2QKXA

N-acetyl glucosamine 1-phosphate uridyltransferase from mycobacterium tuberculosis complex with n-acetyl glucosamine 1-phosphate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
388
structure length
388
Chain Sequence
TFPGDTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional protein glmU
publication title Structure and function of GlmU from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 143
structure length 388
sequence length 388
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2qkxA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2qkxA01
2RIZA 2YQJA 3E26A 3V0OA 5AJOA 2VS3A 4EA7A 1ZHJA 1LL0A 3TIOA 4GBPA 1MC3A 1HJLA 3I0CA 2AH9A 4B4GA 3ZGFA 2WLDA 4ARWA 3TZTA 4G87A 3DJ4A 4DECA 3Q4SA 2QIAA 4IRQA 1EZIA 2JCOA 2A8UA 3R5DA 4HO5A 2RJ6A 5DDVA 2UX8A 2FFVA 1TW1A 3FS8A 1XZ6A 1VGWA 4L41C 5CMGX 2WLFA 3RMVA 1HM0A 3VBPA 2YQSA 2Y6PA 5FU8A 3ZGGA 3BSSA 1LL3A 4Y7FA 1FWYA 2TDTA 3D8VA 4MZUA 1ZI3A 3E25A 3KWEA 5C3DA 5ADXV 3MC4A 1VPAA 1W77A 4M99A 1GA8A 1ZI1A 1R7UA 4HG6A 1FOAA 3ZLLA 4DDZA 4KQLA 4Y7VA 1GWVA 4LW3A 3CU0A 3VBNA 3FTTA 2V0IA 2Z87A 3N9WA 2PGVA 2YC5A 5C4EA 3Q1XA 4DCLA 4MYBA 1YP2A 3D98A 2FKOA 1GQCA 4R7PA 3R8YA 2FYCB 5FU0A 4M2BA 3FSXA 1Z90A 4AAWA 1FG5N 2Y4JA 1V83A 3I0LA 2P72A 2IC7A 3FSBA 4HZCA 4HURA 1S80A 3ST8A 3TISA 3CKNA 5C1HA 1KGQA 1THJA 1S4NA 3FSYA 5CMJA 2MZBA 3EH0A 4D48A 3JUKA 2V0HA 2PA4A 4AYLA 1OMZA 1QRLA 3JUJA 5CQPA 4KC4A 3CKQA 5FTSA 1ZJ3A 4CJCA 3PNNA 4FRLA 2NPOA 3LW6A 1G3LA 5C48A 2YQHA 2OI6A 3OTMA 5C49A 1TDTA 4M4KA 3U2UA 4MYOA 1KRUA 5C4BA 4EA9A 1R82A 3SRTA 4AA7A 1R7XA 3KWDA 5ADXU 4AC3A 2QH5A 1FXJA 4G3QA 1H5SA 1OQMB 4B4MA 1JV1A 1KHRA 5E3QA 3JQYA 3GUEA 2V0KA 3V4EA 3OU9A 4M2AA 3FWWA 2X65A 2YQCA 5AJPA 2VXLA 4BQHA 3K8DA 1ZCVA 1ZCTA 1KQAA 3CGXA 2AM5A 2D0JA 3SX5A 1WT0A 3USQA 3TQDA 4E75A 3SXDA 5I1FA 2BO4A 5AFUV 1ZJ0A 1FXOA 1LVWA 3F1YA 4ZDQA 3V8ZA 4ISXA 2ZU7A 1MR9A 2VS4A 2VFZA 4EE5A 3POLA 3F1CA 5C4CA 3DUVA 5EJ1A 1FR8A 2YCMA 3V8YA 3OTZA 4P02A 1FGGA 4IHHA 1H7EA 1H7LA 2I5EA 4N27A 4EABA 3OH1A 3RMWA 1H5RB 4FRMA 3DK5A 3IXCA 4BMAA 1KK4A 3R2WA 2QIVX 3V90A 5E3PA 1H5SD 4K6RA 2V0JA 2P6WA 1ZDGA 2AM3A 3FOQA 3ZF8A 3BRKX 4HUSA 1LL2A 4D11C 2ICYA 4FROA 2IU9A 1ZI5A 3USRA 3Q7UA 3OH0A 1MP3A 2VHEA 4IRPA 5C1GA 4KC2A 4Y62A 3R1WA 1JYLA 4E79A 4FCEA 4MNDA 4Y9XA 2Y4LA 3R5AA 3PKQA 4NAKA 1H4CA 2XATA 1V82A 4M9CA 5F42A 1YP4A 1G93A 2Q4JA 1NF5B 3KWCA 3EE5A 1H5TB 1VZTA 2AGDA 3TDTA 4EEAA 4JISA 3I0EA 3BXYA 5AFUU 1J2ZA 3QVBA 4YS8A 3NZ2A 1HV9A 2RJ4A 1R7VA 4DE7A 1W57A 1ZCUA 5CQMX 1H4EA 5IFYA 1G0RA 1H7TA 4CJ8A 1H7GA 3OUPA 3P1BA 2YC3A 1MP5A 1V3WA 1OMXA 2O1FA 4EA8A 1FO8A 1MRLA 4ASYA 2WLGA 1LZ7A 4KC1A 1QQ0A 3BSWA 2WVKA 1G8OA 2XMEA 2WGZA 2APCA 4FRAA 3SXEA 2RIJA 3TWDA 3T7NA 3MQHA 3CJ8A 1EYRA 1KRVA 3OAMA 1FR9A 1NMMB 4HO4A 4C2SA 3I3AA 1FGXA 2V0LA 4B42A 5L6VA 2VXMA 4EGGA 2RITA 5CQOA 1ZJPA 2JCJA 1QRGA 3OW5A 4FREA 2PX7A 1XHBA 1LZIA 2VS5A 5DEMA 1QRMA 3CKJA 5U2KA 1O0RA 2Y4MA 3CKOA 5FYEA 2X60A 2GGOA 2VD4A 1O7QA 1SSQA 3HSQA 1GWWA 1H5RA 2XWNA 4ASJA 4HO9A 3VBMA 4M28A 4M98A 3ECTA 5CMFX 4Y64A 1R7TA 4Y7UA 2RIYA 4J09A 5L6SA 5AJNA 1ZJ2A 4B5BA 2Y4KA 4CVHA 4NANA 5E3RA 4NAIA 2WVLA 2RJ8A 4B3UA 2D7RA 1INJA 3V0MA 5BXCA 3RSBA 4HCQA 1SS9A 1VZUA 2I5KA 2E8BA 5C8RA 1VICA 3IOJA 5CQLX 4CJBA 2WAWA 3GVDA 1I52A 1ZDFA 5J49A 1KRRA 1ON8A 2RJ1A 1JVDA 1TW5A 1TVYA 4H7OA 1VH1A 4NALA 1LXAA 1G1LA 3NGWA 1KGTA 4KNXA 2GGQA 4Y7GA 2DPWA 3I0JA 1R80A 1XATA 4IHGA 2E3DA 5C38A 1H7FA 4KPXA 5JQQA 1QREA 1ZCYA 2AQ9A 1FRWA 2JCLA 1ZI4A 1ZJ1A 4KRVA 3SXAA 4B2XA 1V84A 2P73A 3OC9A 2RJ5A 1G23A 1FZWA 1NKHB 1HM9A 1R7YA 1KK6A 2OI5A 3PMOA 3K8EA 2W0VA 1H5SC 2CU2A 3U2XA 4HOCA 4E6UA 3V0NA 3BFPA 1H3MA 1LZ0A 2RIXA 1QG8A 3OH2A 3R0SA 2XWMA 5DDTA 3JTJA 4MFGA 4KXOA 1ON6A 1T3DA 4HZDA 3OH3A 4FRDA 4B4BA 1IINA 3O3PA 3TK8A 3SXBA 1WT2A 3VBIA 4R37A 2IU8A 1VGZA 2VSHA 1E5KA 3EEVA 1NWGB 4R36A 3HJJA 2WE9A 1G95A 4N6AA 4EEOA 1QGQA 2FYAA 4HO6A 3D5NA 1WT1A 3OH4A 1YROB 4ECMA 1IIMA 4D0ZA 2AECA 1R81A 2RJ9A 1NQIB 1WT3A 1H7QA 2QGIA 2PGYA 1NHEB 1SSMA 3C8VA 1H5SB 5IDTA 3SX3A 1INIA 3I0FA 1VM8A 2O1HA 4G3PA 2FY7A 4J18A 1WVCA 1JV3A 3VBKA 1JYKA 4FQWA 2O1GA 2W0WA 3R3IA 3U2TA 3I3XA 2AM4A 1QGSA 5CMHA 5C47A 2FFUA 3SXGA 4IHFA 4FRHA 5DEPA 3V91A 1G97A 1GX4A 3I0KA 3VBLA 1XHDA 2BO8A 2WLEA 4FCUA 3V0LA 2FYBA 1PZTA 4Y6UA 3IOHA 3U0YA 3I0HA 4FRBA 4E1KA 5C3AA 3SX8A 1JVGA 2WLCA 3DHOA 2NXVA 2OEGA 4UEGA 2BO7A 3U2WA 3HL3A 3V0PA 2Z86A 4FRPA 5C1LA 4N6BA 2I7BA 3ZLKA 2RJ7A 1HJJA 1VGUA 4KT7A 2AESA 2FYDB 1SSTA 1KK5A 4B2WA 1V67A 4Y63A 3I0DA 3I0IX 4HO3A 3SX7A 1MP4A 4D0TA 1K4VA 5CQNX 4AYJA 1MR7A 2XMHA 4E6TA 3I0GA 1O23B 1GX0A 4N69A 4EEGA 1G9RA 2A8WA 2WEEA 4G3SA 1GQ9A 4EEMA 1QWJA 3TV0A 5FUHA 1VZXA 3FSCA 2X5SA 2JCKA 4KPZA 2OEFA 2XWLA 2D7IA 2RJ0A 1VGTA 2ICXA 2IUAA 3VBJA 1FO9A 3U2VA 3T57A 4Y7TA 3R5BA 1H5TA 2BO6A 4XWIA 5FV9A 4HO2A 3SXCA 5C36A 3Q80A 5EJZA 2P2OA 1ZJOA 1HM8A 2YESA 2ZU9A 1TZFA 5FTVA 1KWSA 4JD0A 4LW6A 4Y6NA 5HS2A 4EQYA 3BCVA 1LZJA 4EE4A 5EIYA 2ZU8A 4EE3A 4EVWA 3VNPA 2OI7A 1QRFA 4FRQA 3V0QA 2JF3A 2X5ZA 4D11A 3SPTA 3CKVA 2AE7A 3OGZA 4HO8A 2Y7AA 1ZIZA 5C4DA 4EAAA 5IDSA 3P47A 3OKRA 1W55A 1WSZA 3T7OA 3EG4A 4KNRA 4HO0A 3U0XA 1OCXA 3GOSA 5C4FA 1G2VA 3F1XA 1H4DA 2WVMA 3PKPA 1S4OA 2VSIA 4P00A 1H7HA 3KIAA 5CMIA 3MQGA 3T7MA 1VH3A 5C3BA 3R3RA 3IOIA 5DG3A 1PZYB 2QKXA 3R5CA 3IGJA 1O7OA 1YP3A 2JF2A 1S4PA 3BSYA
chains in the Genus database with same CATH superfamily
2RIZA 2YQJA 3E26A 3V0OA 5AJOA 2VS3A 4EA7A 1ZHJA 1LL0A 3TIOA 4GBPA 1MC3A 1HJLA 3I0CA 2AH9A 4B4GA 3ZGFA 2WLDA 4ARWA 3TZTA 4G87A 3DJ4A 4DECA 3Q4SA 2QIAA 4IRQA 1EZIA 2JCOA 2A8UA 1L0SA 3R5DA 2RJ6A 4HO5A 5DDVA 2UX8A 2FFVA 1TW1A 3FS8A 1XZ6A 1VGWA 4L41C 5CMGX 2WLFA 3RMVA 1HM0A 3VBPA 2YQSA 2Y6PA 5FU8A 3ZGGA 3BSSA 1LL3A 4Y7FA 1FWYA 2TDTA 3D8VA 4MZUA 1ZI3A 3E25A 3KWEA 5C3DA 5ADXV 3MC4A 1VPAA 1W77A 4M99A 1GA8A 1ZI1A 1R7UA 4HG6A 1FOAA 3ZLLA 4DDZA 4KQLA 4Y7VA 1GWVA 4LW3A 3CU0A 3VBNA 3FTTA 2V0IA 2Z87A 3N9WA 2PGVA 2YC5A 5C4EA 3Q1XA 4DCLA 4MYBA 1YP2A 3D98A 2FKOA 1GQCA 4R7PA 3R8YA 2FYCB 5FU0A 4M2BA 3FSXA 1Z90A 4AAWA 1FG5N 2Y4JA 1V83A 3I0LA 2P72A 2IC7A 3FSBA 4HZCA 4HURA 1S80A 3ST8A 3TISA 3CKNA 5C1HA 1KGQA 1THJA 1S4NA 3FSYA 5CMJA 2MZBA 3EH0A 3SUCA 4D48A 3JUKA 2V0HA 2PA4A 4AYLA 1OMZA 1QRLA 3JUJA 5CQPA 4KC4A 3CKQA 5FTSA 1ZJ3A 4CJCA 3PNNA 4FRLA 2NPOA 3LW6A 1G3LA 5C48A 2YQHA 2OI6A 3GQ7A 3OTMA 5C49A 1TDTA 4M4KA 3U2UA 4MYOA 1KRUA 5C4BA 4EA9A 1R82A 3SRTA 4AA7A 1R7XA 3KWDA 5ADXU 4AC3A 2QH5A 1FXJA 4G3QA 1H5SA 1OQMB 4B4MA 3GQ8A 1JV1A 1KHRA 5E3QA 3JQYA 3GUEA 2V0KA 3V4EA 3OU9A 4M2AA 3FWWA 2X65A 2YQCA 5AJPA 2VXLA 4BQHA 3K8DA 1ZCVA 1ZCTA 1KQAA 3CGXA 2AM5A 2D0JA 3SX5A 1WT0A 3USQA 3TQDA 4E75A 3SXDA 5I1FA 2BO4A 5AFUV 1ZJ0A 1FXOA 1LVWA 3F1YA 4ZDQA 3V8ZA 4ISXA 2ZU7A 1MR9A 2VS4A 2VFZA 4EE5A 3POLA 3F1CA 5C4CA 3DUVA 5EJ1A 1FR8A 2YCMA 3V8YA 3OTZA 4P02A 2VK9A 1FGGA 4IHHA 1H7EA 1H7LA 2I5EA 4N27A 4EABA 3OH1A 3RMWA 1H5RB 4FRMA 4FIYA 3DK5A 3IXCA 4BMAA 1KK4A 3R2WA 2QIVX 3V90A 5E3PA 1H5SD 4K6RA 2V0JA 2P6WA 1ZDGA 2AM3A 3FOQA 3ZF8A 3BRKX 4HUSA 1LL2A 3GQ9A 4D11C 2ICYA 4FROA 2IU9A 1ZI5A 3USRA 3Q7UA 4O6NA 3OH0A 1MP3A 2VHEA 4IRPA 5C1GA 4KC2A 4Y62A 3R1WA 1JYLA 4E79A 4FCEA 4MNDA 4Y9XA 2Y4LA 3R5AA 3PKQA 4NAKA 1H4CA 2XATA 1V82A 4M9CA 5F42A 1YP4A 1G93A 2Q4JA 1NF5B 3KWCA 3EE5A 1H5TB 1VZTA 2AGDA 3TDTA 4EEAA 4JISA 3I0EA 3BXYA 5AFUU 1J2ZA 3QVBA 4YS8A 3NZ2A 1HV9A 2RJ4A 1R7VA 4DE7A 1W57A 1ZCUA 5CQMX 1H4EA 5IFYA 1G0RA 1H7TA 4CJ8A 1H7GA 3OUPA 3P1BA 2YC3A 1MP5A 1V3WA 1OMXA 2O1FA 4EA8A 1FO8A 1MRLA 4ASYA 4O6MA 2WLGA 1LZ7A 4KC1A 1QQ0A 3BSWA 2WVKA 1G8OA 2XMEA 2WGZA 2APCA 4FRAA 3SXEA 2RIJA 3TWDA 3T7NA 2J0AA 3MQHA 3CJ8A 1EYRA 1KRVA 3OAMA 1FR9A 1NMMB 4HO4A 4C2SA 3I3AA 1FGXA 2V0LA 4B42A 5L6VA 2VXMA 4EGGA 2RITA 5CQOA 1ZJPA 2JCJA 1QRGA 3OW5A 4FREA 2PX7A 1XHBA 1LZIA 2VS5A 5DEMA 1QRMA 3CKJA 5U2KA 1O0RA 2Y4MA 3CKOA 5FYEA 2X60A 2VD4A 2GGOA 1O7QA 1SSQA 3HSQA 1GWWA 1H5RA 2XWNA 4ASJA 4HO9A 3VBMA 4M28A 4M98A 3ECTA 5CMFX 4Y64A 1R7TA 4Y7UA 2RIYA 5D92A 4J09A 5L6SA 5AJNA 1ZJ2A 4B5BA 2Y4KA 4CVHA 4NANA 5E3RA 4NAIA 2WVLA 2RJ8A 4B3UA 2D7RA 1INJA 3V0MA 5BXCA 3RSBA 4HCQA 1SS9A 1VZUA 2I5KA 2E8BA 5C8RA 1VICA 3IOJA 4Q7CA 5CQLX 4CJBA 2WAWA 3GVDA 1I52A 1ZDFA 5J49A 1KRRA 1ON8A 2RJ1A 1JVDA 1TW5A 1TVYA 4H7OA 1VH1A 4NALA 1LXAA 1G1LA 3NGWA 1KGTA 4KNXA 2GGQA 4Y7GA 2DPWA 3I0JA 1R80A 1XATA 4IHGA 2E3DA 5C38A 1H7FA 5D91A 4KPXA 5JQQA 1QREA 1ZCYA 2AQ9A 1FRWA 2JCLA 1ZI4A 1ZJ1A 4KRVA 3SXAA 4B2XA 1V84A 2P73A 3OC9A 2RJ5A 1G23A 1FZWA 1NKHB 1HM9A 1R7YA 1KK6A 2OI5A 3PMOA 3K8EA 2W0VA 1H5SC 2CU2A 3U2XA 4HOCA 4E6UA 3V0NA 3BFPA 1Z2FA 1H3MA 1LZ0A 1M8NA 2RIXA 1QG8A 3OH2A 3R0SA 2XWMA 5DDTA 3JTJA 4MFGA 4KXOA 1ON6A 1T3DA 3OH3A 4HZDA 4FRDA 4B4BA 1IINA 3O3PA 3TK8A 3SXBA 1WT2A 3VBIA 4R37A 2IU8A 1VGZA 2VSHA 1E5KA 3EEVA 1NWGB 4R36A 3HJJA 2WE9A 1G95A 4N6AA 4EEOA 1QGQA 2FYAA 4HO6A 3D5NA 1WT1A 3OH4A 1YROB 4ECMA 1IIMA 1EWWA 4D0ZA 2AECA 1R81A 2RJ9A 1NQIB 1WT3A 1H7QA 2QGIA 2PGYA 1NHEB 1SSMA 3C8VA 1H5SB 5IDTA 3SX3A 1INIA 3I0FA 1VM8A 2O1HA 4G3PA 2FY7A 4J18A 1WVCA 1JV3A 3VBKA 1JYKA 4FQWA 2O1GA 2W0WA 3R3IA 3U2TA 3I3XA 2AM4A 1QGSA 5CMHA 5C47A 2FFUA 4MIXA 3SXGA 4IHFA 4FRHA 5DEPA 2C0NA 3V91A 1G97A 1GX4A 3I0KA 3VBLA 1XHDA 2BO8A 2WLEA 4FCUA 3V0LA 2FYBA 1PZTA 4Y6UA 3IOHA 3U0YA 3I0HA 4FRBA 4E1KA 5C3AA 3SX8A 1JVGA 3GQAA 2WLCA 3DHOA 2NXVA 2OEGA 4UEGA 2BO7A 3U2WA 3HL3A 3V0PA 2Z86A 4FRPA 5C1LA 4N6BA 2I7BA 3ZLKA 2RJ7A 1HJJA 1VGUA 4KT7A 2AESA 2FYDB 2J0BA 1SSTA 1KK5A 4B2WA 1V67A 4Y63A 3I0DA 3I0IX 4HO3A 3SX7A 1MP4A 4D0TA 1K4VA 4FIXA 5CQNX 4AYJA 1MR7A 2XMHA 4E6TA 3I0GA 1O23B 1GX0A 4N69A 4EEGA 1G9RA 2A8WA 2WEEA 4G3SA 1GQ9A 4EEMA 1QWJA 3TV0A 5FUHA 1VZXA 3FSCA 2X5SA 2JCKA 4KPZA 2OEFA 2XWLA 2D7IA 2RJ0A 1VGTA 2ICXA 2IUAA 3VBJA 1FO9A 3U2VA 3T57A 4Y7TA 3R5BA 1H5TA 2BO6A 4XWIA 5FV9A 4HO2A 3SXCA 5C36A 3Q80A 5EJZA 2P2OA 1ZJOA 1HM8A 2YESA 2ZU9A 1TZFA 5FTVA 1KWSA 4JD0A 4LW6A 4Y6NA 5HS2A 4EQYA 3BCVA 1LZJA 4EE4A 5EIYA 2ZU8A 4EE3A 4EVWA 3VNPA 2OI7A 1QRFA 4FRQA 3V0QA 2JF3A 2X5ZA 4D11A 3SPTA 3CKVA 2AE7A 3OGZA 4HO8A 2Y7AA 1ZIZA 5C4DA 4EAAA 5IDSA 3P47A 3OKRA 1W55A 1WSZA 3T7OA 3EG4A 4KNRA 4HO0A 3U0XA 1OCXA 3GOSA 5C4FA 1G2VA 3F1XA 1H4DA 2WVMA 3PKPA 1S4OA 2VSIA 4P00A 1H7HA 3KIAA 5CMIA 3MQGA 3T7MA 1VH3A 1N4IA 5C3BA 3R3RA 3IOIA 5DG3A 1PZYB 2QKXA 3R5CA 3IGJA 1O7OA 1YP3A 2JF2A 1S4PA 3BSYA
chains in the Genus database with same CATH topology
2RIZA 2YQJA 3E26A 3V0OA 5AJOA 2VS3A 4EA7A 1ZHJA 1LL0A 3TIOA 4GBPA 1MC3A 1HJLA 3I0CA 2AH9A 4B4GA 3ZGFA 2WLDA 4ARWA 3TZTA 4G87A 3DJ4A 4DECA 3Q4SA 2QIAA 4IRQA 1EZIA 2JCOA 2A8UA 3R5DA 4HO5A 2RJ6A 5DDVA 2UX8A 2FFVA 1TW1A 3FS8A 1XZ6A 1VGWA 4L41C 5CMGX 2WLFA 3RMVA 1HM0A 3VBPA 2YQSA 2Y6PA 5FU8A 3ZGGA 3BSSA 1LL3A 4Y7FA 1FWYA 2TDTA 3D8VA 4MZUA 1ZI3A 3E25A 3KWEA 5C3DA 5ADXV 3MC4A 1VPAA 1W77A 4M99A 1GA8A 1ZI1A 1R7UA 4HG6A 1FOAA 3ZLLA 4DDZA 4KQLA 4Y7VA 1GWVA 4LW3A 3CU0A 3VBNA 3FTTA 2V0IA 2Z87A 3N9WA 2PGVA 2YC5A 5C4EA 3Q1XA 4DCLA 4MYBA 1YP2A 3D98A 2FKOA 1GQCA 4R7PA 3R8YA 2FYCB 5FU0A 4M2BA 3FSXA 1Z90A 4AAWA 1FG5N 2Y4JA 1V83A 3I0LA 2P72A 2IC7A 3FSBA 4HZCA 4HURA 1S80A 3ST8A 3TISA 3CKNA 5C1HA 1KGQA 1THJA 1S4NA 3FSYA 5CMJA 2MZBA 3EH0A 4D48A 3JUKA 2V0HA 2PA4A 4AYLA 1OMZA 1QRLA 3JUJA 5CQPA 4KC4A 3CKQA 5FTSA 1ZJ3A 4CJCA 3PNNA 4FRLA 2NPOA 3LW6A 1G3LA 5C48A 2YQHA 2OI6A 3OTMA 5C49A 1TDTA 4M4KA 3U2UA 4MYOA 1KRUA 5C4BA 4EA9A 1R82A 3SRTA 4AA7A 1R7XA 3KWDA 5ADXU 4AC3A 2QH5A 1FXJA 4G3QA 1H5SA 1OQMB 4B4MA 1JV1A 1KHRA 5E3QA 3JQYA 3GUEA 2V0KA 3V4EA 3OU9A 4M2AA 3FWWA 2X65A 2YQCA 5AJPA 2VXLA 4BQHA 3K8DA 1ZCVA 1ZCTA 1KQAA 3CGXA 2AM5A 2D0JA 3SX5A 1WT0A 3USQA 3TQDA 4E75A 3SXDA 5I1FA 2BO4A 5AFUV 1ZJ0A 1FXOA 1LVWA 3F1YA 4ZDQA 3V8ZA 4ISXA 2ZU7A 1MR9A 2VS4A 2VFZA 4EE5A 3POLA 3F1CA 5C4CA 3DUVA 5EJ1A 1FR8A 2YCMA 3V8YA 3OTZA 4P02A 2VK9A 1FGGA 4IHHA 1H7EA 1H7LA 2I5EA 4N27A 4EABA 3OH1A 3RMWA 1H5RB 4FRMA 4FIYA 3DK5A 3IXCA 4BMAA 1KK4A 3R2WA 2QIVX 3V90A 5E3PA 1H5SD 4K6RA 2V0JA 2P6WA 1ZDGA 2AM3A 3FOQA 3ZF8A 3BRKX 4HUSA 1LL2A 4D11C 2ICYA 4FROA 2IU9A 1ZI5A 3USRA 3Q7UA 4O6NA 3OH0A 1MP3A 2VHEA 4IRPA 5C1GA 4KC2A 4Y62A 3R1WA 1JYLA 4E79A 4FCEA 4MNDA 4Y9XA 2Y4LA 3R5AA 3PKQA 4NAKA 1H4CA 2XATA 1V82A 4M9CA 5F42A 1YP4A 1G93A 2Q4JA 1NF5B 3KWCA 3EE5A 1H5TB 1VZTA 2AGDA 3TDTA 4EEAA 4JISA 3I0EA 3BXYA 5AFUU 1J2ZA 3QVBA 4YS8A 3NZ2A 1HV9A 2RJ4A 1R7VA 4DE7A 1W57A 1ZCUA 5CQMX 1H4EA 5IFYA 1G0RA 1H7TA 4CJ8A 1H7GA 3OUPA 3P1BA 2YC3A 1MP5A 1V3WA 1OMXA 2O1FA 4EA8A 1FO8A 1MRLA 4ASYA 4O6MA 2WLGA 1LZ7A 4KC1A 1QQ0A 3BSWA 2WVKA 1G8OA 2XMEA 2WGZA 2APCA 4FRAA 3SXEA 2RIJA 3TWDA 3T7NA 2J0AA 3MQHA 3CJ8A 1EYRA 1KRVA 3OAMA 1FR9A 1NMMB 4HO4A 4C2SA 3I3AA 1FGXA 2V0LA 4B42A 5L6VA 2VXMA 4EGGA 2RITA 5CQOA 1ZJPA 2JCJA 1QRGA 3OW5A 4FREA 2PX7A 1XHBA 1LZIA 2VS5A 5DEMA 1QRMA 3CKJA 5U2KA 1O0RA 2Y4MA 3CKOA 5FYEA 2X60A 2GGOA 2VD4A 1O7QA 1SSQA 3HSQA 1GWWA 1H5RA 2XWNA 4ASJA 4HO9A 3VBMA 4M28A 4M98A 3ECTA 5CMFX 4Y64A 1R7TA 4Y7UA 2RIYA 5D92A 4J09A 5L6SA 5AJNA 1ZJ2A 4B5BA 2Y4KA 4CVHA 4NANA 5E3RA 4NAIA 2WVLA 2RJ8A 4B3UA 2D7RA 1INJA 3V0MA 5BXCA 3RSBA 4HCQA 1SS9A 1VZUA 2I5KA 2E8BA 5C8RA 1VICA 3IOJA 4Q7CA 5CQLX 4CJBA 2WAWA 3GVDA 1I52A 1ZDFA 5J49A 1KRRA 1ON8A 2RJ1A 1JVDA 1TW5A 1TVYA 4H7OA 1VH1A 4NALA 1LXAA 1G1LA 3NGWA 1KGTA 4KNXA 2GGQA 4Y7GA 2DPWA 3I0JA 1R80A 1XATA 4IHGA 2E3DA 5C38A 1H7FA 5D91A 4KPXA 5JQQA 1QREA 1ZCYA 2AQ9A 1FRWA 2JCLA 1ZI4A 1ZJ1A 4KRVA 3SXAA 4B2XA 1V84A 2P73A 3OC9A 2RJ5A 1G23A 1FZWA 1NKHB 1HM9A 1R7YA 1KK6A 2OI5A 3PMOA 3K8EA 2W0VA 1H5SC 2CU2A 3U2XA 4HOCA 4E6UA 3V0NA 3BFPA 1H3MA 1LZ0A 2RIXA 1QG8A 3OH2A 3R0SA 2XWMA 5DDTA 3JTJA 4MFGA 4KXOA 1ON6A 1T3DA 4HZDA 3OH3A 4FRDA 4B4BA 1IINA 3O3PA 3TK8A 3SXBA 1WT2A 3VBIA 4R37A 2IU8A 1VGZA 2VSHA 1E5KA 3EEVA 1NWGB 4R36A 3HJJA 2WE9A 1G95A 4N6AA 4EEOA 1QGQA 2FYAA 4HO6A 3D5NA 1WT1A 3OH4A 1YROB 4ECMA 1IIMA 4D0ZA 2AECA 1R81A 2RJ9A 1NQIB 1WT3A 1H7QA 2QGIA 2PGYA 1NHEB 1SSMA 3C8VA 1H5SB 5IDTA 3SX3A 1INIA 3I0FA 1VM8A 2O1HA 4G3PA 2FY7A 4J18A 1WVCA 1JV3A 3VBKA 1JYKA 4FQWA 2O1GA 2W0WA 3R3IA 3U2TA 3I3XA 2AM4A 1QGSA 5CMHA 5C47A 2FFUA 4MIXA 3SXGA 4IHFA 4FRHA 5DEPA 2C0NA 3V91A 1G97A 1GX4A 3I0KA 3VBLA 1XHDA 2BO8A 2WLEA 4FCUA 3V0LA 2FYBA 1PZTA 4Y6UA 3IOHA 3U0YA 3I0HA 4FRBA 4E1KA 5C3AA 3SX8A 1JVGA 2WLCA 3DHOA 2NXVA 2OEGA 4UEGA 2BO7A 3U2WA 3HL3A 3V0PA 2Z86A 4FRPA 5C1LA 4N6BA 2I7BA 3ZLKA 2RJ7A 1HJJA 1VGUA 4KT7A 2AESA 2FYDB 2J0BA 1SSTA 1KK5A 4B2WA 1V67A 4Y63A 3I0DA 3I0IX 4HO3A 3SX7A 1MP4A 4D0TA 1K4VA 4FIXA 5CQNX 4AYJA 1MR7A 2XMHA 4E6TA 3I0GA 1O23B 1GX0A 4N69A 4EEGA 1G9RA 2A8WA 2WEEA 4G3SA 1GQ9A 4EEMA 1QWJA 3TV0A 5FUHA 1VZXA 3FSCA 2X5SA 2JCKA 4KPZA 2OEFA 2XWLA 2D7IA 2RJ0A 1VGTA 2ICXA 2IUAA 3VBJA 1FO9A 3U2VA 3T57A 4Y7TA 3R5BA 1H5TA 2BO6A 4XWIA 5FV9A 4HO2A 3SXCA 5C36A 3Q80A 5EJZA 2P2OA 1ZJOA 1HM8A 2YESA 2ZU9A 1TZFA 5FTVA 1KWSA 4JD0A 4LW6A 4Y6NA 5HS2A 4EQYA 3BCVA 1LZJA 4EE4A 5EIYA 2ZU8A 4EE3A 4EVWA 3VNPA 2OI7A 1QRFA 4FRQA 3V0QA 2JF3A 2X5ZA 4D11A 3SPTA 3CKVA 2AE7A 3OGZA 4HO8A 2Y7AA 1ZIZA 5C4DA 4EAAA 5IDSA 3P47A 3OKRA 1W55A 1WSZA 3T7OA 3EG4A 4KNRA 4HO0A 3U0XA 1OCXA 3GOSA 5C4FA 1G2VA 3F1XA 1H4DA 2WVMA 3PKPA 1S4OA 2VSIA 4P00A 1H7HA 3KIAA 5CMIA 3MQGA 3T7MA 1VH3A 5C3BA 3R3RA 3IOIA 5DG3A 1PZYB 2QKXA 3R5CA 3IGJA 1O7OA 1YP3A 2JF2A 1S4PA 3BSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RIZ A;  2YQJ A;  3E26 A;  3V0O A;  5AJO A;  2VS3 A;  4EA7 A;  1ZHJ A;  1LL0 A;  3TIO A;  4GBP A;  1MC3 A;  1HJL A;  3I0C A;  2AH9 A;  4B4G A;  3ZGF A;  2WLD A;  4ARW A;  3TZT A;  4G87 A;  3DJ4 A;  4DEC A;  3Q4S A;  2QIA A;  4IRQ A;  1EZI A;  2JCO A;  2A8U A;  3R5D A;  4HO5 A;  2RJ6 A;  5DDV A;  2UX8 A;  2FFV A;  1TW1 A;  3FS8 A;  1XZ6 A;  1VGW A;  4L41 C;  5CMG X;  2WLF A;  3RMV A;  1HM0 A;  3VBP A;  2YQS A;  2Y6P A;  5FU8 A;  3ZGG A;  3BSS A;  1LL3 A;  4Y7F A;  1FWY A;  2TDT A;  3D8V A;  4MZU A;  1ZI3 A;  3E25 A;  3KWE A;  5C3D A;  5ADX V;  3MC4 A;  1VPA A;  1W77 A;  4M99 A;  1GA8 A;  1ZI1 A;  1R7U A;  4HG6 A;  1FOA A;  3ZLL A;  4DDZ A;  4KQL A;  4Y7V A;  1GWV A;  4LW3 A;  3CU0 A;  3VBN A;  3FTT A;  2V0I A;  2Z87 A;  3N9W A;  2PGV A;  2YC5 A;  5C4E A;  3Q1X A;  4DCL A;  4MYB A;  1YP2 A;  3D98 A;  2FKO A;  1GQC A;  4R7P A;  3R8Y A;  2FYC B;  5FU0 A;  4M2B A;  3FSX A;  1Z90 A;  4AAW A;  1FG5 N;  2Y4J A;  1V83 A;  3I0L A;  2P72 A;  2IC7 A;  3FSB A;  4HZC A;  4HUR A;  1S80 A;  3ST8 A;  3TIS A;  3CKN A;  5C1H A;  1KGQ A;  1THJ A;  1S4N A;  3FSY A;  5CMJ A;  2MZB A;  3EH0 A;  4D48 A;  3JUK A;  2V0H A;  2PA4 A;  4AYL A;  1OMZ A;  1QRL A;  3JUJ A;  5CQP A;  4KC4 A;  3CKQ A;  5FTS A;  1ZJ3 A;  4CJC A;  3PNN A;  4FRL A;  2NPO A;  3LW6 A;  1G3L A;  5C48 A;  2YQH A;  2OI6 A;  3OTM A;  5C49 A;  1TDT A;  4M4K A;  3U2U A;  4MYO A;  1KRU A;  5C4B A;  4EA9 A;  1R82 A;  3SRT A;  4AA7 A;  1R7X A;  3KWD A;  5ADX U;  4AC3 A;  2QH5 A;  1FXJ A;  4G3Q A;  1H5S A;  1OQM B;  4B4M A;  1JV1 A;  1KHR A;  5E3Q A;  3JQY A;  3GUE A;  2V0K A;  3V4E A;  3OU9 A;  4M2A A;  3FWW A;  2X65 A;  2YQC A;  5AJP A;  2VXL A;  4BQH A;  3K8D A;  1ZCV A;  1ZCT A;  1KQA A;  3CGX A;  2AM5 A;  2D0J A;  3SX5 A;  1WT0 A;  3USQ A;  3TQD A;  4E75 A;  3SXD A;  5I1F A;  2BO4 A;  5AFU V;  1ZJ0 A;  1FXO A;  1LVW A;  3F1Y A;  4ZDQ A;  3V8Z A;  4ISX A;  2ZU7 A;  1MR9 A;  2VS4 A;  2VFZ A;  4EE5 A;  3POL A;  3F1C A;  5C4C A;  3DUV A;  5EJ1 A;  1FR8 A;  2YCM A;  3V8Y A;  3OTZ A;  4P02 A;  1FGG A;  4IHH A;  1H7E A;  1H7L A;  2I5E A;  4N27 A;  4EAB A;  3OH1 A;  3RMW A;  1H5R B;  4FRM A;  3DK5 A;  3IXC A;  4BMA A;  1KK4 A;  3R2W A;  2QIV X;  3V90 A;  5E3P A;  1H5S D;  4K6R A;  2V0J A;  2P6W A;  1ZDG A;  2AM3 A;  3FOQ A;  3ZF8 A;  3BRK X;  4HUS A;  1LL2 A;  4D11 C;  2ICY A;  4FRO A;  2IU9 A;  1ZI5 A;  3USR A;  3Q7U A;  3OH0 A;  1MP3 A;  2VHE A;  4IRP A;  5C1G A;  4KC2 A;  4Y62 A;  3R1W A;  1JYL A;  4E79 A;  4FCE A;  4MND A;  4Y9X A;  2Y4L A;  3R5A A;  3PKQ A;  4NAK A;  1H4C A;  2XAT A;  1V82 A;  4M9C A;  5F42 A;  1YP4 A;  1G93 A;  2Q4J A;  1NF5 B;  3KWC A;  3EE5 A;  1H5T B;  1VZT A;  2AGD A;  3TDT A;  4EEA A;  4JIS A;  3I0E A;  3BXY A;  5AFU U;  1J2Z A;  3QVB A;  4YS8 A;  3NZ2 A;  1HV9 A;  2RJ4 A;  1R7V A;  4DE7 A;  1W57 A;  1ZCU A;  5CQM X;  1H4E A;  5IFY A;  1G0R A;  1H7T A;  4CJ8 A;  1H7G A;  3OUP A;  3P1B A;  2YC3 A;  1MP5 A;  1V3W A;  1OMX A;  2O1F A;  4EA8 A;  1FO8 A;  1MRL A;  4ASY A;  2WLG A;  1LZ7 A;  4KC1 A;  1QQ0 A;  3BSW A;  2WVK A;  1G8O A;  2XME A;  2WGZ A;  2APC A;  4FRA A;  3SXE A;  2RIJ A;  3TWD A;  3T7N A;  3MQH A;  3CJ8 A;  1EYR A;  1KRV A;  3OAM A;  1FR9 A;  1NMM B;  4HO4 A;  4C2S A;  3I3A A;  1FGX A;  2V0L A;  4B42 A;  5L6V A;  2VXM A;  4EGG A;  2RIT A;  5CQO A;  1ZJP A;  2JCJ A;  1QRG A;  3OW5 A;  4FRE A;  2PX7 A;  1XHB A;  1LZI A;  2VS5 A;  5DEM A;  1QRM A;  3CKJ A;  5U2K A;  1O0R A;  2Y4M A;  3CKO A;  5FYE A;  2X60 A;  2GGO A;  2VD4 A;  1O7Q A;  1SSQ A;  3HSQ A;  1GWW A;  1H5R A;  2XWN A;  4ASJ A;  4HO9 A;  3VBM A;  4M28 A;  4M98 A;  3ECT A;  5CMF X;  4Y64 A;  1R7T A;  4Y7U A;  2RIY A;  4J09 A;  5L6S A;  5AJN A;  1ZJ2 A;  4B5B A;  2Y4K A;  4CVH A;  4NAN A;  5E3R A;  4NAI A;  2WVL A;  2RJ8 A;  4B3U A;  2D7R A;  1INJ A;  3V0M A;  5BXC A;  3RSB A;  4HCQ A;  1SS9 A;  1VZU A;  2I5K A;  2E8B A;  5C8R A;  1VIC A;  3IOJ A;  5CQL X;  4CJB A;  2WAW A;  3GVD A;  1I52 A;  1ZDF A;  5J49 A;  1KRR A;  1ON8 A;  2RJ1 A;  1JVD A;  1TW5 A;  1TVY A;  4H7O A;  1VH1 A;  4NAL A;  1LXA A;  1G1L A;  3NGW A;  1KGT A;  4KNX A;  2GGQ A;  4Y7G A;  2DPW A;  3I0J A;  1R80 A;  1XAT A;  4IHG A;  2E3D A;  5C38 A;  1H7F A;  4KPX A;  5JQQ A;  1QRE A;  1ZCY A;  2AQ9 A;  1FRW A;  2JCL A;  1ZI4 A;  1ZJ1 A;  4KRV A;  3SXA A;  4B2X A;  1V84 A;  2P73 A;  3OC9 A;  2RJ5 A;  1G23 A;  1FZW A;  1NKH B;  1HM9 A;  1R7Y A;  1KK6 A;  2OI5 A;  3PMO A;  3K8E A;  2W0V A;  1H5S C;  2CU2 A;  3U2X A;  4HOC A;  4E6U A;  3V0N A;  3BFP A;  1H3M A;  1LZ0 A;  2RIX A;  1QG8 A;  3OH2 A;  3R0S A;  2XWM A;  5DDT A;  3JTJ A;  4MFG A;  4KXO A;  1ON6 A;  1T3D A;  4HZD A;  3OH3 A;  4FRD A;  4B4B A;  1IIN A;  3O3P A;  3TK8 A;  3SXB A;  1WT2 A;  3VBI A;  4R37 A;  2IU8 A;  1VGZ A;  2VSH A;  1E5K A;  3EEV A;  1NWG B;  4R36 A;  3HJJ A;  2WE9 A;  1G95 A;  4N6A A;  4EEO A;  1QGQ A;  2FYA A;  4HO6 A;  3D5N A;  1WT1 A;  3OH4 A;  1YRO B;  4ECM A;  1IIM A;  4D0Z A;  2AEC A;  1R81 A;  2RJ9 A;  1NQI B;  1WT3 A;  1H7Q A;  2QGI A;  2PGY A;  1NHE B;  1SSM A;  3C8V A;  1H5S B;  5IDT A;  3SX3 A;  1INI A;  3I0F A;  1VM8 A;  2O1H A;  4G3P A;  2FY7 A;  4J18 A;  1WVC A;  1JV3 A;  3VBK A;  1JYK A;  4FQW A;  2O1G A;  2W0W A;  3R3I A;  3U2T A;  3I3X A;  2AM4 A;  1QGS A;  5CMH A;  5C47 A;  2FFU A;  3SXG A;  4IHF A;  4FRH A;  5DEP A;  3V91 A;  1G97 A;  1GX4 A;  3I0K A;  3VBL A;  1XHD A;  2BO8 A;  2WLE A;  4FCU A;  3V0L A;  2FYB A;  1PZT A;  4Y6U A;  3IOH A;  3U0Y A;  3I0H A;  4FRB A;  4E1K A;  5C3A A;  3SX8 A;  1JVG A;  2WLC A;  3DHO A;  2NXV A;  2OEG A;  4UEG A;  2BO7 A;  3U2W A;  3HL3 A;  3V0P A;  2Z86 A;  4FRP A;  5C1L A;  4N6B A;  2I7B A;  3ZLK A;  2RJ7 A;  1HJJ A;  1VGU A;  4KT7 A;  2AES A;  2FYD B;  1SST A;  1KK5 A;  4B2W A;  1V67 A;  4Y63 A;  3I0D A;  3I0I X;  4HO3 A;  3SX7 A;  1MP4 A;  4D0T A;  1K4V A;  5CQN X;  4AYJ A;  1MR7 A;  2XMH A;  4E6T A;  3I0G A;  1O23 B;  1GX0 A;  4N69 A;  4EEG A;  1G9R A;  2A8W A;  2WEE A;  4G3S A;  1GQ9 A;  4EEM A;  1QWJ A;  3TV0 A;  5FUH A;  1VZX A;  3FSC A;  2X5S A;  2JCK A;  4KPZ A;  2OEF A;  2XWL A;  2D7I A;  2RJ0 A;  1VGT A;  2ICX A;  2IUA A;  3VBJ A;  1FO9 A;  3U2V A;  3T57 A;  4Y7T A;  3R5B A;  1H5T A;  2BO6 A;  4XWI A;  5FV9 A;  4HO2 A;  3SXC A;  5C36 A;  3Q80 A;  5EJZ A;  2P2O A;  1ZJO A;  1HM8 A;  2YES A;  2ZU9 A;  1TZF A;  5FTV A;  1KWS A;  4JD0 A;  4LW6 A;  4Y6N A;  5HS2 A;  4EQY A;  3BCV A;  1LZJ A;  4EE4 A;  5EIY A;  2ZU8 A;  4EE3 A;  4EVW A;  3VNP A;  2OI7 A;  1QRF A;  4FRQ A;  3V0Q A;  2JF3 A;  2X5Z A;  4D11 A;  3SPT A;  3CKV A;  2AE7 A;  3OGZ A;  4HO8 A;  2Y7A A;  1ZIZ A;  5C4D A;  4EAA A;  5IDS A;  3P47 A;  3OKR A;  1W55 A;  1WSZ A;  3T7O A;  3EG4 A;  4KNR A;  4HO0 A;  3U0X A;  1OCX A;  3GOS A;  5C4F A;  1G2V A;  3F1X A;  1H4D A;  2WVM A;  3PKP A;  1S4O A;  2VSI A;  4P00 A;  1H7H A;  3KIA A;  5CMI A;  3MQG A;  3T7M A;  1VH3 A;  5C3B A;  3R3R A;  3IOI A;  5DG3 A;  1PZY B;  2QKX A;  3R5C A;  3IGJ A;  1O7O A;  1YP3 A;  2JF2 A;  1S4P A;  3BSY A; 
#chains in the Genus database with same CATH topology
 2RIZ A;  2YQJ A;  3E26 A;  3V0O A;  5AJO A;  2VS3 A;  4EA7 A;  1ZHJ A;  1LL0 A;  3TIO A;  4GBP A;  1MC3 A;  1HJL A;  3I0C A;  2AH9 A;  4B4G A;  3ZGF A;  2WLD A;  4ARW A;  3TZT A;  4G87 A;  3DJ4 A;  4DEC A;  3Q4S A;  2QIA A;  4IRQ A;  1EZI A;  2JCO A;  2A8U A;  1L0S A;  3R5D A;  2RJ6 A;  4HO5 A;  5DDV A;  2UX8 A;  2FFV A;  1TW1 A;  3FS8 A;  1XZ6 A;  1VGW A;  4L41 C;  5CMG X;  2WLF A;  3RMV A;  1HM0 A;  3VBP A;  2YQS A;  2Y6P A;  5FU8 A;  3ZGG A;  3BSS A;  1LL3 A;  4Y7F A;  1FWY A;  2TDT A;  3D8V A;  4MZU A;  1ZI3 A;  3E25 A;  3KWE A;  5C3D A;  5ADX V;  3MC4 A;  1VPA A;  1W77 A;  4M99 A;  1GA8 A;  1ZI1 A;  1R7U A;  4HG6 A;  1FOA A;  3ZLL A;  4DDZ A;  4KQL A;  4Y7V A;  1GWV A;  4LW3 A;  3CU0 A;  3VBN A;  3FTT A;  2V0I A;  2Z87 A;  3N9W A;  2PGV A;  2YC5 A;  5C4E A;  3Q1X A;  4DCL A;  4MYB A;  1YP2 A;  3D98 A;  2FKO A;  1GQC A;  4R7P A;  3R8Y A;  2FYC B;  5FU0 A;  4M2B A;  3FSX A;  1Z90 A;  4AAW A;  1FG5 N;  2Y4J A;  1V83 A;  3I0L A;  2P72 A;  2IC7 A;  3FSB A;  4HZC A;  4HUR A;  1S80 A;  3ST8 A;  3TIS A;  3CKN A;  5C1H A;  1KGQ A;  1THJ A;  1S4N A;  3FSY A;  5CMJ A;  2MZB A;  3EH0 A;  3SUC A;  4D48 A;  3JUK A;  2V0H A;  2PA4 A;  4AYL A;  1OMZ A;  1QRL A;  3JUJ A;  5CQP A;  4KC4 A;  3CKQ A;  5FTS A;  1ZJ3 A;  4CJC A;  3PNN A;  4FRL A;  2NPO A;  3LW6 A;  1G3L A;  5C48 A;  2YQH A;  2OI6 A;  3GQ7 A;  3OTM A;  5C49 A;  1TDT A;  4M4K A;  3U2U A;  4MYO A;  1KRU A;  5C4B A;  4EA9 A;  1R82 A;  3SRT A;  4AA7 A;  1R7X A;  3KWD A;  5ADX U;  4AC3 A;  2QH5 A;  1FXJ A;  4G3Q A;  1H5S A;  1OQM B;  4B4M A;  3GQ8 A;  1JV1 A;  1KHR A;  5E3Q A;  3JQY A;  3GUE A;  2V0K A;  3V4E A;  3OU9 A;  4M2A A;  3FWW A;  2X65 A;  2YQC A;  5AJP A;  2VXL A;  4BQH A;  3K8D A;  1ZCV A;  1ZCT A;  1KQA A;  3CGX A;  2AM5 A;  2D0J A;  3SX5 A;  1WT0 A;  3USQ A;  3TQD A;  4E75 A;  3SXD A;  5I1F A;  2BO4 A;  5AFU V;  1ZJ0 A;  1FXO A;  1LVW A;  3F1Y A;  4ZDQ A;  3V8Z A;  4ISX A;  2ZU7 A;  1MR9 A;  2VS4 A;  2VFZ A;  4EE5 A;  3POL A;  3F1C A;  5C4C A;  3DUV A;  5EJ1 A;  1FR8 A;  2YCM A;  3V8Y A;  3OTZ A;  4P02 A;  2VK9 A;  1FGG A;  4IHH A;  1H7E A;  1H7L A;  2I5E A;  4N27 A;  4EAB A;  3OH1 A;  3RMW A;  1H5R B;  4FRM A;  4FIY A;  3DK5 A;  3IXC A;  4BMA A;  1KK4 A;  3R2W A;  2QIV X;  3V90 A;  5E3P A;  1H5S D;  4K6R A;  2V0J A;  2P6W A;  1ZDG A;  2AM3 A;  3FOQ A;  3ZF8 A;  3BRK X;  4HUS A;  1LL2 A;  3GQ9 A;  4D11 C;  2ICY A;  4FRO A;  2IU9 A;  1ZI5 A;  3USR A;  3Q7U A;  4O6N A;  3OH0 A;  1MP3 A;  2VHE A;  4IRP A;  5C1G A;  4KC2 A;  4Y62 A;  3R1W A;  1JYL A;  4E79 A;  4FCE A;  4MND A;  4Y9X A;  2Y4L A;  3R5A A;  3PKQ A;  4NAK A;  1H4C A;  2XAT A;  1V82 A;  4M9C A;  5F42 A;  1YP4 A;  1G93 A;  2Q4J A;  1NF5 B;  3KWC A;  3EE5 A;  1H5T B;  1VZT A;  2AGD A;  3TDT A;  4EEA A;  4JIS A;  3I0E A;  3BXY A;  5AFU U;  1J2Z A;  3QVB A;  4YS8 A;  3NZ2 A;  1HV9 A;  2RJ4 A;  1R7V A;  4DE7 A;  1W57 A;  1ZCU A;  5CQM X;  1H4E A;  5IFY A;  1G0R A;  1H7T A;  4CJ8 A;  1H7G A;  3OUP A;  3P1B A;  2YC3 A;  1MP5 A;  1V3W A;  1OMX A;  2O1F A;  4EA8 A;  1FO8 A;  1MRL A;  4ASY A;  4O6M A;  2WLG A;  1LZ7 A;  4KC1 A;  1QQ0 A;  3BSW A;  2WVK A;  1G8O A;  2XME A;  2WGZ A;  2APC A;  4FRA A;  3SXE A;  2RIJ A;  3TWD A;  3T7N A;  2J0A A;  3MQH A;  3CJ8 A;  1EYR A;  1KRV A;  3OAM A;  1FR9 A;  1NMM B;  4HO4 A;  4C2S A;  3I3A A;  1FGX A;  2V0L A;  4B42 A;  5L6V A;  2VXM A;  4EGG A;  2RIT A;  5CQO A;  1ZJP A;  2JCJ A;  1QRG A;  3OW5 A;  4FRE A;  2PX7 A;  1XHB A;  1LZI A;  2VS5 A;  5DEM A;  1QRM A;  3CKJ A;  5U2K A;  1O0R A;  2Y4M A;  3CKO A;  5FYE A;  2X60 A;  2VD4 A;  2GGO A;  1O7Q A;  1SSQ A;  3HSQ A;  1GWW A;  1H5R A;  2XWN A;  4ASJ A;  4HO9 A;  3VBM A;  4M28 A;  4M98 A;  3ECT A;  5CMF X;  4Y64 A;  1R7T A;  4Y7U A;  2RIY A;  5D92 A;  4J09 A;  5L6S A;  5AJN A;  1ZJ2 A;  4B5B A;  2Y4K A;  4CVH A;  4NAN A;  5E3R A;  4NAI A;  2WVL A;  2RJ8 A;  4B3U A;  2D7R A;  1INJ A;  3V0M A;  5BXC A;  3RSB A;  4HCQ A;  1SS9 A;  1VZU A;  2I5K A;  2E8B A;  5C8R A;  1VIC A;  3IOJ A;  4Q7C A;  5CQL X;  4CJB A;  2WAW A;  3GVD A;  1I52 A;  1ZDF A;  5J49 A;  1KRR A;  1ON8 A;  2RJ1 A;  1JVD A;  1TW5 A;  1TVY A;  4H7O A;  1VH1 A;  4NAL A;  1LXA A;  1G1L A;  3NGW A;  1KGT A;  4KNX A;  2GGQ A;  4Y7G A;  2DPW A;  3I0J A;  1R80 A;  1XAT A;  4IHG A;  2E3D A;  5C38 A;  1H7F A;  5D91 A;  4KPX A;  5JQQ A;  1QRE A;  1ZCY A;  2AQ9 A;  1FRW A;  2JCL A;  1ZI4 A;  1ZJ1 A;  4KRV A;  3SXA A;  4B2X A;  1V84 A;  2P73 A;  3OC9 A;  2RJ5 A;  1G23 A;  1FZW A;  1NKH B;  1HM9 A;  1R7Y A;  1KK6 A;  2OI5 A;  3PMO A;  3K8E A;  2W0V A;  1H5S C;  2CU2 A;  3U2X A;  4HOC A;  4E6U A;  3V0N A;  3BFP A;  1Z2F A;  1H3M A;  1LZ0 A;  1M8N A;  2RIX A;  1QG8 A;  3OH2 A;  3R0S A;  2XWM A;  5DDT A;  3JTJ A;  4MFG A;  4KXO A;  1ON6 A;  1T3D A;  3OH3 A;  4HZD A;  4FRD A;  4B4B A;  1IIN A;  3O3P A;  3TK8 A;  3SXB A;  1WT2 A;  3VBI A;  4R37 A;  2IU8 A;  1VGZ A;  2VSH A;  1E5K A;  3EEV A;  1NWG B;  4R36 A;  3HJJ A;  2WE9 A;  1G95 A;  4N6A A;  4EEO A;  1QGQ A;  2FYA A;  4HO6 A;  3D5N A;  1WT1 A;  3OH4 A;  1YRO B;  4ECM A;  1IIM A;  1EWW A;  4D0Z A;  2AEC A;  1R81 A;  2RJ9 A;  1NQI B;  1WT3 A;  1H7Q A;  2QGI A;  2PGY A;  1NHE B;  1SSM A;  3C8V A;  1H5S B;  5IDT A;  3SX3 A;  1INI A;  3I0F A;  1VM8 A;  2O1H A;  4G3P A;  2FY7 A;  4J18 A;  1WVC A;  1JV3 A;  3VBK A;  1JYK A;  4FQW A;  2O1G A;  2W0W A;  3R3I A;  3U2T A;  3I3X A;  2AM4 A;  1QGS A;  5CMH A;  5C47 A;  2FFU A;  4MIX A;  3SXG A;  4IHF A;  4FRH A;  5DEP A;  2C0N A;  3V91 A;  1G97 A;  1GX4 A;  3I0K A;  3VBL A;  1XHD A;  2BO8 A;  2WLE A;  4FCU A;  3V0L A;  2FYB A;  1PZT A;  4Y6U A;  3IOH A;  3U0Y A;  3I0H A;  4FRB A;  4E1K A;  5C3A A;  3SX8 A;  1JVG A;  3GQA A;  2WLC A;  3DHO A;  2NXV A;  2OEG A;  4UEG A;  2BO7 A;  3U2W A;  3HL3 A;  3V0P A;  2Z86 A;  4FRP A;  5C1L A;  4N6B A;  2I7B A;  3ZLK A;  2RJ7 A;  1HJJ A;  1VGU A;  4KT7 A;  2AES A;  2FYD B;  2J0B A;  1SST A;  1KK5 A;  4B2W A;  1V67 A;  4Y63 A;  3I0D A;  3I0I X;  4HO3 A;  3SX7 A;  1MP4 A;  4D0T A;  1K4V A;  4FIX A;  5CQN X;  4AYJ A;  1MR7 A;  2XMH A;  4E6T A;  3I0G A;  1O23 B;  1GX0 A;  4N69 A;  4EEG A;  1G9R A;  2A8W A;  2WEE A;  4G3S A;  1GQ9 A;  4EEM A;  1QWJ A;  3TV0 A;  5FUH A;  1VZX A;  3FSC A;  2X5S A;  2JCK A;  4KPZ A;  2OEF A;  2XWL A;  2D7I A;  2RJ0 A;  1VGT A;  2ICX A;  2IUA A;  3VBJ A;  1FO9 A;  3U2V A;  3T57 A;  4Y7T A;  3R5B A;  1H5T A;  2BO6 A;  4XWI A;  5FV9 A;  4HO2 A;  3SXC A;  5C36 A;  3Q80 A;  5EJZ A;  2P2O A;  1ZJO A;  1HM8 A;  2YES A;  2ZU9 A;  1TZF A;  5FTV A;  1KWS A;  4JD0 A;  4LW6 A;  4Y6N A;  5HS2 A;  4EQY A;  3BCV A;  1LZJ A;  4EE4 A;  5EIY A;  2ZU8 A;  4EE3 A;  4EVW A;  3VNP A;  2OI7 A;  1QRF A;  4FRQ A;  3V0Q A;  2JF3 A;  2X5Z A;  4D11 A;  3SPT A;  3CKV A;  2AE7 A;  3OGZ A;  4HO8 A;  2Y7A A;  1ZIZ A;  5C4D A;  4EAA A;  5IDS A;  3P47 A;  3OKR A;  1W55 A;  1WSZ A;  3T7O A;  3EG4 A;  4KNR A;  4HO0 A;  3U0X A;  1OCX A;  3GOS A;  5C4F A;  1G2V A;  3F1X A;  1H4D A;  2WVM A;  3PKP A;  1S4O A;  2VSI A;  4P00 A;  1H7H A;  3KIA A;  5CMI A;  3MQG A;  3T7M A;  1VH3 A;  1N4I A;  5C3B A;  3R3R A;  3IOI A;  5DG3 A;  1PZY B;  2QKX A;  3R5C A;  3IGJ A;  1O7O A;  1YP3 A;  2JF2 A;  1S4P A;  3BSY A; 
#chains in the Genus database with same CATH homology
 2RIZ A;  2YQJ A;  3E26 A;  3V0O A;  5AJO A;  2VS3 A;  4EA7 A;  1ZHJ A;  1LL0 A;  3TIO A;  4GBP A;  1MC3 A;  1HJL A;  3I0C A;  2AH9 A;  4B4G A;  3ZGF A;  2WLD A;  4ARW A;  3TZT A;  4G87 A;  3DJ4 A;  4DEC A;  3Q4S A;  2QIA A;  4IRQ A;  1EZI A;  2JCO A;  2A8U A;  3R5D A;  4HO5 A;  2RJ6 A;  5DDV A;  2UX8 A;  2FFV A;  1TW1 A;  3FS8 A;  1XZ6 A;  1VGW A;  4L41 C;  5CMG X;  2WLF A;  3RMV A;  1HM0 A;  3VBP A;  2YQS A;  2Y6P A;  5FU8 A;  3ZGG A;  3BSS A;  1LL3 A;  4Y7F A;  1FWY A;  2TDT A;  3D8V A;  4MZU A;  1ZI3 A;  3E25 A;  3KWE A;  5C3D A;  5ADX V;  3MC4 A;  1VPA A;  1W77 A;  4M99 A;  1GA8 A;  1ZI1 A;  1R7U A;  4HG6 A;  1FOA A;  3ZLL A;  4DDZ A;  4KQL A;  4Y7V A;  1GWV A;  4LW3 A;  3CU0 A;  3VBN A;  3FTT A;  2V0I A;  2Z87 A;  3N9W A;  2PGV A;  2YC5 A;  5C4E A;  3Q1X A;  4DCL A;  4MYB A;  1YP2 A;  3D98 A;  2FKO A;  1GQC A;  4R7P A;  3R8Y A;  2FYC B;  5FU0 A;  4M2B A;  3FSX A;  1Z90 A;  4AAW A;  1FG5 N;  2Y4J A;  1V83 A;  3I0L A;  2P72 A;  2IC7 A;  3FSB A;  4HZC A;  4HUR A;  1S80 A;  3ST8 A;  3TIS A;  3CKN A;  5C1H A;  1KGQ A;  1THJ A;  1S4N A;  3FSY A;  5CMJ A;  2MZB A;  3EH0 A;  4D48 A;  3JUK A;  2V0H A;  2PA4 A;  4AYL A;  1OMZ A;  1QRL A;  3JUJ A;  5CQP A;  4KC4 A;  3CKQ A;  5FTS A;  1ZJ3 A;  4CJC A;  3PNN A;  4FRL A;  2NPO A;  3LW6 A;  1G3L A;  5C48 A;  2YQH A;  2OI6 A;  3OTM A;  5C49 A;  1TDT A;  4M4K A;  3U2U A;  4MYO A;  1KRU A;  5C4B A;  4EA9 A;  1R82 A;  3SRT A;  4AA7 A;  1R7X A;  3KWD A;  5ADX U;  4AC3 A;  2QH5 A;  1FXJ A;  4G3Q A;  1H5S A;  1OQM B;  4B4M A;  1JV1 A;  1KHR A;  5E3Q A;  3JQY A;  3GUE A;  2V0K A;  3V4E A;  3OU9 A;  4M2A A;  3FWW A;  2X65 A;  2YQC A;  5AJP A;  2VXL A;  4BQH A;  3K8D A;  1ZCV A;  1ZCT A;  1KQA A;  3CGX A;  2AM5 A;  2D0J A;  3SX5 A;  1WT0 A;  3USQ A;  3TQD A;  4E75 A;  3SXD A;  5I1F A;  2BO4 A;  5AFU V;  1ZJ0 A;  1FXO A;  1LVW A;  3F1Y A;  4ZDQ A;  3V8Z A;  4ISX A;  2ZU7 A;  1MR9 A;  2VS4 A;  2VFZ A;  4EE5 A;  3POL A;  3F1C A;  5C4C A;  3DUV A;  5EJ1 A;  1FR8 A;  2YCM A;  3V8Y A;  3OTZ A;  4P02 A;  2VK9 A;  1FGG A;  4IHH A;  1H7E A;  1H7L A;  2I5E A;  4N27 A;  4EAB A;  3OH1 A;  3RMW A;  1H5R B;  4FRM A;  4FIY A;  3DK5 A;  3IXC A;  4BMA A;  1KK4 A;  3R2W A;  2QIV X;  3V90 A;  5E3P A;  1H5S D;  4K6R A;  2V0J A;  2P6W A;  1ZDG A;  2AM3 A;  3FOQ A;  3ZF8 A;  3BRK X;  4HUS A;  1LL2 A;  4D11 C;  2ICY A;  4FRO A;  2IU9 A;  1ZI5 A;  3USR A;  3Q7U A;  4O6N A;  3OH0 A;  1MP3 A;  2VHE A;  4IRP A;  5C1G A;  4KC2 A;  4Y62 A;  3R1W A;  1JYL A;  4E79 A;  4FCE A;  4MND A;  4Y9X A;  2Y4L A;  3R5A A;  3PKQ A;  4NAK A;  1H4C A;  2XAT A;  1V82 A;  4M9C A;  5F42 A;  1YP4 A;  1G93 A;  2Q4J A;  1NF5 B;  3KWC A;  3EE5 A;  1H5T B;  1VZT A;  2AGD A;  3TDT A;  4EEA A;  4JIS A;  3I0E A;  3BXY A;  5AFU U;  1J2Z A;  3QVB A;  4YS8 A;  3NZ2 A;  1HV9 A;  2RJ4 A;  1R7V A;  4DE7 A;  1W57 A;  1ZCU A;  5CQM X;  1H4E A;  5IFY A;  1G0R A;  1H7T A;  4CJ8 A;  1H7G A;  3OUP A;  3P1B A;  2YC3 A;  1MP5 A;  1V3W A;  1OMX A;  2O1F A;  4EA8 A;  1FO8 A;  1MRL A;  4ASY A;  4O6M A;  2WLG A;  1LZ7 A;  4KC1 A;  1QQ0 A;  3BSW A;  2WVK A;  1G8O A;  2XME A;  2WGZ A;  2APC A;  4FRA A;  3SXE A;  2RIJ A;  3TWD A;  3T7N A;  2J0A A;  3MQH A;  3CJ8 A;  1EYR A;  1KRV A;  3OAM A;  1FR9 A;  1NMM B;  4HO4 A;  4C2S A;  3I3A A;  1FGX A;  2V0L A;  4B42 A;  5L6V A;  2VXM A;  4EGG A;  2RIT A;  5CQO A;  1ZJP A;  2JCJ A;  1QRG A;  3OW5 A;  4FRE A;  2PX7 A;  1XHB A;  1LZI A;  2VS5 A;  5DEM A;  1QRM A;  3CKJ A;  5U2K A;  1O0R A;  2Y4M A;  3CKO A;  5FYE A;  2X60 A;  2GGO A;  2VD4 A;  1O7Q A;  1SSQ A;  3HSQ A;  1GWW A;  1H5R A;  2XWN A;  4ASJ A;  4HO9 A;  3VBM A;  4M28 A;  4M98 A;  3ECT A;  5CMF X;  4Y64 A;  1R7T A;  4Y7U A;  2RIY A;  5D92 A;  4J09 A;  5L6S A;  5AJN A;  1ZJ2 A;  4B5B A;  2Y4K A;  4CVH A;  4NAN A;  5E3R A;  4NAI A;  2WVL A;  2RJ8 A;  4B3U A;  2D7R A;  1INJ A;  3V0M A;  5BXC A;  3RSB A;  4HCQ A;  1SS9 A;  1VZU A;  2I5K A;  2E8B A;  5C8R A;  1VIC A;  3IOJ A;  4Q7C A;  5CQL X;  4CJB A;  2WAW A;  3GVD A;  1I52 A;  1ZDF A;  5J49 A;  1KRR A;  1ON8 A;  2RJ1 A;  1JVD A;  1TW5 A;  1TVY A;  4H7O A;  1VH1 A;  4NAL A;  1LXA A;  1G1L A;  3NGW A;  1KGT A;  4KNX A;  2GGQ A;  4Y7G A;  2DPW A;  3I0J A;  1R80 A;  1XAT A;  4IHG A;  2E3D A;  5C38 A;  1H7F A;  5D91 A;  4KPX A;  5JQQ A;  1QRE A;  1ZCY A;  2AQ9 A;  1FRW A;  2JCL A;  1ZI4 A;  1ZJ1 A;  4KRV A;  3SXA A;  4B2X A;  1V84 A;  2P73 A;  3OC9 A;  2RJ5 A;  1G23 A;  1FZW A;  1NKH B;  1HM9 A;  1R7Y A;  1KK6 A;  2OI5 A;  3PMO A;  3K8E A;  2W0V A;  1H5S C;  2CU2 A;  3U2X A;  4HOC A;  4E6U A;  3V0N A;  3BFP A;  1H3M A;  1LZ0 A;  2RIX A;  1QG8 A;  3OH2 A;  3R0S A;  2XWM A;  5DDT A;  3JTJ A;  4MFG A;  4KXO A;  1ON6 A;  1T3D A;  4HZD A;  3OH3 A;  4FRD A;  4B4B A;  1IIN A;  3O3P A;  3TK8 A;  3SXB A;  1WT2 A;  3VBI A;  4R37 A;  2IU8 A;  1VGZ A;  2VSH A;  1E5K A;  3EEV A;  1NWG B;  4R36 A;  3HJJ A;  2WE9 A;  1G95 A;  4N6A A;  4EEO A;  1QGQ A;  2FYA A;  4HO6 A;  3D5N A;  1WT1 A;  3OH4 A;  1YRO B;  4ECM A;  1IIM A;  4D0Z A;  2AEC A;  1R81 A;  2RJ9 A;  1NQI B;  1WT3 A;  1H7Q A;  2QGI A;  2PGY A;  1NHE B;  1SSM A;  3C8V A;  1H5S B;  5IDT A;  3SX3 A;  1INI A;  3I0F A;  1VM8 A;  2O1H A;  4G3P A;  2FY7 A;  4J18 A;  1WVC A;  1JV3 A;  3VBK A;  1JYK A;  4FQW A;  2O1G A;  2W0W A;  3R3I A;  3U2T A;  3I3X A;  2AM4 A;  1QGS A;  5CMH A;  5C47 A;  2FFU A;  4MIX A;  3SXG A;  4IHF A;  4FRH A;  5DEP A;  2C0N A;  3V91 A;  1G97 A;  1GX4 A;  3I0K A;  3VBL A;  1XHD A;  2BO8 A;  2WLE A;  4FCU A;  3V0L A;  2FYB A;  1PZT A;  4Y6U A;  3IOH A;  3U0Y A;  3I0H A;  4FRB A;  4E1K A;  5C3A A;  3SX8 A;  1JVG A;  2WLC A;  3DHO A;  2NXV A;  2OEG A;  4UEG A;  2BO7 A;  3U2W A;  3HL3 A;  3V0P A;  2Z86 A;  4FRP A;  5C1L A;  4N6B A;  2I7B A;  3ZLK A;  2RJ7 A;  1HJJ A;  1VGU A;  4KT7 A;  2AES A;  2FYD B;  2J0B A;  1SST A;  1KK5 A;  4B2W A;  1V67 A;  4Y63 A;  3I0D A;  3I0I X;  4HO3 A;  3SX7 A;  1MP4 A;  4D0T A;  1K4V A;  4FIX A;  5CQN X;  4AYJ A;  1MR7 A;  2XMH A;  4E6T A;  3I0G A;  1O23 B;  1GX0 A;  4N69 A;  4EEG A;  1G9R A;  2A8W A;  2WEE A;  4G3S A;  1GQ9 A;  4EEM A;  1QWJ A;  3TV0 A;  5FUH A;  1VZX A;  3FSC A;  2X5S A;  2JCK A;  4KPZ A;  2OEF A;  2XWL A;  2D7I A;  2RJ0 A;  1VGT A;  2ICX A;  2IUA A;  3VBJ A;  1FO9 A;  3U2V A;  3T57 A;  4Y7T A;  3R5B A;  1H5T A;  2BO6 A;  4XWI A;  5FV9 A;  4HO2 A;  3SXC A;  5C36 A;  3Q80 A;  5EJZ A;  2P2O A;  1ZJO A;  1HM8 A;  2YES A;  2ZU9 A;  1TZF A;  5FTV A;  1KWS A;  4JD0 A;  4LW6 A;  4Y6N A;  5HS2 A;  4EQY A;  3BCV A;  1LZJ A;  4EE4 A;  5EIY A;  2ZU8 A;  4EE3 A;  4EVW A;  3VNP A;  2OI7 A;  1QRF A;  4FRQ A;  3V0Q A;  2JF3 A;  2X5Z A;  4D11 A;  3SPT A;  3CKV A;  2AE7 A;  3OGZ A;  4HO8 A;  2Y7A A;  1ZIZ A;  5C4D A;  4EAA A;  5IDS A;  3P47 A;  3OKR A;  1W55 A;  1WSZ A;  3T7O A;  3EG4 A;  4KNR A;  4HO0 A;  3U0X A;  1OCX A;  3GOS A;  5C4F A;  1G2V A;  3F1X A;  1H4D A;  2WVM A;  3PKP A;  1S4O A;  2VSI A;  4P00 A;  1H7H A;  3KIA A;  5CMI A;  3MQG A;  3T7M A;  1VH3 A;  5C3B A;  3R3R A;  3IOI A;  5DG3 A;  1PZY B;  2QKX A;  3R5C A;  3IGJ A;  1O7O A;  1YP3 A;  2JF2 A;  1S4P A;  3BSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...