2QKQA

Structure of the sam domain of human ephrin type-b receptor 4
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
AFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title SAM Domain of Human Ephrin Type-B Receptor 4 (EPHB4)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-B receptor 4
total genus 21
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qkqA00
1UCVA 4IS7A 1OW5A 2Y9TA 2B6GA 2K60A 2JV3A 1LKYB 2KIVA 1SXDA 3IDWA 2YTUA 2KMDA 2QB1A 5F3XB 2QARA 3H8MA 2DKZA 3SEIA 2QKQA 2EAPA 5J8YA 1B0XA 1Z1VA 2QB0B 2F8KA 4PZOA 3BS5A 1X9XA 1F0MA 2ESEA 1WWUA 2E8NA 2KG5A 5JTIA 1LKYA 2ES6A 3TADC 5KNIA 2Y9UA 2QARB 2DKXA 2LMRA 2EAMA 5JRTA 3HILA 5L1MA 2K4PA 3KKAA 2LPEA 1X40A 3SENA 4RQMA 1UQVA 3TACB 2QB0A 1KW4A 2F3NA 1SGGA 1PK1A 1V38A 2E8PA 1SV0A 5JU5A 4MHVA 1JI7A 2FE9A 1COKA 4RQNA 1WWVA 3K1RB 2DL0A 2E8OA 2E8MA 2F44A 1SV0C 2D8CA 2L5YA 2KSOA 1PK1B 4NJ8A 2EAOA 4NL9C 1OXJA 3KKAC 1SV4A 5J8YC 2GLEA 1B4FA 1SXEA 1X66A 2EANA 4PZNA 4NL9A 1RG6A 3BS5B 1DXSA 3TADA 2KE7A 2D3DA 3BS7A 1V85A 2KSOB 3BQ7A 1PK3A
chains in the Genus database with same CATH superfamily
2RDIA 5FP0A 1U47A 3HT3A 1WCNA 2Y9TA 1NZBA 5CWRA 3DDHA 2KKPA 1LKYB 4C8OA 3QEBZ 1XWLA 1N61A 4CE6A 4NY8A 1X9WA 4UAZA 1ZQBA 3RH4A 4NLZA 4M0AA 3TI0A 2AQ0A 5AM4A 4PZOA 3Q8RB 1X9XA 2R8JA 9ICAA 9ICXA 2ES6A 2LM4A 1JIHA 4Q8EA 1QTMA 1ZQKA 3B0XA 3SQIA 2A19A 2Q4TA 2QARB 4J9LA 4DFPA 2WFAA 4P0PB 1ZQ1C 5JRTA 2C2DA 3KKAA 1A76A 4DFDA 2BKEA 2PI4A 1SWVA 3RJHA 1SL1A 4ED6A 7ICMA 2EQYA 1Y88A 1N2XA 5AKXA 4DOCA 1Z19A 3FC4A 1X9MA 1TE2A 1PVRA 1JALA 2HBLA 4YD1A 4QIWC 4BXOB 3RTVA 1FFUA 1Q46A 5IIMA 2BPCA 1D8YA 4KMUA 1FIQA 3HPOA 3D2QA 1B22A 2HCFA 1JXEA 1T3NA 2Z7JA 4QZHA 1UA0A 4I2CA 1EXNA 2W3RA 4CNQA 3C2LA 9ICSA 1V85A 4C4RA 8ICEA 4IR9A 1S0VA 2B0CA 3JPPA 3QUCA 2KVSA 5AKYA 3C5FA 2WF5A 1XSPA 1A77A 3MGVA 2LBOA 1UHUA 5ALVA 8ICHA 4TQRA 5IIKA 2FMQA 2QARA 1ZQAA 4P0PA 4C4TA 1X9SA 2DKZA 1SWWA 4QZDA 1FO4A 5ALTA 4O5EA 1B0XA 5AK6A 4Z6DA 4M9LA 1MQ3A 4RPZA 4FZMA 3OSPA 4Z6EA 1U48A 2VKQA 5JTIA 4F4KA 5J2FA 1SKSA 5AKKA 5ALHA 1KBUA 1BNPA 4NV0A 4P4OA 2KNJA 1KDHA 2FLNA 1ZQGA 3ETLA 3NRWA 3PVXA 2ODGA 3KZIU 4IQTA 5KT4A 3AL0B 4DL2A 4Z6CA 2K4PA 1BPBA 2KV2A 2IMWP 2BPFA 2HBMA 3NS1A 1Z1BA 3LK9A 5KG0A 3TACB 2V4QA 1JRPA 4C4SA 1PK1A 4NLCA 2BHNA 2W9BA 4DL6A 8ICUA 3QXGA 2VJ4A 1S0NA 3WKDA 4O5CA 4M6WB 3HKZF 2ASJA 2ZUCA 2F1IA 4F71A 4RU9A 2DPJA 4XA5A 1CRXA 2MUTA 5AI0A 2JH1A 3NGDA 9ICBA 2EZZA 4TUQA 2CPRA 3RR7A 3BQTA 4NJ8A 2KSOA 4F50A 2WF9A 4J03A 3GFKB 4C7YA 4DL4A 4DSFA 2WF6A 7ICIA 5J0YA 4I29A 1DK2A 2XVTA 3NVYA 4UQGA 1GO3F 2HOQA 2PXIA 4EZ6A 2A3VA 2ZIXB 1SGGA 2UVWA 1TK0A 1JMSA 4RQ7A 3EW9A 3UQ0A 1RYRA 4YQWA 3RJFA 2JV3A 3ED5A 3PSIA 3WK4A 1RZTA 4DQQA 5EE0A 1UA1A 3SEIA 2I1QA 3QUTA 4B9TA 4I27A 5KFUA 4KN7A 4ED8A 2IBKA 5D46A 2E8NA 1L8OA 2JEJA 5KG4A 9ICMA 3ZDCA 2AJQA 2E3TA 2DKXA 3BDPA 4KLEA 2WF7A 4UB3A 4EENA 2MUTB 4NLBA 2HHWA 2OXOA 5GTIU 5KG6A 2KZ3A 4O3NA 4R8UA 4RQMA 4RNMA 5K4LA 5KFQA 2H3ZA 1QLNA 9ICWA 2KFZA 2Y1JA 3SV4A 1P7DA 2H3FA 2K89A 1T8EA 1QSLA 4RQ1A 3MC1A 5CB1A 3N7SC 3RJJA 2HOIA 2NO4A 2PI5A 5F9LA 3K1RB 3CYMA 2E5SA 8ICCA 3RRGA 1NK0A 4DEZA 3F2DA 1D9DA 1NK8A 3BQ1A 3UM9A 3PX6A 2FMSA 2B21A 5KFHA 3UMGA 2ZG6A 5L1LA 5DDYA 5ALYA 1ZQUA 1U45A 4B9LA 9ICHA 3RRHA 4F5QA 2ZIUA 4PZNA 1DRGA 8ICMA 2EH9A 1JXLA 3PSFA 3WKEA 4LJXA 2K4IA 3ZD8A 4F5RA 2ZIVB 5CR0A 2HHXA 4OD0A 5EE1A 1ZQOA 3BQ2A 4C8LA 8ICLA 1NJXA 4RQ6A 2BCUA 3UMCA 2XY5A 1RXWA 2G08A 2F1JA 1FFVA 4RNNA 2YMLA 1BPXA 2IA6A 4KLLA 8ICYA 3ETRA 2JZBB 4IQVA 4B9SA 2KG5A 2WB1F 4M6WA 5KNIA 1ZD3A 4F5PA 5KT5A 1ZQNA 2DFLA 4Y2SA 2K8CB 1U49A 2P66A 4CGZA 3PY8A 2AQ4A 2NRWA 3IHQB 2FLLA 5IIOA 1ED1A 2K8AA 7ICUA 4OO1J 2HHSA 3MR3A 4KLOA 2QB0A 3MBYA 5AIAA 1NK6A 4IRCA 4RQ4A 4PL2A 1L7OA 1RYSA 2KZZA 5KFVA 7ICFA 5IIIA 4P2HA 4QNLA 3VCBA 2KEYA 3PSTA 4DSLA 3PW2A 5F9NA 3M8SA 4P0QB 1KEJA 8ICSA 3Q8SB 1RYUA 3UXNA 3QUBA 1SV0C 4FE3A 5AKHA 1HEKA 2R8IA 1Z00A 3ISCA 3AQFA 4QZGA 4YD2A 4DQPA 1ZQZA 3MFIA 1WG8A 4GLXA 8ICZA 3WU2U 1FEZA 2ASDA 1NJZA 3PW4A 3J81j 2K8BB 3BZCA 3NVWA 1N48A 1RPLA 3IN5A 4KLJA 4F4XA 8ICNA 5DGAA 4TURA 3OSNA 2F76X 2R18A 4YMNA 4O3PA 1Q3VA 1IV8A 2I6XA 2FPMA 5J8YA 2F1HA 1PZNA 1HUZA 2QB0B 2LYAA 2G07A 2BQUA 3V6KA 5DBAA 1J97A 2ZXHA 5J2KA 2P6RA 3D2NA 7ICTA 1MC8A 3F2BA 3RH6A 2Y9UA 1DGSA 4FBTA 2JEGA 2KZMA 5AK3A 2E1FA 2WAQC 1TVAA 3KBBA 4P0QA 4DS5A 3K75D 3BQ0A 2KJ5A 3QYPA 1UQVA 2QLTA 5ALSA 5HR6A 2KP7A 5DG8A 1V38A 3GV7B 3SI8A 3QX7A 2PFPA 4DQSA 9ICIA 5D49A 1XO1A 5KFXA 3AUOA 1X2IA 2DUYA 1RQLA 3RAXA 2IOFA 3RB6A 5ALGA 2JGAA 3WKAA 3VC8A 5DQGA 5IILA 1L5UA 3OGUA 2XIDA 4RQ0A 1LB2B 5DBCA 3N28A 4KLHA 1B4FA 1SXEA 3SMVA 4GIBA 4RT3A 1Z3EB 4ED1A 3ICXA 3RAQA 5J0SA 3I28A 2W7PA 5AKIA 4K4IA 4I2IA 4DF8A 2FJ6A 4M04A 5CEHA 2LYBA 2JZBA 4RQ8A 2D3DA 3LVWA 5EOZA 3IV6A 4RPYA 5AIBA 1UCVA 4IS7A 5ALXA 4ECRA 2BR0A 4B9MA 3NUQA 4MEXA 3MFHA 7ICVA 3LVVA 1ZJNA 4KLIA 1PVQA 3ZDEA 4I2FA 4NWIA 4FS1A 2PFOA 5KFWA 4QWEA 4PGYA 1M6YA 5EWEA 5ALFA 2VIXA 2KN7A 4FFDA 1BGXT 4QZBA 1TK8A 2H3VA 2VANA 3MDAA 2HOFA 5ALDA 3JPOA 1ZQRA 2Y0SC 2W55A 1RQNA 5CHGA 3KZXA 2J6UA 3T79A 2UVRA 5HMLA 4QWDA 2DQNB 1WCLA 2XI9A 5HNKA 3UXOA 1NJWA 1SKWA 3IRUA 4R66A 5BOMA 5HMMA 1NI3A 2D8CA 1L3VA 5KFTA 3M6ZA 5DKWA 2LM1A 2ZJ5A 2W8KA 2UVVA 2GH1A 2F2AB 4ECZA 4KLGA 1UPHA 2W9AA 1Z4OA 5DGBA 2MRLA 2HDOA 3SAFA 2VA8A 3OTQA 2PMZF 2KE7A 1S10A 2ZIWB 4KLUA 4UB2A 4PHDA 3V6JA 3T5KA 3O0FA 1QQ7A 4PJ0U 1WUDA 9ICVA 1L6NA 4R63A 1ZRNA 3DV9A 7ICHA 1SXDA 3IDWA 2F77X 5DB6A 1S9FA 2QKQA 3RB0A 2C2EA 2F8LA 4Y2PA 2Y1IA 4FZLA 5ALZA 1ZQWA 4K4HA 4M9NA 1N56A 1D8BA 2ESEA 3PX4A 5H2FU 2RHFA 1RXVA 1VDVA 2NRTA 1A0PA 2ZUDA 4YP3A 1D9FA 4ECWA 5TISU 4ED7A 4KLDA 4QZIA 5A0LA 1C20A 3RBDA 5DLGA 5L1MA 4HYKA 2XICA 2W03A 3EPIA 2ZTCA 4C7ZA 1QSSA 4EX7A 3Q8LA 3QU9A 3FAHA 1NKBA 1KKXA 4RPXA 2C28A 2OH2A 4EBEA 5AKLA 4ZH4A 2K4EA 3MGHA 1LV5A 4EELA 2NRVA 3H7IA 4YVZA 2F44A 4DLEA 5AM5A 1MSWD 1ZOLA 1MA7A 4EEKA 1ZQDA 2MAXA 3PZPA 3C5GA 9ICKA 5HHHA 1X66A 2LKYA 4MFAA 4DOAA 2EANA 4XQ8A 9ICCA 9ICEA 1YZ7A 5ALPA 9ICOA 4PGQA 5KG1A 4GFJA 2JHDA 4G3IA 1UT5A 3N4MB 3TKAA 2W54A 4DF4A 5J2HA 3AU6A 4YN4A 1A6SA 3JPQA 2IHNA 4A8EA 4IR1A 1KQQA 3GZFA 4DFJA 3I1YA 3F2CA 1TV9A 2DPIA 1PUZA 4JV0A 2A1JA 4RQ5A 3EYZA 4I2GA 2HBKA 3MDCA 1N5WA 4BJQA 4ECQA 3QU7A 3TFSA 1TAUA 4OCZA 3A0HU 8ICAA 3JPSA 1WWUA 4DL3A 4KLFA 2CXYA 4JV1A 2C2RA 4DLGA 4DQRA 2W04A 3H4DA 1SB3C 4USAA 4US9A 5J0TA 4J9NA 1O08A 3WK6A 5KAIU 1IM4A 4B6JA 4I2DA 2RLTA 1D8LA 3B0YA 2ZXIA 2LYHA 3D6JA 2RP5A 1BVSA 3KHRA 4JWMA 2F3NA 3AU2A 4QW9A 4Z6FA 3GIJA 4K4GA 4IL6U 5DQHA 5J0WA 5AI4A 4Y2JA 2FE9A 5L1KA 4B9UA 3C2MA 2R8HA 2BCVA 3K4GA 7ICQA 4C80A 4UB5A 5J0OA 7ICJA 1N63A 3AN1A 2L5YA 3LDAA 1S0OA 1ZQCA 3M8RA 3UQ2A 4NL9C 1UT8A 5J2AA 3RH5A 4OJOA 5J8YC 2AGPA 4PH5A 1TKDA 4UASA 4R8UB 3V7JA 1QQ6A 2XGQA 4FS2A 1XSLA 1BPEA 4YR2A 2GWSA 1K5OA 3K1ZA 4P4MA 2OYYA 3QZ8A 8ICGA 4BWMA 4KTQA 1PK3A 4NM1A 3HX0A 4F92B 1X42A 1JUDA 2NV3A 3D2SA 2W9CA 4RZRA 5KG5A 5C0YA 5ALNA 1ZD2P 4UBCA 4Q44A 2E1EA 5AK4A 3H8MA 1V97A 5KAFU 1J2NA 1AQ6A 4Q43A 9ICQA 1Z1VA 1ZQQA 4FO6A 1IG6A 3IP4B 3PW0A 2IHMA 4AP9A 2ZIUB 5J2BA 5KFSA 2ZIXA 3Q8QB 2KHQA 3TAQA 3AM9A 5ALMA 3IM1A 1X6JA 3GDXA 3MR6A 5TZVA 1QCKA 4QWCA 4R64A 3H8WA 2W9MA 1SL2A 3FM9A 3OHBA 5DB8A 1SL0A 1ZQFA 4YXMA 1Q8KA 4UATA 4DOBA 2EZYA 1TAMA 5KFRA 1XNSA 4QW8A 1S5LU 3PW7A 1YT3A 2AGOA 5KFBA 5KT3A 3H40A 3H0RB 4BGDA 5KFNA 2E8MA 3ONNA 3T5LA 7ICNA 5AI5A 1PK1B 5KG7A 1OXJA 1X6IA 1NNLA 9ICGA 7ICKA 1MN8A 5KT6A 1ZQVA 3SYZA 3MGIA 3PMNA 1N5XA 2NRXA 5EWFA 1S77D 3S6JA 5KFOA 3QZ7A 4I2EA 3BS5B 4RNOA 4Q45A 9ICNA 5AI9A 2BZFA 3LYSA 2KKVA 1XC9A 4F3OA 4J9KA 5GTHU 4G9BA 2NO5A 2KSOB 4YR3A 3GILA 3C28A 1U4BA 1ZXIA 4TQSA 4Q8FA 5DDMA 4GXIA 3TARA 1ZYQA 5EWGA 2IOHA 1XS9D 2FMPA 1ZRMA 4FBUA 3QU2A 3SZ2A 3RF9A 1K1QA 3QU4A 5DG7A 2KFNA 4OJ5A 3ISBA 4F2SA 4F5OA 3TADC 3SAHA 1IIPA 3C1ZA 3GIMA 7ICRA 4NXZA 4M2YA 2FLPA 2A1AA 4O9MA 2YY6A 3SV3A 2ATLA 3HILA 2XGPA 2XCPA 3HRDD 4X5VA 1X40A 2BQRA 2W9CB 4NLKA 2W3SA 3ALRA 2BQ3A 1SKRA 4RUCA 5AKZA 4MFCA 4EEYA 8ICJA 2KK0A 2ALZA 2DGZA 2W7OA 2OM6A 2YMPA 4I2BA 4TUPA 2YN4A 2YB4A 4BX9C 3WK7A 5ALQA 5J2GA 2KVCA 3M9OB 1T7PA 5AK5A 1WWVA 1BPYA 4OJLA 2E8OA 2PFNA 3N7PD 7ICLA 2A1JB 1NZPA 3RJEA 4O3OA 4R65A 1SV4A 2CRXA 3NVVA 5AHXA 1NKCA 4I2HA 5J0RA 3BZKA 4PHAA 5AKGA 3M9NB 4Y2XA 5EE9A 3HWTA 4JV2A 2VA2A 4UB4A 5KT2A 4QWBA 1U9LA 2EDUA 3EPGA 1KN5A 3BS7A 4LZGA 1HUOA 3KOOA 3G6YA 1S8OA 3SD7A 2MU2A 2XC9A 2HW3A 2ISPA 2RRDA 2FDRA 1Z00B 4QZ8A 2YMMA 2FI1A 4PL1A 5JUMA 1WYGA 3JPTA 4QWAA 2AHOB 2HSZA 5AKJA 3GV8B 1KL9A 4M9HA 5ALLA 2CN1A 5DQIA 3PSPA 1L7MA 2ZJAA 2DBYA 4O3SA 1H38A 2G0AA 2LMRA 3PV8A 3WK9A 4BUGA 3BJYA 4Y2YA 5KFCA 4ELUA 4EYIB 4I2JA 5HHIA 3SAGA 3G6VA 5KFLA 4NM2A 1NK7A 4OJPA 9ICRA 1OUQA 1Z4NA 5J0QA 3C23A 1F5SA 2Y0SF 4UBBA 3TANA 1XSNA 5JU5A 4TUSA 3ISDA 3ZD9A 5AI8A 1COKA 4DSKA 2W11A 4UB8U 3PR4A 5AM2A 3QEAZ 4U6PA 1LVHA 4NLNA 4QIWF 3H8SA 4ECSA 4DSIA 4GC7A 1L8LA 3G6XA 3HJEA 4YMOA 2WB1C 3UMBA 5ALOA 2BGWA 1NJYA 1C7YA 1NOMA 2UVUA 4DL7A 2BCSA 2WF8A 5CRXA 3L5KA 3RR8A 5AM0A 5KTQA 1OW5A 1CUKA 1DOQA 1KFSA 2WHEA 2ZUBA 2KIVA 5J29A 2YTUA 4PHEA 2P6UA 2XY6A 4KLTA 1JROA 4IRDA 5G5HA 1URJA 2BDPA 4GC6A 3E0FA 1BPDA 5DB7A 3MR2A 2MA1A 1LKYA 2YX8A 2NYVA 5J0UA 4ED0A 4QZCA 4AYBC 3LWLA 1YZ6A 9ICJA 5J2IA 9ICPA 3WKBA 3U26A 4C0ZA 1NK9A 2PKEA 2XCAA 3JPRA 4MF2A 3WKCA 2G5IB 5ALIA 3M6KA 3V7LA 4ELVA 3RJKA 5IINA 3MABA 4KX3A 4FZNA 8ICXA 2RQ5A 3QE9Y 2OCEA 1DK3A 4EX6A 5KFDA 1V9PA 4O3QA 2HI0A 5KFJA 1ZQLA 4CCHA 3QU5A 2PFQA 3H0MB 5J2CA 2HVIA 3OPXA 2N1RA 4DS4A 5KG2A 2EAOA 2JH7A 4Y2VA 5ALJA 2KIWA 3H0LB 1ZJMA 3HP6A 3ZDBA 4O5KA 1PVPA 2HHUA 3ORYA 2HHTA 4CDGA 3GQCA 1ZQSA 3WK8A 1JN3A 3PO4A 4OJ6A 4PGXA 3MR5A 2ZTDA 4YFKA 1DXSA 1F44A 5KT7A 3RB3A 3M7DA 2JXJA 3HW8A 1ZQTA 2WAQF 2JEFA 1ZQXA 3NRZA 1KRPA 4UARA 4EBDA 5ALUA 2JMGA 2KMDA 4IQUA 3UXPA 2G06A 4F91B 3LWMA 4F72A 3NVZA 8ICFA 5L1IA 3E2EA 4F4WA 4ACOA 3V7KA 4YR0A 4KN4A 1F0MA 2RDJA 2C22A 1HJPA 5KFFA 4F93B 1TFRA 4UAWA 4GXKA 2VA3A 3TQ1A 1AROP 2XO7A 4QJFB 2BPGA 5J0XA 1JX4A 4KLMA 2IOFK 8ICIA 4IC9A 4NLGA 3WK5A 2V9WA 2AGQA 1B43A 2R8GA 1KW4A 3C2KA 2HHVA 5DG9A 7ICEA 2H3IA 4ECTA 3JPNA 2W8LA 2G5HB 3Q8PB 8ICBA 1JI7A 3GV5B 4O3MA 4RQNA 5T14A 5J2DA 3RBEA 4IQWA 4DFKA 4EYHB 8ICRA 4QZFA 4E0DA 4DSEA 4CF4A 5EE3A 2KICA 3KKAC 2W9BB 2ASLA 4U7CA 5AKEA 1T3QA 2P35A 4ELTA 2M0NA 1COOA 4NL9A 5L9XA 5HP4A 1ZQMA 3RB4A 8ICWA 3TADA 3FDSA 1SZPA 4M9JA 2NRZA 2KHVA 5KFKA 3AMZA 3BQ7A 3CRXA 1VLBA 5G5GA 5AI6A 4XRHA 1ZQIA 2B6GA 3E58A 3C21A 2JR5A 4YCXA 3H8JA 3CP8A 4MFFA 4O3RA 2JRZA 4RQ2A 2OWOA 2XY7A 5DLFA 4CRXA 4IRKA 2PMZC 5B5EU 4Y2QA 2GO7A 3AQEA 4QZAA 3L4PA 4DL5A 4B9VA 4DQIA 3I76A 4PPXA 2ZIVA 2GOLA 4ICAA 1ZQJA 4YXJA 4GXJA 4LZDA 4DCCA 2AH5A 1ZQPA 5KFMA 4UAYA 4ED3A 3NTUA 4DFMA 1QSYA 2K4HA 4BWJA 3GIIA 2EAMA 1ZQHA 2LPEA 1QQ5A 3SENA 2JEIA 1S0MA 2O6KA 4MF8A 4KMOB 2H3QA 3PX0A 2BCQA 4UB1A 3M9MB 1ECWA 2EZXA 4RUAA 5CA7A 2V4RA 4JK1A 5B66U 3OHAA 4F2RA 1ZQEA 5J2JA 2KJ9A 4I28A 1RDFA 5E79U 4MEYA 8ICKA 3KTQA 1ZETA 5C5JA 3DEEA 3PO5A 5KFIA 4QZ9A 2YMQA 5CP2A 4KLQA 4WJ3B 1N62A 1RG6A 4RT2A 9ICTA 5KFPA 2FPKA 3THVA 1KLNA 4ED2A 1L3SA 4QZEA 5KL1B 5ALWA 1SZHA 3F53A 3PW5A 3CW2C 2LI6A 1KTQA 2WTFA 1L7NA 2QB1A 3V72A 3RFAA 2ZIWA 5F3XB 3C1YA 2W43A 2DWQA 7ICPA 2EAPA 4JMUA 1N60A 2AU0A 3C29A 2BCRA 5AICA 5BOLA 3Q8KA 4KLSA 4KX5A 5J2EA 2MSNA 3AEVA 4Y2TA 3KFUF 4M47A 2FPLA 3Q8MA 4J9QA 3RJGA 3IG8A 1KFDA 1L7PA 3KHHA 4J9OA 4Y2RA 1NK4A 3KHLA 1BNOA 4LVSA 5L1JA 5AM1A 2OHFA 2HHQA 2D6FC 3GU3A 4UAUA 1CEZA 4EZ9A 2ZTEA 2KD1A 4ECXA 5KFEA 2E8PA 4UW9A 2G09A 2Q0ZX 2YB1A 4RQ3A 3EZ5A 3ZI4A 3H4BA 1Q3UA 1SV0A 4DSJA 4MHVA 4I2AA 4J9PA 1T94A 3V6HA 2J6TA 3L3FX 5ALKA 3M1YA 4C8NA 4B9NA 3A0BU 1L3TA 5ALRA 1L3UA 2I5HA 1S97A 3T5HA 1KSPA 2GLEA 2BDUA 4UB6U 4C8KA 5KL8B 4UAVA 1J2MA 1DGJA 2M9NA 3QNMA 2J6SA 3CNHA 5KFGA 3PMLA 5ALEA 2KOBA 3IG5A 2YQEA 4M9GA 4ECVA 1ZD4A 3NASA 3QUQA 3GIKA 4J9SA 2K60A 9ICFA 7ICGA 2LHTA 1TAQA 2ISOA 4J9MA 4JB3A 5KFZA 3EWAA 1NK5A 7ICSA 4JUZA 3OJUA 3EUB2 4KITB 4ECYA 5DBBA 2AXTU 2HMXA 2R8KA 2F8KA 1TK5A 3BS5A 5BPCA 2I9GA 4PHPA 3PNCA 5DB9A 4JWNA 8ICPA 4EBCA 3ZDAA 1O03A 9ICLA 4P4PA 4XUSA 3N7RC 1CI4A 8ICVA 3T3FA 2VJ5A 4ECUA 3RJIA 2KTQA 4J9RA 3PR5B 9ICUA 4US8A 5CJ7A 1S76D 4Y2UA 1ZQYA 4F8RA 4CF3A 2KJ8A 8ICQA 3R9KA 8ICOA 4ZOHC 3KD3A 4DO9A 2ZJ8A 5D4BA 4BDPA 5KFYA 1ZD5A 4C8MA 8ICTA 3ZDDA 3F5AA 5KG3A 4F4YA 1MQ2A 1KFTA 3F5EA 1BPZA 1K1SA 7ICOA 2HVHA 2DL0A 1T4GA 4CF5A 1NKEA 4AYBF 5J0PA 4YMMA 5KFAA 3TFRA 5IIJA 1IXRA 3KHGA 3SR6A 2HBJA 1HIWA 3B9JA 3OJSA 4F4ZA 3FYHA 5HR7A 3N97B 1VJ5A 4HAIA 5AM3A 2H5XA 3UPQA 1SIJA 3TAPA 2DF4B 4F5NA 4BXOA 4YG2A 3T5JA 1XU4A 4O0IA 3HKZC 1QH9A 1RM6C 4DWIA 1XO0A 2OEHA
chains in the Genus database with same CATH topology
1UCVA 4IS7A 1OW5A 2Y9TA 2B6GA 2K60A 2JV3A 1LKYB 2KIVA 1SXDA 3IDWA 2YTUA 2KMDA 2QB1A 5F3XB 2QARA 3H8MA 2DKZA 3SEIA 2QKQA 2EAPA 5J8YA 1B0XA 1Z1VA 2QB0B 2F8KA 4PZOA 3BS5A 1X9XA 1F0MA 2ESEA 1WWUA 2E8NA 2KG5A 5JTIA 1LKYA 2ES6A 3TADC 5KNIA 2Y9UA 2QARB 2DKXA 2LMRA 2EAMA 5JRTA 3HILA 5L1MA 2K4PA 3KKAA 2LPEA 1X40A 3SENA 4RQMA 1UQVA 3TACB 2QB0A 1KW4A 2F3NA 1SGGA 1PK1A 1V38A 2E8PA 1SV0A 5JU5A 4MHVA 1JI7A 2FE9A 1COKA 4RQNA 1WWVA 3K1RB 2DL0A 2E8OA 2E8MA 2F44A 1SV0C 2D8CA 2L5YA 2KSOA 1PK1B 4NJ8A 2EAOA 4NL9C 1OXJA 3KKAC 1SV4A 5J8YC 2GLEA 1B4FA 1SXEA 1X66A 2EANA 4PZNA 4NL9A 1RG6A 3BS5B 1DXSA 3TADA 2KE7A 2D3DA 3BS7A 1V85A 2KSOB 3BQ7A 1PK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCV A;  4IS7 A;  1OW5 A;  2Y9T A;  2B6G A;  2K60 A;  2JV3 A;  1LKY B;  2KIV A;  1SXD A;  3IDW A;  2YTU A;  2KMD A;  2QB1 A;  5F3X B;  2QAR A;  3H8M A;  2DKZ A;  3SEI A;  2QKQ A;  2EAP A;  5J8Y A;  1B0X A;  1Z1V A;  2QB0 B;  2F8K A;  4PZO A;  3BS5 A;  1X9X A;  1F0M A;  2ESE A;  1WWU A;  2E8N A;  2KG5 A;  5JTI A;  1LKY A;  2ES6 A;  3TAD C;  5KNI A;  2Y9U A;  2QAR B;  2DKX A;  2LMR A;  2EAM A;  5JRT A;  3HIL A;  5L1M A;  2K4P A;  3KKA A;  2LPE A;  1X40 A;  3SEN A;  4RQM A;  1UQV A;  3TAC B;  2QB0 A;  1KW4 A;  2F3N A;  1SGG A;  1PK1 A;  1V38 A;  2E8P A;  1SV0 A;  5JU5 A;  4MHV A;  1JI7 A;  2FE9 A;  1COK A;  4RQN A;  1WWV A;  3K1R B;  2DL0 A;  2E8O A;  2E8M A;  2F44 A;  1SV0 C;  2D8C A;  2L5Y A;  2KSO A;  1PK1 B;  4NJ8 A;  2EAO A;  4NL9 C;  1OXJ A;  3KKA C;  1SV4 A;  5J8Y C;  2GLE A;  1B4F A;  1SXE A;  1X66 A;  2EAN A;  4PZN A;  4NL9 A;  1RG6 A;  3BS5 B;  1DXS A;  3TAD A;  2KE7 A;  2D3D A;  3BS7 A;  1V85 A;  2KSO B;  3BQ7 A;  1PK3 A; 
#chains in the Genus database with same CATH topology
 2RDI A;  5FP0 A;  1U47 A;  3HT3 A;  1WCN A;  2Y9T A;  1NZB A;  5CWR A;  3DDH A;  2KKP A;  1LKY B;  4C8O A;  3QEB Z;  1XWL A;  1N61 A;  4CE6 A;  4NY8 A;  1X9W A;  4UAZ A;  1ZQB A;  3RH4 A;  4NLZ A;  4M0A A;  3TI0 A;  2AQ0 A;  5AM4 A;  4PZO A;  3Q8R B;  1X9X A;  2R8J A;  9ICA A;  9ICX A;  2ES6 A;  2LM4 A;  1JIH A;  4Q8E A;  1QTM A;  1ZQK A;  3B0X A;  3SQI A;  2A19 A;  2Q4T A;  2QAR B;  4J9L A;  4DFP A;  2WFA A;  4P0P B;  1ZQ1 C;  5JRT A;  2C2D A;  3KKA A;  1A76 A;  4DFD A;  2BKE A;  2PI4 A;  1SWV A;  3RJH A;  1SL1 A;  4ED6 A;  7ICM A;  2EQY A;  1Y88 A;  1N2X A;  5AKX A;  4DOC A;  1Z19 A;  3FC4 A;  1X9M A;  1TE2 A;  1PVR A;  1JAL A;  2HBL A;  4YD1 A;  4QIW C;  4BXO B;  3RTV A;  1FFU A;  1Q46 A;  5IIM A;  2BPC A;  1D8Y A;  4KMU A;  1FIQ A;  3HPO A;  3D2Q A;  1B22 A;  2HCF A;  1JXE A;  1T3N A;  2Z7J A;  4QZH A;  1UA0 A;  4I2C A;  1EXN A;  2W3R A;  4CNQ A;  3C2L A;  9ICS A;  1V85 A;  4C4R A;  8ICE A;  4IR9 A;  1S0V A;  2B0C A;  3JPP A;  3QUC A;  2KVS A;  5AKY A;  3C5F A;  2WF5 A;  1XSP A;  1A77 A;  3MGV A;  2LBO A;  1UHU A;  5ALV A;  8ICH A;  4TQR A;  5IIK A;  2FMQ A;  2QAR A;  1ZQA A;  4P0P A;  4C4T A;  1X9S A;  2DKZ A;  1SWW A;  4QZD A;  1FO4 A;  5ALT A;  4O5E A;  1B0X A;  5AK6 A;  4Z6D A;  4M9L A;  1MQ3 A;  4RPZ A;  4FZM A;  3OSP A;  4Z6E A;  1U48 A;  2VKQ A;  5JTI A;  4F4K A;  5J2F A;  1SKS A;  5AKK A;  5ALH A;  1KBU A;  1BNP A;  4NV0 A;  4P4O A;  2KNJ A;  1KDH A;  2FLN A;  1ZQG A;  3ETL A;  3NRW A;  3PVX A;  2ODG A;  3KZI U;  4IQT A;  5KT4 A;  3AL0 B;  4DL2 A;  4Z6C A;  2K4P A;  1BPB A;  2KV2 A;  2IMW P;  2BPF A;  2HBM A;  3NS1 A;  1Z1B A;  3LK9 A;  5KG0 A;  3TAC B;  2V4Q A;  1JRP A;  4C4S A;  1PK1 A;  4NLC A;  2BHN A;  2W9B A;  4DL6 A;  8ICU A;  3QXG A;  2VJ4 A;  1S0N A;  3WKD A;  4O5C A;  4M6W B;  3HKZ F;  2ASJ A;  2ZUC A;  2F1I A;  4F71 A;  4RU9 A;  2DPJ A;  4XA5 A;  1CRX A;  2MUT A;  5AI0 A;  2JH1 A;  3NGD A;  9ICB A;  2EZZ A;  4TUQ A;  2CPR A;  3RR7 A;  3BQT A;  4NJ8 A;  2KSO A;  4F50 A;  2WF9 A;  4J03 A;  3GFK B;  4C7Y A;  4DL4 A;  4DSF A;  2WF6 A;  7ICI A;  5J0Y A;  4I29 A;  1DK2 A;  2XVT A;  3NVY A;  4UQG A;  1GO3 F;  2HOQ A;  2PXI A;  4EZ6 A;  2A3V A;  2ZIX B;  1SGG A;  2UVW A;  1TK0 A;  1JMS A;  4RQ7 A;  3EW9 A;  3UQ0 A;  1RYR A;  4YQW A;  3RJF A;  2JV3 A;  3ED5 A;  3PSI A;  3WK4 A;  1RZT A;  4DQQ A;  5EE0 A;  1UA1 A;  3SEI A;  2I1Q A;  3QUT A;  4B9T A;  4I27 A;  5KFU A;  4KN7 A;  4ED8 A;  2IBK A;  5D46 A;  2E8N A;  1L8O A;  2JEJ A;  5KG4 A;  9ICM A;  3ZDC A;  2AJQ A;  2E3T A;  2DKX A;  3BDP A;  4KLE A;  2WF7 A;  4UB3 A;  4EEN A;  2MUT B;  4NLB A;  2HHW A;  2OXO A;  5GTI U;  5KG6 A;  2KZ3 A;  4O3N A;  4R8U A;  4RQM A;  4RNM A;  5K4L A;  5KFQ A;  2H3Z A;  1QLN A;  9ICW A;  2KFZ A;  2Y1J A;  3SV4 A;  1P7D A;  2H3F A;  2K89 A;  1T8E A;  1QSL A;  4RQ1 A;  3MC1 A;  5CB1 A;  3N7S C;  3RJJ A;  2HOI A;  2NO4 A;  2PI5 A;  5F9L A;  3K1R B;  3CYM A;  2E5S A;  8ICC A;  3RRG A;  1NK0 A;  4DEZ A;  3F2D A;  1D9D A;  1NK8 A;  3BQ1 A;  3UM9 A;  3PX6 A;  2FMS A;  2B21 A;  5KFH A;  3UMG A;  2ZG6 A;  5L1L A;  5DDY A;  5ALY A;  1ZQU A;  1U45 A;  4B9L A;  9ICH A;  3RRH A;  4F5Q A;  2ZIU A;  4PZN A;  1DRG A;  8ICM A;  2EH9 A;  1JXL A;  3PSF A;  3WKE A;  4LJX A;  2K4I A;  3ZD8 A;  4F5R A;  2ZIV B;  5CR0 A;  2HHX A;  4OD0 A;  5EE1 A;  1ZQO A;  3BQ2 A;  4C8L A;  8ICL A;  1NJX A;  4RQ6 A;  2BCU A;  3UMC A;  2XY5 A;  1RXW A;  2G08 A;  2F1J A;  1FFV A;  4RNN A;  2YML A;  1BPX A;  2IA6 A;  4KLL A;  8ICY A;  3ETR A;  2JZB B;  4IQV A;  4B9S A;  2KG5 A;  2WB1 F;  4M6W A;  5KNI A;  1ZD3 A;  4F5P A;  5KT5 A;  1ZQN A;  2DFL A;  4Y2S A;  2K8C B;  1U49 A;  2P66 A;  4CGZ A;  3PY8 A;  2AQ4 A;  2NRW A;  3IHQ B;  2FLL A;  5IIO A;  1ED1 A;  2K8A A;  7ICU A;  4OO1 J;  2HHS A;  3MR3 A;  4KLO A;  2QB0 A;  3MBY A;  5AIA A;  1NK6 A;  4IRC A;  4RQ4 A;  4PL2 A;  1L7O A;  1RYS A;  2KZZ A;  5KFV A;  7ICF A;  5III A;  4P2H A;  4QNL A;  3VCB A;  2KEY A;  3PST A;  4DSL A;  3PW2 A;  5F9N A;  3M8S A;  4P0Q B;  1KEJ A;  8ICS A;  3Q8S B;  1RYU A;  3UXN A;  3QUB A;  1SV0 C;  4FE3 A;  5AKH A;  1HEK A;  2R8I A;  1Z00 A;  3ISC A;  3AQF A;  4QZG A;  4YD2 A;  4DQP A;  1ZQZ A;  3MFI A;  1WG8 A;  4GLX A;  8ICZ A;  3WU2 U;  1FEZ A;  2ASD A;  1NJZ A;  3PW4 A;  3J81 j;  2K8B B;  3BZC A;  3NVW A;  1N48 A;  1RPL A;  3IN5 A;  4KLJ A;  4F4X A;  8ICN A;  5DGA A;  4TUR A;  3OSN A;  2F76 X;  2R18 A;  4YMN A;  4O3P A;  1Q3V A;  1IV8 A;  2I6X A;  2FPM A;  5J8Y A;  2F1H A;  1PZN A;  1HUZ A;  2QB0 B;  2LYA A;  2G07 A;  2BQU A;  3V6K A;  5DBA A;  1J97 A;  2ZXH A;  5J2K A;  2P6R A;  3D2N A;  7ICT A;  1MC8 A;  3F2B A;  3RH6 A;  2Y9U A;  1DGS A;  4FBT A;  2JEG A;  2KZM A;  5AK3 A;  2E1F A;  2WAQ C;  1TVA A;  3KBB A;  4P0Q A;  4DS5 A;  3K75 D;  3BQ0 A;  2KJ5 A;  3QYP A;  1UQV A;  2QLT A;  5ALS A;  5HR6 A;  2KP7 A;  5DG8 A;  1V38 A;  3GV7 B;  3SI8 A;  3QX7 A;  2PFP A;  4DQS A;  9ICI A;  5D49 A;  1XO1 A;  5KFX A;  3AUO A;  1X2I A;  2DUY A;  1RQL A;  3RAX A;  2IOF A;  3RB6 A;  5ALG A;  2JGA A;  3WKA A;  3VC8 A;  5DQG A;  5IIL A;  1L5U A;  3OGU A;  2XID A;  4RQ0 A;  1LB2 B;  5DBC A;  3N28 A;  4KLH A;  1B4F A;  1SXE A;  3SMV A;  4GIB A;  4RT3 A;  1Z3E B;  4ED1 A;  3ICX A;  3RAQ A;  5J0S A;  3I28 A;  2W7P A;  5AKI A;  4K4I A;  4I2I A;  4DF8 A;  2FJ6 A;  4M04 A;  5CEH A;  2LYB A;  2JZB A;  4RQ8 A;  2D3D A;  3LVW A;  5EOZ A;  3IV6 A;  4RPY A;  5AIB A;  1UCV A;  4IS7 A;  5ALX A;  4ECR A;  2BR0 A;  4B9M A;  3NUQ A;  4MEX A;  3MFH A;  7ICV A;  3LVV A;  1ZJN A;  4KLI A;  1PVQ A;  3ZDE A;  4I2F A;  4NWI A;  4FS1 A;  2PFO A;  5KFW A;  4QWE A;  4PGY A;  1M6Y A;  5EWE A;  5ALF A;  2VIX A;  2KN7 A;  4FFD A;  1BGX T;  4QZB A;  1TK8 A;  2H3V A;  2VAN A;  3MDA A;  2HOF A;  5ALD A;  3JPO A;  1ZQR A;  2Y0S C;  2W55 A;  1RQN A;  5CHG A;  3KZX A;  2J6U A;  3T79 A;  2UVR A;  5HML A;  4QWD A;  2DQN B;  1WCL A;  2XI9 A;  5HNK A;  3UXO A;  1NJW A;  1SKW A;  3IRU A;  4R66 A;  5BOM A;  5HMM A;  1NI3 A;  2D8C A;  1L3V A;  5KFT A;  3M6Z A;  5DKW A;  2LM1 A;  2ZJ5 A;  2W8K A;  2UVV A;  2GH1 A;  2F2A B;  4ECZ A;  4KLG A;  1UPH A;  2W9A A;  1Z4O A;  5DGB A;  2MRL A;  2HDO A;  3SAF A;  2VA8 A;  3OTQ A;  2PMZ F;  2KE7 A;  1S10 A;  2ZIW B;  4KLU A;  4UB2 A;  4PHD A;  3V6J A;  3T5K A;  3O0F A;  1QQ7 A;  4PJ0 U;  1WUD A;  9ICV A;  1L6N A;  4R63 A;  1ZRN A;  3DV9 A;  7ICH A;  1SXD A;  3IDW A;  2F77 X;  5DB6 A;  1S9F A;  2QKQ A;  3RB0 A;  2C2E A;  2F8L A;  4Y2P A;  2Y1I A;  4FZL A;  5ALZ A;  1ZQW A;  4K4H A;  4M9N A;  1N56 A;  1D8B A;  2ESE A;  3PX4 A;  5H2F U;  2RHF A;  1RXV A;  1VDV A;  2NRT A;  1A0P A;  2ZUD A;  4YP3 A;  1D9F A;  4ECW A;  5TIS U;  4ED7 A;  4KLD A;  4QZI A;  5A0L A;  1C20 A;  3RBD A;  5DLG A;  5L1M A;  4HYK A;  2XIC A;  2W03 A;  3EPI A;  2ZTC A;  4C7Z A;  1QSS A;  4EX7 A;  3Q8L A;  3QU9 A;  3FAH A;  1NKB A;  1KKX A;  4RPX A;  2C28 A;  2OH2 A;  4EBE A;  5AKL A;  4ZH4 A;  2K4E A;  3MGH A;  1LV5 A;  4EEL A;  2NRV A;  3H7I A;  4YVZ A;  2F44 A;  4DLE A;  5AM5 A;  1MSW D;  1ZOL A;  1MA7 A;  4EEK A;  1ZQD A;  2MAX A;  3PZP A;  3C5G A;  9ICK A;  5HHH A;  1X66 A;  2LKY A;  4MFA A;  4DOA A;  2EAN A;  4XQ8 A;  9ICC A;  9ICE A;  1YZ7 A;  5ALP A;  9ICO A;  4PGQ A;  5KG1 A;  4GFJ A;  2JHD A;  4G3I A;  1UT5 A;  3N4M B;  3TKA A;  2W54 A;  4DF4 A;  5J2H A;  3AU6 A;  4YN4 A;  1A6S A;  3JPQ A;  2IHN A;  4A8E A;  4IR1 A;  1KQQ A;  3GZF A;  4DFJ A;  3I1Y A;  3F2C A;  1TV9 A;  2DPI A;  1PUZ A;  4JV0 A;  2A1J A;  4RQ5 A;  3EYZ A;  4I2G A;  2HBK A;  3MDC A;  1N5W A;  4BJQ A;  4ECQ A;  3QU7 A;  3TFS A;  1TAU A;  4OCZ A;  3A0H U;  8ICA A;  3JPS A;  1WWU A;  4DL3 A;  4KLF A;  2CXY A;  4JV1 A;  2C2R A;  4DLG A;  4DQR A;  2W04 A;  3H4D A;  1SB3 C;  4USA A;  4US9 A;  5J0T A;  4J9N A;  1O08 A;  3WK6 A;  5KAI U;  1IM4 A;  4B6J A;  4I2D A;  2RLT A;  1D8L A;  3B0Y A;  2ZXI A;  2LYH A;  3D6J A;  2RP5 A;  1BVS A;  3KHR A;  4JWM A;  2F3N A;  3AU2 A;  4QW9 A;  4Z6F A;  3GIJ A;  4K4G A;  4IL6 U;  5DQH A;  5J0W A;  5AI4 A;  4Y2J A;  2FE9 A;  5L1K A;  4B9U A;  3C2M A;  2R8H A;  2BCV A;  3K4G A;  7ICQ A;  4C80 A;  4UB5 A;  5J0O A;  7ICJ A;  1N63 A;  3AN1 A;  2L5Y A;  3LDA A;  1S0O A;  1ZQC A;  3M8R A;  3UQ2 A;  4NL9 C;  1UT8 A;  5J2A A;  3RH5 A;  4OJO A;  5J8Y C;  2AGP A;  4PH5 A;  1TKD A;  4UAS A;  4R8U B;  3V7J A;  1QQ6 A;  2XGQ A;  4FS2 A;  1XSL A;  1BPE A;  4YR2 A;  2GWS A;  1K5O A;  3K1Z A;  4P4M A;  2OYY A;  3QZ8 A;  8ICG A;  4BWM A;  4KTQ A;  1PK3 A;  4NM1 A;  3HX0 A;  4F92 B;  1X42 A;  1JUD A;  2NV3 A;  3D2S A;  2W9C A;  4RZR A;  5KG5 A;  5C0Y A;  5ALN A;  1ZD2 P;  4UBC A;  4Q44 A;  2E1E A;  5AK4 A;  3H8M A;  1V97 A;  5KAF U;  1J2N A;  1AQ6 A;  4Q43 A;  9ICQ A;  1Z1V A;  1ZQQ A;  4FO6 A;  1IG6 A;  3IP4 B;  3PW0 A;  2IHM A;  4AP9 A;  2ZIU B;  5J2B A;  5KFS A;  2ZIX A;  3Q8Q B;  2KHQ A;  3TAQ A;  3AM9 A;  5ALM A;  3IM1 A;  1X6J A;  3GDX A;  3MR6 A;  5TZV A;  1QCK A;  4QWC A;  4R64 A;  3H8W A;  2W9M A;  1SL2 A;  3FM9 A;  3OHB A;  5DB8 A;  1SL0 A;  1ZQF A;  4YXM A;  1Q8K A;  4UAT A;  4DOB A;  2EZY A;  1TAM A;  5KFR A;  1XNS A;  4QW8 A;  1S5L U;  3PW7 A;  1YT3 A;  2AGO A;  5KFB A;  5KT3 A;  3H40 A;  3H0R B;  4BGD A;  5KFN A;  2E8M A;  3ONN A;  3T5L A;  7ICN A;  5AI5 A;  1PK1 B;  5KG7 A;  1OXJ A;  1X6I A;  1NNL A;  9ICG A;  7ICK A;  1MN8 A;  5KT6 A;  1ZQV A;  3SYZ A;  3MGI A;  3PMN A;  1N5X A;  2NRX A;  5EWF A;  1S77 D;  3S6J A;  5KFO A;  3QZ7 A;  4I2E A;  3BS5 B;  4RNO A;  4Q45 A;  9ICN A;  5AI9 A;  2BZF A;  3LYS A;  2KKV A;  1XC9 A;  4F3O A;  4J9K A;  5GTH U;  4G9B A;  2NO5 A;  2KSO B;  4YR3 A;  3GIL A;  3C28 A;  1U4B A;  1ZXI A;  4TQS A;  4Q8F A;  5DDM A;  4GXI A;  3TAR A;  1ZYQ A;  5EWG A;  2IOH A;  1XS9 D;  2FMP A;  1ZRM A;  4FBU A;  3QU2 A;  3SZ2 A;  3RF9 A;  1K1Q A;  3QU4 A;  5DG7 A;  2KFN A;  4OJ5 A;  3ISB A;  4F2S A;  4F5O A;  3TAD C;  3SAH A;  1IIP A;  3C1Z A;  3GIM A;  7ICR A;  4NXZ A;  4M2Y A;  2FLP A;  2A1A A;  4O9M A;  2YY6 A;  3SV3 A;  2ATL A;  3HIL A;  2XGP A;  2XCP A;  3HRD D;  4X5V A;  1X40 A;  2BQR A;  2W9C B;  4NLK A;  2W3S A;  3ALR A;  2BQ3 A;  1SKR A;  4RUC A;  5AKZ A;  4MFC A;  4EEY A;  8ICJ A;  2KK0 A;  2ALZ A;  2DGZ A;  2W7O A;  2OM6 A;  2YMP A;  4I2B A;  4TUP A;  2YN4 A;  2YB4 A;  4BX9 C;  3WK7 A;  5ALQ A;  5J2G A;  2KVC A;  3M9O B;  1T7P A;  5AK5 A;  1WWV A;  1BPY A;  4OJL A;  2E8O A;  2PFN A;  3N7P D;  7ICL A;  2A1J B;  1NZP A;  3RJE A;  4O3O A;  4R65 A;  1SV4 A;  2CRX A;  3NVV A;  5AHX A;  1NKC A;  4I2H A;  5J0R A;  3BZK A;  4PHA A;  5AKG A;  3M9N B;  4Y2X A;  5EE9 A;  3HWT A;  4JV2 A;  2VA2 A;  4UB4 A;  5KT2 A;  4QWB A;  1U9L A;  2EDU A;  3EPG A;  1KN5 A;  3BS7 A;  4LZG A;  1HUO A;  3KOO A;  3G6Y A;  1S8O A;  3SD7 A;  2MU2 A;  2XC9 A;  2HW3 A;  2ISP A;  2RRD A;  2FDR A;  1Z00 B;  4QZ8 A;  2YMM A;  2FI1 A;  4PL1 A;  5JUM A;  1WYG A;  3JPT A;  4QWA A;  2AHO B;  2HSZ A;  5AKJ A;  3GV8 B;  1KL9 A;  4M9H A;  5ALL A;  2CN1 A;  5DQI A;  3PSP A;  1L7M A;  2ZJA A;  2DBY A;  4O3S A;  1H38 A;  2G0A A;  2LMR A;  3PV8 A;  3WK9 A;  4BUG A;  3BJY A;  4Y2Y A;  5KFC A;  4ELU A;  4EYI B;  4I2J A;  5HHI A;  3SAG A;  3G6V A;  5KFL A;  4NM2 A;  1NK7 A;  4OJP A;  9ICR A;  1OUQ A;  1Z4N A;  5J0Q A;  3C23 A;  1F5S A;  2Y0S F;  4UBB A;  3TAN A;  1XSN A;  5JU5 A;  4TUS A;  3ISD A;  3ZD9 A;  5AI8 A;  1COK A;  4DSK A;  2W11 A;  4UB8 U;  3PR4 A;  5AM2 A;  3QEA Z;  4U6P A;  1LVH A;  4NLN A;  4QIW F;  3H8S A;  4ECS A;  4DSI A;  4GC7 A;  1L8L A;  3G6X A;  3HJE A;  4YMO A;  2WB1 C;  3UMB A;  5ALO A;  2BGW A;  1NJY A;  1C7Y A;  1NOM A;  2UVU A;  4DL7 A;  2BCS A;  2WF8 A;  5CRX A;  3L5K A;  3RR8 A;  5AM0 A;  5KTQ A;  1OW5 A;  1CUK A;  1DOQ A;  1KFS A;  2WHE A;  2ZUB A;  2KIV A;  5J29 A;  2YTU A;  4PHE A;  2P6U A;  2XY6 A;  4KLT A;  1JRO A;  4IRD A;  5G5H A;  1URJ A;  2BDP A;  4GC6 A;  3E0F A;  1BPD A;  5DB7 A;  3MR2 A;  2MA1 A;  1LKY A;  2YX8 A;  2NYV A;  5J0U A;  4ED0 A;  4QZC A;  4AYB C;  3LWL A;  1YZ6 A;  9ICJ A;  5J2I A;  9ICP A;  3WKB A;  3U26 A;  4C0Z A;  1NK9 A;  2PKE A;  2XCA A;  3JPR A;  4MF2 A;  3WKC A;  2G5I B;  5ALI A;  3M6K A;  3V7L A;  4ELV A;  3RJK A;  5IIN A;  3MAB A;  4KX3 A;  4FZN A;  8ICX A;  2RQ5 A;  3QE9 Y;  2OCE A;  1DK3 A;  4EX6 A;  5KFD A;  1V9P A;  4O3Q A;  2HI0 A;  5KFJ A;  1ZQL A;  4CCH A;  3QU5 A;  2PFQ A;  3H0M B;  5J2C A;  2HVI A;  3OPX A;  2N1R A;  4DS4 A;  5KG2 A;  2EAO A;  2JH7 A;  4Y2V A;  5ALJ A;  2KIW A;  3H0L B;  1ZJM A;  3HP6 A;  3ZDB A;  4O5K A;  1PVP A;  2HHU A;  3ORY A;  2HHT A;  4CDG A;  3GQC A;  1ZQS A;  3WK8 A;  1JN3 A;  3PO4 A;  4OJ6 A;  4PGX A;  3MR5 A;  2ZTD A;  4YFK A;  1DXS A;  1F44 A;  5KT7 A;  3RB3 A;  3M7D A;  2JXJ A;  3HW8 A;  1ZQT A;  2WAQ F;  2JEF A;  1ZQX A;  3NRZ A;  1KRP A;  4UAR A;  4EBD A;  5ALU A;  2JMG A;  2KMD A;  4IQU A;  3UXP A;  2G06 A;  4F91 B;  3LWM A;  4F72 A;  3NVZ A;  8ICF A;  5L1I A;  3E2E A;  4F4W A;  4ACO A;  3V7K A;  4YR0 A;  4KN4 A;  1F0M A;  2RDJ A;  2C22 A;  1HJP A;  5KFF A;  4F93 B;  1TFR A;  4UAW A;  4GXK A;  2VA3 A;  3TQ1 A;  1ARO P;  2XO7 A;  4QJF B;  2BPG A;  5J0X A;  1JX4 A;  4KLM A;  2IOF K;  8ICI A;  4IC9 A;  4NLG A;  3WK5 A;  2V9W A;  2AGQ A;  1B43 A;  2R8G A;  1KW4 A;  3C2K A;  2HHV A;  5DG9 A;  7ICE A;  2H3I A;  4ECT A;  3JPN A;  2W8L A;  2G5H B;  3Q8P B;  8ICB A;  1JI7 A;  3GV5 B;  4O3M A;  4RQN A;  5T14 A;  5J2D A;  3RBE A;  4IQW A;  4DFK A;  4EYH B;  8ICR A;  4QZF A;  4E0D A;  4DSE A;  4CF4 A;  5EE3 A;  2KIC A;  3KKA C;  2W9B B;  2ASL A;  4U7C A;  5AKE A;  1T3Q A;  2P35 A;  4ELT A;  2M0N A;  1COO A;  4NL9 A;  5L9X A;  5HP4 A;  1ZQM A;  3RB4 A;  8ICW A;  3TAD A;  3FDS A;  1SZP A;  4M9J A;  2NRZ A;  2KHV A;  5KFK A;  3AMZ A;  3BQ7 A;  3CRX A;  1VLB A;  5G5G A;  5AI6 A;  4XRH A;  1ZQI A;  2B6G A;  3E58 A;  3C21 A;  2JR5 A;  4YCX A;  3H8J A;  3CP8 A;  4MFF A;  4O3R A;  2JRZ A;  4RQ2 A;  2OWO A;  2XY7 A;  5DLF A;  4CRX A;  4IRK A;  2PMZ C;  5B5E U;  4Y2Q A;  2GO7 A;  3AQE A;  4QZA A;  3L4P A;  4DL5 A;  4B9V A;  4DQI A;  3I76 A;  4PPX A;  2ZIV A;  2GOL A;  4ICA A;  1ZQJ A;  4YXJ A;  4GXJ A;  4LZD A;  4DCC A;  2AH5 A;  1ZQP A;  5KFM A;  4UAY A;  4ED3 A;  3NTU A;  4DFM A;  1QSY A;  2K4H A;  4BWJ A;  3GII A;  2EAM A;  1ZQH A;  2LPE A;  1QQ5 A;  3SEN A;  2JEI A;  1S0M A;  2O6K A;  4MF8 A;  4KMO B;  2H3Q A;  3PX0 A;  2BCQ A;  4UB1 A;  3M9M B;  1ECW A;  2EZX A;  4RUA A;  5CA7 A;  2V4R A;  4JK1 A;  5B66 U;  3OHA A;  4F2R A;  1ZQE A;  5J2J A;  2KJ9 A;  4I28 A;  1RDF A;  5E79 U;  4MEY A;  8ICK A;  3KTQ A;  1ZET A;  5C5J A;  3DEE A;  3PO5 A;  5KFI A;  4QZ9 A;  2YMQ A;  5CP2 A;  4KLQ A;  4WJ3 B;  1N62 A;  1RG6 A;  4RT2 A;  9ICT A;  5KFP A;  2FPK A;  3THV A;  1KLN A;  4ED2 A;  1L3S A;  4QZE A;  5KL1 B;  5ALW A;  1SZH A;  3F53 A;  3PW5 A;  3CW2 C;  2LI6 A;  1KTQ A;  2WTF A;  1L7N A;  2QB1 A;  3V72 A;  3RFA A;  2ZIW A;  5F3X B;  3C1Y A;  2W43 A;  2DWQ A;  7ICP A;  2EAP A;  4JMU A;  1N60 A;  2AU0 A;  3C29 A;  2BCR A;  5AIC A;  5BOL A;  3Q8K A;  4KLS A;  4KX5 A;  5J2E A;  2MSN A;  3AEV A;  4Y2T A;  3KFU F;  4M47 A;  2FPL A;  3Q8M A;  4J9Q A;  3RJG A;  3IG8 A;  1KFD A;  1L7P A;  3KHH A;  4J9O A;  4Y2R A;  1NK4 A;  3KHL A;  1BNO A;  4LVS A;  5L1J A;  5AM1 A;  2OHF A;  2HHQ A;  2D6F C;  3GU3 A;  4UAU A;  1CEZ A;  4EZ9 A;  2ZTE A;  2KD1 A;  4ECX A;  5KFE A;  2E8P A;  4UW9 A;  2G09 A;  2Q0Z X;  2YB1 A;  4RQ3 A;  3EZ5 A;  3ZI4 A;  3H4B A;  1Q3U A;  1SV0 A;  4DSJ A;  4MHV A;  4I2A A;  4J9P A;  1T94 A;  3V6H A;  2J6T A;  3L3F X;  5ALK A;  3M1Y A;  4C8N A;  4B9N A;  3A0B U;  1L3T A;  5ALR A;  1L3U A;  2I5H A;  1S97 A;  3T5H A;  1KSP A;  2GLE A;  2BDU A;  4UB6 U;  4C8K A;  5KL8 B;  4UAV A;  1J2M A;  1DGJ A;  2M9N A;  3QNM A;  2J6S A;  3CNH A;  5KFG A;  3PML A;  5ALE A;  2KOB A;  3IG5 A;  2YQE A;  4M9G A;  4ECV A;  1ZD4 A;  3NAS A;  3QUQ A;  3GIK A;  4J9S A;  2K60 A;  9ICF A;  7ICG A;  2LHT A;  1TAQ A;  2ISO A;  4J9M A;  4JB3 A;  5KFZ A;  3EWA A;  1NK5 A;  7ICS A;  4JUZ A;  3OJU A;  3EUB 2;  4KIT B;  4ECY A;  5DBB A;  2AXT U;  2HMX A;  2R8K A;  2F8K A;  1TK5 A;  3BS5 A;  5BPC A;  2I9G A;  4PHP A;  3PNC A;  5DB9 A;  4JWN A;  8ICP A;  4EBC A;  3ZDA A;  1O03 A;  9ICL A;  4P4P A;  4XUS A;  3N7R C;  1CI4 A;  8ICV A;  3T3F A;  2VJ5 A;  4ECU A;  3RJI A;  2KTQ A;  4J9R A;  3PR5 B;  9ICU A;  4US8 A;  5CJ7 A;  1S76 D;  4Y2U A;  1ZQY A;  4F8R A;  4CF3 A;  2KJ8 A;  8ICQ A;  3R9K A;  8ICO A;  4ZOH C;  3KD3 A;  4DO9 A;  2ZJ8 A;  5D4B A;  4BDP A;  5KFY A;  1ZD5 A;  4C8M A;  8ICT A;  3ZDD A;  3F5A A;  5KG3 A;  4F4Y A;  1MQ2 A;  1KFT A;  3F5E A;  1BPZ A;  1K1S A;  7ICO A;  2HVH A;  2DL0 A;  1T4G A;  4CF5 A;  1NKE A;  4AYB F;  5J0P A;  4YMM A;  5KFA A;  3TFR A;  5IIJ A;  1IXR A;  3KHG A;  3SR6 A;  2HBJ A;  1HIW A;  3B9J A;  3OJS A;  4F4Z A;  3FYH A;  5HR7 A;  3N97 B;  1VJ5 A;  4HAI A;  5AM3 A;  2H5X A;  3UPQ A;  1SIJ A;  3TAP A;  2DF4 B;  4F5N A;  4BXO A;  4YG2 A;  3T5J A;  1XU4 A;  4O0I A;  3HKZ C;  1QH9 A;  1RM6 C;  4DWI A;  1XO0 A;  2OEH A; 
#chains in the Genus database with same CATH homology
 1UCV A;  4IS7 A;  1OW5 A;  2Y9T A;  2B6G A;  2K60 A;  2JV3 A;  1LKY B;  2KIV A;  1SXD A;  3IDW A;  2YTU A;  2KMD A;  2QB1 A;  5F3X B;  2QAR A;  3H8M A;  2DKZ A;  3SEI A;  2QKQ A;  2EAP A;  5J8Y A;  1B0X A;  1Z1V A;  2QB0 B;  2F8K A;  4PZO A;  3BS5 A;  1X9X A;  1F0M A;  2ESE A;  1WWU A;  2E8N A;  2KG5 A;  5JTI A;  1LKY A;  2ES6 A;  3TAD C;  5KNI A;  2Y9U A;  2QAR B;  2DKX A;  2LMR A;  2EAM A;  5JRT A;  3HIL A;  5L1M A;  2K4P A;  3KKA A;  2LPE A;  1X40 A;  3SEN A;  4RQM A;  1UQV A;  3TAC B;  2QB0 A;  1KW4 A;  2F3N A;  1SGG A;  1PK1 A;  1V38 A;  2E8P A;  1SV0 A;  5JU5 A;  4MHV A;  1JI7 A;  2FE9 A;  1COK A;  4RQN A;  1WWV A;  3K1R B;  2DL0 A;  2E8O A;  2E8M A;  2F44 A;  1SV0 C;  2D8C A;  2L5Y A;  2KSO A;  1PK1 B;  4NJ8 A;  2EAO A;  4NL9 C;  1OXJ A;  3KKA C;  1SV4 A;  5J8Y C;  2GLE A;  1B4F A;  1SXE A;  1X66 A;  2EAN A;  4PZN A;  4NL9 A;  1RG6 A;  3BS5 B;  1DXS A;  3TAD A;  2KE7 A;  2D3D A;  3BS7 A;  1V85 A;  2KSO B;  3BQ7 A;  1PK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...