2QKWA

Structural basis for activation of plant immunity by bacterial effector protein avrpto
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
101
structure length
101
Chain Sequence
DNVTSSQLLSVRHQLAESAGLPRDQHEFVSSQAPQSLRNRYNNLYSHTQRTLDMADMQHRYMTGASGINPGMLPHENVDDMRSAITDWSDMREALQHAMGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avirulence protein
publication title The structural basis for activation of plant immunity by bacterial effector protein AvrPto
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Transferase
total genus 36
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11592 AvrPto Central core of the bacterial effector protein AvrPto
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.140 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AvrPto 2qkwA00
2QKWA 1R5EA
chains in the Genus database with same CATH superfamily
2YLLA 2OZNB 1ZYLA 4FZSA 3FD9A 1E9VA 3D51A 4NPHA 3D2EA 3I01A 3M3WA 3LLLA 4EZWA 3O3NB 2F7OA 3ZEDA 2X3VA 1HWWA 4EZZA 1OAOA 4H8SA 3BUDA 3ABHA 3I2WA 2ND1A 3CV5A 1E2UA 4R5IA 4AZ7A 3A98A 4EZQA 3HAIA 2GAFD 1TQVA 4AKVA 1TQWA 1X03A 2EX3B 1I4LA 4EZXA 2ELBA 4IW0A 1X04A 3QA8A 2N3KA 4PO2A 2Z0OA 4EZTA 4G6QA 4JWDA 2ZXQA 1QWUA 2YL9A 2YI8A 4HR1B 4EZUA 2EWFA 2YI9A 4AZ5A 4JN4A 4HY9A 3LMFA 2X3XA 3CZSA 4FM3A 3I04A 3EJPA 5C5BB 5FIGA 2ND0A 4H6IA 3EJQA 1E1DA 1DKYA 2C08A 3CAZA 2Q13A 5C5BA 2NCZA 4KIKB 4WPEA 3BUBA 4UDXX 3EJSA 1R34A 3BVXA 4EZPA 1UPXA 2Z8YA 3EJUA 4IM0A 1TQSA 1GN9A 4KIKA 2WYIA 2YLAA 3BVVA 4R5LA 3OWGA 2RT6A 1PS3A 3RPMA 1WDZA 2FYVA 3DYTA 3F7WA 4IWPA 1LQ7A 2Z0NA 3D4ZA 2YKTA 2OBMA 3DX3A 3T4AG 3VKHA 3HAHA 4AZHA 1O7DB 1TQTA 3OK8A 4F01A 1OA0A 3OHXM 4IM3A 2MI7A 2F7QA 2D1LA 2QXLA 2YL6A 1W9MA 2PY6A 2EFLA 2X3WA 4AVMA 4I1QA 3DDFA 1DKXA 1YWMA 4IWQA 1U00A 3DPQA 4JNEA 2FICA 2LXYA 2JNSA 2F1AA 3LVTA 4JWIA 3KAWA 3QNJA 3D50A 2RAIA 4JWEA 4ATMA 2ALWA 4DCNC 4EZNA 3EJTA 4HR1A 2V0OA 4BNEA 1SU6A 4JL9A 3QE6A 3DDGA 4R5GA 4FZOA 4IM2A 1TQUA 3KAVA 2F7PA 3BUIA 2O0I1 4EZYA 3UITA 1SU7A 4B9QA 3DX4A 3B52X 3T48A 2WYHA 3L3OM 2YL5A 2F7RA 4EZVA 2LM0A 2PMRA 4F00A 2RAKA 2OW7A 3D52A 4AZ6A 3VEAA 3BVWA 4AZCB 1GNLA 2RAJA 2GF4A 2KHOA 1OA1A 3T49A 4DYLA 1MJGA 5E84A 4D8JA 3ERCC 3I39X 3B51X 1URUA 5FLEX 3SYVA 1I49A 3B53X 2Q12A 2YL8A 3Q0KA 3RV0A 1JQKA 4AZCA 3DX0A 4AZIA 3GI7A 4JNFA 2QKWA 4JLCA 1HXKA 4JWCA 4E81A 4AZBA 3ER9B 1I4TA 3D4YA 3QNIA 2X5CA 3T46A 3C7NA 4E3CA 3CZNA 4HYBA 2WINM 4H6HA 4EZRA 3BUQA 3BUPA 1ZWWA 3VEBA 3SOGA 3QWEA 1QWNA 1R33A 2D4CA 2JNKA 3L3PA 2Z0VA 3BVUA 3BLBA 1DKZA 4IWOA 3ER8C 4EZSA 4UDYX 1R5EA 3T47A 2YIBA 2OBLA 4NQIA 2YIAA 2F1BA 1QX1A 3DX1A 2GA9D 3G9GA 3ACOA 1SU8A 3CKDA 2OW6A 3EJRA 3PLTA 3DPPA 4FZPA 4M0MA 3O3OB 3BVTA 3DPOA 2YIVX 3D2FA 4AZGA 4WPCA 3HAJA 1GNTA 1Y2OA 5KBPA 3Q84A 4R5KA 1I4DA 3KDRA 2OO2A 2EFKA 3RV1A 1HTYA 4EZOA 4NSWA 2F18A 5TKYA 1SUFA 3O3MB 3DX2A 1O7DC 3CVRA 2QFFA 4R5JA
chains in the Genus database with same CATH topology
2QKWA 1R5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKW A;  1R5E A; 
#chains in the Genus database with same CATH topology
 2YLL A;  2OZN B;  1ZYL A;  4FZS A;  3FD9 A;  1E9V A;  3D51 A;  4NPH A;  3D2E A;  3I01 A;  3M3W A;  3LLL A;  4EZW A;  3O3N B;  2F7O A;  3ZED A;  2X3V A;  1HWW A;  4EZZ A;  1OAO A;  4H8S A;  3BUD A;  3ABH A;  3I2W A;  2ND1 A;  3CV5 A;  1E2U A;  4R5I A;  4AZ7 A;  3A98 A;  4EZQ A;  3HAI A;  2GAF D;  1TQV A;  4AKV A;  1TQW A;  1X03 A;  2EX3 B;  1I4L A;  4EZX A;  2ELB A;  4IW0 A;  1X04 A;  3QA8 A;  2N3K A;  4PO2 A;  2Z0O A;  4EZT A;  4G6Q A;  4JWD A;  2ZXQ A;  1QWU A;  2YL9 A;  2YI8 A;  4HR1 B;  4EZU A;  2EWF A;  2YI9 A;  4AZ5 A;  4JN4 A;  4HY9 A;  3LMF A;  2X3X A;  3CZS A;  4FM3 A;  3I04 A;  3EJP A;  5C5B B;  5FIG A;  2ND0 A;  4H6I A;  3EJQ A;  1E1D A;  1DKY A;  2C08 A;  3CAZ A;  2Q13 A;  5C5B A;  2NCZ A;  4KIK B;  4WPE A;  3BUB A;  4UDX X;  3EJS A;  1R34 A;  3BVX A;  4EZP A;  1UPX A;  2Z8Y A;  3EJU A;  4IM0 A;  1TQS A;  1GN9 A;  4KIK A;  2WYI A;  2YLA A;  3BVV A;  4R5L A;  3OWG A;  2RT6 A;  1PS3 A;  3RPM A;  1WDZ A;  2FYV A;  3DYT A;  3F7W A;  4IWP A;  1LQ7 A;  2Z0N A;  3D4Z A;  2YKT A;  2OBM A;  3DX3 A;  3T4A G;  3VKH A;  3HAH A;  4AZH A;  1O7D B;  1TQT A;  3OK8 A;  4F01 A;  1OA0 A;  3OHX M;  4IM3 A;  2MI7 A;  2F7Q A;  2D1L A;  2QXL A;  2YL6 A;  1W9M A;  2PY6 A;  2EFL A;  2X3W A;  4AVM A;  4I1Q A;  3DDF A;  1DKX A;  1YWM A;  4IWQ A;  1U00 A;  3DPQ A;  4JNE A;  2FIC A;  2LXY A;  2JNS A;  2F1A A;  3LVT A;  4JWI A;  3KAW A;  3QNJ A;  3D50 A;  2RAI A;  4JWE A;  4ATM A;  2ALW A;  4DCN C;  4EZN A;  3EJT A;  4HR1 A;  2V0O A;  4BNE A;  1SU6 A;  4JL9 A;  3QE6 A;  3DDG A;  4R5G A;  4FZO A;  4IM2 A;  1TQU A;  3KAV A;  2F7P A;  3BUI A;  2O0I 1;  4EZY A;  3UIT A;  1SU7 A;  4B9Q A;  3DX4 A;  3B52 X;  3T48 A;  2WYH A;  3L3O M;  2YL5 A;  2F7R A;  4EZV A;  2LM0 A;  2PMR A;  4F00 A;  2RAK A;  2OW7 A;  3D52 A;  4AZ6 A;  3VEA A;  3BVW A;  4AZC B;  1GNL A;  2RAJ A;  2GF4 A;  2KHO A;  1OA1 A;  3T49 A;  4DYL A;  1MJG A;  5E84 A;  4D8J A;  3ERC C;  3I39 X;  3B51 X;  1URU A;  5FLE X;  3SYV A;  1I49 A;  3B53 X;  2Q12 A;  2YL8 A;  3Q0K A;  3RV0 A;  1JQK A;  4AZC A;  3DX0 A;  4AZI A;  3GI7 A;  4JNF A;  2QKW A;  4JLC A;  1HXK A;  4JWC A;  4E81 A;  4AZB A;  3ER9 B;  1I4T A;  3D4Y A;  3QNI A;  2X5C A;  3T46 A;  3C7N A;  4E3C A;  3CZN A;  4HYB A;  2WIN M;  4H6H A;  4EZR A;  3BUQ A;  3BUP A;  1ZWW A;  3VEB A;  3SOG A;  3QWE A;  1QWN A;  1R33 A;  2D4C A;  2JNK A;  3L3P A;  2Z0V A;  3BVU A;  3BLB A;  1DKZ A;  4IWO A;  3ER8 C;  4EZS A;  4UDY X;  1R5E A;  3T47 A;  2YIB A;  2OBL A;  4NQI A;  2YIA A;  2F1B A;  1QX1 A;  3DX1 A;  2GA9 D;  3G9G A;  3ACO A;  1SU8 A;  3CKD A;  2OW6 A;  3EJR A;  3PLT A;  3DPP A;  4FZP A;  4M0M A;  3O3O B;  3BVT A;  3DPO A;  2YIV X;  3D2F A;  4AZG A;  4WPC A;  3HAJ A;  1GNT A;  1Y2O A;  5KBP A;  3Q84 A;  4R5K A;  1I4D A;  3KDR A;  2OO2 A;  2EFK A;  3RV1 A;  1HTY A;  4EZO A;  4NSW A;  2F18 A;  5TKY A;  1SUF A;  3O3M B;  3DX2 A;  1O7D C;  3CVR A;  2QFF A;  4R5J A; 
#chains in the Genus database with same CATH homology
 2QKW A;  1R5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...