2QKQA

Structure of the sam domain of human ephrin type-b receptor 4
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
b'AFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-B receptor 4
publication title SAM Domain of Human Ephrin Type-B Receptor 4 (EPHB4)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qkqA00
2F8KA 1COKA 2QB0A 5JTIA 3BS7A 2F44A 1LKYA 2KG5A 4NL9C 2ESEA 4NL9A 3SEIA 4PZNA 2D3DA 2DL0A 4MHVA 2KSOA 2K60A 1SGGA 1V38A 2F3NA 2E8NA 3SENA 1PK1B 2FE9A 1X40A 1B0XA 5L1MA 2K4PA 2QB0B 1SXDA 4NJ8A 4PZOA 3TACB 3BS5A 2E8OA 2B6GA 1LKYB 1X9XA 1Z1VA 2YTUA 2EANA 2JV3A 1V85A 1JI7A 1PK3A 2KSOB 1OW5A 2EAPA 1F0MA 3HILA 4RQMA 2L5YA 5F3XB 2E8MA 1WWVA 1WWUA 1X66A 3KKAC 2QKQA 3KKAA 5J8YC 2KIVA 4IS7A 5J8YA 1UQVA 3BQ7A 2LMRA 3BS5B 3TADC 3K1RB 3TADA 2QB1A 2QARA 5JRTA 1UCVA 2LPEA 3H8MA 5JU5A 2Y9TA 1B4FA 1RG6A 2Y9UA 1DXSA 2GLEA 1OXJA 2E8PA 1KW4A 5KNIA 2EAMA 1SV0C 1SV0A 1SV4A 2DKZA 2D8CA 4RQNA 2ES6A 2DKXA 3IDWA 1SXEA 2KE7A 2QARB 1PK1A 2EAOA 2KMDA
chains in the Genus database with same CATH superfamily
9ICGA 4QZFA 2BR0A 2UVRA 3JPQA 1XS9D 3PX0A 3I76A 4P0QB 1S0MA 2E5SA 1N5WA 3UQ2A 5KFXA 5ALYA 2KN7A 4NL9A 4PH5A 7ICFA 3DV9A 4O5EA 2YMLA 2IHMA 2KSOA 2RRDA 3M8SA 4OJPA 3GDXA 1QTMA 2ZUCA 4O5KA 4I2JA 4M9JA 2FE9A 1X40A 4UATA 1ZRMA 4MFCA 2V4QA 1FIQA 2H3ZA 4KMUA 2F2AB 3F5EA 8ICQA 3G6XA 1X9XA 2EANA 1NKEA 4IRDA 1QLNA 4UAVA 5KFWA 3N28A 1N63A 4M2YA 2H3QA 1Z00B 5ALTA 5DBAA 2XGPA 8ICZA 5ALZA 5CHGA 1ZYQA 2KIVA 2JZBB 1HIWA 5J8YA 5EE1A 4C4SA 1H38A 2PI4A 2YB4A 8ICOA 4C80A 4DOBA 1T7PA 3WK6A 4R8UB 1BPYA 5JU5A 4XUSA 5KFSA 4Q8FA 3SMVA 4TQRA 1BPEA 3SV3A 8ICBA 2UVWA 5KNIA 4I28A 2AGOA 1VDVA 4J9RA 1SWVA 4RPZA 3L5KA 2JEFA 1KN5A 2LYAA 9ICQA 3SI8A 2DKXA 5ALGA 3M9NB 4I2BA 4US8A 1K1SA 4XA5A 4DSLA 4DSIA 5J2AA 4ECYA 1NNLA 1QQ7A 4Y2RA 3FAHA 4NM2A 1MN8A 5J2BA 4Y2SA 9ICIA 2I5HA 4OD0A 2Z7JA 3PW0A 4CGZA 4Y2UA 4QZHA 1YZ7A 2KTQA 1CI4A 4UB6U 1S97A 3WK9A 4BXOA 2ZXIA 4ICAA 4CCHA 3RJHA 2KK0A 1ECWA 1TK8A 8ICSA 2HW3A 3WU2U 3MR2A 4M04A 3UXNA 8ICKA 1X9SA 4P0PB 2BHNA 4FFDA 4OJ6A 4ED6A 3CP8A 2WF7A 5ALKA 1TE2A 2OM6A 2ZIXB 1F44A 3CRXA 5CP2A 2RDIA 3UXPA 3C23A 3Q8PB 1ZQKA 1TV9A 1N62A 5AI6A 1IXRA 1BPXA 4IS7A 5AICA 5J2HA 5DGAA 4J9LA 4K4HA 4TUQA 5CWRA 4R63A 5HNKA 4YCXA 2XICA 1P7DA 2LYHA 3WK8A 2HBJA 1S76D 4KLEA 2A3VA 3C5FA 5D46A 3HW8A 4DQSA 3H8JA 2KZ3A 1J2NA 2P66A 3D2NA 1FEZA 1WCLA 3TFSA 4P4MA 3HP6A 3M9OB 2WB1C 5ALQA 4F93B 3LVVA 3PR5B 3U26A 4Q8EA 2QB0A 5KG1A 2VA3A 3KD3A 2XC9A 4OJOA 3HKZC 3OGUA 1U48A 4C8OA 3ETLA 1ZQMA 4BDPA 4QWBA 4PGYA 3V7JA 5KFZA 1HJPA 1RPLA 3PMLA 4KLHA 4BWJA 2K89A 1PK1B 8ICXA 3IP4B 9ICHA 4RU9A 3BZCA 3BS5A 5KFGA 3JPRA 3MBYA 2KHVA 2B6GA 5C0YA 5AKLA 1L3UA 4J03A 4O3OA 2W9CB 1XWLA 3FYHA 4UB8U 5AM0A 1ZQXA 3GIKA 4J9NA 4US9A 4UW9A 1X6JA 4UBCA 4RQMA 3THVA 2W9MA 4I2GA 3E0FA 3FM9A 4O9MA 5EE3A 3C2MA 5AKEA 5HR7A 1ED1A 3TQ1A 1S8OA 2DBYA 1J97A 7ICJA 5DBCA 4J9QA 2FMQA 2FJ6A 2VJ5A 2OHFA 5KG6A 3M1YA 4YMOA 3MGHA 2WHEA 3NRWA 1XU4A 1RG6A 1K1QA 5J0UA 3IHQB 3PW7A 4TUPA 1SKRA 3V6KA 4C4RA 3UXOA 2W11A 4QZEA 3JPOA 5IIJA 2ZJ8A 4B9TA 3PO4A 1D9DA 4PHAA 3WKBA 4B9VA 3HRDD 3MFHA 5BOLA 1ZRNA 3RH4A 3N4MB 4F2RA 1LVHA 4CF4A 5J2CA 4IQVA 2CRXA 1ZQUA 2YX8A 1V9PA 4HYKA 4EX7A 2W8LA 2R18A 3ZI4A 1SZPA 4DWIA 7ICPA 2K4HA 2H5XA 2F76X 3PSIA 2ZIVB 4DL2A 1CRXA 1Z19A 2KOBA 5KFCA 1QSYA 3RJEA 4OCZA 1U49A 3PW5A 8ICGA 4BGDA 2ZIUB 2HBKA 1XO0A 4LVSA 2XY7A 3ZDAA 2DPIA 1ZQOA 1S77D 9ICKA 4DQRA 2HBLA 2Y0SF 2HHTA 2E8MA 5AM4A 5J29A 1XSPA 3BJYA 1L3TA 3RJGA 5B66U 5J2EA 2G09A 4QW8A 3QEAZ 3TADC 1N56A 2HBMA 1VLBA 3Q8QB 3QU4A 5KT7A 2YY6A 5ALRA 3PMNA 4M6WA 1D8LA 1UT8A 3SAHA 1BVSA 1U45A 5AHXA 4EZ9A 1D8BA 3QE9Y 3RAXA 2BCVA 2AGQA 3PW4A 1JXLA 4JWMA 4UASA 4F50A 3QZ8A 1BNOA 2H3IA 2GWSA 1BNPA 1C20A 3AU6A 3IM1A 2ESEA 2ISOA 9ICBA 3EWAA 1L8LA 1X2IA 3JPPA 3T3FA 3KFUF 2HDOA 2IOHA 2K60A 4ECQA 4QW9A 4TURA 2BPGA 2KD1A 4J9PA 3K75D 1TKDA 5D49A 5KFVA 5B5EU 1FO4A 2KICA 5GTHU 4RT2A 4DOAA 3UMBA 5BPCA 1JN3A 2MUTB 4JV2A 2HOIA 5KFJA 1Z1VA 2XY5A 4Q43A 1ZQFA 3KHRA 5EWGA 2KP7A 4KTQA 1FFVA 5KFPA 3JPNA 2YQEA 8ICCA 4DL5A 3UM9A 3HILA 2IBKA 3QX7A 3UMCA 2FLLA 5DQHA 4DF4A 7ICIA 3RH5A 2ATLA 4EZ6A 3BQ2A 4KX3A 4NWIA 5DLFA 3TARA 3H8MA 2CPRA 4FBUA 2KV2A 2RLTA 2BCUA 5J2JA 2PMZF 4RQ4A 8ICNA 5DB9A 3OTQA 4DFJA 5ALLA 1Z1BA 3N7PD 5KFUA 3NASA 2ZG6A 4DL6A 4XRHA 4F8RA 3KZIU 3C29A 3KHLA 4KLQA 3AQEA 3D2QA 4Z6EA 2KMDA 3H0MB 4QWEA 1DOQA 1KFDA 4KLSA 1SB3C 2WF9A 5KFFA 4YVZA 2VA8A 1LKYA 5KTQA 4RT3A 2CN1A 1BPBA 4Y2YA 4NY8A 1XNSA 5EE9A 1KFSA 3ICXA 4ECUA 1KKXA 1ZQSA 5EE0A 2F77X 2F3NA 2BGWA 2ZIWB 1N5XA 4B9SA 3SR6A 5KAIU 3IN5A 2HVHA 2W8KA 7ICTA 2A19A 1HUZA 5FP0A 9ICWA 4UB2A 3SZ2A 5KT4A 3RB0A 1TAQA 4YD1A 4DFMA 1PVPA 4KLOA 4OJLA 2FMPA 4Y2JA 2HCFA 1DK3A 2ZTCA 2R8JA 1WUDA 1ZQDA 1UA0A 9ICXA 2NYVA 2GO7A 4F3OA 5DG8A 2ZJAA 3UQ0A 9ICRA 2K8BB 2OCEA 4UBBA 5DBBA 4FZNA 1SL2A 1TK0A 4MFFA 3EW9A 4RQ1A 2K8AA 1KDHA 1NK7A 1L7OA 4IRKA 5L1KA 4F5QA 5AI8A 2W9BB 5ALSA 4RNOA 1SV0C 4EEKA 2BPFA 8ICIA 1KBUA 1MSWD 2DKZA 4RQNA 5DLGA 4KLJA 2V9WA 2YMMA 3PSFA 1ZD4A 4C0ZA 4FBTA 3UMGA 7ICRA 5AM3A 3IG5A 3OSPA 2C28A 2QLTA 2E1EA 1SL0A 1ZQBA 4MF2A 3GIMA 3Q8KA 9ICCA 4O3RA 1T3NA 4BJQA 2LBOA 5KT2A 1N60A 4LJXA 2NO5A 3H8WA 1J2MA 2W7PA 3C21A 3PNCA 2HHUA 4BWMA 3Q8SB 4F5NA 1SKSA 3AEVA 2IOFA 2ZUDA 4OJ5A 3ISDA 4DQPA 1ZQCA 3T79A 4ED3A 4ECVA 2BQUA 5L1MA 3C5GA 3C28A 2G0AA 3TACB 4C8NA 4Z6FA 1A77A 3GILA 4J9KA 1ZD3A 2R8IA 1IV8A 4JWNA 1OW5A 2XIDA 4RPYA 4DOCA 3RRGA 1NK8A 4GIBA 4IQWA 3BQ1A 4J9MA 4RQ3A 3NUQA 3N97B 4M9NA 1ZQZA 9ICJA 4O3NA 2QARA 3RB3A 3V72A 3QYPA 4QJFB 5KG2A 4F2SA 4KMOB 2DF4B 4FZMA 2Y0SC 7ICSA 4P0QA 4F4WA 3M6ZA 1S0NA 2PI5A 2BPCA 3QUCA 3OPXA 3WK5A 2PFNA 3K1ZA 2ES6A 9ICAA 3RBDA 5KFQA 4QIWF 1LV5A 4RQ6A 3LK9A 4IR9A 2MSNA 1QQ5A 5AKIA 4CF5A 5DG9A 1T3QA 4YXMA 1KSPA 1L7MA 2D6FC 1HEKA 1WG8A 1RXWA 4NLKA 2VKQA 4PZNA 3MDCA 2D3DA 5CA7A 3G6YA 3PY8A 2DL0A 3E58A 4KLFA 2JR5A 5CEHA 1TAUA 4M9GA 5C5JA 1JMSA 4JK1A 3GQCA 4MFAA 4NV0A 4F5RA 9ICUA 1Z00A 1HUOA 3RJIA 3WKAA 4ZH4A 1NK4A 2JZBA 4ED7A 4M47A 1B43A 4I2HA 3BZKA 1K5OA 5ALUA 3GIIA 4I27A 1DRGA 4A8EA 3NRZA 2DGZA 4IQUA 2A1AA 5J0WA 1MQ2A 2WF6A 3NS1A 3IRUA 4R8UA 5J0YA 4U6PA 4I2DA 2BDUA 2Y1IA 2JMGA 4EBCA 2HOFA 4ED2A 1NJWA 2EAPA 3EUB2 5KT6A 4RQ2A 3KHGA 1B22A 4ECWA 3KKAC 2K8CB 2AH5A 1ZQVA 3TAPA 2K4EA 4B9MA 1UQVA 4DS4A 1T4GA 2EZXA 1NK9A 2NRWA 8ICYA 4QZBA 3JPSA 4C7YA 2A1JB 5AM1A 2UVVA 1Q8KA 3C1ZA 4ECTA 3ALRA 5AKKA 1XSNA 1PZNA 4Y2XA 1N48A 2P35A 2OEHA 2GOLA 1OXJA 3QU5A 1NZPA 4DSEA 2E3TA 2AGPA 1X42A 2W3RA 4B9LA 3F2CA 4YG2A 2J6SA 4F4ZA 3OHBA 2BCRA 2JGAA 3T5HA 2BKEA 4R65A 1NK5A 1SXEA 2KE7A 3H7IA 2ZTDA 1BPZA 4Y2PA 3WK7A 4I29A 2PMZC 2LKYA 5KG3A 2AHOB 3SQIA 1NK0A 3M8RA 1L3VA 1VJ5A 3F2DA 3QUBA 4P0PA 4TQSA 3RB4A 4QZDA 2XVTA 1SL1A 2ZIXA 4DFKA 2MAXA 4UB4A 3L4PA 1KQQA 4KLMA 4CNQA 2HI0A 3IV6A 4JV0A 4Q45A 2VJ4A 3PR4A 3RJFA 5IIIA 4AP9A 3EPGA 2KZMA 1A6SA 4EELA 3ED5A 3EYZA 3SAFA 4UB5A 3EZ5A 4DLGA 3NVYA 5GTIU 1JX4A 1XC9A 3OJUA 1ZQHA 5DB7A 5IIMA 4ECRA 3V6HA 1U4BA 3ISBA 4YR3A 1ZQGA 3PX4A 1IM4A 1YZ6A 3KOOA 2JH1A 3QNMA 2LMRA 3ETRA 5DDMA 1S9FA 3ZD9A 1JIHA 2BCQA 3TADA 3KTQA 1UCVA 4KLUA 1T94A 3WKEA 1DXSA 2FPKA 3OSNA 1NJZA 1AQ6A 1KW4A 5AKYA 4UB3A 2W03A 5AM5A 1X6IA 5KFHA 8ICWA 2DQNB 7ICNA 2WFAA 5DDYA 2OXOA 4JB3A 4C8MA 2Q4TA 1PK1A 1N2XA 5HMMA 4KLGA 1Z4OA 3LWMA 3BS7A 1QQ6A 5KG0A 3WK4A 4FZLA 2F44A 3NVWA 4DL3A 3RR8A 2OYYA 3V7LA 3ZDDA 3E2EA 2EZZA 2ASJA 2KZZA 2YMQA 3SEIA 2W9CA 1QSSA 2AQ0A 1NOMA 5AKHA 1RYUA 3MR5A 1V38A 5AK5A 3RRHA 2I6XA 4KLTA 2B0CA 3ONNA 3BDPA 9ICOA 5AK3A 4FS1A 1L7PA 5DGBA 4ELTA 4KX5A 1COOA 5KFLA 5HHIA 4RQ7A 4UAZA 2NV3A 1ZQTA 4QWAA 2NRXA 2KSOB 1SKWA 1O08A 1NZBA 5L1IA 5G5HA 1ZQQA 4C8KA 5L1JA 1AROP 1OUQA 1KEJA 3MC1A 1U9LA 4KITB 9ICVA 1IG6A 1N61A 4Z6DA 3GU3A 2LPEA 2DUYA 8ICVA 7ICEA 8ICFA 3NVVA 5KL1B 5G5GA 2E8PA 3NGDA 3Q8LA 4DSKA 5T14A 3H0LB 1SWWA 3HT3A 2ISPA 3B0YA 2HHSA 1SV4A 5CR0A 4DLEA 2KFZA 4MF8A 4O5CA 5J0SA 7ICOA 2F1JA 1UPHA 2LHTA 5J0PA 1LB2B 4O3SA 4ZOHC 2ZIVA 3HPOA 2GH1A 4NLBA 4QWCA 8ICEA 1DGJA 2J6TA 4O3QA 1ZOLA 3SYZA 4IC9A 3RF9A 2KG5A 1MA7A 4NLNA 1X9WA 1TK5A 2ZIUA 1Y88A 3MDAA 4EBDA 3T5JA 2P6UA 5AK6A 4QIWC 3VCBA 4MEXA 3F53A 1RM6C 5KG5A 2YB1A 3F2BA 4EYHB 2E8NA 1QCKA 5EWEA 2Q0ZX 2RQ5A 2ALZA 1JUDA 4LZDA 1QH9A 1B0XA 3GV8B 7ICKA 8ICHA 9ICLA 4GC7A 4O3PA 4C8LA 5E79U 1Q3VA 5KFEA 2EH9A 4F4XA 2JRZA 5AKJA 3OJSA 3AMZA 2KJ9A 2RP5A 1Q3UA 2F1IA 4MEYA 5AKZA 3Q8RB 5KFDA 4B6JA 2EQYA 1S0OA 1XO1A 4U7CA 4B9UA 5HR6A 3NVZA 2ZUBA 4BXOB 4LZGA 4ECSA 1JRPA 4GXJA 1NJXA 1DK2A 2HHQA 3RAQA 2HOQA 2HHVA 1RXVA 5JRTA 3TFRA 3MGVA 1C7YA 5F9LA 1WCNA 2BQ3A 4AYBF 2NRVA 9ICMA 9ICSA 2W55A 2PXIA 5J2IA 7ICLA 4NLGA 4UAYA 1SV0A 2FDRA 4F5PA 1A0PA 4KN4A 5ALDA 4YD2A 2KKPA 3LDAA 2B21A 4PJ0U 3DDHA 4CF3A 2MA1A 4QZAA 4DFPA 4C7ZA 4ED8A 4RUAA 4KLDA 5HP4A 5J2GA 2FLNA 2DWQA 2KEYA 2MUTA 5ALVA 3UPQA 3G6VA 2KFNA 2G5HB 1ZQLA 4NL9C 4Y2TA 3WKCA 2N1RA 3LYSA 2W7OA 5KT5A 2KIWA 4F4YA 4EBEA 7ICMA 2ASLA 3MR3A 3BQTA 4USAA 2O6KA 3SENA 3V7KA 2KVSA 2M9NA 4R66A 2QB0B 1ZQ1C 1Q46A 4DQQA 4YMMA 4HAIA 3SAGA 3RBEA 3I28A 2YTUA 4DO9A 1RQLA 1V85A 1U47A 2IHNA 2BDPA 2LM1A 2YMPA 2G06A 4PHEA 1ZJMA 4FO6A 3N7RC 5EWFA 1WWUA 3B0XA 5J8YC 4K4GA 4E0DA 3BS5B 3ORYA 3J81j 3RFAA 2ZXHA 1YT3A 5ALJA 3GV7B 2H3VA 4DSFA 2HMXA 3D6JA 3HX0A 2WTFA 1XSLA 4Y2VA 1B4FA 5A0LA 2BCSA 2J6UA 2PFPA 4K4IA 2WAQF 3S6JA 4QZGA 1M6YA 4P2HA 4ED0A 1PUZA 2RDJA 4ECXA 5F9NA 4R64A 1KRPA 2JH7A 2IMWP 2D8CA 3AM9A 5CB1A 5D4BA 5ALPA 1JXEA 2W43A 3KBBA 3KHHA 5BOMA 2MRLA 2ZIWA 5KL8B 4EEYA 1RYRA 3AN1A 4F91B 3D2SA 2F8KA 2XCPA 1TVAA 4ACOA 5J2FA 4FS2A 1CUKA 5AI0A 4C4TA 1UA1A 3CYMA 3TKAA 5AI5A 1ZD5A 1Z4NA 4J9OA 8ICUA 5KFYA 4GXIA 1F5SA 1DGSA 1SGGA 4M0AA 5JUMA 2VANA 3MR6A 3RH6A 5ALXA 1ZQYA 4IQTA 3FDSA 2AQ4A 2K4PA 3A0HU 4GXKA 3RB6A 4PZOA 4M9HA 2JV3A 5AK4A 3H40A 4UQGA 4O3MA 5IIKA 1ZETA 3O0FA 5H2FU 4RQ8A 4OO1J 5HHHA 4RQ5A 1S0VA 3L3FX 3RJKA 4EYIB 5KAFU 2W9BA 4QZ9A 3QXGA 1X66A 5J0TA 3KKAA 4ECZA 4RNMA 4Q44A 2MU2A 7ICGA 3TAQA 8ICPA 3QU9A 2KKVA 1JALA 2QB1A 4RNNA 2IOFK 4YN4A 3TI0A 3IG8A 3OHAA 5DKWA 1ZQAA 1ZQNA 5DQGA 2G07A 4PGQA 4DL7A 5EOZA 2HHXA 2EAMA 5KFBA 2P6RA 3GIJA 4YFKA 3TANA 1KFTA 4ELUA 5IILA 5KFAA 5DB8A 5ALIA 4NLCA 4DSJA 1ZQWA 5KFTA 1PVQA 5HMLA 3M6KA 4I2IA 4YQWA 4UAUA 5IIOA 4GC6A 2R8GA 3R9KA 4M6WB 3QEBZ 3RJJA 1NKBA 2W9AA 2HHWA 4UAWA 3GV5B 4F4KA 5J0QA 1S10A 3HJEA 3PZPA 4MHVA 4I2FA 5DG7A 3MFIA 5AI9A 1NKCA 4NLZA 2OH2A 1A76A 4XQ8A 4P4PA 3LVWA 3V6JA 8ICRA 3EPIA 1NI3A 2XCAA 5KFIA 3T5KA 3PVXA 2C2DA 9ICEA 3FC4A 2V4RA 2G08A 2XO7A 4EENA 1EXNA 4G9BA 5J2DA 1FFUA 2PKEA 5KFKA 3ZD8A 5IINA 5TZVA 4CRXA 3KZXA 3ZDEA 1L6NA 5ALOA 1X9MA 3QUTA 1D8YA 1IIPA 1ZD2P 4IRCA 2R8HA 1BPDA 4RZRA 3PSPA 2W54A 2JEIA 4NXZA 2I1QA 1NK6A 1L3SA 3PW2A 3BQ7A 4KLIA 2C2RA 3QU7A 1RYSA 4I2AA 3K1RB 4BX9C 5TISU 4CDGA 9ICPA 2PFOA 5KFOA 5J0OA 5AIBA 5KFNA 4F92B 1V97A 4DF8A 3GFKB 5ALNA 2C2EA 5ALWA 4GFJA 4IL6U 4QZCA 4UARA 5J2KA 2F1HA 1GO3F 2ZJ5A 3GZFA 1ZQRA 2YN4A 2F8LA 1Z3EB 2CXYA 4I2EA 2RHFA 2EAOA 3VC8A 4AYBC 2IA6A 2XI9A 2NO4A 3C1YA 3NTUA 3ISCA 1COKA 4RQ0A 7ICHA 3ZDBA 4QZIA 2UVUA 4QWDA 4FE3A 1O03A 2M0NA 3DEEA 1D9FA 2Y1JA 1RZTA 1L5UA 2K4IA 1WYGA 7ICUA 5J0XA 4DQIA 2FMSA 2W3SA 3SV4A 3A0BU 4F5OA 4JV1A 4EX6A 5ALHA 1ZJNA 5DQIA 2FPMA 3QZ7A 3N7SC 2LM4A 1SXDA 4ED1A 4NJ8A 4X5VA 1LKYB 3C2KA 1UHUA 2JXJA 2A1JA 1PK3A 1S5LU 1URJA 3AQFA 4KN7A 3M7DA 7ICQA 5ALFA 1SZHA 4YP3A 2VIXA 1F0MA 3PSTA 5AKGA 5F3XB 4Z6CA 4DS5A 2FPLA 4PL1A 3T5LA 2WF5A 4I2CA 2NRZA 9ICNA 5KT3A 4RPXA 2QKQA 4GLXA 3SD7A 2AXTU 4PL2A 4PHDA 2BZFA 3M9MB 4YMNA 2R8KA 2JHDA 4YR2A 3K4GA 3B9JA 5CJ7A 2EZYA 2WF8A 2ASDA 5L9XA 2I9GA 4YXJA 2Y9TA 2WB1F 5L1LA 5AIAA 5ALEA 5AI4A 2FI1A 2GLEA 3LWLA 3CW2C 4M9LA 2XY6A 3PX6A 5J0RA 4J9SA 1ZQEA 2DPJA 4G3IA 4BUGA 3MABA 4B9NA 5ALMA 3HKZF 2KVCA 1RDFA 1ZQJA 4F72A 2LI6A 1KLNA 3BQ0A 2E1FA 1BGXT 4Y2QA 1T8EA 8ICJA 2WAQC 1TFRA 5JTIA 2BQRA 5KG7A 2AU0A 4CE6A 3AUOA 3AU2A 2DFLA 3PV8A 3QUQA 3MGIA 2XGQA 5AM2A 2NRTA 9ICTA 1TAMA 4PHPA 7ICVA 5AKXA 1KTQA 1KL9A 8ICTA 1ZXIA 3H0RB 2W04A 2AJQA 4O0IA 1MQ3A 4P4OA 2VA2A 3C2LA 2JEGA 3F5AA 2E8OA 3Q8MA 8ICMA 5DB6A 2HSZA 3CNHA 1JROA 5KFMA 4NM1A 2OWOA 4PPXA 4YR0A 1JI7A 1ZQIA 2JEJA 1L7NA 1ZQPA 4TUSA 4RUCA 2L5YA 2FLPA 3H4DA 1WWVA 3RTVA 8ICLA 2KJ8A 4KLLA 9ICFA 2ZTEA 4F71A 2LYBA 4JUZA 2H3FA 4UB1A 2KJ5A 4DL4A 1CEZA 4DEZA 2PFQA 1PVRA 1MC8A 3ZDCA 1UT5A 4JMUA 1RQNA 2Y9UA 5KG4A 2KHQA 4ELVA 2HVIA 3QU2A 3RR7A 3WKDA 2EDUA 1L8OA 2G5IB 2KNJA 4DFDA 3JPTA 5KFRA 4QNLA 1QSLA 2C22A 5CRXA 3I1YA 4QZ8A 1NJYA 2ODGA 3H4BA 1SIJA 4PGXA 4IR1A 3HWTA 3AL0B 3H8SA 3IDWA 3PO5A 4WJ3B 2QARB 8ICAA 5K4LA 4DCCA
chains in the Genus database with same CATH topology
2F8KA 1COKA 2QB0A 5JTIA 3BS7A 2F44A 1LKYA 2KG5A 4NL9C 2ESEA 4NL9A 3SEIA 4PZNA 2D3DA 2DL0A 4MHVA 2KSOA 2K60A 1SGGA 1V38A 2F3NA 2E8NA 3SENA 1PK1B 2FE9A 1X40A 1B0XA 5L1MA 2K4PA 2QB0B 1SXDA 4NJ8A 4PZOA 3TACB 3BS5A 2E8OA 2B6GA 1LKYB 1X9XA 1Z1VA 2YTUA 2EANA 2JV3A 1V85A 1JI7A 1PK3A 2KSOB 1OW5A 2EAPA 1F0MA 3HILA 4RQMA 2L5YA 5F3XB 2E8MA 1WWVA 1WWUA 1X66A 3KKAC 2QKQA 3KKAA 5J8YC 2KIVA 4IS7A 5J8YA 1UQVA 3BQ7A 2LMRA 3BS5B 3TADC 3K1RB 3TADA 2QB1A 2QARA 5JRTA 1UCVA 2LPEA 3H8MA 5JU5A 2Y9TA 1B4FA 1RG6A 2Y9UA 1DXSA 2GLEA 1OXJA 2E8PA 1KW4A 5KNIA 2EAMA 1SV0C 1SV0A 1SV4A 2DKZA 2D8CA 4RQNA 2ES6A 2DKXA 3IDWA 1SXEA 2KE7A 2QARB 1PK1A 2EAOA 2KMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8K A;  1COK A;  2QB0 A;  5JTI A;  3BS7 A;  2F44 A;  1LKY A;  2KG5 A;  4NL9 C;  2ESE A;  4NL9 A;  3SEI A;  4PZN A;  2D3D A;  2DL0 A;  4MHV A;  2KSO A;  2K60 A;  1SGG A;  1V38 A;  2F3N A;  2E8N A;  3SEN A;  1PK1 B;  2FE9 A;  1X40 A;  1B0X A;  5L1M A;  2K4P A;  2QB0 B;  1SXD A;  4NJ8 A;  4PZO A;  3TAC B;  3BS5 A;  2E8O A;  2B6G A;  1LKY B;  1X9X A;  1Z1V A;  2YTU A;  2EAN A;  2JV3 A;  1V85 A;  1JI7 A;  1PK3 A;  2KSO B;  1OW5 A;  2EAP A;  1F0M A;  3HIL A;  4RQM A;  2L5Y A;  5F3X B;  2E8M A;  1WWV A;  1WWU A;  1X66 A;  3KKA C;  2QKQ A;  3KKA A;  5J8Y C;  2KIV A;  4IS7 A;  5J8Y A;  1UQV A;  3BQ7 A;  2LMR A;  3BS5 B;  3TAD C;  3K1R B;  3TAD A;  2QB1 A;  2QAR A;  5JRT A;  1UCV A;  2LPE A;  3H8M A;  5JU5 A;  2Y9T A;  1B4F A;  1RG6 A;  2Y9U A;  1DXS A;  2GLE A;  1OXJ A;  2E8P A;  1KW4 A;  5KNI A;  2EAM A;  1SV0 C;  1SV0 A;  1SV4 A;  2DKZ A;  2D8C A;  4RQN A;  2ES6 A;  2DKX A;  3IDW A;  1SXE A;  2KE7 A;  2QAR B;  1PK1 A;  2EAO A;  2KMD A; 
#chains in the Genus database with same CATH topology
 9ICG A;  4QZF A;  2BR0 A;  2UVR A;  3JPQ A;  1XS9 D;  3PX0 A;  3I76 A;  4P0Q B;  1S0M A;  2E5S A;  1N5W A;  3UQ2 A;  5KFX A;  5ALY A;  2KN7 A;  4NL9 A;  4PH5 A;  7ICF A;  3DV9 A;  4O5E A;  2YML A;  2IHM A;  2KSO A;  2RRD A;  3M8S A;  4OJP A;  3GDX A;  1QTM A;  2ZUC A;  4O5K A;  4I2J A;  4M9J A;  2FE9 A;  1X40 A;  4UAT A;  1ZRM A;  4MFC A;  2V4Q A;  1FIQ A;  2H3Z A;  4KMU A;  2F2A B;  3F5E A;  8ICQ A;  3G6X A;  1X9X A;  2EAN A;  1NKE A;  4IRD A;  1QLN A;  4UAV A;  5KFW A;  3N28 A;  1N63 A;  4M2Y A;  2H3Q A;  1Z00 B;  5ALT A;  5DBA A;  2XGP A;  8ICZ A;  5ALZ A;  5CHG A;  1ZYQ A;  2KIV A;  2JZB B;  1HIW A;  5J8Y A;  5EE1 A;  4C4S A;  1H38 A;  2PI4 A;  2YB4 A;  8ICO A;  4C80 A;  4DOB A;  1T7P A;  3WK6 A;  4R8U B;  1BPY A;  5JU5 A;  4XUS A;  5KFS A;  4Q8F A;  3SMV A;  4TQR A;  1BPE A;  3SV3 A;  8ICB A;  2UVW A;  5KNI A;  4I28 A;  2AGO A;  1VDV A;  4J9R A;  1SWV A;  4RPZ A;  3L5K A;  2JEF A;  1KN5 A;  2LYA A;  9ICQ A;  3SI8 A;  2DKX A;  5ALG A;  3M9N B;  4I2B A;  4US8 A;  1K1S A;  4XA5 A;  4DSL A;  4DSI A;  5J2A A;  4ECY A;  1NNL A;  1QQ7 A;  4Y2R A;  3FAH A;  4NM2 A;  1MN8 A;  5J2B A;  4Y2S A;  9ICI A;  2I5H A;  4OD0 A;  2Z7J A;  3PW0 A;  4CGZ A;  4Y2U A;  4QZH A;  1YZ7 A;  2KTQ A;  1CI4 A;  4UB6 U;  1S97 A;  3WK9 A;  4BXO A;  2ZXI A;  4ICA A;  4CCH A;  3RJH A;  2KK0 A;  1ECW A;  1TK8 A;  8ICS A;  2HW3 A;  3WU2 U;  3MR2 A;  4M04 A;  3UXN A;  8ICK A;  1X9S A;  4P0P B;  2BHN A;  4FFD A;  4OJ6 A;  4ED6 A;  3CP8 A;  2WF7 A;  5ALK A;  1TE2 A;  2OM6 A;  2ZIX B;  1F44 A;  3CRX A;  5CP2 A;  2RDI A;  3UXP A;  3C23 A;  3Q8P B;  1ZQK A;  1TV9 A;  1N62 A;  5AI6 A;  1IXR A;  1BPX A;  4IS7 A;  5AIC A;  5J2H A;  5DGA A;  4J9L A;  4K4H A;  4TUQ A;  5CWR A;  4R63 A;  5HNK A;  4YCX A;  2XIC A;  1P7D A;  2LYH A;  3WK8 A;  2HBJ A;  1S76 D;  4KLE A;  2A3V A;  3C5F A;  5D46 A;  3HW8 A;  4DQS A;  3H8J A;  2KZ3 A;  1J2N A;  2P66 A;  3D2N A;  1FEZ A;  1WCL A;  3TFS A;  4P4M A;  3HP6 A;  3M9O B;  2WB1 C;  5ALQ A;  4F93 B;  3LVV A;  3PR5 B;  3U26 A;  4Q8E A;  2QB0 A;  5KG1 A;  2VA3 A;  3KD3 A;  2XC9 A;  4OJO A;  3HKZ C;  3OGU A;  1U48 A;  4C8O A;  3ETL A;  1ZQM A;  4BDP A;  4QWB A;  4PGY A;  3V7J A;  5KFZ A;  1HJP A;  1RPL A;  3PML A;  4KLH A;  4BWJ A;  2K89 A;  1PK1 B;  8ICX A;  3IP4 B;  9ICH A;  4RU9 A;  3BZC A;  3BS5 A;  5KFG A;  3JPR A;  3MBY A;  2KHV A;  2B6G A;  5C0Y A;  5AKL A;  1L3U A;  4J03 A;  4O3O A;  2W9C B;  1XWL A;  3FYH A;  4UB8 U;  5AM0 A;  1ZQX A;  3GIK A;  4J9N A;  4US9 A;  4UW9 A;  1X6J A;  4UBC A;  4RQM A;  3THV A;  2W9M A;  4I2G A;  3E0F A;  3FM9 A;  4O9M A;  5EE3 A;  3C2M A;  5AKE A;  5HR7 A;  1ED1 A;  3TQ1 A;  1S8O A;  2DBY A;  1J97 A;  7ICJ A;  5DBC A;  4J9Q A;  2FMQ A;  2FJ6 A;  2VJ5 A;  2OHF A;  5KG6 A;  3M1Y A;  4YMO A;  3MGH A;  2WHE A;  3NRW A;  1XU4 A;  1RG6 A;  1K1Q A;  5J0U A;  3IHQ B;  3PW7 A;  4TUP A;  1SKR A;  3V6K A;  4C4R A;  3UXO A;  2W11 A;  4QZE A;  3JPO A;  5IIJ A;  2ZJ8 A;  4B9T A;  3PO4 A;  1D9D A;  4PHA A;  3WKB A;  4B9V A;  3HRD D;  3MFH A;  5BOL A;  1ZRN A;  3RH4 A;  3N4M B;  4F2R A;  1LVH A;  4CF4 A;  5J2C A;  4IQV A;  2CRX A;  1ZQU A;  2YX8 A;  1V9P A;  4HYK A;  4EX7 A;  2W8L A;  2R18 A;  3ZI4 A;  1SZP A;  4DWI A;  7ICP A;  2K4H A;  2H5X A;  2F76 X;  3PSI A;  2ZIV B;  4DL2 A;  1CRX A;  1Z19 A;  2KOB A;  5KFC A;  1QSY A;  3RJE A;  4OCZ A;  1U49 A;  3PW5 A;  8ICG A;  4BGD A;  2ZIU B;  2HBK A;  1XO0 A;  4LVS A;  2XY7 A;  3ZDA A;  2DPI A;  1ZQO A;  1S77 D;  9ICK A;  4DQR A;  2HBL A;  2Y0S F;  2HHT A;  2E8M A;  5AM4 A;  5J29 A;  1XSP A;  3BJY A;  1L3T A;  3RJG A;  5B66 U;  5J2E A;  2G09 A;  4QW8 A;  3QEA Z;  3TAD C;  1N56 A;  2HBM A;  1VLB A;  3Q8Q B;  3QU4 A;  5KT7 A;  2YY6 A;  5ALR A;  3PMN A;  4M6W A;  1D8L A;  1UT8 A;  3SAH A;  1BVS A;  1U45 A;  5AHX A;  4EZ9 A;  1D8B A;  3QE9 Y;  3RAX A;  2BCV A;  2AGQ A;  3PW4 A;  1JXL A;  4JWM A;  4UAS A;  4F50 A;  3QZ8 A;  1BNO A;  2H3I A;  2GWS A;  1BNP A;  1C20 A;  3AU6 A;  3IM1 A;  2ESE A;  2ISO A;  9ICB A;  3EWA A;  1L8L A;  1X2I A;  3JPP A;  3T3F A;  3KFU F;  2HDO A;  2IOH A;  2K60 A;  4ECQ A;  4QW9 A;  4TUR A;  2BPG A;  2KD1 A;  4J9P A;  3K75 D;  1TKD A;  5D49 A;  5KFV A;  5B5E U;  1FO4 A;  2KIC A;  5GTH U;  4RT2 A;  4DOA A;  3UMB A;  5BPC A;  1JN3 A;  2MUT B;  4JV2 A;  2HOI A;  5KFJ A;  1Z1V A;  2XY5 A;  4Q43 A;  1ZQF A;  3KHR A;  5EWG A;  2KP7 A;  4KTQ A;  1FFV A;  5KFP A;  3JPN A;  2YQE A;  8ICC A;  4DL5 A;  3UM9 A;  3HIL A;  2IBK A;  3QX7 A;  3UMC A;  2FLL A;  5DQH A;  4DF4 A;  7ICI A;  3RH5 A;  2ATL A;  4EZ6 A;  3BQ2 A;  4KX3 A;  4NWI A;  5DLF A;  3TAR A;  3H8M A;  2CPR A;  4FBU A;  2KV2 A;  2RLT A;  2BCU A;  5J2J A;  2PMZ F;  4RQ4 A;  8ICN A;  5DB9 A;  3OTQ A;  4DFJ A;  5ALL A;  1Z1B A;  3N7P D;  5KFU A;  3NAS A;  2ZG6 A;  4DL6 A;  4XRH A;  4F8R A;  3KZI U;  3C29 A;  3KHL A;  4KLQ A;  3AQE A;  3D2Q A;  4Z6E A;  2KMD A;  3H0M B;  4QWE A;  1DOQ A;  1KFD A;  4KLS A;  1SB3 C;  2WF9 A;  5KFF A;  4YVZ A;  2VA8 A;  1LKY A;  5KTQ A;  4RT3 A;  2CN1 A;  1BPB A;  4Y2Y A;  4NY8 A;  1XNS A;  5EE9 A;  1KFS A;  3ICX A;  4ECU A;  1KKX A;  1ZQS A;  5EE0 A;  2F77 X;  2F3N A;  2BGW A;  2ZIW B;  1N5X A;  4B9S A;  3SR6 A;  5KAI U;  3IN5 A;  2HVH A;  2W8K A;  7ICT A;  2A19 A;  1HUZ A;  5FP0 A;  9ICW A;  4UB2 A;  3SZ2 A;  5KT4 A;  3RB0 A;  1TAQ A;  4YD1 A;  4DFM A;  1PVP A;  4KLO A;  4OJL A;  2FMP A;  4Y2J A;  2HCF A;  1DK3 A;  2ZTC A;  2R8J A;  1WUD A;  1ZQD A;  1UA0 A;  9ICX A;  2NYV A;  2GO7 A;  4F3O A;  5DG8 A;  2ZJA A;  3UQ0 A;  9ICR A;  2K8B B;  2OCE A;  4UBB A;  5DBB A;  4FZN A;  1SL2 A;  1TK0 A;  4MFF A;  3EW9 A;  4RQ1 A;  2K8A A;  1KDH A;  1NK7 A;  1L7O A;  4IRK A;  5L1K A;  4F5Q A;  5AI8 A;  2W9B B;  5ALS A;  4RNO A;  1SV0 C;  4EEK A;  2BPF A;  8ICI A;  1KBU A;  1MSW D;  2DKZ A;  4RQN A;  5DLG A;  4KLJ A;  2V9W A;  2YMM A;  3PSF A;  1ZD4 A;  4C0Z A;  4FBT A;  3UMG A;  7ICR A;  5AM3 A;  3IG5 A;  3OSP A;  2C28 A;  2QLT A;  2E1E A;  1SL0 A;  1ZQB A;  4MF2 A;  3GIM A;  3Q8K A;  9ICC A;  4O3R A;  1T3N A;  4BJQ A;  2LBO A;  5KT2 A;  1N60 A;  4LJX A;  2NO5 A;  3H8W A;  1J2M A;  2W7P A;  3C21 A;  3PNC A;  2HHU A;  4BWM A;  3Q8S B;  4F5N A;  1SKS A;  3AEV A;  2IOF A;  2ZUD A;  4OJ5 A;  3ISD A;  4DQP A;  1ZQC A;  3T79 A;  4ED3 A;  4ECV A;  2BQU A;  5L1M A;  3C5G A;  3C28 A;  2G0A A;  3TAC B;  4C8N A;  4Z6F A;  1A77 A;  3GIL A;  4J9K A;  1ZD3 A;  2R8I A;  1IV8 A;  4JWN A;  1OW5 A;  2XID A;  4RPY A;  4DOC A;  3RRG A;  1NK8 A;  4GIB A;  4IQW A;  3BQ1 A;  4J9M A;  4RQ3 A;  3NUQ A;  3N97 B;  4M9N A;  1ZQZ A;  9ICJ A;  4O3N A;  2QAR A;  3RB3 A;  3V72 A;  3QYP A;  4QJF B;  5KG2 A;  4F2S A;  4KMO B;  2DF4 B;  4FZM A;  2Y0S C;  7ICS A;  4P0Q A;  4F4W A;  3M6Z A;  1S0N A;  2PI5 A;  2BPC A;  3QUC A;  3OPX A;  3WK5 A;  2PFN A;  3K1Z A;  2ES6 A;  9ICA A;  3RBD A;  5KFQ A;  4QIW F;  1LV5 A;  4RQ6 A;  3LK9 A;  4IR9 A;  2MSN A;  1QQ5 A;  5AKI A;  4CF5 A;  5DG9 A;  1T3Q A;  4YXM A;  1KSP A;  1L7M A;  2D6F C;  1HEK A;  1WG8 A;  1RXW A;  4NLK A;  2VKQ A;  4PZN A;  3MDC A;  2D3D A;  5CA7 A;  3G6Y A;  3PY8 A;  2DL0 A;  3E58 A;  4KLF A;  2JR5 A;  5CEH A;  1TAU A;  4M9G A;  5C5J A;  1JMS A;  4JK1 A;  3GQC A;  4MFA A;  4NV0 A;  4F5R A;  9ICU A;  1Z00 A;  1HUO A;  3RJI A;  3WKA A;  4ZH4 A;  1NK4 A;  2JZB A;  4ED7 A;  4M47 A;  1B43 A;  4I2H A;  3BZK A;  1K5O A;  5ALU A;  3GII A;  4I27 A;  1DRG A;  4A8E A;  3NRZ A;  2DGZ A;  4IQU A;  2A1A A;  5J0W A;  1MQ2 A;  2WF6 A;  3NS1 A;  3IRU A;  4R8U A;  5J0Y A;  4U6P A;  4I2D A;  2BDU A;  2Y1I A;  2JMG A;  4EBC A;  2HOF A;  4ED2 A;  1NJW A;  2EAP A;  3EUB 2;  5KT6 A;  4RQ2 A;  3KHG A;  1B22 A;  4ECW A;  3KKA C;  2K8C B;  2AH5 A;  1ZQV A;  3TAP A;  2K4E A;  4B9M A;  1UQV A;  4DS4 A;  1T4G A;  2EZX A;  1NK9 A;  2NRW A;  8ICY A;  4QZB A;  3JPS A;  4C7Y A;  2A1J B;  5AM1 A;  2UVV A;  1Q8K A;  3C1Z A;  4ECT A;  3ALR A;  5AKK A;  1XSN A;  1PZN A;  4Y2X A;  1N48 A;  2P35 A;  2OEH A;  2GOL A;  1OXJ A;  3QU5 A;  1NZP A;  4DSE A;  2E3T A;  2AGP A;  1X42 A;  2W3R A;  4B9L A;  3F2C A;  4YG2 A;  2J6S A;  4F4Z A;  3OHB A;  2BCR A;  2JGA A;  3T5H A;  2BKE A;  4R65 A;  1NK5 A;  1SXE A;  2KE7 A;  3H7I A;  2ZTD A;  1BPZ A;  4Y2P A;  3WK7 A;  4I29 A;  2PMZ C;  2LKY A;  5KG3 A;  2AHO B;  3SQI A;  1NK0 A;  3M8R A;  1L3V A;  1VJ5 A;  3F2D A;  3QUB A;  4P0P A;  4TQS A;  3RB4 A;  4QZD A;  2XVT A;  1SL1 A;  2ZIX A;  4DFK A;  2MAX A;  4UB4 A;  3L4P A;  1KQQ A;  4KLM A;  4CNQ A;  2HI0 A;  3IV6 A;  4JV0 A;  4Q45 A;  2VJ4 A;  3PR4 A;  3RJF A;  5III A;  4AP9 A;  3EPG A;  2KZM A;  1A6S A;  4EEL A;  3ED5 A;  3EYZ A;  3SAF A;  4UB5 A;  3EZ5 A;  4DLG A;  3NVY A;  5GTI U;  1JX4 A;  1XC9 A;  3OJU A;  1ZQH A;  5DB7 A;  5IIM A;  4ECR A;  3V6H A;  1U4B A;  3ISB A;  4YR3 A;  1ZQG A;  3PX4 A;  1IM4 A;  1YZ6 A;  3KOO A;  2JH1 A;  3QNM A;  2LMR A;  3ETR A;  5DDM A;  1S9F A;  3ZD9 A;  1JIH A;  2BCQ A;  3TAD A;  3KTQ A;  1UCV A;  4KLU A;  1T94 A;  3WKE A;  1DXS A;  2FPK A;  3OSN A;  1NJZ A;  1AQ6 A;  1KW4 A;  5AKY A;  4UB3 A;  2W03 A;  5AM5 A;  1X6I A;  5KFH A;  8ICW A;  2DQN B;  7ICN A;  2WFA A;  5DDY A;  2OXO A;  4JB3 A;  4C8M A;  2Q4T A;  1PK1 A;  1N2X A;  5HMM A;  4KLG A;  1Z4O A;  3LWM A;  3BS7 A;  1QQ6 A;  5KG0 A;  3WK4 A;  4FZL A;  2F44 A;  3NVW A;  4DL3 A;  3RR8 A;  2OYY A;  3V7L A;  3ZDD A;  3E2E A;  2EZZ A;  2ASJ A;  2KZZ A;  2YMQ A;  3SEI A;  2W9C A;  1QSS A;  2AQ0 A;  1NOM A;  5AKH A;  1RYU A;  3MR5 A;  1V38 A;  5AK5 A;  3RRH A;  2I6X A;  4KLT A;  2B0C A;  3ONN A;  3BDP A;  9ICO A;  5AK3 A;  4FS1 A;  1L7P A;  5DGB A;  4ELT A;  4KX5 A;  1COO A;  5KFL A;  5HHI A;  4RQ7 A;  4UAZ A;  2NV3 A;  1ZQT A;  4QWA A;  2NRX A;  2KSO B;  1SKW A;  1O08 A;  1NZB A;  5L1I A;  5G5H A;  1ZQQ A;  4C8K A;  5L1J A;  1ARO P;  1OUQ A;  1KEJ A;  3MC1 A;  1U9L A;  4KIT B;  9ICV A;  1IG6 A;  1N61 A;  4Z6D A;  3GU3 A;  2LPE A;  2DUY A;  8ICV A;  7ICE A;  8ICF A;  3NVV A;  5KL1 B;  5G5G A;  2E8P A;  3NGD A;  3Q8L A;  4DSK A;  5T14 A;  3H0L B;  1SWW A;  3HT3 A;  2ISP A;  3B0Y A;  2HHS A;  1SV4 A;  5CR0 A;  4DLE A;  2KFZ A;  4MF8 A;  4O5C A;  5J0S A;  7ICO A;  2F1J A;  1UPH A;  2LHT A;  5J0P A;  1LB2 B;  4O3S A;  4ZOH C;  2ZIV A;  3HPO A;  2GH1 A;  4NLB A;  4QWC A;  8ICE A;  1DGJ A;  2J6T A;  4O3Q A;  1ZOL A;  3SYZ A;  4IC9 A;  3RF9 A;  2KG5 A;  1MA7 A;  4NLN A;  1X9W A;  1TK5 A;  2ZIU A;  1Y88 A;  3MDA A;  4EBD A;  3T5J A;  2P6U A;  5AK6 A;  4QIW C;  3VCB A;  4MEX A;  3F53 A;  1RM6 C;  5KG5 A;  2YB1 A;  3F2B A;  4EYH B;  2E8N A;  1QCK A;  5EWE A;  2Q0Z X;  2RQ5 A;  2ALZ A;  1JUD A;  4LZD A;  1QH9 A;  1B0X A;  3GV8 B;  7ICK A;  8ICH A;  9ICL A;  4GC7 A;  4O3P A;  4C8L A;  5E79 U;  1Q3V A;  5KFE A;  2EH9 A;  4F4X A;  2JRZ A;  5AKJ A;  3OJS A;  3AMZ A;  2KJ9 A;  2RP5 A;  1Q3U A;  2F1I A;  4MEY A;  5AKZ A;  3Q8R B;  5KFD A;  4B6J A;  2EQY A;  1S0O A;  1XO1 A;  4U7C A;  4B9U A;  5HR6 A;  3NVZ A;  2ZUB A;  4BXO B;  4LZG A;  4ECS A;  1JRP A;  4GXJ A;  1NJX A;  1DK2 A;  2HHQ A;  3RAQ A;  2HOQ A;  2HHV A;  1RXV A;  5JRT A;  3TFR A;  3MGV A;  1C7Y A;  5F9L A;  1WCN A;  2BQ3 A;  4AYB F;  2NRV A;  9ICM A;  9ICS A;  2W55 A;  2PXI A;  5J2I A;  7ICL A;  4NLG A;  4UAY A;  1SV0 A;  2FDR A;  4F5P A;  1A0P A;  4KN4 A;  5ALD A;  4YD2 A;  2KKP A;  3LDA A;  2B21 A;  4PJ0 U;  3DDH A;  4CF3 A;  2MA1 A;  4QZA A;  4DFP A;  4C7Z A;  4ED8 A;  4RUA A;  4KLD A;  5HP4 A;  5J2G A;  2FLN A;  2DWQ A;  2KEY A;  2MUT A;  5ALV A;  3UPQ A;  3G6V A;  2KFN A;  2G5H B;  1ZQL A;  4NL9 C;  4Y2T A;  3WKC A;  2N1R A;  3LYS A;  2W7O A;  5KT5 A;  2KIW A;  4F4Y A;  4EBE A;  7ICM A;  2ASL A;  3MR3 A;  3BQT A;  4USA A;  2O6K A;  3SEN A;  3V7K A;  2KVS A;  2M9N A;  4R66 A;  2QB0 B;  1ZQ1 C;  1Q46 A;  4DQQ A;  4YMM A;  4HAI A;  3SAG A;  3RBE A;  3I28 A;  2YTU A;  4DO9 A;  1RQL A;  1V85 A;  1U47 A;  2IHN A;  2BDP A;  2LM1 A;  2YMP A;  2G06 A;  4PHE A;  1ZJM A;  4FO6 A;  3N7R C;  5EWF A;  1WWU A;  3B0X A;  5J8Y C;  4K4G A;  4E0D A;  3BS5 B;  3ORY A;  3J81 j;  3RFA A;  2ZXH A;  1YT3 A;  5ALJ A;  3GV7 B;  2H3V A;  4DSF A;  2HMX A;  3D6J A;  3HX0 A;  2WTF A;  1XSL A;  4Y2V A;  1B4F A;  5A0L A;  2BCS A;  2J6U A;  2PFP A;  4K4I A;  2WAQ F;  3S6J A;  4QZG A;  1M6Y A;  4P2H A;  4ED0 A;  1PUZ A;  2RDJ A;  4ECX A;  5F9N A;  4R64 A;  1KRP A;  2JH7 A;  2IMW P;  2D8C A;  3AM9 A;  5CB1 A;  5D4B A;  5ALP A;  1JXE A;  2W43 A;  3KBB A;  3KHH A;  5BOM A;  2MRL A;  2ZIW A;  5KL8 B;  4EEY A;  1RYR A;  3AN1 A;  4F91 B;  3D2S A;  2F8K A;  2XCP A;  1TVA A;  4ACO A;  5J2F A;  4FS2 A;  1CUK A;  5AI0 A;  4C4T A;  1UA1 A;  3CYM A;  3TKA A;  5AI5 A;  1ZD5 A;  1Z4N A;  4J9O A;  8ICU A;  5KFY A;  4GXI A;  1F5S A;  1DGS A;  1SGG A;  4M0A A;  5JUM A;  2VAN A;  3MR6 A;  3RH6 A;  5ALX A;  1ZQY A;  4IQT A;  3FDS A;  2AQ4 A;  2K4P A;  3A0H U;  4GXK A;  3RB6 A;  4PZO A;  4M9H A;  2JV3 A;  5AK4 A;  3H40 A;  4UQG A;  4O3M A;  5IIK A;  1ZET A;  3O0F A;  5H2F U;  4RQ8 A;  4OO1 J;  5HHH A;  4RQ5 A;  1S0V A;  3L3F X;  3RJK A;  4EYI B;  5KAF U;  2W9B A;  4QZ9 A;  3QXG A;  1X66 A;  5J0T A;  3KKA A;  4ECZ A;  4RNM A;  4Q44 A;  2MU2 A;  7ICG A;  3TAQ A;  8ICP A;  3QU9 A;  2KKV A;  1JAL A;  2QB1 A;  4RNN A;  2IOF K;  4YN4 A;  3TI0 A;  3IG8 A;  3OHA A;  5DKW A;  1ZQA A;  1ZQN A;  5DQG A;  2G07 A;  4PGQ A;  4DL7 A;  5EOZ A;  2HHX A;  2EAM A;  5KFB A;  2P6R A;  3GIJ A;  4YFK A;  3TAN A;  1KFT A;  4ELU A;  5IIL A;  5KFA A;  5DB8 A;  5ALI A;  4NLC A;  4DSJ A;  1ZQW A;  5KFT A;  1PVQ A;  5HML A;  3M6K A;  4I2I A;  4YQW A;  4UAU A;  5IIO A;  4GC6 A;  2R8G A;  3R9K A;  4M6W B;  3QEB Z;  3RJJ A;  1NKB A;  2W9A A;  2HHW A;  4UAW A;  3GV5 B;  4F4K A;  5J0Q A;  1S10 A;  3HJE A;  3PZP A;  4MHV A;  4I2F A;  5DG7 A;  3MFI A;  5AI9 A;  1NKC A;  4NLZ A;  2OH2 A;  1A76 A;  4XQ8 A;  4P4P A;  3LVW A;  3V6J A;  8ICR A;  3EPI A;  1NI3 A;  2XCA A;  5KFI A;  3T5K A;  3PVX A;  2C2D A;  9ICE A;  3FC4 A;  2V4R A;  2G08 A;  2XO7 A;  4EEN A;  1EXN A;  4G9B A;  5J2D A;  1FFU A;  2PKE A;  5KFK A;  3ZD8 A;  5IIN A;  5TZV A;  4CRX A;  3KZX A;  3ZDE A;  1L6N A;  5ALO A;  1X9M A;  3QUT A;  1D8Y A;  1IIP A;  1ZD2 P;  4IRC A;  2R8H A;  1BPD A;  4RZR A;  3PSP A;  2W54 A;  2JEI A;  4NXZ A;  2I1Q A;  1NK6 A;  1L3S A;  3PW2 A;  3BQ7 A;  4KLI A;  2C2R A;  3QU7 A;  1RYS A;  4I2A A;  3K1R B;  4BX9 C;  5TIS U;  4CDG A;  9ICP A;  2PFO A;  5KFO A;  5J0O A;  5AIB A;  5KFN A;  4F92 B;  1V97 A;  4DF8 A;  3GFK B;  5ALN A;  2C2E A;  5ALW A;  4GFJ A;  4IL6 U;  4QZC A;  4UAR A;  5J2K A;  2F1H A;  1GO3 F;  2ZJ5 A;  3GZF A;  1ZQR A;  2YN4 A;  2F8L A;  1Z3E B;  2CXY A;  4I2E A;  2RHF A;  2EAO A;  3VC8 A;  4AYB C;  2IA6 A;  2XI9 A;  2NO4 A;  3C1Y A;  3NTU A;  3ISC A;  1COK A;  4RQ0 A;  7ICH A;  3ZDB A;  4QZI A;  2UVU A;  4QWD A;  4FE3 A;  1O03 A;  2M0N A;  3DEE A;  1D9F A;  2Y1J A;  1RZT A;  1L5U A;  2K4I A;  1WYG A;  7ICU A;  5J0X A;  4DQI A;  2FMS A;  2W3S A;  3SV4 A;  3A0B U;  4F5O A;  4JV1 A;  4EX6 A;  5ALH A;  1ZJN A;  5DQI A;  2FPM A;  3QZ7 A;  3N7S C;  2LM4 A;  1SXD A;  4ED1 A;  4NJ8 A;  4X5V A;  1LKY B;  3C2K A;  1UHU A;  2JXJ A;  2A1J A;  1PK3 A;  1S5L U;  1URJ A;  3AQF A;  4KN7 A;  3M7D A;  7ICQ A;  5ALF A;  1SZH A;  4YP3 A;  2VIX A;  1F0M A;  3PST A;  5AKG A;  5F3X B;  4Z6C A;  4DS5 A;  2FPL A;  4PL1 A;  3T5L A;  2WF5 A;  4I2C A;  2NRZ A;  9ICN A;  5KT3 A;  4RPX A;  2QKQ A;  4GLX A;  3SD7 A;  2AXT U;  4PL2 A;  4PHD A;  2BZF A;  3M9M B;  4YMN A;  2R8K A;  2JHD A;  4YR2 A;  3K4G A;  3B9J A;  5CJ7 A;  2EZY A;  2WF8 A;  2ASD A;  5L9X A;  2I9G A;  4YXJ A;  2Y9T A;  2WB1 F;  5L1L A;  5AIA A;  5ALE A;  5AI4 A;  2FI1 A;  2GLE A;  3LWL A;  3CW2 C;  4M9L A;  2XY6 A;  3PX6 A;  5J0R A;  4J9S A;  1ZQE A;  2DPJ A;  4G3I A;  4BUG A;  3MAB A;  4B9N A;  5ALM A;  3HKZ F;  2KVC A;  1RDF A;  1ZQJ A;  4F72 A;  2LI6 A;  1KLN A;  3BQ0 A;  2E1F A;  1BGX T;  4Y2Q A;  1T8E A;  8ICJ A;  2WAQ C;  1TFR A;  5JTI A;  2BQR A;  5KG7 A;  2AU0 A;  4CE6 A;  3AUO A;  3AU2 A;  2DFL A;  3PV8 A;  3QUQ A;  3MGI A;  2XGQ A;  5AM2 A;  2NRT A;  9ICT A;  1TAM A;  4PHP A;  7ICV A;  5AKX A;  1KTQ A;  1KL9 A;  8ICT A;  1ZXI A;  3H0R B;  2W04 A;  2AJQ A;  4O0I A;  1MQ3 A;  4P4O A;  2VA2 A;  3C2L A;  2JEG A;  3F5A A;  2E8O A;  3Q8M A;  8ICM A;  5DB6 A;  2HSZ A;  3CNH A;  1JRO A;  5KFM A;  4NM1 A;  2OWO A;  4PPX A;  4YR0 A;  1JI7 A;  1ZQI A;  2JEJ A;  1L7N A;  1ZQP A;  4TUS A;  4RUC A;  2L5Y A;  2FLP A;  3H4D A;  1WWV A;  3RTV A;  8ICL A;  2KJ8 A;  4KLL A;  9ICF A;  2ZTE A;  4F71 A;  2LYB A;  4JUZ A;  2H3F A;  4UB1 A;  2KJ5 A;  4DL4 A;  1CEZ A;  4DEZ A;  2PFQ A;  1PVR A;  1MC8 A;  3ZDC A;  1UT5 A;  4JMU A;  1RQN A;  2Y9U A;  5KG4 A;  2KHQ A;  4ELV A;  2HVI A;  3QU2 A;  3RR7 A;  3WKD A;  2EDU A;  1L8O A;  2G5I B;  2KNJ A;  4DFD A;  3JPT A;  5KFR A;  4QNL A;  1QSL A;  2C22 A;  5CRX A;  3I1Y A;  4QZ8 A;  1NJY A;  2ODG A;  3H4B A;  1SIJ A;  4PGX A;  4IR1 A;  3HWT A;  3AL0 B;  3H8S A;  3IDW A;  3PO5 A;  4WJ3 B;  2QAR B;  8ICA A;  5K4L A;  4DCC A; 
#chains in the Genus database with same CATH homology
 2F8K A;  1COK A;  2QB0 A;  5JTI A;  3BS7 A;  2F44 A;  1LKY A;  2KG5 A;  4NL9 C;  2ESE A;  4NL9 A;  3SEI A;  4PZN A;  2D3D A;  2DL0 A;  4MHV A;  2KSO A;  2K60 A;  1SGG A;  1V38 A;  2F3N A;  2E8N A;  3SEN A;  1PK1 B;  2FE9 A;  1X40 A;  1B0X A;  5L1M A;  2K4P A;  2QB0 B;  1SXD A;  4NJ8 A;  4PZO A;  3TAC B;  3BS5 A;  2E8O A;  2B6G A;  1LKY B;  1X9X A;  1Z1V A;  2YTU A;  2EAN A;  2JV3 A;  1V85 A;  1JI7 A;  1PK3 A;  2KSO B;  1OW5 A;  2EAP A;  1F0M A;  3HIL A;  4RQM A;  2L5Y A;  5F3X B;  2E8M A;  1WWV A;  1WWU A;  1X66 A;  3KKA C;  2QKQ A;  3KKA A;  5J8Y C;  2KIV A;  4IS7 A;  5J8Y A;  1UQV A;  3BQ7 A;  2LMR A;  3BS5 B;  3TAD C;  3K1R B;  3TAD A;  2QB1 A;  2QAR A;  5JRT A;  1UCV A;  2LPE A;  3H8M A;  5JU5 A;  2Y9T A;  1B4F A;  1RG6 A;  2Y9U A;  1DXS A;  2GLE A;  1OXJ A;  2E8P A;  1KW4 A;  5KNI A;  2EAM A;  1SV0 C;  1SV0 A;  1SV4 A;  2DKZ A;  2D8C A;  4RQN A;  2ES6 A;  2DKX A;  3IDW A;  1SXE A;  2KE7 A;  2QAR B;  1PK1 A;  2EAO A;  2KMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...