A;  2WF6 A;  1RG6 A;  5HHH A;  1NI3 A;  3OJU A;  4QWC A;  3GV7 B;  1BPX A;  5KFU A;  4EBC A;  2V9W A;  2F3N A;  5L1M A;  3UXO A;  4LVS A;  1PVR A;  1IIP A;  1QH9 A;  2W43 A;  1UCV A;  4DO9 A;  2KZ3 A;  4NXZ A;  1OUQ A;  2VA8 A;  3N7R C;  2DPJ A;  3V7K A;  1ZQQ A;  3KHH A;  3PML A;  4IR9 A;  1ZQR A;  4LZD A;  3WKA A;  2MAX A;  2VAN A;  3TFS A;  2OXO A;  4U7C A;  4M9N A;  1X6I A;  3VCB A;  1ZYQ A;  2ZXH A;  4CNQ A;  3LDA A;  1ZQM A;  3TAD A;  4G3I A;  5D46 A;  3TAQ A;  5DBB A;  3EW9 A;  3A0B U;  4YVZ A;  1O08 A;  1K1S A;  5KT4 A;  4KLE A;  5ALV A;  3PX0 A;  1IG6 A;  5J2B A;  2AU0 A;  1L5U A;  1FIQ A;  4QIW C;  5KT3 A;  4Z6F A;  1RXW A;  4F4K A;  5KFY A;  1T7P A;  5J0R A;  5KFW A;  2IHM A;  3JPR A;  3SI8 A;  2GWS A;  2YN4 A;  3RRH A;  4QIW F;  4DL5 A;  1WCN A;  2RDJ A;  2LM1 A;  2QAR A;  4NLG A;  1V85 A;  4IQU A;  1SXD A;  4IS7 A;  2C2D A;  4ED0 A;  2P66 A;  4BWM A;  4KX5 A;  3G6V A;  8ICC A;  4Z6C A;  4F71 A;  4K4H A;  3F53 A;  2JZB A;  1PVP A;  5KFQ A;  2Z7J A;  1HUO A;  8ICH A;  4QZD A;  5KFZ A;  2DPI A;  2MUT B;  3MFH A;  2PMZ C;  4XA5 A;  4UB1 A;  3RTV A;  1Q3U A;  5FP0 A;  4DSL A;  3OSN A;  2WTF A;  5EWG A;  5KFP A;  5J2G A;  2F1H A;  4XQ8 A;  1XO1 A;  1K5O A;  5KFH A;  2PMZ F;  5AKL A;  5DKW A;  4Y2Y A;  4KLL A;  1OW5 A;  4JV1 A;  1JRP A;  4YMN A;  1A6S A;  1J2M A;  4IC9 A;  1Z1V A;  1KBU A;  5B5E U;  2FMP A;  4NLK A;  4UAZ A;  1YZ7 A;  4F5O A;  1L7O A;  4DL6 A;  5AK5 A;  3MGH A;  3IDW A;  5G5H A;  3RB3 A;  4QZC A;  3RBE A;  1X66 A;  3CRX A;  2AGP A;  1U4B A;  4I2E A;  2KZM A;  1Z4N A;  3SAH A;  5BOM A;  2A1J A;  9ICJ A;  4JWN A;  3CP8 A;  2R8J A;  4GC6 A;  1L7N A;  3QU9 A;  1TAQ A;  4DFM A;  3NRW A;  5J2J A;  2WF8 A;  1NK0 A;  2PFO A;  4OD0 A;  5KFG A;  5CP2 A;  5E79 U;  4AYB C;  4IRC A;  5IIN A;  5F9L A;  5ALW A;  4I2A A;  3OGU A;  5KFI A;  2JV3 A;  4AYB F;  3JPT A;  1QTM A;  4QW8 A;  2NRZ A;  5KAF U;  1QQ6 A;  3OJS A;  1VJ5 A;  4RQM A;  4J9S A;  4O0I A;  5J0Y A;  1Q46 A;  2J6S A;  3RH6 A;  4M04 A;  3RF9 A;  3M7D A;  1ZJM A;  2R8K A;  5KG5 A;  8ICW A;  1RM6 C;  1ZQA A;  4F5N A;  2JEJ A;  5KT5 A;  1ZET A;  5KNI A;  5L1L A;  3RBD A;  2F77 X;  2KEY A;  2XY7 A;  4DL2 A;  4Y2Q A;  5DG9 A;  4F5Q A;  4UAY A;  5EE1 A;  2H5X A;  4I2B A;  3H8M A;  5KFJ A;  1U47 A;  2KHQ A;  1DRG A;  5J2H A;  3RFA A;  3MFI A;  2FMS A;  1NJZ A;  2GLE A;  4QWD A;  3V6H A;  4ECT A;  1ZQK A;  3WK4 A;  2FLL A;  7ICT A;  2VA3 A;  4JK1 A;  1ZQJ A;  3D6J A;  1T4G A;  3O0F A;  2MU2 A;  3KBB A;  1KL9 A;  4DWI A;  4R8U B;  3RB6 A;  7ICU A;  5DBA A;  7ICN A;  3ED5 A;  3V6J A;  2KTQ A;  3I1Y A;  2BGW A;  5AM2 A;  4RT3 A;  4C4S A;  1NJW A;  2HVI A;  4UAT A;  2ZIW A;  2F44 A;  5CWR A;  2AGQ A;  3Q8R B;  4TUQ A;  3AU6 A;  3MGI A;  1TE2 A;  4M0A A;  5KFB A;  1ZQZ A;  5KFK A;  5KG2 A;  4QZH A;  4QWE A;  4UB8 U;  1B0X A;  5J0X A;  2AHO B;  2ZIX A;  4NV0 A;  4I2C A;  1S77 D;  2R8I A;  1BGX T;  2GOL A;  9ICN A;  3UQ0 A;  9ICE A;  4O3Q A;  4QZ9 A;  5JTI A;  1LKY A;  4KLQ A;  4YP3 A;  5AI8 A;  5KG7 A;  4ELT A;  2YX8 A;  5ALY A;  1VDV A;  4K4I A;  3MR6 A;  1L7M A;  4BX9 C;  4ECZ A;  5AKJ A;  2BQR A;  2QLT A;  4C7Z A;  4EEK A;  3C23 A;  4J03 A;  3BZC A;  8ICJ A;  4QWB A;  2W9B A;  5CJ7 A;  5L1J A;  5ALX A;  5DQH A;  3HWT A;  5C0Y A;  4NL9 A;  4F5R A;  2ZJ5 A;  4NLZ A;  4GXI A;  1X9S A;  3E58 A;  1LB2 B;  2WF7 A;  3GIM A;  3EUB 2;  4NM1 A;  1EXN A;  4J9P A;  2OCE A;  1Q8K A;  5ALE A;  4DL7 A;  3UXP A;  5IIM A;  2Q0Z X;  4YD1 A;  4DFK A;  8ICL A;  1XC9 A;  2HHV A;  5AM4 A;  5HP4 A;  4I2G A;  1KW4 A;  1JMS A;  5HHI A;  2UVW A;  4F72 A;  2XID A;  2QAR B;  3M6Z A;  1U48 A;  3B0X A;  3NAS A;  3C1Y A;  2BQ3 A;  2OHF A;  4Q43 A;  1ZQE A;  1MC8 A;  3SAG A;  3TAP A;  4NLB A;  2G08 A;  1L3T A;  2JZB B;  2JHD A;  1WWV A;  2E8O A;  1WWU A;  1Q3V A;  4PPX A;  4F50 A;  2GO7 A;  4YD2 A;  7ICH A;  1NKE A;  3KKA C;  2W9C A;  3SV3 A;  5TIS U;  1TFR A;  3JPS A;  3QUT A;  3OHA A;  3H4B A;  4O3S A;  4KLD A;  4J9M A;  4Y2V A;  3UMG A;  5KL8 B;  3HPO A;  4DFP A;  5KT2 A;  4TUP A;  3PW4 A;  1TKD A;  4LZG A;  4M9L A;  3N7P D;  3WKD A;  1Z3E B;  1N61 A;  4O3R A;  1KSP A;  4Q8F A;  3SZ2 A;  1SV0 C;  2KVC A;  2EZX A;  3F2C A;  1ZOL A;  1ZQT A;  2HOF A;  8ICG A;  2A1J B;  2E1F A;  1BPZ A;  1ZD2 P;  5T14 A;  3CNH A;  5C5J A;  2IOH A;  2W8L A;  4NM2 A;  4RQ5 A;  4YR3 A;  2FI1 A;  4EEL A;  5KL1 B;  3UPQ A;  2KKV A;  4DL4 A;  3GIL A;  2IMW P;  3SEI A;  2Y1I A;  3AMZ A;  4DSI A;  3EPG A;  4DOC A;  4OJO A;  4F3O A;  3WKE A;  3SAF A;  4KIT B;  4F93 B;  2WFA A;  3QUC A;  3HW8 A;  3RR7 A;  1SV4 A;  4QZB A;  1ZQF A;  5ALR A;  4YR0 A;  2Q4T A;  4O3M A;  2RP5 A;  4RT2 A;  2DKX A;  1B22 A;  2F1J A;  3NVV A;  4RZR A;  2HW3 A;  1GO3 F;  3AQF A;  4J9N A;  3F2B A;  5ALD A;  2BHN A;  5AK4 A;  5D49 A;  2ZIV A;  2JEG A;  8ICO A;  2HHS A;  2KG5 A;  3E2E A;  4DEZ A;  5H2F U;  4C8L A;  4YMO A;  4JV0 A;  2KFN A;  4ELV A;  1BPY A;  3M9O B;  5EOZ A;  3PST A;  4Y2X A;  8ICB A;  2BCS A;  1URJ A;  3E0F A;  2HHT A;  1MQ2 A;  3FM9 A;  2IOF A;  2AGO A;  1SZH A;  2CRX A;  4BJQ A;  3H0L B;  1UA1 A;  1TV9 A;  5J0U A;  2JH1 A;  8ICM A;  5J0O A;  3C21 A;  1AQ6 A;  2BKE A;  8ICR A;  3IN5 A;  3BQ7 A;  5L1K A;  3PX6 A;  5F3X B;  1XU4 A;  3AN1 A;  4I2I A;  4PHD A;  5KFE A;  2FPM A;  4KLG A;  3EPI A;  3KHR A;  2ZIW B;  3T3F A;  1CEZ A;  3IHQ B;  2H3I A;  2PFN A;  2HSZ A;  2PI5 A;  2HBM A;  1NK6 A;  3ALR A;  3R9K A;  3ZI4 A;  2KD1 A;  1HJP A;  1JX4 A;  4PH5 A;  3ZDD A;  5DBC A;  3UMB A;  2OH2 A;  2ZIX B;  4P0P A;  5KFL A;  2HCF A;  1N5W A;  1ZQI A;  1DK2 A;  2WF9 A;  4CE6 A;  8ICZ A;  1L6N A;  3M1Y A;  3MR5 A;  1SWV A;  5KTQ A;  1DK3 A;  1LKY B;  2VIX A;  3IG8 A;  1ZJN A;  4C8O A;  4DQI A;  4E0D A;  4DFD A;  5AKY A;  3MBY A;  1T94 A;  2ISO A;  4KN4 A;  4EX6 A;  3EYZ A;  4UB3 A;  4I27 A;  2HOQ A;  3K1Z A;  3T5L A;  1NK5 A;  4YFK A;  4RPZ A;  3C2K A;  2W9B B;  8ICI A;  2XCP A;  5KFM A;  4PZO A;  5CA7 A;  4EEN A;  5ALT A;  1JIH A;  1KFT A;  4PL2 A;  1X2I A;  3LWL A;  4YN4 A;  3RJE A;  1N56 A;  5ALL A;  5AIB A;  3B9J A;  5EWE A;  3SR6 A;  4C0Z A;  2XGQ A;  1IV8 A;  4FBU A;  2NO4 A;  4OJP A;  9ICT A;  4JV2 A;  5J0W A;  3HX0 A;  3HRD D;  2HMX A;  5ALF A;  1XS9 D;  3QYP A;  4JWM A;  1PUZ A;  5ALO A;  2BPC A;  4F92 B;  1SXE A;  4ED7 A;  2A1A A;  3RAX A;  2LYH A;  3TAC B;  3PR5 B;  2AH5 A;  2XVT A;  1ARO P;  1ZD4 A;  4QZF A;  2KV2 A;  4RUA A;  3GII A;  3CYM A;  1QLN A;  1ZQW A;  2HOI A;  4QZI A;  2K60 A;  1MA7 A;  4YG2 A;  4ED8 A;  1JRO A;  3DV9 A;  5ALU A;  4ICA A;  1D9D A;  1D8B A;  5D4B A;  1JXL A;  5AI0 A;  3ZD8 A;  1X40 A;  2KMD A;  3RJH A;  3PVX A;  2ZUD A;  5KAI U;  2XC9 A;  2EQY A;  1V38 A;  4FS1 A;  2K8A A;  3GDX A;  3PMN A;  7ICS A;  1A76 A;  3GZF A;  2CXY A;  3PNC A;  4ED6 A;  2KP7 A;  9ICM A;  3F2D A;  4U6P A;  3THV A;  5J2A A;  4DS5 A;  1KTQ A;  2DUY A;  3V7L A;  2LM4 A;  3QEA Z;  3BJY A;  5KG4 A;  5AKE A;  5KFN A;  4KLO A;  2VJ4 A;  4KLM A;  3N7S C;  1T3N A;  4MEY A;  4MF2 A;  2B0C A;  1KRP A;  3M8R A;  3VC8 A;  5ALZ A;  1BVS A;  1J97 A;  4FFD A;  2QB0 A;  3RRG A;  5ALH A;  1FFU A;  2KJ8 A;  4FZM A;  2C2E A;  4RPX A;  3PX4 A;  4UB5 A;  5ALN A;  4CF3 A;  2ASD A;  3MDC A;  4YMM A;  5J2I A;  4Q44 A;  1ZRM A;  1BPE A;  2MSN A;  3H8W A;  3QUB A;  1X9W A;  4O9M A;  4DF4 A;  3QZ7 A;  2JEF A;  5CEH A;  2WB1 C;  2DFL A;  5AIC A;  3RJK A;  5AI5 A;  5J2F A;  3HT3 A;  3WK7 A;  3TAN A;  2LYB A;  2QB1 A;  4O3O A;  4FBT A;  4F8R A;  9ICX A;  1S0N A;  5JRT A;  5DLG A;  3TI0 A;  3PW7 A;  9ICI A;  1MSW D;  3NRZ A;  1D8L A;  4DQQ A;  2ZIV B;  5HR6 A;  2VKQ A;  3UMC A;  3WK5 A;  1ZRN A;  4ECW A;  8ICA A;  4UW9 A;  5J2C A;  5IIL A;  3SEN A;  2ATL A;  1C20 A;  3K75 D;  5AKZ A;  5J8Y C;  2OM6 A;  2O6K A;  1WYG A;  5III A;  4ECV A;  2KIC A;  2C2R A;  4YCX A;  5BPC A;  2KFZ A;  2EZZ A;  1YT3 A;  1C7Y A;  3MC1 A;  8ICY A;  3ZDB A;  1KN5 A;  4RQ7 A;  1ECW A;  2FPL A;  1MN8 A;  1COO A;  9ICH A;  1Z00 A;  2DL0 A;  5EE3 A;  1ZD5 A;  2ZJA A;  1DGS A;  4US9 A;  1B43 A;  4RQ0 A;  2HBL A;  4B9T A;  3EZ5 A;  1NZB A;  5ALQ A;  4DLG A;  7ICI A;  4F91 B;  4RPY A;  3JPN A;  4DFJ A;  4M47 A;  4QZE A;  9ICR A;  2I5H A;  1ZQY A;  1ZQO A;  4X5V A;  5ALK A;  2W04 A;  1KFD A;  9ICC A;  4RNM A;  4PHP A;  3N28 A;  3BDP A;  1TK5 A;  4RQ8 A;  3OTQ A;  4PJ0 U;  4K4G A;  1WG8 A;  3UXN A;  4P0P B;  4UAR A;  5IIJ A;  5J0Q A;  2IBK A;  5L9X A;  1YZ6 A;  5EE9 A;  4ECY A;  1S76 D;  1PVQ A;  1L3S A;  3TAD C;  1NJY A;  2DKZ A;  4F5P A;  4F2S A;  4EYH B;  2YTU A;  1NJX A;  1SKW A;  1UQV A;  5KT7 A;  4OO1 J;  2H3V A;  2KSO A;  1HUZ A;  4CF5 A;  2P35 A;  4TQR A;  7ICM A;  2QKQ A;  8ICU A;  3H0R B;  4J9Q A;  5AKI A;  4RNN A;  3QNM A;  1JI7 A;  1RYU A;  5GTI U;  4C8M A;  2KK0 A;  9ICO A;  2HVH A;  7ICF A;  2MRL A;  3B0Y A;  3BQT A;  4ECQ A;  3C2M A;  1XNS A;  3FC4 A;  4I2J A;  3H4D A;  3WKB A;  2ZIU A;  3M6K A;  2VA2 A;  3QUQ A;  5KFF A;  2V4Q A;  4UBB A;  2D6F C;  2B21 A;  2W3R A;  1TAM A;  1BPB A;  9ICQ A;  2W9A A;  1RYS A;  5CHG A;  3BQ1 A;  3QE9 Y;  3A0H U;  4M6W A;  2BQU A;  3ETR A;  3DDH A;  4NJ8 A;  1ZQC A;  2C22 A;  2E3T A;  4FS2 A;  4EEY A;  2FMQ A;  5KG0 A;  2R18 A;  1H38 A;  2J6U A;  5KFV A;  5J0T A;  5HMM A;  2KNJ A;  5KFR A;  1TK8 A;  3K1R B;  4KMO B;  4MFA A;  3Q8S B;  4DL3 A;  1KLN A;  3BQ2 A;  3D2N A;  5AK6 A;  2M0N A;  4Z6D A;  4IQW A;  1HEK A;  5AKH A;  4P0Q A;  2FLN A;  1LVH A;  2ZTE A;  2G5H B;  4OCZ A;  4DQP A;  1D8Y A;  4B6J A;  3L4P A;  5ALI A;  2NV3 A;  2ALZ A;  3KHL A;  5DB8 A;  3C5F A;  1ZQD A;  1S5L U;  2W03 A;  3QU2 A;  1V97 A;  7ICV A;  5CB1 A;  2CN1 A;  1ZQX A;  2KOB A;  3MDA A;  3DEE A;  1FFV A;  4NWI A;  4UAU A;  9ICG A;  5IIK A;  2FPK A;  2UVU A;  3NVW A;  1N63 A;  3WKC A;  4P4M A;  4BXO A;  1F5S A;  5AK3 A;  5KG6 A;  4Y2R A;  2W8K A;  3K4G A;  1F0M A;  5DQG A;  4MF8 A;  7ICO A;  1LV5 A;  4WJ3 B;  2A3V A;  5CRX A;  3H8S A;  3RAQ A;  1S10 A;  4Y2U A;  4TUS A;  2NRX A;  1CUK A;  2H3Q A;  4NLC A;  1RXV A;  4XUS A;  3L3F X;  4PZN A;  5KFC A;  2XIC A;  2AQ0 A;  4IRD A;  2YB4 A;  3QU7 A;  2QB0 B;  3PW0 A;  2DQN B;  3RB0 A;  5DG8 A;  1XSP A;  4F4X A;  3T79 A;  1P7D A;  3S6J A;  4I2H A;  3ZDE A;  3QEB Z;  4UB2 A;  4B9N A;  3WK6 A;  1SWW A;  5ALJ A;  4KLH A;  4OJL A;  5AM0 A;  3U26 A;  5KT6 A;  8ICF A;  5AM5 A;  1O03 A;  2JXJ A;  5AI6 A;  1UPH A;  3GFK B;  3NUQ A;  3OSP A;  2HDO A;  2RQ5 A;  4DSK A;  3UQ2 A;  1XWL A;  4GFJ A;  4DOB A;  5K4L A;  1S97 A;  2KIV A;  1SB3 C;  4HYK A;  2BDP A;  2D8C A;  3PW2 A;  3T5K A;  4RQ1 A;  3V6K A;  5J2E A;  7ICE A;  1QCK A;  1WCL A;  2K4I A;  3RR8 A;  2V4R A;  1XO0 A;  3ZDC A;  1J2N A;  2E8M A;  4I29 A;  2BDU A;  3BZK A;  3MR2 A;  4QW9 A;  2ASJ A;  4LJX A;  3PR4 A;  4IR1 A;  2LI6 A;  8ICK A;  1QSY A;  2PXI A;  3LVV A;  4ED3 A;  5L1I A;  4FZN A;  9ICF A;  3SV4 A;  5AKG A;  4P4O A;  2K8C B;  3IM1 A;  3MR3 A;  2OYY A;  4R66 A;  2XO7 A;  9ICA A;  5TZV A;  4QZ8 A;  3C5G A;  4KLU A;  1Z00 B;  2HHW A;  1JUD A;  3ETL A;  5AM3 A;  1NOM A;  7ICG A;  2G5I B;  4F4Z A;  4B9M A;  2W55 A;  1X9X A;  2G09 A;  2WAQ C;  1S8O A;  1MQ3 A;  1S0M A;  1QSS A;  4OJ5 A;  8ICE A;  3KZI U;  1L3U A;  2K4H A;  2WAQ F;  4GXJ A;  9ICL A;  4M2Y A;  2XGP A;  2W3S A;  3NGD A;  4BWJ A;  3ZDA A;  1SL1 A;  2W54 A;  1Z4O A;  2ZG6 A;  3F5A A;  4C8N A;  3GV8 B;  1RZT A;  2YML A;  3AQE A;  3D2Q A;  5KFD A;  4JUZ A;  1ZQH A;  4OJ6 A;  3I28 A;  4DF8 A;  2Y0S C;  3FDS A;  1U9L A;  2JGA A;  1TK0 A;  4NL9 C;  4BGD A;  1PK3 A;  5KFA A;  4PHE A;  2Y0S F;  2M9N A;  1X9M A;  5AI9 A;  4KLT A;  2A19 A;  1COK A;  1KDH A;  3H40 A;  2D3D A;  2JRZ A;  4KTQ A;  3AL0 B;  4R65 A;  3GV5 B;  3SYZ A;  2EZY A;  4YXM A;  1XSL A;  2YB1 A;  4MEX A;  2KSO B;  2H3F A;  3GU3 A;  2AJQ A;  5IIO A;  4RQ4 A;  1S0O A;  5AIA A;  2KZZ A;  4B9U A;  1ZXI A;  4B9V A;  8ICS A;  1A77 A;  2F76 X;  3LVW A;  2XY5 A;  4B9S A;  4ELU A;  2NRW A;  2YMQ A;  7ICP A;  1FO4 A;  4UBC A;  2R8G A;  2ZIU B;  2P6U A;  2J6T A;  3V72 A;  4KLJ A;  4ECU A;  4O5E A;  4US8 A;  2G0A A;  2F8L A;  3OPX A;  7ICR A;  4G9B A;  4IQT A;  3C2L A;  2EH9 A;  4FE3 A;  1BNP A;  3PSI A;  4M6W B;  5AHX A;  1FEZ A;  3AEV A;  8ICP A;  3QU5 A;  4QZA A;  1UT5 A;  2DBY A;  3Q8K A;  4I28 A;  4DSE A;  4YR2 A;  5DB6 A;  3MGV A;  2EAO A;  3PO4 A;  3ORY A;  5EWF A;  4JMU A;  4DSF A;  4DSJ A;  2ZUB A;  4J9L A;  5J0S A;  2L5Y A;  4P0Q B;  1PK1 A;  3Q8M A;  2K89 A;  3C1Z A;  5HNK A;  3FYH A;  1L8L A;  3BS5 A;  4KX3 A;  4C4T A;  5ALM A;  3F5E A;  1RQN A;  1NZP A;  2G06 A;  4RQ6 A;  1U45 A;  3ONN A;  4GXK A;  2W9C B;  3Q8L A;  4I2D A;  3TFR A;  4KMU A;  2KE7 A;  4GLX A;  3SQI A;  4UB4 A;  5AI4 A;  2F2A B;  2BPG A;  1ZQL A;  2IA6 A;  3JPQ A;  1D9F A;  7ICQ A;  9ICV A;  1SIJ A;  4JB3 A;  2ZTC A;  2Y9U A;  8ICX A;  2H3Z A;  3C29 A;  4BXO B;  4RUC A;  1RPL A;  4EYI B;  4B9L A;  4UB6 U;  4J9R A;  3HIL A;  1QQ5 A;  5BOL A;  1Z19 A;  1L3V A;  3N4M B;  2ISP A;  2RHF A;  4PL1 A;  2WF5 A;  5JUM A;  2ODG A;  4O5K A;  3EWA A;  2E1E A;  2K4E A;  1N5X A;  5DDY A;  2PFP A;  3KKA A;  1RYR A;  4BUG A;  4ECR A;  5DGB A;  2KHV A;  4Y2S A;  3N97 B;  3WK8 A;  1ZQB A;  3BQ0 A;  4F4Y A;  2ZTD A;  3ICX A;  4DQS A;  3H7I A;  2KVS A;  3OHB A;  2OEH A;  4IL6 U;  2LHT A;  1SV0 A;  3HKZ C;  2IHN A;  2WHE A;  1NK9 A;  3HJE A;  3LK9 A;  4FZL A;  2E5S A;  2WB1 F;  3M8S A;  3HKZ F;  4DOA A;  2G07 A;  3KFU F;  3Q8P B;  3IV6 A;  1VLB A;  2YMP A;  2OWO A;  5G5G A;  3FAH A;  2PI4 A;  1NKC A;  3H8J A;  1DXS A;  4KLI A;  2UVR A;  2R8H A;  5J29 A;  3SD7 A;  2IOF K;  3LWM A;  1B4F A;  1BPD A;  1NK4 A;  1NK8 A;  4Y2T A;  1NNL A;  1TAU A;  2N1R A;  9ICU A;  4CF4 A;  4PGX A;  5HR7 A;  1N48 A;  1Z1B A;  9ICB A;  3M9M B;  4USA A;  3G6Y A;  2VJ5 A;  2NRV A;  1XSN A;  1T3Q A;  8ICT A;  1L8O A;  4HAI A;  4UQG A;  2ESE A;  4Y2J A;  3D2S A;  4CDG A;  1ZQN A;  4ECX A;  3PSP A;  2KJ5 A;  4R64 A;  2NRT A;  4C4R A;  4DS4 A;  2I1Q A;  1QSL A;  4MHV A;  3QXG A;  4EBD A;  1ZQG A;  5KFX A;  3TAR A;  4Z6E A;  4R63 A;  3RB4 A;  2K4P A;  1U49 A;  1QQ7 A;  2C28 A;  3RH4 A;  1UT8 A;  4A8E A;  4O3P A;  4KLF A;  1L7P A;  1JN3 A;  2BZF A;  5DQI A;  1T8E A;  2XI9 A;  3IRU A;  3JPP A;  2EAN A;  2ZUC A;  3KD3 A;  3T5J A;  1RQL A;  1ZQ1 C;  3KHG A;  1NK7 A;  2DF4 B;  3SMV A;  4CRX A;  3KOO A;  3LYS A;  3GQC A;  5A0L A;  2KJ9 A;  3ZD9 A;  5J2K A;  8ICV A;  2GH1 A;  3H0M B;  3HP6 A;  2LBO A;  2XY6 A;  4ZOH C;  2LYA A;  5AKX A;  3BS7 A;  4MFC A;  3I76 A; 
#chains in the Genus database with same CATH homology
 1B4F A;  1PK3 A;  5JTI A;  2KE7 A;  3KKA C;  1COK A;  1LKY A;  2QAR A;  3K1R B;  1V85 A;  1SXD A;  4IS7 A;  5J8Y A;  2E8P A;  2D3D A;  2FE9 A;  5KNI A;  2QB0 A;  2KIV A;  2Y9U A;  2D8C A;  2KSO B;  4RQN A;  1SV0 C;  3H8M A;  3HIL A;  3BQ7 A;  2EAP A;  2EAM A;  5F3X B;  2Y9T A;  2E8M A;  2ESE A;  2GLE A;  1SXE A;  2E8N A;  4NL9 A;  1RG6 A;  3TAC B;  1OW5 A;  3TAD C;  2DKZ A;  1OXJ A;  3KKA A;  2QB1 A;  2YTU A;  1Z1V A;  4MHV A;  2F3N A;  5L1M A;  5JRT A;  3SEI A;  1UQV A;  2KSO A;  1UCV A;  2K60 A;  1PK1 B;  2K4P A;  2QKQ A;  3IDW A;  1X66 A;  3BS5 B;  1F0M A;  1X9X A;  1JI7 A;  2B6G A;  1SV0 A;  3SEN A;  1SV4 A;  1X40 A;  2KMD A;  2EAN A;  1KW4 A;  2LMR A;  1V38 A;  5J8Y C;  2F44 A;  2DKX A;  2F8K A;  1LKY B;  2QAR B;  2EAO A;  4PZN A;  3TAD A;  5JU5 A;  1B0X A;  2DL0 A;  2QB0 B;  2LPE A;  2L5Y A;  1PK1 A;  2KG5 A;  3BS5 A;  2ES6 A;  2JV3 A;  1WWV A;  1DXS A;  2E8O A;  1WWU A;  3BS7 A;  1SGG A;  4NJ8 A;  4NL9 C;  4RQM A;  4PZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...