2QL1A

Structural characterization of a mutated, adcc-enhanced human fc fragment
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
209
structure length
209
Chain Sequence
GGPDVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPLPEEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of a mutated, ADCC-enhanced human Fc fragment
pubmed doi rcsb
molecule keywords IGHM protein
molecule tags Immune system
source organism Homo sapiens
total genus 37
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ql1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ql1A01
1GC1C 4S1RH 1II4E 4MS8C 1IKNC 4NM8H 3DMMC 4M6NL 3ZYIA 5A16A 4IOFD 1HYRC 1SJEB 3ARXA 5AUMB 2CLRB 3VGBA 1BZQK 1M7DB 4DN4H 1XF5A 4ONFL 4X98B 4ZAKB 3QPQD 3FTGB 5E8DL 3M8OL 3VH8G 5EWIH 1VGEL 1WITA 4M7LT 5GISL 4KVCL 2X2YA 2IFFL 3LSOA 2QHRH 5KS9A 1FORH 1N0XL 1R3JA 3QFJA 2AJVL 1YN6B 1TENA 3FQXA 3MYJA 4NO0B 5IEHB 4CNIB 1ED3B 4KKCC 4YQXH 4Z7NE 1JFQL 2FX7H 5CINL 1A3RL 1CBVH 2P5ED 3VFGL 3UJIH 1MAMH 3DVNA 5DJ6B 1DDHB 1OD9A 2P45B 2W0FA 1V3MA 3ESUF 4FQCH 4OSUL 2UZIH 2XTLA 3BJ91 1KCUL 4HPOH 3QCTL 1HHGA 4HJJH 5DQDH 2HKHH 5L6YH 1FL5A 4KQ3H 4HEPG 2FDBP 1FNFA 5BW7A 2V7NB 3C2AH 3OZ9H 1XGQB 2JCCB 4P48A 1JHTB 5AUMA 3RUGF 5F89B 5E2JA 4UU9A 1QYGL 5FGBC 4X98A 1FC1A 2X4NB 1YEIH 4K3EH 1U3HC 3OF6A 4FQPA 4IIQA 2ZCKH 2RAMA 1EFXA 4XBEL 1ZLWK 3MLWH 3EOBB 4HKXB 3HMXA 1P7QD 1OPGH 5TGBB 1IBGH 3ZE0E 4G8GD 3BT2H 3G5VA 3KJ4C 4JM2B 4PV9A 3HZKA 1SEBA 3DUUB 5K33A 4N0UB 5ABDE 3RX7A 2D9CA 1GZQB 2QQNH 1DDHA 5FB8A 5GJSL 3OXRA 5C0BE 5FYJH 4MNGA 4NOBA 1RJZA 3VCLB 5EPMB 1PSKL 5JW4Q 4P9HH 4I3GA 4K8RC 2EIZA 2FX8L 5I1EH 3S36X 4P2CG 1YEEL 3CUPA 1KIPA 1K85A 5F89A 2VLKE 1BJ8A 5D8JH 3QDJB 3EDDA 3PIQA 1R24A 1LEIB 1Y0LB 5EDXA 4FQLH 3E6FA 4HCRH 3L9RA 4LVNC 3HI1A 3IRZA 4HKXA 5EBWA 3T2NH 2XQYK 1AI1H 4RAVA 3WV0A 3RJDA 4H25A 5TQ2L 4JM2A 4TNVF 3QNYA 1OAXH 2IH3A 3DUUA 3MUGA 1NC2B 1FVDA 3RUGE 5TDPA 5DD5H 2VUOA 3SKNB 3WS3A 5EUOA 5DJ2A 5GZNC 3TN0C 4WCYL 1KCSL 1U9KA 2PTTB 3OX8B 4LFHD 5EA0H 2EC9T 4XX1G 2NY4B 1AQDA 1QLRA 4BUHA 3TZVC 2OXHA 1HCVA 4JVUA 4WW2A 3GKZA 2WLZA 1A7QH 1F90H 1UXSA 2AK4A 5BS0D 4HT1L 1P7HL 5CKGA 3DV4B 2OK0L 1MFEH 5EZLB 5F7DB 5KVGL 2MKLC 3LQZA 3L5JA 3SKMB 2XXCB 2YZ1A 1RUPH 1DBKL 1RZFL 3DUHA 2WWMD 4FQJL 3ZSTA 1R3KA 1B4JH 5EUKB 2J4WL 1FGVL 4G8FB 3SE9L 1UA6H 2MJWA 1J0KA 3PWPE 4XP1L 5AEAA 2IANE 2N56A 2IADA 1JHLL 5ISZE 3AXLB 1WIOA 4K94C 5HHPA 1MCNA 1HI6B 4UT7L 3S4SG 3G6JA 1A4JB 1K6QH 5IVXF 1N8ZB 1LILA 1A3QA 1RJLB 3NCEB 4I18C 2BNQD 1A8JH 4HXBL 4RZCA 1QBBA 1BWWA 3U0TA 1U58A 3MUZ1 4OZFG 1D6VH 4PREB 5D7IA 4ODSH 5KG9A 5TDNB 3BWAB 2V2XB 5EZLA 5TE6H 3DSFL 5ADPH 4MVBD 4O00A 3N1GC 3MMEA 2F74B 2YPKA 1SMOA 4JO2L 2BNRA 2ICCA 4L4JA 3S34H 3TEUA 2K7PA 4NFDA 3A6CH 1CL7H 3FQWB 4OCRL 1AQKH 5MEOA 4G8FA 4KKNA 4OQTL 4GKNA 2VZUA 4JPWH 3IDMB 4X7FC 5JHLL 3RVVD 35C8H 2A1WL 5TQ0H 5C1MB 1T0NB 3BN9C 1ZHNB 2R4SH 4J4PA 4FQ1L 3GJFB 4I77L 1R3LA 2DKSA 5EOCH 1D5XB 3MNVB 4GW4A 4WI6A 5JR1L 2UWEF 4U6VH 1E6JH 1G7MA 4F7EB 4M8QA 2JELH 4DW2L 1R5WB 2M8XA 3QRFM 4CW1B 3CLFL 3V0VB 4P2QE 2XN9D 4KKBD 2HN7B 2VAJA 4PYHA 4QXTA 3V6FB 3CXDL 1YJDH 1TJHH 5GXBB 2DRUA 3DROB 5JOFA 5I1DA 2QKIA 4PJ5A 4IRSB 3VGDA 3CC5A 4H5SB 5H94B 2P5WE 1H3TA 4PJ9C 1T7WA 1WEJH 3T0EE 3MRQB 3LS4H 3EYVB 2GTZA 5TDOB 3RVWD 2ZCLL 5IVXE 2Z93A 3B2VL 3FONB 1INEL 3FT2A 5A2FA 1A47A 1DQDH 5EU6A 4HBCL 1I4FB 5I73B 4M4RA 3V6OC 4ZPTB 1GC1L 1U8NB 2EH8L 4XC3H 2I07B 2Z4QB 1H5BC 3O2DL 2J8UA 3G6AA 4X6CB 3VRLF 5I15L 3TYFB 4CN4A 3GJFA 3GGWA 1T6VN 1YYLL 4S1SL 5GRWA 4JGMA 4JHAH 2VJXA 3SE3C 5IT2L 3BAEH 5HHOD 5GJTL 2EDRA 1R5WA 3HPJB 4RGND 2Z0BA 1UB6B 1RUAL 5GGTH 4K3DH 2HRPH 3NCMA 3WEXA 2NXYD 2RHEA 3ULUD 5T3ZH 4IRSA 5HGBB 1T21B 5L8KB 1WCBB 2YBRB 4PJHF 5FGCB 4APQB 1SJXA 1OAUH 3IJHB 4O4YH 5FUZL 2FD6H 4X6DB 3EYVA 4JKPH 4EI5D 2UWEE 1MVUB 1PD6A 3NZ8A 3OWEA 4OCXL 4PLJD 3QP3A 5TDOA 5DQ9B 4EUPG 3W0WD 3FONA 1HIMH 4Y2DC 1OARH 2G5BB 3GMOA 1KB9J 5D93C 4LAQL 4XZUB 5LAXA 3T3MF 1X7QA 5I16B 5KSAD 4XGZB 1N6QL 1KLUA 5C3TA 1IM9B 3TA3C 1UM6L 3GMNA 2DQFA 3KYKH 1TZHB 3D1MC 4JQXA 4D8PA 1MJUL 3VD7A 1UB6A 2MCPL 3BZDA 3LEYL 3CXHJ 1DBJL 4U1LA 4U1KB 2X05A 4LGRB 1NJ9A 3B5GA 1XR8B 5CUSL 4YDLC 1LO4L 4OI8A 2VDKH 1QSFD 3I9GH 1YEJL 3U46A 4EUPH 1WCBA 2Y23A 4APQA 2VXQL 3IAPA 4P5TB 3UTSD 4NQCB 1HXYB 3VRLE 2C1PA 4CKVX 4HUVB 2NX5B 4LLYA 2G2RA 4Q7DA 1IEBB 5F96H 5J6GA 2APWA 2NY2C 1BLNB 3HI5H 3DMMB 2W9LA 5I76B 1WLHA 1FH5L 2OSLB 4AEHL 3LMJL 3QWQB 1HZHH 1A9BA 2W0LA 4FQIH 3L3GA 4U2YA 4XXDA 3C6SB 3ESVF 3O9WA 4MQ7A 3V52H 4HWEL 1EEZB 4PJHE 4XGZA 4XCNB 4XPHH 3ZHLA 4JRWA 1K4DB 1BEYH 3QNZB 1S5IH 4WNQB 4Z7VB 1HHIB 1J1PH 2ZSVA 3LPGA 5DUML 1YMMB 5JHDE 3G9AB 3CDGA 4RDQF 5B21A 2VERN 1LVEA 5I18H 5TF1L 3WDJA 5CP3H 2XTJC 3IXTB 4WJ5B 3T3ME 5IB2B 5I1CH 2HT4D 4ODWB 5D1ZC 5DVNA 1RK0A 4WDIB 5SWSB 1HHKB 3N06B 4G42A 1NGXA 3MOQA 4KMQA 1MCPH 5CJQH 5AZEL 2V2WB 2B2XL 2FATL 4UQ2A 3S36L 2EH7H 2AI0L 4XPGH 4P2OC 5BVPH 4J6RL 3NTCL 2HWZH 4HUMB 3MV9D 4IMKC 3K8MA 1B2WH 5EBLB 4Z18A 5C0IB 5IVZB 1U3HB 5TE7L 4AIOA 1H0DA 1BM3H 3GSRA 1WBZB 1YNKL 5D7LE 3VI3F 2P42B 2HMIC 5IBUB 1IAKB 1D6EA 2IQAB 4AENB 4POZD 5FYJE 2VTFA 4URTB 5FHAL 2CLVA 4O51B 2HA1A 3NIFF 3PL6D 4O58H 3QHFL 2IBZY 4OGXL 2YPVL 4NJ9H 4ZTOL 3U9PH 4P3CL 3B9AA 5IQ7H 3WKMH 5IB2A 5I66B 3ZYOA 1ADQH 2WUCH 5E8PA 5GRJH 3FFCD 4R90L 3HA0A 5JO5B 3D85B 5FO7A 1ZOXA 2P49B 2XQBL 4X8JB 5J8OA 3MV7A 5E03A 5FGBA 5EBLA 4NZUH 1F58H 4XVSL 3LKSA 3UTTB 5CEZH 1MI5E 1T2XA 3KPPB 3FRUA 5GSRA 4LVNB 5MHSD 3LDBB 1VENA 3S3PA 4E41E 2BDNL 2X1QA 1QBLL 2IQAA 4X9FA 4AENA 2VQ1A 3EHBC 3P40A 3D0VB 1JGUL 1NCDH 4HKJB 3TVMD 3UDWC 1MREH 4D3CH 2FR4B 3ARTA 3QUZD 4PJEB 4BELD 5BRZE 4MA3B 3PXHA 5JW5B 3SO3C 3IJYB 2VLLB 1BFSA 3LAFA 5DJCA 1EAPB 4FMFA 1QO3B 4HUXA 3TN0B 2EEDA 4QHMA 1KCVH 4AY0A 2OR7A 32C2A 4Y7MA 4H88H 3VI3E 2AJXL 4DOHB 3MLYH 1UCBH 3TZVB 4QHLA 1I1FA 3EO1B 1EPFA 4QLRA 4JO3H 3PDOA 1RQ5A 3QIBD 3L5WB 5KANI 4XNMA 4Z7UF 2ZG3A 4U1MA 1N5AB 3LD8C 1MCQA 4I0PC 3E0GA 4NZTL 3NIFE 1MCIA 3VXMB 2NNAA 4ZFFB 1TZGL 4PJCB 4X7SH 4XX1E 4WFGD 2VLJE 3V5DA 4YFLI 5GGQH 3H3PL 3L5XL 3RDTA 2PETA 3D0VA 2GJ6B 4OLYL 3UTZA 4JLRB 1WFTA 1S7RA 4OCSL 2ORBH 5D7SL 2UVEA 3P0GB 3C9NB 1MFBH 1EHXA 2VLLA 1EMTH 2NY0D 3C8KB 2ITCB 5F1OB 4G9FD 1E6OH 5HPMB 1OVZA 3TN0A 1X5HA 3VGAC 3MLTB 2EDTA 1VA9A 1NSNH 2PTVA 5DVKA 3ZHKA 4FQ2L 3MRRB 4I1NB 4Y5YC 1CTOA 5C7XL 1NBZB 3TZVA 5D1XD 1K8IA 4P46C 3L5WA 1I1RA 2BHUA 2JK5B 1DE4B 3L3IB 3RU8H 2RFXB 3BKYL 2PYFA 3KPSB 2OTPA 2XY2A 1KLFA 1X5LA 5E94B 1F97A 1L9MA 3T4AB 5IB5B 4KK9C 4Z7WA 4JZJC 3N50A 3GUTA 4PRID 3PQYA 1J0ZA 3HMXH 3EOTL 3U9UB 5IFAH 25C8H 2Y36L 5JZ7C 3OG6B 2GJ6A 5DS8B 3GK8H 4EZMA 3IDJA 4OF5A 3Q1SL 3SOBH 2LU4A 1PQZA 2X4RA 3TGXA 5C09E 5FYJU 5DJZB 3SDYH 4HKBB 5E2WL 4FP8H 5E6YA 4TSAL 2ITCA 1DUYA 5JIKA 2FHFA 3PGCB 2VRAA 4HQQH 4YIQA 4TQEL 4WWKD 5J9PA 3O3BA 1VFMA 5TE4H 2X4PA 1KJMB 5CIPA 3O3DA 4ZFGL 4I18A 5CCKL 5FGRA 1KTDA 3F5WB 4I3RL 2ERJC 2ZP0T 3QPQC 4NBYB 4XNYH 1G7IB 4Z77A 3QEUB 5BZDB 4P57B 4PJ9B 2NR6C 3X14B 3S6CA 3ES6A 4XB8A 4Y5VC 3MROA 4UUJB 4NWUH 5E24E 3OJDA 3AROA 3JWDC 2E6PA 1VPOL 3W9EA 3NCJH 4OTXL 3WLWD 4R97C 1YEFH 4GG8A 3DARA 5IOPB 4DAGH 4DTGL 4P2RE 5E1HB 3BMVA 1YEHH 5CHNA 4TNWK 1H5BB 5BMFH 4GO6B 2V2TB 1ZEAH 2ZNXA 2CRZA 1I7ZA 2WP3O 3MRDB 1JGVH 4KC3B 4OB5H 2FYYA 4JFFE 1S7XB 1KPVB 2XA8H 2BHYA 3E8UH 1A5FL 3H9SA 5T3ZE 4GMSL 4JZOA 5DJZA 4HKBA 2CKNA 4XPTL 5DEZA 3O6LH 3PGCA 3ZDYF 2FGWH 4JDTL 3LEXA 4QT5B 1JV5A 4NQVB 4M6NH 6CGTA 2JJWA 1I3UA 1KJMA 1F11B 3WDHA 4DGYL 5FYKU 2HKFL 5IGXL 2GUOA 4I0CC 1CFQA 1TJIH 4ONFH 5D6DC 3EKCA 1U8MA 3QEUA 4M00A 1U8JB 4F15C 4F9PA 1ZS8A 3GSWA 4S1QH 5BZDA 3TESA 3M8OH 5HYJB 4ZUWA 1A7NL 4PLKD 1S8DA 4LK4A 3CCHB 3MBED 4PYGA 1NC4A 5EZJB 3OSKA 3W2DL 2AJVH 4Y2DB 4MA8L 3DIFB 1U8PA 1M4KA 4LCWA 4W70A 1I7RA 1CFTB 4YXKL 5D93B 1JFQH 3M1BB 2UY6A 4ZXBA 4YPGA 4G6JL 2OL3A 5GZOD 1TQBC 1NGWB 5ACZB 2R56H 1DVFD 4AJ0A 3QCTH 4NJAL 1CXKA 4NQTA 5EOCJ 5CD5D 5LWYL 1J8KA 4JFPB 3NFPB 3O41A 4L8DB 4PJGA 1D5MA 4LPXA 3U0WL 4OV5B 5LG1A 3ELAT 2BVQB 2D03L 1CQYA 4GJTB 3WIHL 4YDLB 1QYGH 4AK1A 4MNQE 3VWJA 1NCBH 1N7ML 1OF2A 1RVFH 3BYYA 3QH3B 1UKSA 3BZFB 1OM3L 5ALBL 3EOYG 5T1LA 3S37X 1HQ4B 1AD9B 2QL1A 4N5ED 1AJ7H 3MUJA 2GY7B 4CVXB 2DBLH 2NY2B 2MSPA 3DJ9A 2APBA 3ZDYE 1BQUA 2YN5A 1P69B 3VE0B 4R4BA 1J5OH 3ARBA 2XZQL 3IETB 4DQOL 2FJFB 4U1NA 3RP1A 1A6ZB 1ETZB 4L4TD 3EZ8A 4K7PY 4GRLD 5GJSH 1A9EA 1FZJA 4P5MB 3TA3A 3LN5B 3DO7A 1Q0XL 3WO4C 4WO4D 5DT1L 3ZMRA 3MJ7A 3BP5B 2APVA 2BRRL 4G43A 2FX8H 5GGSB 4FN0A 3QXAA 4OV5A 1WCQA 2NY7L 3O6FD 4M5ZL 3DX9B 3FJTA 3I6KB 2XTJB 4G5ZL 5EOTA 2Q6WA 1NCAL 1UADC 2AJ3A 4KROD 3VXUD 2WWMC 2HT3D 3B5HA 3FB5A 5D1ZB 3LZFL 2H9GB 2ICEB 1A6VH 5ID1B 3A67L 4NZDA 5A2KH 1T66D 5JXAL 1YECL 3LKQB 2MTPA 2J6EL 3FO1A 5L88L 4HJGA 4PY7B 4RISH 2ICES 2H1PL 4P2OB 2EXYD 1YPZA 1UG9A 4HUWA 3RIAK 3MRKB 4JCMA 3D3VA 3LCYA 5DC0A 1QKZL 1ZA6A 4L8CA 2L7JA 4JRYB 4OGYH 3GMLB 3BVNA 3RY6A 3GJFH 1J7VR 3EO9H 1JF1A 3RVTD 5JOPD 4MNHB 2R23B 4NCC1 1FCCA 1FL6A 5KS9F 2EYRB 3P0VH 1H3WM 4QF1A 3AM8C 3MRBA 5E0QA 4NUJB 3RGHA 4HT1H 3UTQB 2OK0H 3I6KA 3B6SA 4MVBC 4N0FA 3OKNB 5F97E 1KELH 2ADJA 5HGAA 5KVGH 3OB0K 1CGWA 1IAIM 3B4NA 5CEZE 3M17B 3EYFA 3SDXB 1KC5H 2J4WH 1XF3B 3ORJA 4GKZA 1DP0A 3TP4A 3IF1B 2APFA 1MAKA 1PX3A 1Q9OA 4Y19E 4S11A 4R7NA 1JTTA 5AYQA 4N8VA 5DTFB 1IKFL 4N8CL 4XNUH 4KKBC 5FKPB 2DQCL 2R29L 3QUXD 1CIDA 4JDVB 1BD2A 4HHAA 5EH1A 4XH2B 1J9CT 4L9LA 2AJUL 4NBZB 4MNHA 3MREB 4N1HB 4ZUTA 4TUOB 1FN4A 1GHFH 4PGBB 2D2OA 5IK3A 2G5RA 4KZDH 3OKEA 4X99B 4HXBH 3LIZL 1IQDA 1V5JA 2ESVA 1TPXC 5C2BH 3SO3B 1DQQA 4YHPB 3DSFH 2A9MH 2FEDD 3RVWC 5IB3A 3EO0B 3RWFA 4JO2H 1BIHA 5HHNA 1EEUA 2E6JA 1X4XA 4MSWA 4OCRH 4HIIA 2B20A 4IRJD 1XF3A 3QQ4B 5F9DC 1I75A 4JQIH 2WINB 4XNQB 3IS1X 1DANT 1IC4L 5KS9E 1C7TA 3LD8B 5C0FA 3QDHA 2MQ0A 4I0PB 3P4OA 1OT2A 4NKOB 2WWKT 4ZQKB 4NO2A 1J1XL 2JCCF 1ORQA 5DVLA 5JR1H 4DW2H 5HD8D 1OOAA 1P84J 3DX8B 3CLFH 4LBEB 1NGZA 1I1AA 4ONGL 5C08E 3O3UN 2NXYC 2PYEA 3CXDH 3RWEB 5HGHB 4PGBA 4EOWL 3D18A 3JWDL 2IWGA 1OQXA 3DXAB 1REIA 4M62H 4U1HB 3TC9A 3H0TB 5C0AE 5C0BD 2VXVH 4YAQB 4LCYB 1UXWA 5J1TC 4JM2F 4LLDB 4EJ1C 4ODVL 4G8IB 4H0HB 3V5KA 1WQVT 1IAIL 1LO5B 4MA1C 4ODBD 2ZCLH 3KXFA 4MCZB 3B2VH 3SQOL 4HBCH 4Y5YB 5EUOF 2VLKD 4EIZC 4F7TB 3QQ4A 4J3SA 4XNQA 2UV3A 4P46B 1CDCA 5I1AA 1I9IH 1A6TB 4MA7H 2BXZA 3WS6C 4I0PA 1OHQA 2VQUA 5KVFH 4JY6B 4FTVA 2WIIB 4WW2F 4J3UA 2R9HD 4ZQKA 3C09C 1JGDB 5IT2H 4L3CA 4NKMA 5GJTH 4UAOB 4DZBA 2YD8A 4ZDHB 3KLSA 4JZJB 4JHZA 1P6AB 1E28A 1WK0A 2BVYA 1GYAA 5EO9B 3ZL4H 1RIUL 1ORSA 1OAZL 1INQA 1EH9A 3MRPB 1FGNL 5JPNB 3QUML 5HDOA 4X4MA 3P77A 5FUZH 5GRUL 2HG5B 5IBUG 5HI4D 1JGLL 4G8IA 2JCCE 2VDNH 5ETUB 1ZHKB 3QI9C 4WHYG 3TBVA 3EYOA 4MCZA 3D6GA 1NLBL 5J11C 2N1KA 4Y5YA 3GSOB 1FAIL 3PHSA 3O2VL 4LAQH 3MCKB 1LNUA 2CUHA 2NW3B 2ZUUA 2JB6A 4J3VA 4WY7L 5AG9A 4G3YH 4MJ5B 4Y5VB 2JKXA 3SDAA 5D7IF 1UM6H 2E7CA 4DUWA 2I9LA 2EKSA 4R97B 4ZDHA 3PWPD 4U1IA 2IAND 2MWCA 1DSFH 4NPYA 3EFDH 2KQNA 1G7JA 5ISZD 1DBJH 2G60L 4LCCA 2XWTA 3PUCA 4JN1H 3BOVA 4WHYH 5HDLA 1U8LB 2VXQH 4DCQB 4LDOB 3FQTA 5E00A 2CGRL 2QSQA 4NQSA 1XFPA 3IGAA 2YD7A 3KG5A 4LLQB 4CMMA 4N8PA 4NQDD 2CUIA 3I50L 2GITA 4PP2B 4WV1C 1VB9A 4AEHH 1YUHA 2ED7A 3GSOA 1CLZH 2HAZA 1KJ2A 4K8RH 3MXWL 2W1NA 4F15B 4YE4L 5HVWA 4GG6B 4HWEH 1CGVA 4OLVH 2D7QA 5IHZB 1ZVSB 4DKEH 4G8GB 3MV8B 4E0RB 2HJKA 1GPOH 4OZ4A 5M95B 2DLHA 5DUMH 4IDJL 4QRSB 2DMCA 2XWJB 3NAAL 3QUMB 1PZ5A 4GXVL 1WZ1L 4FOMA 1N3NB 2C26A 1MFCL 3NABL 4BSWB 3QHTC 5TF1H 1RURH 4XMKL 4UT9H 4LCUB 2MCG1 1TQBB 4G6KL 4P2QD 2Y5TB 1G9MC 3SE8L 3KLHC 2J8UF 3OAYK 5D2LB 5ESAB 1KBGL 5FDWA 4AG4L 5D7IE 5FFLA 4P5KB 1F8TH 1ZAGA 5AZEH 2B2XH 2FATH 2P5WD 4PP2A 5BV7C 5IEKA 5CBEA 5E5MA 3T0ED 2XZCL 2BNRE 2NZ9D 4JAMB 4M1CC 1D7FA 3BEVB 3LKPB 1Q9KB 1CD1A 3HCVB 2IBZX 2ICWB 5IW6A 1QLFA 2RCSL 1CFNA 4PS4L 1YNKH 3QWOB 1WZKA 4KY1L 4E0RA 4HGWB 1VEMA 4M93C 2J88L 3O3AA 5FHAH 1K9TA 3L3DB 2XWJA 4NNXB 5ANMB 1H15A 4HMDA 4N0RA 4YX2H 2BVPB 2YPVH 1WF5A 4ZTOH 2DLGA 4P3CH 5GPRA 1ZT4A 4LCUA 3L6FB 1WWWX 3GZKA 4JDZA 4PJ5E 4K94H 5FO9A 3WO4B 5A3ID 2VZ3A 4R90H 1T5XA 3ZTNL 2OMNA 3L3KA 3QIBC 4P4KA 4BZ2L 5BS0B 4MXWH 1G0DA 4IOSD 5I8EB 5JNYB 1AIFB 4HF5L 2DWEA 2OR9H 4MAYD 4Y4FA 5CIPH 4LSSL 3FB6A 1RY7B 1RJYB 2VAAB 1DLHB 3Q2CA 3CFJA 1Q9KA 4K7FB 4M61B 5EU6E 1ZA3B 1A1MA 3IDIB 4NYLA 2XFXA 5CEYA 3HNVL 4FXGB 5MEPA 5FYLH 1OB1B 3U7WL 2J8UE 4AYFA 3F65A 3GBML 5FHBH 1WFUA 5HI5D 5J89A 3VWKC 2NW2B 3BO8B 4X6DF 2KZWA 3QRGH 1F4YH 4HIHB 2DM7A 1NDMB 4OLUL 1OSPH 3MFFA 5BQ7B 1T89A 2EEBA 1AKJD 1S5HB 4PG2C 2FRGP 3EBAA 5HJ3B 1HXMA 4XI5D 5C3LD 3SGEI 3WFBL 2SEBB 4PRHD 1HYSD 5HYIA 4LNRB 1HDMB 1FJ1B 4HJ0D 3GJEB 1WWAX 5D1XC 1FL3B 4QHKI 2AJXH 3LKOA 3HMWH 1HSAB 3NCYS 3MNWA 3ULUL 4NZTH 4W6YB 4PBVC 4ZO6A 3RVUC 4K9EC 1CK0H 1VEPA 4MDJA 5FAAA 1TZGH 3BMWA 4Z78A 3C6LA 1PJ9A 4FRWA 3GNMH 3G6DL 4LRNH 3MLVL 4YHOL 4X6CE 3L3JA 2VKWA 5IBTH 5ERWA 3S5LA 4LIQL 2XG5A 4GH7B 5FUOL 5DQJB 4UDUA 5SWQA 3DUSA 3HHRB 5BQ7A 2X89D 1F4XH 4MJ6B 5GGRB 2XN9B 2H32B 2R2CA 2ID5A 5JHDD 2OL3H 3RNQA 2EDOA 3FOMA 2YUVA 4PGZA 3STZB 4FQ2H 1XF2A 3H7BB 2UVFA 4WU7A 3VFSB 1FL3A 5C7XH 5JOEA 2GSIA 5DFVC 3GI8H 1OT1A 4X6DE 1KIQA 2ADFH 1TPXB 4KJYB 3BKYH 1FLRL 4Y4HD 4PTTB 3NFSL 2BRQA 3SE4C 5DGRA 3WLBB 1GIGL 3EOTH 3VXPB 3SKOA 3FQRB 5ESQB 1U95B 5D7LD 4OV6F 5HHOB 1MIEH 1N64H 1JNNL 4W68A 4XC1H 4ZSOA 4TSAH 5FYJD 1OTUD 3D69A 2ZSWB 3U1SH 1MSPA 3MX0A 5KSBA 2NXYB 4GAFB 2I9TA 1RIHH 3QIWD 2P44B 3V6ZB 3G5XB 1HCFX 2FO4A 4R4FH 4W4OC 4I3RH 4NQCE 1HWGB 1MH5A 5JPMB 1L7TH 2GT9B 2NX5E 3VFTB 1NMAL 4RCAA 2VZOA 1XH3B 1ZHBA 4PLKC 3RY5A 4EI5B 2C3VB 4RX4A 3MBEC 5F93C 4OKDA 2UUDH 1VPOH 1C08B 2BJMH 4OTXH 3TNNB 4HWNA 4IMLA 4BA8A 2YMXL 2Y07L 3QCVL 4DTGH 3O11B 1HEZB 3DI3B 5JMRA 4JFOB 1VACB 4MHHG 5GRYA 1E4XL 5DD1L 2LVEA 1RAMA 3OGCA 1X5YA 2IG2L 1I8IB 4DJMA 4P23A 3RGVD 1A5FH 4G6ML 3C09B 3TNMA 4E41D 3ARDD 4XPTH 3HZYB 1NBYA 2Z35A 4JDTH 4U7KA 5HYSB 1TNMA 5DLMH 5FDYA 5DJAB 4KRPD 5BRZD 5IGXH 1QSFB 2HKFH 3QXVA 4LKCB 4O2CA 1YYMH 2FH6A 4PGJA 5JPMA 1RUKL 3UTSB 1GSMA 5T33L 4XVJL 4OZGB 1CF8H 3AU1B 3WNMA 3EYUL 1GOFA 1T1XA 2OJZL 3IU3B 1A02N 3ISWA 4HZLB 1G9ML 5MP6L 5KW9H 3BPCB 3WNNA 5CGYC 5J11B 5F88B 3VFMB 3K4ZA 3I85A 3O11A 1HEZA 3WUZA 4AM0B 4G9DB 3FO0L 3NACH 4YLQT 3QO1B 3U0PB 4F8QA 4WUKL 3HZVA 2CKBA 3WS6A 2BCKA 4G6JH 5BV7L 1UZ6F 2VLJD 2I60L 1KEML 3BN3B 1SBSL 3OXSB 2VDOL 3DRTB 5LWYH 1TVBA 3AS2A 2W9EH 5CSZB 1T5WB 1CLYH 1Y6KR 3GB7B 5DUPL 1X6NA 3O8XD 5E8OA 3MO1B 3VD9A 1FG9C 3RIFK 3DBXA 4DN3L 4Z7WF 4K2UL 3QDMA 1FSKB 3UPRB 2NY5C 3U4BH 4OZGA 1Y6NR 2HT3C 2IBGA 3B3IA 3HS0A 3QJFA 1FQ9C 5J6HB 3VD3A 5I1GL 4K7PX 3WSQL 1JTPA 1MJ8H 3QI9A 4HZLA 4C55A 3QB7C 3CFKA 5CLTA 2EXYC 4UOW1 2XZQH 1A7RH 1T2JA 3CH1A 3BP4A 4CUCA 3MRJB 3FT3A 5C6TL 1J8HD 4NHUB 4V1DA 3L7EA 4NQXB 1FP5A 5CJXA 2CXKA 2VXSL 3V0WL 5L2KA 2EE6A 1AH1A 2VE6A 4RWYH 4JG1L 4KHTL 1Z9SA 1T5WA 2YWZA 3BZEB 3MFGB 2NY7H 5C09D 2YWYA 4M5ZH 1T0MB 4OJFL 5F7NC 5EZIL 4DOHE 1Q0YH 3FFCB 3GSVB 2ATPB 3UJTL 3LZFH 4O2FA 2XNAB 5DD6A 4ETYA 1BQHB 1O7VA 3MRIA 5JXAH 2G75B 4WV1A 5L88H 5BV7B 1XGRA 5CWSB 3CU1A 4FABL 1F4WH 1UZ8B 1IGIL 4M7KH 4YUEL 4GRWB 1BGXH 1QKZH 3OAZK 2A6IA 1DQJB 4LSRL 3PQYE 4YHKL 4D9LH 1MHEA 1J0YA 5JW4N 3FN9A 2GJ6E 3KLDA 1YMHB 5K93A 4K9EL 4M93B 3B2UD 4PRPA 1LEKA 3TVMB 2R0LL 1ZLUH 5HHQB 1R5IA 3MA7A 2M26A 12E8H 4E5XA 3SPVA 4JFFD 1RZIA 3DO3A 5T3ZD 1JHKL 5E5UB 1U8OA 2DQUL 5D1QC 4L5FH 5GS1C 1FIEA 3RZWA 1FIGL 3JUZA 1W2KT 3IJSA 4IRJC 5BVJA 2IH1B 3QIBB 3V5HA 2JJVA 5FYLE 3GHBL 2D0FA 2IEPA 3KPSE 4WI4A 3WHXA 2HH0H 3BGMB 1YNLL 4PJGF 1QFWM 5HD8C 1IKFH 4QHUB 3GMRA 2OBGA 2EDBA 3ARUA 1IM3B 4JB9H 1X5AA 4H1LA 1FFOA 3IAQA 2D4DA 3REWB 3Q6GL 3SN6N 3D9AL 5D5MA 4AEIH 1A14H 3H9SE 2MMXA 1NCWH 1H3GA 2VXUH 4B5EA 3RWJB 2DQGH 2F5BH 4G9FB 3X3FH 5CJBA 1X5JA 3CIQA 1MCHA 4PRBA 4UDTB 4R0LC 4U0RB 1CLOL 5DRZA 5D1XB 1TMCB 5K9OB 4MNQD 4Q97A 3T08A 4UV7L 2VN4A 1XGYL 2VISA 2Z8VC 4X9HA 1QQDB 4PB0H 3VG9C 2R9HC 2FLBT 5HYQB 1JNHB 4QHUA 3V6OE 3KR3H 1FG2B 4PRIB 1RULL 1FFPB 4RMTA 2X4UA 4U6XA 2VXTH 1BFTA 1JPSL 2C3HA 3JWDH 3VWKA 2Q1EA 4JZNA 1KN2L 5DEGA 1T1YB 2ZUSA 4HC1L 4NNPH 1X5ZA 2DD8H 3ZDZF 2DIBA 2GSGB 1NFKA 1I8KB 1TXKA 5HI4C 4OD1H 5BCAA 4WWKB 4PJGE 3QG6A 1NUNB 3MXVL 5AAMA 3VFPA 2YPLA 3T1FB 2CIIB 1YPZF 3WFDL 2XOTA 3MR9B 4L4VD 2WBJD 5HYJE 1RZJC 1XZ0B 3T4YB 1EXUA 1TIUA 2AKRB 2EYSB 1MJ7L 4NFCA 1GOHA 4WI8A 43C9B 4ETQB 4JRXA 4LU5L 1MHCA 4J1UA 3QUYD 4JO4H 1ERNA 4YR6A 1IGCL 1J1OL 3IDGB 3TFKD 3CZFB 3SDCC 1BZ7A 4XBGB 1XMWA 2IALB 4D2NA 1IT9L 1RIUH 2HTKC 3ECBB 2HLAB 1OAZH 5CZVL 4HX1B 4QOKA 1TTUA 4PJFA 1NGYA 1WGOA 3KPNA 2XRAL 3D2UA 4OD3H 4QYOA 2W60A 2HFFB 3C5SB 3T1FA 4TSCL 1E27B 1MCRA 4M3KB 2GY5A 5E6IC 4GQ9L 2PXYA 3U36B 3HE7D 1QRKA 2AXFA 2NQCA 1EIBA 3PNWB 2BERA 4ZYKB 3O2VH 4N0CD 5KN5B 2AKRA 1S7VB 2HP4A 2EYSA 2DDQL 4KI1A 5EO1B 4DGIH 3CX2A 3MBEB 5CEZD 3UJJL 5T1MB 1PEZA 3ZDZE 1OCWL 1X5XA 3SBWA 1UVQB 2NY5L 5FA3A 3RAJL 2E9WA 3U4EB 1YPZE 1CYGA 4Y19D 4Z7OF 3D3VE 2E7HA 2EO1A 5J13C 5F1IB 2YKLL 5DHVA 4OGZA 3SKJL 2NXZD 3CH8A 4Y1AB 3QQ3A 1A1NB 3AAZB 2DLFH 1NAMA 5FOJA 2DQTH 3TO4A 5J1AB 3MLXL 3DGCR 5CBAB 2YSSB 1LEGA 2EDYA 4L29A 1I8LC 2A77L 1ZSDB 3TIDB 3AMLA 4U6YB 3I50H 4RMRA 1K2DA 1S9WA 4W4OA 1BBDL 5KN5A 3H8NA 3JV0A 4YE4H 1INDL 3ARPA 4KKAC 4LDEB 4HIEB 1MHHB 3L95A 5T1MA 4UIMB 1S7SB 4K7PL 5AZ2L 1T7VA 3TJEL 3UYRL 3MZTA 2PTUA 4C83B 2W0PA 1TTFA 4ZOCA 4CU7A 4JRYE 3PGDA 1Y18B 1NCTA 4L4TB 3B9EA 3D39A 1MFCH 1P4BL 1P7KB 4AQOA 5I1KL 1F6AA 4GRLB 4Y88A 4G6KH 5I9QC 4QXWA 3SE8H 5C08D 1P4LB 1QA9B 2PW2A 4U33A 3TWCL 5JUEL 2KBGA 3VW3L 2YSSA 4RQQB 2ESVE 3B9KA 4AG4H 4PV8B 4ZODA 2HYMA 1NUDA 2P8PA 3OAUL 3O6FB 4PP1D 1ZGLB 4JFZH 1BBJB 4Z7OE 1ODAA 5DRNB 2X5PA 1IGJB 1RHHA 3GM8A 2HTLD 4GQPH 4KROB 1R3HA 3WDIA 1CXLA 1N59A 3IFOB 3P4NA 3QQNA 1P5UA 4EVNA 1AGEB 1O5DT 4Q9QH 1RMFL 3OF6D 2YXFA 5HI5C 4HSQA 1GGCL 1EFXD 4XPBL 4ORGB 5ICYA 4FA8A 2JIXA 6FABL 2J88H 4WI5A 4JKWA 4F37K 1V3JA 5EZOH 4RFEB 4IDLA 4F3FA 2VIRA 4NO0D 4PRAB 1ZHLB 4XBPB 4GXUN 1LO2L 1TETH 2PYEE 2NTFA 1UH2A 4XI5C 1MNUL 1HYSC 3BPOB 4HJ0C 4CADA 2H32H 2H8PA 3V7MA 5IW3A 4BFIA 1JPFB 4NO3B 4PGEA 5JA9A 1HILB 4JM4L 4UMGA 4OZHB 4QRRA 5DC9B 2P7TB 5GGVH 1A3LL 1QR4A 4QWWD 3QISA 1EZVX 1S9VB 3RL2A 4Y4KC 4X4YB 3FFDA 4WGVB 4X5WA 3WIIL 5FO8B 1KGCE 1EHLL 1HOCB 4KMTL 3F8UB 3CVHL 3U7WH 3ZSSA 1MHPL 2GJZA 5C71A 3CSYB 3GBMH 3U2SA 1IGFL 3UROR 3DV6B 2E7MA 2CJUL 1T7ZA 4JM2D 4XBPA 2A73B 5F8RC 4P3WA 5DRWB 4AT6B 3W39B 1SJHB 3CFBA 1U6AL 4HXAL 3DXAE 5EORL 1ZWIA 2B1HL 1BQLL 1YY9D 3RWCB 5I17B 4BH7A 1PBYA 4JKKA 1D9KA 3R06B 4LVOB 4PJXB 4X4XB 5A1AA 1HSBA 2FX9L 4NWTH 4MX7A 5D1QB 3G5ZA 1MJJA 5DJXB 5GS1B 5EC2B 5HYSG 5EBMB 4IRJB 2F8OA 5IKCB 2ZCHH 1C5CL 1JZ3A 4ZNEA 4LLVB 5C70A 2W38A 3DV6A 3NCBB 1NGQL 4I9WD 4AIZA 1WBXA 2OI9B 3HRZB 1MCFA 3KHQA 4NDMB 2XKNA 1RZJL 1XGPB 3BQUA 4DGVL 1F2QA 1OTUC 2QQKL 2CKBH 4YDVA 1N5YL 2CIKB 2LU3A 2OTWA 4EDXB 5A43C 1B0WA 1OGAB 4YXLL 4NOFA 3RKPA 2P8MB 1T1ZA 2EYTB 4Z0BL 2JB5L 4RFOL 3U4AA 3WFHA 1AXTL 4HS8L 2A6JA 4UNVA 1IVLA 2DQJH 4F57L 1FLRH 3VFRB 1GAFH 2LAAA 3BP6B 4R0LB 2VLKB 4LEOA 2FWOA 3PV6B 3Q5YA 5DI8B 4D0BB 2BNRD 2OJEA 4HH9A 1K3ZA 3ALWA 1KXTB 4S2SB 2W0KA 3FZUC 3VG9B 3RGVC 1UB5A 3RL1B 3ARDC 1TVHA 2X4QA 1PX4A 4J4PD 1P1ZB 3C5ZA 4JFHE 3BI9X 4PR5B 2DQIH 4HMCA 4A2LA 2A74B 3T0XA 4HIXH 3PWLB 5DA0B 3LRSB 4YHZL 1IGTA 5B8CC 5CD3B 1U92A 1FO0L 2WNGA 5I8KL 4Q2ZB 2EYTA 4MAUL 2P8LB 4MMZC 1YZZA 3KPLA 4X6FA 4PJ5D 4NFBA 4YDJA 4ZO8A 1MLCA 1MEXL 3CNKA 4A6YL 1XR9B 4ODUB 4RAUA 4NBXB 2PR4L 2WP3T 4WFFE 2ZOKA 5ICZB 3MC0A 1FVCB 4D0BA 4YHIB 3IDYC 2WZPD 5DSCB 2EXWC 5EU6D 4CVZB 1E4XH 5DD1H 3CJJA 3MV8E 3QDGA 2IG2H 3EGSA 1M6OA 5I1HL 2XWBA 3PWPB 5IJKA 1BQHG 5IF0A 2IANB 3SDCB 5ISZB 3O8XC 1WVZA 3BDXA 1Z0MA 3HAEA 1MWAA 3FN3A 2Q20A 4HLJA 5E4IA 5B38A 1M05B 2R1WB 4Z5RA 4XVJH 4NSKB 5A2LH 3EYUH 4IRSD 4WU5B 3HRPA 5J7CC 2OJZH 4D0CB 1C16B 5EU5A 1PKOA 4NQDB 2R2BA 4WW1B 5F44A 5AYUL 1G9MH 3GBNL 5I19L 3RFZC 3I02B 5IR1B 3O6ML 4XWOD 1JYXA 4DKFH 4TULL 1ZT1B 3U79A 3D87B 5CLWA 3IS0X 2HT2C 3OKOA 4WUKH 5C0GA 3VMNA 3W9DA 4CVZA 2CH8A 5BV7H 4QCIA 2V5YA 1VESA 3Q3GB 2I60H 1KEMH 1N26A 3ARVA 4GRWH 1SBSH 3GMQA 4UZGA 1I3GH 3LRHA 1OL0A 5C0JB 5IM7A 1DBBH 2B4CC 4XTRD 4H1LH 4ONOA 4YNYB 4TUJA 4P2QB 1DEEB 2I24N 2AK1H 4GUPB 4A6YB 1M05A 4OCMC 4GW5B 2AQ2A 4F7CB 4OM0H 3MBXL 2Z91B 4R3SA 5I75C 2JJSC 3WSQH 1NMBL 4APQD 1DQML 4R7DA 3WCYA 1AY1L 3PWUA 1KFAH 4NT6A 1XIWC 4KDVA 2P5WB 2A6DB 5E6IA 2E7LC 4S1RL 3T0EB 2AJZA 4NM8L 1LE5B 5KSBF 3H9ZA 2YHGA 4EEEA 4DN4L 3D48R 3OKKA 4ZNCD 3HLAA 1L0YA 1A7PL 2FHCA 2FSEB 3NFNA 3O9WD 5EWIL 4LAJH 2AAVA 3V0WH 3B2UC 2QHRL 2IFGA 1FORL 2A6KA 3MGTB 4P9ML 5JDSB 1FBIL 2PO6C 3R0MA 3S9DB 3MODH 2DQEH 4FFVD 1HH6B 2XA3A 4YQXL 2FX7L 3L3OB 4ZFOA 1AGCB 4KAQH 5J4MA 5EZIH 1I3RA 2BZDA 3UJIL 1MAML 3O3EA 4LKXB 4QKXB 5KSVB 4TVPL 2Z91A 4QXGH 4FQCL 4X6EA 4NQCD 3HC3L 5C0ND 5ITBH 3ZO0A 4HUKB 4HJJL 4N9GA 3VXSA 4LP4A 5DQDL 2HKHL 2NX5D 3REVA 4KQ3L 5TJWK 4U1SA 5IHBA 1JPTH 2ADGB 5FM8A 4MS8D 3C2AL 3OZ9L 4UNUA 5J56B 2UWEB 3OKDA 4HKZB 3FMGH 1KT2B 3PP3K 2C4FT 5SWZA 4LSRH 3MUHL 5JORA 4NCDA 1YEIL 2B39A 4K3EL 2OQJA 4GW1B 4LPTA 2ZCKL 4P2YA 5DFWH 3QBTB 2P5EA 4K9EH 4X7TB 5E2TL 5FF6A 1OPGL 2R0LH 1EGJL 3T77B 1A22B 1IBGL 3TV3L 3BT2L 4ZSOE 4GT7A 2D7OA 2H26B 1HH6A 3WN5A 3B8YA 3LHPL 2C3XA 5IQ9A 5IFHH 4DVBA 2AJSH 4KKCD 3V6BR 5IMLB 2DQUH 4PRHB 3JV6B 5IROA 2QQNL 5TPWL 4RGOH 2C9AA 1WBYB 1HQRB 5LBSL 1G7HA 4NKQB 5GIRB 1G1YA 2FGZA 3FB7B 3GHBH 5F7YC 1MFDL 4OF0A 1H3PH 5I1EL 4WRLA 1AO7A 4HKZA 4Y4KB 4TRPL 1P7QA 4JJ5A 4KHXH 3TBSB 4JKMA 3S96A 1NDGB 5D8JL 1C5DA 3FT4A 3MV7D 2ARJB 1BIIB 2FL5B 1IC5H 2O5XL 4FQLL 3IU4L 3NCFB 4HCRL 4OZGF 1EEYA 3TJHD 3Q6FA 2FBOJ 3QULA 3D9AH 3T2NL 3QHZL 4PJHB 1AI1L 1Z3GL 3BUYB 3LEVH 4KK8C 4PGDB 2YOCA 1BVLB 4FFZH 5JHDB 3T09A 1U8KA 2VC2L 5DD5L 2VR4A 1NAMH 4LSPL 3RRQA 4N90D 3VU2A 4NNYB 2EDWA 5C07A 1UYWL 2WBJC 5F9AC 4GAYB 1F3DJ 5EA0L 1LWRA 3DVGA 4PJDA 1XGYH 4UV7H 1SM3L 3FB7A 5SX4I 3C87A 4X6BA 4K8RD 1Q9LA 1X6LA 3SJVB 1WZMA 1F90L 1G84A 3QUYC 4Y4KA 4IRZH 2A2QT 4Y4HB 4A2MA 3Q5TA 3TBSA 2Y7QB 1U91B 3TFKC 1QR1A 3LH2H 3RKDC 2EZ0C 1RULH 2CRYA 1UWEL 1Z5LA 4U6HA 7CGTA 1T3FB 1RUPL 3U6RA 3UPAA 4AMKL 1B4JL 4HFWB 4OBRA 1K4CA 4ZPVB 5ID0B 3BUYA 5D7LB 3PWNB 3BIKB 3QAZC 2O61A 4HC1H 4UQ3B 4CDGC 3RDTD 3J7HA 3ZTJG 5M7QA 1KTLA 3OQ3B 4WTZA 5MI0C 3CK0L 3MJ9A 5EIQA 2A83B 4PRNA 4C56B 1K6QL 3HE7C 5JIHA 1TZIA 5C6PB 3QDME 1V05A 3TBTA 4CVUA 1KB5A 2DJ4A 5GZND 4OZGE 3TN0D 4GRMA 3E2HC 2H3NA 1MCKA 2CD0A 2HVJB 4HS6B 1MJ7H 3MJ8B 5DRXA 5DDHA 1A0QH 3GSUA 3TZVD 1D6VL 1HWHB 3DURB 4ODSL 2VDQH 3X12B 1VFBB 3WFEH 1FC2D 3RTQC 2NLJB 3S3SA 3VXOA 4IS6A 4W6XB 1IGCH 5TE6L 4PTUB 5ADPL 5EN2B 1QHOA 5E7FA 1Z9LA 1IZJA 2FJGA 1UQSB 4F7MB 3GRWA 1UWXK 1EO7A 1MY7A 4RMSA 3CDCA 3ZTJH 3A6CL 4NKDB 1AQKL 3ULSB 4MD5B 2IPKB 1IGYB 5DMGC 4EI6B 4F80A 35C8L 3RGVB 3PQYD 3HZMB 4Q0XH 3ARDB 4J3OC 4RA3A 5IMKB 3TPUB 4IHOB 2GJ6D 3RNKB 5EOCL 1BP3B 4TSCH 3X3GH 3I3BA 2JELL 2A83A 2DJSA 1M71B 5BRZB 3O0RH 5B8CB 4U1JB 4XHQA 1HHHB 4XCEB 1TJHL 1FE8L 1UJ3A 2DDQH 5D5MF 4UIKH 4UB0H 3UJJH 2CLZA 3X12A 1OCWH 1WEJL 2NY5H 3LS4L 4LPWA 5FYLD 4BSVB 5JLZA 3BH8B 1UQSA 2L0DA 5IMOB 2R2HB 3IDYB 3HUJA 1DQDL 2YKLH 4JFEA 3L3HB 1IGYA 2ZUWA 4XC3L 2PW1A 3BN9D 4NC0B 3TPUA 3MCLL 3CSPA 3MLXH 2W65B 4HEME 3LKNA 5K59F 3OKMB 5DYOA 3BAEL 1KTRL 4ZUVA 3BZ4B 3H9SD 3O8XB 5C0DB 1QLEH 1FZKA 5C2UB 2OYPA 4K3DL 3O81A 3CPLA 1T83A 1JGEA 2HRPL 2UYLB 4PGCA 1BBDH 1RZ7L 4QRTA 3FFCE 1JK8B 3MNZB 1JE6A 1X44A 1KLGB 1C7SA 1QRNA 7FABH 1ONQB 5E7BA 5IMMB 3ROLA 1VEOA 5HBBA 5CEXA 1OAUL 4O4YL 2FD6L 5GGUA 1R5VB 4QHNB 1F4HA 3TBYB 4M4PA 2R1XA 3GIVA 4GRWE 5EFIA 1LK2A 3JTTB 1NC4D 4OCYH 1HIML 1D5BB 1OARL 2Q86A 1S9YA 1JWSB 1J8HB 1KTKE 3BKJL 1JYVA 5DK2B 1W0WB 4ZS6C 2XZAL 1PG7X 4I3SL 3SGKA 3BFOA 2W65A 4ZXBD 4IM8A 3P11L 2X42A 3VRIB 4JY4B 4DEPC 5C0RH 4Z7UB 3OAUH 5C09B 4LSUH 4J8RA 3QYCA 5H8DA 1I7UA 1CIUA 1S9XB 4KUZH 5D7JC 4X0KB 2X4OB 5DZLA 1F13A 1YDPA 3W0WA 2V5RA 3LPFA 5I75B 1A4KA 3VWJD 5C9JA 1RZGB 2X7LB 3HG1A 4PJFF 3MCG1 1TJGH 5HYJD 1LE9B 1MLBB 1AHWA 1T04B 3HC4L 5T1LD 6FABH 5F96L 3VXNB 4LRIC 4HAFA 1W72L 1SY6L 2C7UA 5KSAA 3ARZA 2I5YH 1JN6A 2VABA 2B8OT 5EO0B 5K9JH 3MGAA 4Z0XA 4TYUA 1ES0B 5E99H 5HHMD 5GGSY 5T1KA 5DK2A 3ARBD 1LO2H 4KTEH 4XCFL 1RHFA 4WHTA 1K8DB 2AERT 4O2EA 2CO7B 1H3XA 5JXEC 1BEYL 4NRYA 3I84A 1S5IL 4JFFB 3CFDB 3RWGB 1VGKA 1J1PL 3TA3D 4M1DL 2PO6B 4JM4H 4TTGA 1DR9A 5MENB 5AG8A 2YPLE 4OGAD 5KAQG 4WW2C 1BJ1H 3GKWH 5E8NA 2OX5A 1ZT7A 4MDIA 3BRDA 2VDRH 4V2CB 1EHLH 5DK0A 4OFYA 1JWMA 2JJSA 4I13B 5I1CL 4EXPX 5EIIA 3QEGL 1XIWA 3KYMB 3BW9A 1OP5H 5I1JH 4FG6D 4JRXE 1U93A 1PDKA 2EH7L 3KS0J 3KVQA 3H2WA 4XPGL 5BVPL 2HWZL 4ZFZA 1B2WL 5IIEB 1BX2B 3N0PB 4QRQB 1BM3L 3D3VD 1CT8A 4HXAH 1UFUA 4CVWA 3STLA 2B1HH 4UT6H 4WUUB 1PKQB 3ZDXF 4PJFE 1IGMH 2G9HA 2X4TB 3MRGB 2P1YA 2PO6A 5I6XC 3ME0A 3GSQA 1VKXA 2FX9H 3R1GH 4O58L 3HAEH 2DF3A 4TVSa 4MWFA 4ODXA 3L1OL 4NJ9L 1KSRA 2DI9A 3KYNA 3G9VA 4NRZB 3JVGA 3RA7H 3BRFA 1FFNB 5IQ7L 1W72B 3TH4T 1ADQL 3MRHA 2AGJH 4TOYL 3MRMA 3S8WA 1KPRA 1C5CH 3MV9A 5GRJL 3WE6A 3OR6A 1BVZA 2AXHA 4L8SA 1QEWB 2VL5B 1A1OA 4J4PC 4LLMB 3SCMC 4FZEL 5I1LB 1RZJH 1YY8B 5DR5L 1VADA 4NZUL 1F58L 1BX2A 4ONHB 3Q5OA 5CEZL 2QQKH 2Z8SA 4QRQA 5CP7B 1N5YH 3CFEB 3K2UH 4L8BB 4JRYD 4KXZI 4WUUA 1F45A 1GRWA 1BD2D 3JTSA 4PRDB 4ELKA 3CSBA 1EERB 4WENB 4ZUSB 2BVOB 2HMID 1YEKL 4PBXA 4Z0BH 3VA6A 1NCDL 1VFAB 3DX7B 3QEQA 4G80B 4RFOH 3NOIA 1AXTH 4HS8H 1MREL 1DN0A 2EDXA 4F57H 2ESVD 4M03A 3RBGA 4L4VB 3OR7A 2R8SH 3F7YB 1W0VA 1AGFA 1XGUB 2WBJB 1S78C 3TT1L 1KCVL 3AY4C 1AGDB 4YFEA 4H88L 3I6LE 3MLSH 1V8HA 3ZDXE 1UWGH 2VLRA 3MLYL 3T0VA 1OP3K 1N6UA 1UCBL 4U3CA 5MEQA 1ROWA 4JO3L 3QUYB 4C4KO 4LLMA 5DHYA 3QXDB 4HZAA 5GRVL 4PIRF 2BXYA 4ISVA 3T65A 1G7QB 5D9SA 2IAMA 5DJ8B 3D39E 4YHZH 3STBA 2D7PA 4Y1AE 3QUZA 4TPRH 3K46A 3QEHA 3IDNB 2BVOA 2PYED 3QAZB 5H35A 15C8L 4MAUH 3EHBD 1NQBA 2J7LA 5MI0B 5INDA 3FQNA 4UOW0 4A6YH 1LD9B 2PCPB 1EMTL 5ICXB 1HH9A 5I8CA 3VFUA 3HE7B 4XWOC 1VFOA 1E6OL 1Z0NA 4I2XB 2IGFL 3VFOB 3FRPA 1A7BA 2C1OA 3GMMA 3KXFD 3OHXB 2ITDA 4LF3A 4D9RE 4PD4K 3AS0A 4JN2B 3FL7A 4HV8A 2VNCA 4Z95L 2X70A 1KACB 1KGCD 3BXNB 2FIKA 4MZ2A 5C0EA 2ATKB 3LQAC 4LHUB 3RU8L 4F58L 5I1HH 4I0PD 5EU4B 4Y19B 3JWOC 4JQXC 4I4WB 3QXTA 4XTRC 2NXZB 4XXCA 3SDDA 4OZIA 1T2QL 4U2ZA 3HMXL 1XGTA 1CDUA 5IVOA 5IFAL 25C8L 4K3JH 4OUUB 3DWTA 4J2XA 2N7AA 3DXAD 4JFXB 5HI3D 3KLAA 1S7UA 2EDLA 4YHMH 3IB4A 2Y4SA 3K8KA 3O45B 1RZKC 5F9JA 4QRRE 1JYNA 4BQBA 5I19H 4HQQL 3TLRA 5TE4L 5JW3H 1E4KA 3DLQR 5A16B 4I2XA 3PJSA 3CSGA 5IB1A 1AGBB 4S10A 1N2RA 3MRCA 3TF7C 4P3DA 1XF5B 3V79C 4XNYL 1KV3A 1EDQA 5CJ5A 3O9WC 4P46D 2XPGA 4PJXF 3U30C 3RTQA 4BM7A 3P30L 4MXQD 2E5EA 4LHUA 2AEPH 3LSOB 1OWRM 5E5RB 5KS9B 3QFJB 1R3JB 4NWUL 2R2EA 3SDAD 3PG2A 4MJ2A 1MRFH 1B0RA 3MYJB 4FFVC 1YEFL 3GJFK 5FEBA 4KK9D 2VYRE 3I6GA 1RD6A 2H2PC 5BMFL 1S9KC 1ZEAL 4OFVA 4YXHH 3BP7A 3DVNB 1JGVL 2AS5M 5JZ7D 4OB5L 1PG7L 3IFPA 2W0FB 1OTTD 2YD5A 2ZWLT 3F6LA 3E8UL 1QNZL 5C0NC 5I1IL 4KJQC 3O6LL 1GGUA 1FL5B 2FGWL 4TUKH 4M02A 5I2IA 4LPCA 4X7EC 1AGBA 1Q9WA 4MLSA 4DKAA 4UU9B 1TJIL 1H8SA 2F54A 4L3AA 4ZNEE 2H6PA 4S1QL 4ALAL 1G7LA 4IIQB 1A7PH 1EFXB 4EN3C 3RWIA 2NR6D 5BXFA 3OJVC 2QR0A 4LPYA 5T3XH 4JY5L 3F58H 1CDIA 4P9MH 4PPTA 1FBIH 4K23H 3G5VB 4PV9B 2YZ8A 2XG4A 3HZKB 1SEBB 2VZTA 1C8PA 4M48H 4JFHD 4J3TA 2Y6SD 3CX5K 4NQEA 4TVPH 5FB8B 5IW1A 3OXRB 1BF8A 5IFJA 4AL8H 3IRPX 4PJXE 4MNGB 2QEJA 2R56L 1RJZB 4FXKA 3HC3H 3GBLA 5KAQF 3MJ9H 3RPIA 4XT1C 3EZJB 2DM3A 3WIFA 3PE9A 2EIZB 3L5HA 1OLLA 5HDQH 1MVFA 3CUPB 1KIPB 1S7QA 3AREA 5D7JB 1OW0C 1MY5A 4IEFB 1P2CB 1UCTA 1NCBL 4O5LH 4WFFD 3PIQB 1RVFL 3HNTH 1NH6A 1R24B 1XCTA 1CR9H 3KWWB 3TJHC 3E6FB 1AJ7L 3L9RB 3HI1B 3OKLA 2DBLL 5E2TH 5EBWB 4KWUA 2OZ4A 1EGJH 1ITBB 3TV3H 2RGSA 4RAVB 3MV8D 4H25B 3WD5H 2GFBA 3UC0H 3QNYB 1J5OL 2IH3B 1DVFA 3MUGB 3LHPH 1JZ2A 4L3EA 5I74C 1FVDB 4YH6A 3QA3A 1TLKA 1V7NH 2B5IB 4R8WH 5TDPB 1OGAE 4RDQG 2Q7YA 1Z9OA 2PN5A 3N1QC 5TPWH 4FZ8L 3WS3B 5EUOB 4TNWF 1VCAA 3P73A 5DJ2B 5F7KC 1M1SA 5LBSH 3NPSC 1AQDB 4MD0A 5KTEH 1QLRB 3ZKMC 4N0YL 1WJ3A 1MFDH 5TF0A 4WW2B 4P4KD 2IQ9L 1UXSB 2AK4B 4YFDB 1NEZA 5D7JA 4YDKH 4TRPH 3I75A 4YHYC 4Y4FD 1P2CA 2CDEA 3LQZB 2CRIA 5CSBA 5KVMC 3C2SA 2O5XH 3KWWA 3IU4H 1R3KB 3D25B 1GGIL 4LRIA 4OCWH 1A6VL 3QHZH 3GEWB 2YD2A 1IARB 1Z3GH 3RDTC 1P5VA 4RISL 2IADB 4P0DA 4P49A 5E08H 1CVRA 1GGBL 3B43A 3C08H 3G04A 1YEGH 5HHPB 1U2HA 2VC2H 5F70A 4XVTH 4LSPH 4RFNC 3G6JB 4KPHH 4OGYL 5BO1H 5JXEA 3EO9L 1UYWH 1IAMA 5KANG 3EOAA 3DHMA 5I6XB 1SM3H 4U7MA 4RZCB 1VFUA 3VXUA 3ILQC 3LPWA 3ZT6A 3P0VL 3EFFA 1HN1A 3QXUA 4AQ1B 3U0TB 1U58B 3R4DA 5D7IB 4K07A 3R0NA 5KG9B 3HN3A 5I0DA 1KELL 4X7CC 2ILLA 3MMEB 2YPKB 3WNPA 1UWEH 2BNRB 4MZ3A 5GGRY 1JL8A 3WJJC 4BQ9A 4Z76A 1HKFA 4AMKH 1QPPA 1KC5L 3C6LD 3D25A 5D2NA 3K81A 5MEOB 3UTPE 4GKNB 1IFHH 5DMIL 3F12A 5DF0A 1ZANH 2WANA 5GGVY 3QIUA 1A6UH 2WV3A 1S7WA 1R3LB 1MQ8A 3WL9A 1OAQH 1X5IA 4FQHA 2MNUA 3CK0H 4GW4B 3PDGA 3TBWA 1G7MB 4M8QB 4HDIA 1I9JL 4AH2B 4XNUL 4M5YL 3OMZA 3LQAL 1SYVA 1WT5A 4KK6C 1YN7A 4QXTB 2ADIA 1GHFL 2GQHA 2ZUQC 4KZDL 1H8OA 2PKDA 3C60A 1ZK9A 3JWOL 5I1DB 2QKIB 5JOFB 4PJ5B 3CC5B 2VH5H 4NQDE 2ZJSH 3TIEB 1B3JA 5C2BL 1BJ1J 3CMGA 2ENYA 2A9ML 5DC4B 2QTEA 2GTZB 1QUNA 4NZJA 4Y5XA 2Z93B 3MLRL 2F9BT 4H20H 3FT2B 2BSTA 1FYTA 5EU6B 3SQBA 5B39A 2ZPKH 5CMAA 4JQIL 4UTBL 1FVEA 5CZKA 3QUXA 2X4SA 3VJ6A 2J8UB 3G6AB 1FRGH 3SCMA 5DO2C 1F3JA 3GGWB 4ELMA 1TCMA 4JE4B 4C58B 4AH2A 4ZOEA 3MYZA 2FZ3B 1IILE 4FQXA 1CGYA 3RIAF 1X4YA 4YO0A 1FNEA 4FMKA 3WEXB 4IBLT 4PJBA 1FE8H 1I1YA 4OF7A 2Z92A 4G8EA 1CXIA 2B4CH 4M62L 2NY1D 3RWDA 3TIEA 1G6RA 2JJTA 2RQ8A 3VXSE 4F9PC 2VXVL 3IDUA 1NUGA 4HS3A 5DUBA 1F5WA 1OGTA 2BFVL 2HVKA 4FFYL 5SX5H 2X9YA 3NZ8B 5ITFA 2H2SC 2KUTA 1RK1A 2BMKA 1QSEA 3AY4A 1S7TA 1SQ2N 2YC1A 3AB0B 5SWZE 1KPUA 2EIBA 4Y16C 4GKSA 1OP9A 3GMOB 4DUVA 1KCKA 5LAXB 1IAII 2B7DT 2X41A 1I9IL 1X7QB 4MA7L 4PJDF 4ZXBC 4HLZH 3MCLH 3GMPA 5KVFL 4YHNA 1KLUB 3QJHA 2YD9A 4P23D 3GMNB 2DQFB 2FZ3A 2MFNA 4D8PB 2GAZA 4U1LB 3ZL4L 1CTNA 1RZ7H 1NJ9B 3CVHA 2W07A 1V7MH 4NIKB 1OQOA 3U46B 3PGFH 3VWJC 2YA2A 3MOAL 3ZT7A 2C1PB 4RIRA 1RIVH 9CGTA 1CI5A 4LLYB 2G2RB 1LHZA 1NL0H 1J88A 2ZOLA 3BKCL 5B3JF 4QGTA 5J6GB 1MRDH 2VDNL 1AO7E 1RZ8A 1W0YT 3P4MA 3LV3A 4FXLA 5ACMA 1A6AB 5IWLA 3ARBC 2IBBA 3BPLC 1A9BB 3BKJH 3L3GB 4XXDB 2XZAH 3O9WB 4MQ7B 4FNLL 5CGTA 3H9YA 4I3SH 1DEDA 1NFIA 1SVZA 3U30B 4G3YL 3QG7H 3VD5A 4KDWA 1NFDA 3RUGA 1FV1A 3P11H 4JPIA 3SEPA 1C5BL 3RBSA 2ZSVB 4OGAC 1KG0A 3CDGB 1DSFL 4PRHE 3EFDL 5ELIA 4PJIB 2COQA 5C07E 1KUMA 4JN1L 3QSKB 3U48A 4NGHH 3QDMD 3NN8A 4PJDE 3FCTA 4F7PA 3RQ3A 3T2OA 3UAJC 1RK0B 3HC4H 1TCRA 4FG6C 2VZ1A 4G42B 1NGXB 1W72H 4GAJH 1SY6H 3KPRB 3QI9D 2DAVA 5C0CA 1N0LA 3QPXH 4UQ2B 1U3ZA 4K71C 4M7JL 5T3XE 1CE6A 1A6AA 1CLZL 3G08B 1V3LA 4ENEC 4K8RL 1WFNA 4XCFH 3L7FA 1H0DB 2BC4A 4OLVL 2DQDH 3VXQA 3GSRB 4LOUC 5B3NA 3RY6C 4V1DD 4QRPB 4DKEL 2NPLX 4TVPE 1D6EB 1CZ8L 1GPOL 4M1DH 5FOBA 5B3JE 3K2MC 1ZVHA 5IHLB 1ZE3C 4G6AD 2CLVB 2AV1A 4QGYA 4PJIA 1B90A 2BSRA 3HUJF 2I26N 3KYOA 2QQQA 3BH9A 5HY9A 4P99A 4RGMC 1RURL 2CPCA 1XAUA 4UT9L 3DTXA 3WXWH 5HHVL 5E8PB 5FCSH 3QEGH 3F62A 2PNDA 3ARGC 3SJVE 1VERA 4IOIA 1QHPA 1RJCA 3KPRA 2OM5A 2EDNA 5FO7B 1F8TL 4YDIL 5ENWA 3ROOA 3GSNA 4BFGA 3MV7B 2F5AH 3G08A 2YRLA 2BSED 3KGRA 5HGGS 3LKSB 2OTUA 4YBHA 1FO0A 3FOLA 5DMKA 1PFCA 5FCUL 1BVKA 3FRUB 5GSRB 3V4UH 4EN3A 4JPVL 3T2PA 1JI1A 1NANI 4QRPA 4L9LC 1SMAA 3VDAA 3WO3B 2VQ1B 1FDLL 3KJ4B 1QSVA 1QBAA 3IKCA 1AD0A 4C56E 4LHUG 5AAWA 4K55A 4ZUUA 4YX2L 3JBG7 5F6HI 3L1OH 2NTSP 1AP2B 3W81A 1EO5A 5DJCB 2C4XA 4HUXB 4QHMB 4TOYH 3HNSH 3ILPA 4K94L 32C2B 3KLHD 1HKLH 5B4MD 3NPSB 4HH8A 1U8HA 2UUDK 1CICA 4QHLB 3HR5A 3WUWB 1I1FB 1F42A 3PDOB 4MXWL 4KRNA 4XNMB 4EDWH 4YFLF 1DQTA 4U1MB 2AXGA 2OR9L 4FZEH 1T80A 1OW0A 1TVDA 4YHYB 5DR5H 4XCYA 4I8DA 1CFSA 4M43H 3HUJE 2NNAB 4L1HA 4M1CD 5E9DA 4JFEE 4F2MA 4HG4K 5KZCD 4I48A 5D6CA 3V5DB 5FYLL 4U3XA 1I1AC 5INCA 1CGUA 2YUWA 5DHXB 5FHBL 5HPOA 1U2CA 4MQXD 1YEKH 2CDFA 1DCLA 4PB9H 4X83A 3RDTB 3QRGL 1F4YL 3UTZB 2GTWA 1S7RB 1IEAA 2Y9RT 1AR2A 1OSPL 3BPNC 5E95B 5FV2A 5H37G 1G1CA 1AP2A 1EJOH 2EDDA 1CD8A 3TT1H 2Q76A 2DYPA 1QRNE 3LQMA 4NRXA 1U8IB 4D0DA 2DKUA 3WUWA 3HMWL 2MQCA 1K8IB 1GXEA 1R0AH 1C12A 4QNPF 1J86A 3FQUA 2PYFB 2AV7A 1T20A 1CK0L 4XPAH 4TSBH 4Z7WB 3GNML 3GUTB 4LRNL 1SYSA 2C5DC 1CDGA 3PQYB 4NM4L 5H37H 5IBTL 1DJSA 3MJGX 4OBSA 3WKNA 15C8H 5DJYA 3VWKD 5HI3C 3IDJB 4GLRI 4ZO7A 4AEFA 1PQZB 2X4RB 2QLVB 1F4XL 4JANA 1DUYB 3BIAX 4RRPA 4YIQB 5J9PB 2OL3L 3O3BB 4IJ3C 2RJMA 2YPLD 2IGFH 4R4ND 5F6IC 2X4PB 2ZUQB 5CIPB 3O3DB 4I18B 1KTDB 1U8IA 3V95A 4Z95H 2EC9U 3HG1E 4Z77B 1WISA 3GI8L 2ADFL 4R26H 4MXQC 5E8EA 1XEDA 3ES6B 2E27H 4NN5C 3NZHL 3MROB 4F58H 3SDAC 3VRJA 3OJDB 4JRXD 5HSFA 3W9EB 3RVUD 3WJJA 1J8HE 5F6HJ 4GG8B 1T2QH 1CG9A 4CRPA 5GS2H 5CHNB 4LCCC 1I7ZB 3I2CH 1OTTC 2FYYB 4Z7UE 4K3GA 4JFQA 3H9SB 1MIEL 1N64L 4QOKD 3VH8A 4JZOB 3DYOA 4XC1L 3D2UD 5KVEH 3LEXB 1JV5B 4Y8DC 3U1SL 2B1AL 1RIHL 4ODHH 3DETC 4D9QD 2GUOB 2PXYD 4R4FL 4XPFL 3UZEA 5JMOC 1L7TL 1CFQB 1AC0A 1U8MB 3A6OA 1ZS8B 3GSWB 1J0IA 5DFVD 2P24A 4ZUWB 3P30H 1S8DB 1I8MA 3RWHA 2W9DH 5F9OH 1YEDA 1NC4B 2BJML 3OAZH 1FNSL 3VFWA 1R3IH 1U8PB 4LCWB 1I7RB 2GK2A 2Y6SC 4PJAA 1U3JA 4RBPH 5L7XH 1HNFA 3CFCL 2X40A 4LHJB 1ZLUK 1EA9C 1JUFA 1LK3L 4ZXBB 2CDGA 4YPGB 3LB6C 3QIWA 1PG7H 2OL3B 2QSTA 1QNZH 3EJJX 4HK0A 1WFOA 5MENE 5I1IH 2WWKO 2AABL 3O41B 3LN9A 4PJGB 1D5MB 4PY8I 2APXA 3X11B 5DLML 1BFVH 1YYML 2DM4A 1UM5L 3P9LA 2IJ0C 2OXGA 3VWJB 5F3BA 2J8OA 1OF2B 3DX6A 2VITB 4U49A 4ALAH 1CF8L 4LLUA 5T1LB 4EXKA 3S35H 4XWGH 3I6LD 1MI5A 2F58L 4HAGA 4JY5H 3FHQA 5DMJB 5KW9L 2Q8AL 5HHMB 4Y16A 4R4BB 3ARBB 5FIEA 43CAA 5IBLD 4U1NB 3NACL 4WUUE 1PKQE 3D39D 3R8QA 4MJIB 4Y1AD 1A9EB 1FZJB 4GSDH 3EYSH 3LS5H 3PWJA 2VDLH 1J18A 3QEQE 3TA3B 1IC7L 3DO7B 4CU6A 3MJ7B 3P2TA 4OKVA 2W9EL 3FO9A 4OM1H 5LXGL 1CLYL 1JIBA 3MRFA 4G43B 4P4KC 4TN9A 3X11A 4R2GD 1QVOA 1L4IA 4LQFL 4ZAKC 4MMXC 3QXAB 3W11C 4Y4FC 3S7GA 2DWDA 5EOTB 2Q6WB 3GI9L 3U4BL 2AJ3B 2VITA 2VLRE 4LASL 2D31A 3IFNH 3FB5B 4FQQA 1NKRA 4D9RD 2P47B 1MJ8L 4KTDH 5F71A 2GCYB 5E70A 3THMH 3U83A 1D5ZB 4HUNB 5T1DL 3FO1B 3SGDI 4BQ6A 4HJGB 2FECL 2JIXD 4DFHA 5CGYD 1A7RL 2EDJA 1YPZB 4HUWB 2R1YB 2F53A 4XMPL 3D3VB 4W81A 4L8CB 1ZA6B 5IVNA 1T89C 1UH3A 2HFGL 4MJIA 4FZ8H 3DGGA 5LQBH 3BVNB 4HWBA 3O2WH 2F8VA 1JF1B 5DK3A 4FFWC 1RU9H 1XF1A 1DUZA 1FL6B 3WJLC 4RWYL 4N0YH 1QFUH 1QBMH 4KMLB 4QF1B 2IQ9H 4L4VE 3MRBB 1P53A 3B6SB 4QRRD 4N0FB 1NBVH 4RGMB 1WAAA 4OAWA 2ADJB 4NN7C 5HGAB 5EU7C 1Q0YL 1G6RH 3S4SA 3VGGA 4JQVC 3C6LC 1JRHI 4POUB 3EYFB 4HK3J 3RZCA 1GGIH 2J8HA 2BHZA 4GKZB 1JZ7A 2GCYA 4OLXL 1D5ZA 1XF4A 1Q9OB 4ZS7L 1J0JA 1F4WL 4R7NB 4QY8A 4M7KL 4N8VB 1GGBH 4OZFA 2R1YA 1XCQA 1BGXL 4PY8J 5FM4A 5FA4A 5E1AA 2X1OA 4D9LL 1BD2B 4HHAB 3WHE0 5C92A 1IE5A 2P46B 4L9LB 3E6HB 4ZUTB 1FN4B 4NO5A 5IK3B 4OQ1A 3OKEB 12E8L 4MCYA 1IQDB 4WEMB 1D9KD 2ESVB 4KQ4H 2YXMA 2BOBA 1QFOA 3LN4A 5EC1A 4NP4L 1BFOA 1DQQB 4I2XE 4XP6L 5IB3B 4L5FL 3RWFB 3RIFF 1G0XA 4PJ8A 5HHNB 5E2UL 4ZTPH 4MSWB 3UO1H 3SGEH 3ARGA 3V4PL 4HIIB 4AIXA 5DJDA 4RNRA 4PLOB 1Q94A 1CGSL 5DMIH 4RSVA 5C0FB 4P2RA 5IHUH 3F7PC 4JVPA 3P4OB 2HH0L 1KOAA 4KVNH 4NO2B 2OLDA 1ITCA 1ORQB 5GGTA 3TCLB 1I9JH 2RR3A 5T5FL 4HIJA 5E56A 2OR8A 4M5YH 3BQUD 1BMGA 3LQAH 1NGZB 1KF9B 4BQCA 1I1AB 2NY3C 5ESVA 3QQ9C 3WNOA 2PYEB 3OPZH 3B5TA 3E6HA 4JB9L 5D70H 5FK9A 3D18B 4OD2A 1CE1H 3OGOE 3JWOH 4AEIL 1A14L 2NY1C 1CN4A 5CGMA 2AQ3A 3QR2A 2DIAA 1NCWL 1UXWB 2VXUL 2XKSA 2DQGL 2F5BL 3BPNB 4LSQL 5BJTA 3X3FL 1Y6MR 3V5KB 2AP2A 3FN0L 2RIKA 5D1QD 3KXFB 3MLRH 4B0MM 1RZKH 2F54E 4HFUH 1HHJA 1AE6H 1H3VA 4Q6IA 4UTBH 1OSZA 4JGJA 1FLTX 5I1AB 3KPOA 1IAOA 3H9HA 3DRQA 3HPLA 3QFJE 4PB0L 5LGJA 3KPMA 4FTVB 4P23C 3TCLA 3BSZL 4L3CB 1FNHA 4NKMB 4DZBB 2H45A 3KR3L 1MUJA 3C5ZD 4BK4A 1E28B 4EUPA 1ZXQA 2VXTL 2D4FA 1ORSB 4NQEE 5A2JH 4BFBD 5L2JA 3N1FC 3QO0A 1OGAD 1INQB 2Z31A 4NNPL 2DD8L 3N85H 3P77B 4OD1L 5TH2A 4MNQA 1WICA 2BFVH 2ZUVA 4FFYH 4BQ8A 4LGPB 1OAYH 4OIAA 4PUBH 2YUXA 3TBVB 4IJ3B 3VGAB 3EYOB 1R6VA 1WV7T 1U42A 1WC7A 2YEZA 1K5NB 1PY9A 1LNUB 4GBXA 2JB6B 4R96A 3BEWA 5GRZA 3T0DA 4NN5B 3QDGD 4F33A 3FO2A 3SDAB 5IB4A 4JO4L 2I9LB 2EKSB 4KRLB 3PHQA 4L3EE 1LGVA 3D0LA 2F19L 3EAKA 3PHOA 4U1IB 1KJVA 4NPYB 3C5JA 1G7JB 1QFWI 3CDFA 4LCCB 2XWTB 3IAGC 2BOCA 4MNGE 5FUCC 3MOAH 1SJVA 4QEGA 1DZBA 1CD9B 3FQTB 3UBXB 5E00B 3BKCH 1A7OH 4NQSB 4OD3L 3IGAB 3BGAA 4CMMB 3FB8A 1U41A 1JYWA 2GITB 3G6JF 2YD6A 5K9QI 1YUHB 1AXSA 3S97C 2BNUA 2ERJB 1CVSC 1KJ2B 4H0IA 1I85A 1K5NA 4FNLH 3S88L 1LO3H 4DGIL 2CK2A 4KJWD 3X13A 1JPGB 3A0OA 5CJXC 1JZ5A 3UTPD 2HJKB 1C5BH 5AD0A 4OZ4B 3WUWG 4G6AC 1EVUA 4NKIL 5EIVA 3SDCD 4KDTA 1PZ5B 5EUOE 5FM5O 1LO0L 2HTKD 3OL2A 2DLFL 4NQUA 4Y89A 4M1GH 2Q87A 1Q72L 1C1EL 1MELA 2DQTL 3UBXA 1F6LL 4LLWA 2EDFA 4Z7NF 5FDWB 2AK4E 4NC1C 4ELMF 5J0BA 3ULVF 4X5XA 5E6ID 4M7JH 2BP3A 5CBEB 5IEKB 2Q3AA 5E5MB 1FPTH 1M7IA 1A6WL 4PJBF 1CD1B 8FABA 5D2NE 2NYYC 4I9WE 4BKLA 3VFVB 2HJFA 5DEFA 1QLFB 5IW6B 1JPGA 1CFNB 5DVOA 2IPTH 3ETBF 1CZ8H 3V8OA 3O3AB 3G6JE 1H15B 4R9HA 3LVEA 1FZMA 5IV2B 5D72H 1EBAA 1KIRA 3QZWB 3VXRA 1ZT4B 4JDZB 5HHVH 5B4MC 1QPXA 1PW3A 5FO9B 1NUFA 5DD3H 2ZG1A 5DGQA 4DUXA 3K74B 1T5XB 3O4LA 3L3KB 1CQKA 4P4KB 1ND0A 4LSVL 2DLEA 3VXSD 3QNXB 4JFZL 5GSVA 2Y72A 2DWEB 4YDIH 4Y4FB 3FB6B 1AC6A 3MPCA 3CFJB 2R0WH 1FYTE 1A1MB 3VFVA 4NYLB 5FCUH 2XFXB 4JR9H 5CEYB 5SWZD 1NGPH 4KKAD 1J05A 4JPVH 5MEPB 4Q9QL 1OY3B 4MQXC 3F7VA 2YR3A 4M9OA 3UPCA 3V9FA 4ELME 1FDLH 1IEHA 3ULVE 5C08A 5EZOL 4MB4A 5EU3A 3BHBA 5H2BA 3MOBL 3IT8D 3MFFB 3HKFA 5IV2A 1TETL 3QZWA 5C0AA 2K3TA 4KV5F 1HXMB 4PJBE 1LDPL 1CFBA 1EV2E 3JUYA 3UCRA 1BPVA 4P59L 1LQSR 1SJEA 2CLRA 1PLGH 1NFDF 3LKOB 1M7DA 2Q8BH 3R8BB 4ZAKA 3CGTA 3QNXA 3MNWB 3FTGA 5GGVL 4XRCB 1QSEE 4CGTA 2DLTA 4NN7B 1AO7D 4I0KA 4ZOBA 4MDJB 5FV1L 4Z78B 1FAKT 3C6LB 4H26B 3U7YL 3WFZA 1YN6A 4YC2C 3TT3H 4NO0A 5IEHA 4CNIA 1ED3A 3L3JB 4V2BA 3ARYA 2NCMA 4MB3A 5ERWB 3S5LB 3MGOB 4U31A 2VB5A 1EZVY 1OAKL 5DJ6A 1W8NA 4UDUB 5SWQB 3X17A 3DUSB 2WW8A 4GS7C 3LY6A 4R4NC 1JJUA 3RNQB 3V0AC 4C4KT 3FOMB 4XAWH 2EKJA 2V7NA 1XF2B 1BOYA 1XGQA 2JCCA 3WJLA 1JHTA 4WU7B 5C07D 1D3CA 2AEWA 2ZUTA 4GMTH 2GSIB 2WUBL 2X4NA 1KIQB 2GIYA 4NWTL 4XRCA 4EBQH 5F7MC 4PJIF 3HE6C 3EOBA 3LDBC 4Y4KD 5TFSH 4LHQB 5TGBA 1YQVH 4JQVA 4KUCF 4H26A 4KV5E 5T3XD 4LP5A 1MFAL 4N1CA 4LARL 2JTDA 2ZCHL 4N0UA 4NM4H 5KJRH 1BECA 3SKOB 1NFDE 3MGOA 3PXJA 3MLUH 1GZQA 1GVIA 5JIPA 5HXMA 5GHWH 4F37F 4TVPD 4ZSOB 1QFPA 2OMBA 3EIFA 3GIZH 3VCLA 5EPMA 3D69B 2CKBL 2NY3B 4J3WA 5KSBB 2I9TB 3QWRA 2PXYC 1QACA 4MQSB 3AGVA 5FYKH 2FO4B 1MH5B 3KPTA 3M07A 4GKOA 2NY1B 2V5SA 2MHAB 3QDJA 4M6AA 1ZHBB 2H41A 1LEIA 1GGYA 1JZ6A 1Y0LA 4YPJA 3NZHH 2DQJL 5C0CE 3SJVD 4CAGA 1IJ9A 3SBWC 2E8YA 4XNZC 1GAFL 1MCOL 2XZZA 2RBLA 1MRCH 4IMLB 4B41A 2X10A 1PZUB 1NC2A 2LE9A 2LABA 5GRXG 3OGCB 1CFVH 3SKNA 4P23B 1L0QA 3TNMB 3TO4C 4U1GC 2PTTA 3OX8A 1NBYB 2DQIL 3TO2B 4PJIE 4HIXL 2Z35B 2B1AH 4HWBH 5BOPA 4C56D 4DVRL 3MTRA 3OB8A 4MXVF 4O2CB 1KJ3H 4ODTH 4XPFH 4NHCH 3DV4A 3OV6A 4WI3A 1DTUA 5F7DA 4YEFA 2MHAA 3BDYH 3SKMA 3KPRE 1T1XB 5EUKA 2AEQH 3PP3H 3WBDA 4MA1B 2IMNA 4X9GA 4XMLH 2K9UA 1FNSH 4M7ZC 3BUTA 1EHAA 5IBLC 1MIMH 1NKOA 5DMYA 3RX5A 1RPQA 3OJ2C 1W8OA 3AXLA 3VA2C 3CFCH 4NUGL 1LK3H 4JFED 4QRPE 1HI6A 1DANU 3KDMB 3HZVB 2CKBB 2BCKB 4S1DD 1A4JA 3FZUD 4LSTH 4OZFH 5CAYB 1N8ZA 2J12B 3AVEA 2FB4L 1YA5A 3CU7A 3HB3C 1RJLA 3TO2A 1TVBB 2AABH 3B9KC 4R2GC 4BZ1H 3VGEA 5E8OB 4N8VG 3DBXB 1VDGA 4PREA 5TDNA 1UM5H 3QDMB 5E2VH 3BWAA 5I71C 4QTIH 2V2XA 4JJHA 3W5NA 1IQWH 3B3IB 3HS0B 3QJFB 4Q9BA 2F74A 3ZKNC 3JV4B 3NGBC 2NY6D 2HFEB 1QRND 4FS0A 3WFCL 3FQWA 4U4BA 2F58H 1WWCA 3QI9B 1MCCA 1TNNA 3MV7E 3CFKB 3IDMA 2Q8AH 1T0NA 4DKFL 1ZHNA 5E9DE 2EDKA 3CH1B 2XYCA 3BP4B 4MXVE 4OLWL 1D5XA 3MNVA 1ULVA 2E7BA 4F7EA 3FT3B 3KDMA 2EXWD 4V1DB 3L7EB 4CW1A 3V0VA 3U82B 2HN7A 4JVWA 1IC7H 2O5ZL 3V6FA 5L2KB 5GS3A 2VE6B 1I3GL 5LXGH 3ABZA 2VSCA 3DROA 4M6MH 4N90E 1DBBL 4H5SA 4LQFH 5H94A 1UENA 1HK6A 5JQ6H 4EIGB 3K1KC 3TH2T 4RWHA 2AK1L 3MRQA 3MJ6A 3GI9H 2UZYB 1DQLH 4MQTB 4LASH 3JV4A 4OM0L 2HFEA 4O2FB 5DD6B 1UACH 1KFAL 1I4FA 5L0QC 3HG1D 2J5LC 4ZPTA 3MRIB 5T1DH 1UT9A 1U8NA 2I07A 4WV1B 3OG4B 3HFMH 1XGRB 2Z4QA 5DWUH 5KSUB 4X6CA 3TYFA 4JEGB 4JFYB 4XMPH 2A9NH 5GS0D 3DOSA 2A6IB 2HFGH 2HT2D 5T1KD 1MHEB 1NAKL 3HPJA 3MACL 4XVUD 3RI5K 1LEKB 4PRPB 3MA7B 1R5IB 3RHWK 4E5XB 1D9KC 1G9EA 5HGBA 3SPVB 1T21A 1RZIB 3MODL 2DQEL 2YBRA 3IJHA 3MLZH 4KAQL 1U8OB 4X6DA 4PJAF 3SHSA 1MPAL 1KXVC 4OQTA 4KU1A 1MVUA 1JF6A 4QXGL 1UZ6E 3IJSB 5DQ9A 5BVJB 1E4JA 4OFYD 2VDPH 2G5BA 5ITBL 1RUQH 3V5HB 5LGHL 4OLXH 4XP5L 4HWUA 1DFBH 3ZE2F 1XIWD 4XZUA 1JPTL 4ZS7H 5KSUA 3KAAA 1UWXH 4HK3N 3WHXB 4XNXH 1EFQA 3INUL 2WBWB 5I16A 4JFYA 3FMGL 4OT1H 1CU4L 5KZCB 4Z7WE 3BQUC 1IM9A 3GMRB 5KVDH 4WVRA 1TZHA 2XIDA 4UTAH 1KXQE 3VG0H 4H1LB 1KCRH 4WWID 1FFOB 4U1KA 5D5MB 4YWGL 1XR8A 3VMOA 1I9RH 4HBQA 2DKMA 2P43B 5DD0L 2PO6D 2X1WL 1VSCA 4P5TA 4YGVB 2LAGB 1HXYA 2QADC 4NQCA 5IFHL 3GFUA 4NP4H 5MEND 4HUVA 2AJSL 2NX5A 2D7MA 4XP6H 1IEBA 3UP1A 5E2UH 1BLNA 1IKNA 4PRBB 5DURD 4JFDB 3DMMA 3WXVL 5I76A 3O2DA 4RGOL 5DRZB 3V4PH 3P4LA 3DVFA 3BIBX 2OSLA 1CGSH 2VISB 4YJZL 5CZXD 3C6SA 2CQVA 1H3PL 2R4RH 5HVGB 2DQHH 1ZV5A 3UBXG 1EEZA 4XCNA 4KHXL 1K4DA 3C5ZC 3QNZA 5T5FH 4WNQA 4Z7VA 4TTDC 1HHIA 4KJPC 4PJAE 4YC2B 3MRLB 1IC5L 1YMMA 1QSZA 2X4UB 4U6XB 4KGJA 3VWKB 4G7YH 4WUUD 4JZN