2QL1A

Structural characterization of a mutated, adcc-enhanced human fc fragment
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
209
structure length
209
Chain Sequence
GGPDVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPLPEEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IGHM protein
publication title Structural characterization of a mutated, ADCC-enhanced human Fc fragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ql1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ql1A01
4LSRL 1P4LB 4AQOA 1FHGA 4OLXL 1NDGB 5E94A 3MUGB 4APQA 3SO5A 2WW8A 2VN7A 4IMKC 1F42A 2V2XB 2EZ0C 4NQEB 1DEEB 1I8LA 2D31B 3CSPA 5CIPB 1ZHNA 4EN3B 2JE8A 2MQ0A 1ITBB 4M6NL 1XZ0B 5LGKA 1R0AH 4JFQA 4HIJA 1FO0B 2LFGA 4QOKE 5CHNB 3GSNB 3D69A 1ZWIB 4ODHL 2IALB 3T2OA 1NBVH 4ZPTB 4WI3A 4PJAA 1HHJB 3RP1A 1IGFL 3NZHH 3Q1SH 3FO0L 5EORL 3I84A 2AXFB 1FL6A 4QRUA 1XCQB 4GW5B 2BSTA 4Z9KB 3QHTC 1L0XA 3LHPL 2HTLD 2Y06H 4HC1A 3OWEA 5DC4B 5ETUB 2VC2L 1HHGB 4F37F 3UPRB 4PB9H 5DURD 2APXA 3BXNA 2FO1A 1N0XH 4WWKA 5F72S 4LCWD 5FA3B 2V5TA 5LGJB 1DBAL 1S7SB 2BC4B 4DVBA 1NGPH 2DQCH 3RWEB 3CK0H 3GRWA 1I8KB 1X5YA 2ED8A 3BP5A 4JDVB 3RVUC 1D9KD 1G6RL 4L5FH 2DBLH 5I74B 2DIAA 3VXQA 4OZFB 2FLRT 5GRWA 4OF8A 1NBZA 3QNYB 3WS3A 1PZ5B 4ZO7A 4R2GC 5DD0L 3KPNB 4H20H 3RWFB 5LJYH 3SGEH 5C0FA 3MNZB 4KKLD 1J8HA 3G5YB 4RAVA 1HCVA 4U3HA 4G7VL 2QHRL 2X4SB 2P7TA 3BKCL 4YHLH 1BVZA 5GS1B 4ALAL 3PL6A 4LCCA 1H3GA 1FRGL 2GJ6D 3T0XA 4Z7WE 3KPLB 3WKML 4GUPB 2YD9A 3BVNB 1FAIL 4QWWC 1NPUA 3V5DA 2Y7QA 3A67H 4YXLH 1P4IL 2FJFA 1MFBH 4JHAL 5FFLA 4ZUWB 5T1KD 3VXMD 2VITA 4P5MB 4JREB 2OI9C 4P9MH 5ESQB 1E6OL 1VGKB 3UYPA 3HR5A 4WTXA 2YZ1A 3BQUA 4L8SC 2N7AA 4PBXA 3IDJB 2OP4L 3VG0H 2ZUYA 3B6SB 1EZVY 1I8MB 3QEQE 4J3VA 4L29A 1QPPA 2O93L 4N8VA 4WY7H 2X4NA 1WZLA 4Y88A 2NMSA 3PWVA 3QCUH 3AC0A 3Q3GA 1C16B 3RI5K 4MNQB 4ERSL 1JYXA 3TBTB 5EC2B 1OAUH 4HIHB 1XIWA 4I9WD 2HVKA 4JPWH 3TPUA 3S3JA 3GBMH 5FHBH 3FQNA 1N6QH 4NQEE 2AXGB 4JG0L 1N0LA 4U3CA 2LTQC 5ITFA 1NFDA 3MGTB 4JANB 4XMLL 2A9NL 4LSTL 4LSVH 4J12A 1J9CT 2PCPA 2GTWA 1OWWA 3QDGB 4Z7OE 4NCDA 3CXDH 3V6OE 1OP3H 1AD9A 4G8FA 4HLJA 1GZPB 3CX5J 2ZUQB 4JQXC 2X4RA 3KJ4C 4QTIH 1P7KB 4WI8A 3U1SL 3QIWD 2AK4A 5J12C 4J4PA 5D6DC 2C3XA 2E7LA 1NCAH 1NC2B 3DBXB 2FH8A 5IMLA 3DPBA 1DLHB 4LLDA 2D7TL 5L8KB 2Q76B 1ACYH 2P5WA 3RWDA 2R0WL 1OLZA 3VWKB 4X7EC 1T2JA 2OJZH 3BGFC 4HK3N 3BZDA 2PO6B 4PB0L 4NQXA 1PEWA 3TESA 1CXLA 2VDPH 4GXUM 2PXYD 5TDPA 1BD2A 4XCYA 5IG7B 3LS5L 4I2XA 3NMEA 2FO4B 4IHOA 2LU7A 1L0QA 4Y5VB 1ETZA 1KPRA 3O8XB 5H37H 3O9WC 2I5YL 3TBVB 1Q9LB 1ZA6B 3G6JB 3ZT6A 3MRCB 1R5WA 5HXMA 4OGYH 5C0ND 5C0GB 1A4JB 4LLMB 2GAZB 3DGGB 2WBJB 4M48L 4UNUA 3R8BB 3G04A 3F6IA 5GSVA 3IKKA 3B2UC 4UI2A 2DM2A 4K3GA 1KELL 3VA6A 5KOMC 2NY2C 1G7PB 2EYRB 1U3HD 5JIIA 1EBAA 3UZEA 1JUFA 4N8PA 1QFWI 3QG7L 5FOJA 3SKJL 2Y4SA 4WW2F 3A6BL 4RIRA 4BA8A 4RGOL 4MHHG 2PR4L 4KJPD 2EDWA 2ZOKA 4N0UB 1BJ8A 3T4AB 5T1LA 3IXAA 1F4YH 2E3VA 4CU7A 1CI5A 4XGZA 5C2UB 1GOHA 3FL7A 3FCTB 2HKHL 1YY9C 1IFHL 5I66B 3P4OB 1GHFH 3QPQC 4LLYB 2VXVH 3MXVL 4TVPD 5IQ7L 4D9QE 4L4VE 2NNAA 5FYKD 4JHWL 5D6CB 4HMDA 2BVTA 4WO4B 4TSAL 3WFBL 4XCNA 1LEGB 5EOQH 4G43B 3C8HA 2HFEA 1ZANL 1MCPL 1ORQB 5IFHL 3LRHA 2XY1A 1IC4L 4TSBH 3HMXA 1A6TB 1NDMB 1IKFL 4GQ9H 3RGVB 3RVWC 5BRZD 4G5ZL 5MEOB 5FM5M 4MAYC 2GHWB 1NMCC 1JN6A 1G7MB 5EU5A 3WDJA 1KJMB 3PWNA 3N85H 1WFTA 4R0LC 2O61B 3MLWL 4PJBF 3MREB 4Y2DC 4YBQC 3SDDA 2D7OA 3BUYB 3DUUA 3QDGE 1DUYA 2DQDH 4P5TA 4LVNC 2X9YA 2Z4QA 2NY7L 4AIOA 1UM5H 3EJJX 3WN5A 4B41A 3DX9B 1RVFH 3W2DL 1ZVHA 2YXFA 3IETB 1TETL 2LQRA 4LEXL 3SDYL 3BEWB 1H0DA 2A6IA 4M5ZL 4YDVB 3T0AA 4JFOB 4JQVC 2IG2L 4HWBA 4ODXB 1OD9A 2GY7B 3RX8A 5H35A 1I75A 4QOKD 3HE7B 2JELL 5EG6C 5IB4A 3GBNH 2VDMH 4XNMA 3UEZA 4K23H 3EDKA 5I18H 1R5VB 1TQCB 5MERA 1OW0A 3RIFK 4PY7B 4LCYB 2HRPH 1JF1A 5EWIH 2P8MB 3G6JE 1AGEB 3LEVH 4ZAKD 2QJDA 2DM3A 1AQDB 2C1OB 3QXWA 4Y4FC 1JHTA 1NBYB 1JWMA 1NAML 1RMFL 4JY6B 5AAWA 5FYJH 4DGIL 2XKNB 4FN0A 3RPKA 4LU5H 3U4BH 3SGJA 2AEQL 4NC1C 1RHHB 4JKPH 4OV6F 2A1WL 3T2PA 4NZJA 2FGWL 3MBEB 5EO9B 2J6EL 3DX7A 2J5LC 4XMKH 4LFHG 4WJ5A 5GRUH 3AM8C 2C3HA 4ELMA 4N0UE 1RIUL 2AJUH 2X5PA 4R4BB 5C3LD 5C07A 1CDBA 3GKZA 4G9FD 3L3HA 4P46C 4WTZG 1NBQA 4P2QB 4ZD3H 4YHOL 3OXRA 5L9DH 4ZTPH 3WFCH 3NCEB 4W70A 3N1PC 4FFVD 3ZLQC 5HVHC 1NCTA 3HNSH 3U9PH 3W0WA 4RQQA 4M6OH 1IGML 1YMME 1INQA 5BO1H 2NY6C 1MOEA 2AXJA 1IC5H 3TIEA 1NGQH 1Y0LB 4WNQA 1FYTE 4XP6H 4X9BA 5M7QA 1G7IB 3VFPA 3P9MB 2CR6A 5DHYB 1RUPL 1JTTA 4AG4H 2IBZX 1GSMA 4QHMB 3FN0L 3CFKA 4QO1A 2XRAH 5I1KL 1WCBA 3LDBC 4HPOL 4AMKL 1HSAA 5JIKA 4MS8C 3QEQD 32C2A 4GBXD 3IRPX 4WUUE 1XGYH 4PJAF 5F97E 1N2RA 1NCBH 3QQ3A 2VL5B 5BV7L 5ECJE 2XTJB 3IVKA 4QHKI 5IFJA 1TVBB 2DN7A 1IEBB 3QCVH 3ZT5A 5KVGH 1CGYA 2EE2A 2O5ZH 2XWJA 3O41A 2OX5A 4Z5RA 1MY5A 1P2CA 4Y5YB 2B5IB 5DMKA 1PY9A 1CDJA 1GAFL 1AR1D 5C0DB 2VXQL 1HHHB 1CFVL 4NQED 3BH8B 4FQHB 2YD8A 4HZAA 1S9VA 3UPAA 4O9HL 1QA9A 3OKOB 4EN3D 3ULUC 4TSCL 4HXAH 3NCJL 4FXGB 1IKNC 2YC1A 5D1QD 3MJ7B 5DEGA 3ARDD 2Z93B 3X17A 5CGMA 1CE1L 1GC1L 3WFEL 4EI5C 4UIKL 3VFNA 3FQTB 1MCJA 1MHCB 1R3JA 1LVEA 3OKKB 3T65A 2VDLH 3F5WA 3V2AR 3HAEH 2ZSWB 5CINH 3GMQB 4L9LC 4C54A 3NGBB 1UXWA 2FD6L 4BZ2L 1R3KA 4UINH 1NSNH 4FZ8L 4XCFL 1CGXA 5ALCL 5I1AB 4GKNA 4KQ4H 5B3NA 2XZAH 3UTQA 3ZKMD 1U8IB 1P53A 3JTSA 4HLZG 5CGYC 1GGCH 5ISZB 3MV7B 2H9GB 3BP7A 1AXTH 2A73B 1F3DJ 1DVFB 1ZV5A 1CS6A 2QBWA 4JKLA 1DQML 4LVHB 1D6VL 3QJHA 4OBRA 4YFLI 3PGCA 4GG6B 4OF0A 5IBLD 3DRTA 4OI8A 3B2VH 3BOVA 5GPRA 5I1GH 1MJJA 5J1SC 5GRZA 5BZWA 4P2QE 2VLRD 4K3HA 1RUAH 1JGDA 3TIDA 4NHCL 1X5XA 1FVCB 3HPLB 5EZLA 1WZ1L 2H32B 3FRPA 1HXMA 5BOPA 3ARGA 5HHMB 1HYSD 4OB5L 1FL5B 5DSCA 5EOCL 5F7YC 1NFDF 2X9WA 4KTEL 5I1LB 3BAEL 3LN5A 3WNPA 5C9JA 3CDYA 3Q5YA 3P3YA 3QIBA 4PJGB 3C60D 4XP9L 2OZ4L 2X4UA 3S5LG 2F8VA 2OTWB 3NIFE 3GMLB 1JNNH 4MSWA 5D7JD 1ZEAH 4ZOAA 5B38G 1Q9KB 3TN0D 3QDMB 5IKCA 3K46A 3FB6B 1QNZH 1LNUB 1QFWM 4U7KA 3UJIH 4MJ2A 2Q7YB 2ICWJ 1KCSL 4HCRA 2XTJE 3EJZC 1AFVH 1RUQL 5GIRB 1N4XL 1QFUH 4MNQD 3PHOB 1QBAA 1S3KL 1M71B 3D48R 5IMMA 4R26L 4OLVL 5IWLC 3VRLE 5DEFA 3NBNA 5ICZB 3FKUS 3KS0J 5A2IH 2KH2B 4LLQB 3VA2C 4X7TA 4YEEA 3QULB 1YMHB 5DVOA 2B1HL 5JPNB 1FFRA 4UDTA 4OAWB 4CN1A 4FQPA 2PYFB 4CN4A 1QLEL 4PV8B 3I6GB 3QUXB 3ZDYE 5EU4B 2WANA 5F44A 3CVHA 3WCYA 5C0RL 4L8BB 2WK2A 1CGSH 3HZYA 4MD0B 3TVMC 3CH8A 2AP2A 4PREA 5H8DA 1IEHA 2JB6A 2BNQB 2IFFH 5TGBA 5E9DB 3SDCB 1W0WB 3LRSA 3FZUD 3QG6A 2EC9U 4J3XA 1QRNB 5IT2H 2QADB 3SQOH 4WEBH 2EIZA 1NFIA 3WFZA 2H1PL 3MCKB 3QAZB 1YNKL 5EC1B 2PO6D 2OL3A 3BW9A 4S2SB 4OV5B 1GIGL 3HLAA 2MPAH 5TF1L 3QJFA 1HINL 2X42A 5D70H 1UKQA 3K1KC 4J3OC 4MCZA 5MP6L 1A02N 3RKDC 3MV7E 1HZHH 4D0DA 4O2CB 4P2OC 3W82A 5CKAA 4GS7B 2AABL 2WBJD 1T0PB 4IJ3C 4NWUL 5FK9B 5KS9B 4EJ1C 3DXAD 4YNYA 3S8WA 4GG6E 4D8PB 1JWUB 1KXTB 5TE4H 3WXWL 1NUFA 3AGVA 3HN3A 4IRSA 4DGVH 3LRGA 2NLJB 4PLJD 2WBKA 3QR2A 1P1ZB 2UVFA 4PJXB 5EBLA 4QNPF 3RZCA 3BYYA 5HHME 3W11D 4DN3L 4YDLB 4G6KL 4X6DB 2DWEB 2JJUA 3VWJA 4GLRI 1BZ9B 1H5BA 3QXAB 4I77H 3T1FA 1KCKA 1R24B 4E0RB 1EV2E 1A2YB 2CDEA 1WCQA 3FRUA 1N7MH 4KRMB 4PJ8B 4PJDB 3VXTA 2Z31C 4PJGE 5HDBF 1LD9A 2P47B 1NAKH 1YEKL 4OCSL 4QCIA 2GK0A 5FGBA 4HKXB 5JOPD 2YBRB 4O4YL 3QDME 3UC0H 2SEBB 3MRLA 1MLBB 5IV2B 4JN2A 3E2HB 4AT6B 1GCFA 1OAXL 1UKSA 3L3GA 1CD1A 1FN4A 4GMTH 1UZ6F 4U2YA 1JNLH 1R0AL 3IJYB 3ARVA 5I8CB 1OGTB 3QIUC 1OT2A 1IE5A 5DZLA 4TRPH 5DLMH 5HGAA 2D7MA 1F3RB 2ADJB 4LHUB 4L8DA 4KDTA 1NBVL 1VACA 4FQXC 5KG9B 3L3JB 4YAQA 5C0JA 1MQ8A 1P84K 3QEUB 3NZHL 4KRPD 1I8IA 4HGWA 4LGPB 3GSWB 4J6RL 1A6VH 1J0JA 5E1HB 35C8H 3ZE2E 4V1DB 1QFHA 4M00A 4F8TA 4ZFZA 3CLFH 4PB9L 4B0MM 4X7FC 5ESVA 1V7ML 4ONHA 5D1ZD 5E9DE 1N0XL 4X9HA 5KSAA 5IM7A 5KW9H 1QRNE 3T09A 2WLZA 1U3JA 2D9QB 3CK0L 3OF6D 1BECA 4TNWF 5HSFA 4QF1B 5AYUL 4GAYA 1S5HB 4XPAL 3X12B 5GJSH 3BIBX 4LLVB 4ELMF 2DBLL 2N56A 4M7ZC 3RDTB 3S36X 3D3VD 4LNVA 2NW3B 1L7TH 1XR9B 3BWAA 5HHOA 5F6HI 4F7CB 2ADGA 4R90H 1HHKB 4U1KA 1FZOB 4JFPB 3V6FA 1KLFA 4Z7QF 4ZPVA 1IAOB 1S8DA 3OZ9H 4FXKA 1EVUA 3VD9A 3SCMB 5AZEL 5KS9E 1QEWA 5A1AA 1RZFL 3HZKB 3GRWL 3WE6B 4KUCD 2Q6WA 5I71C 2X44D 1B0RA 4PGCB 3RWIB 3X11A 1LP9A 2FJHA 3BT2L 1U9KA 3LN9A 4Y0GA 1GYAA 3MBED 3A67L 4YXLL 4DGYL 4EUPH 5DJ6A 1DQLH 1XT5A 1MLCA 2DQJH 3ETBF 4PJXE 1J0KA 1RI8A 1F2QA 4XXCC 4CDGC 5DD5H 5HGGS 4P5KB 2AQ2A 2R1XA 4X6DE 1RZKL 1JP5A 3VG0L 5DO2D 4P2QD 1A1OA 5JLZA 1KT2A 4J3UA 4MA7L 3NPSB 4WY7L 3QDJE 3D2UD 4PJDE 5HI4D 3B3IA 3B5TA 1BJ1H 1U95B 2VDNH 1OAUL 3RWGA 3GHEL 1MFNA 4JPWL 4X80H 5DS8B 4MB4A 4YE4L 3GBML 4N0CC 1U8QA 4DCQB 4HFUL 3WFHB 3QUKA 1XGUB 1AP2B 1I9RH 3GSRA 4LSVL 5EBGA 5DJDB 3KDMA 1F58L 2NY4C 4EDWL 5E8NB 3O4LB 4NRXB 5T3ZE 3GJEB 3PHQA 3U36A 1XGQB 3DV4A 1X5ZA 1ZVSB 4Y89A 4WFEE 4F15C 1JZ6A 4DJMA 5C0IA 1E28A 3FB7B 1DE4A 4HHAB 4N8VG 3EDEA 1YEFH 2W91A 4RGND 1RQ5A 1BZ7B 1G7QA 1HHIA 2W9EH 3EW3B 3GMNB 2A9MH 4AQ1B 1ACYL 5EBMA 3NFNB 5H2BA 4JRXB 5GGVH 2OJZL 2DM4A 3GNMH 4V1DE 1IT9H 1LO5B 1IAKA 1WC7A 4J3TA 3LQZB 2RAMA 5TQ0H 5JW4R 3L3DB 5SV3A 3SDAB 2YPKB 3MRPB 1N3NB 1CWVA 3TYFA 3T2NH 3SDXA 1ZSDA 2VZVA 3LIZH 1E4KC 4WW1B 3CDFA 1JZ8A 4Y4KB 2YPVH 4NDMB 4OGYL 3MRIA 2CH8A 4KK8D 3ZSTA 1QBML 3UTZB 2APFA 3OR7A 4O5LL 2C7UB 5L2JA 1IRAY 5D93B 3O11B 1MNUH 1I7RB 5EDXA 3T3MF 3SJVB 3I3DA 3ZYZA 1PYWB 1QBBA 1BAFH 4DZ8A 1Q8MA 5J7CC 1MHHB 4Y4HA 5I1CH 3BPCA 3PV7A 4U1SA 4M61A 5ISZD 1AO7B 1T89A 4WHTB 1F4YL 3TO4A 3O6MH 2XG4A 5KBNC 5F7FA 1UJ3C 3Q0HA 4U6HB 4YHYC 5CCKH 1BQHG 1NLDH 2VXTH 2XKSA 1JNHB 4MDIB 5FKPA 3LEXB 1YJDL 3OJDB 5FXCH 2GSIB 2XTLA 4X98A 1MAKA 4FRWA 4NKOA 5B22A 2CRYA 1BBJB 2KKQA 4DKDC 1N64L 4HH9A 3BD4A 1QLFA 1FBIH 2UZIH 3EJYC 1EMTH 4HMEA 3DSNA 1J1OH 5EU3A 1NGYA 2J8UA 1S9XA 2DM7A 4GQ9L 1V8HA 2B0SL 2Y36H 5C0AA 3RTQD 5D1XA 4HSQA 5LBSH 3TGXA 1QVOA 2AJ3A 5CBEA 5E2JA 1YUHB 5DFVD 2F54D 1EGJH 3N85L 3IDYC 5FYKH 1URLA 4NPYB 2D0FA 3OMZA 4Y7MA 3ROLB 1U8KA 3DTXA 1BFOA 2C5DC 4I0PA 4POYA 3VFUB 3O4LE 1J1PH 4U6VH 5C09A 4JY5H 3S36L 3HMXL 5CJOH 3O6FA 3CFEA 4BFIA 5GZOD 4C83B 2GITB 2ZOLB 2GK2A 4LNRA 4HS6A 2V17H 3VFOB 1J1XL 4PLKD 3RZWA 4QHNA 4QRPA 5CD3A 4IMKA 4JRXE 1A6ZA 3O0RL 2BY1A 2EYTB 3CPLB 2VDML 3F8UB 5DRWA 2BXYA 2E7BA 4K23L 4OFYD 4UQ2B 5I18L 1OP5K 1AQKH 4MJ5B 2HJKA 5MHSE 2NTFA 2DRUA 2WSKA 3A0OA 3R1GL 4XPBL 2HRPL 5EWIL 3EOAA 5IW1B 3F7PC 3B8SA 3LEVL 3BE1L 2K7QA 4XCEB 1L6XA 2BNQD 5E9DD 3SDCD 1UJTA 4PGJA 2HRLA 1CLZH 3CFJA 4AL8H 5E70A 2QADD 2J1KA 4LU5L 2EXWD 1EX0A 5LAXA 1KCLA 3QWOB 3FOMA 4FTVB 4HG4K 3DO7B 1KFAL 5I75B 3SJVE 2JIXA 5LXGL 3VRIA 4MX7A 1XGPB 3MSPA 4XMKL 1ERNA 3C5ZB 4PY8J 5JZ7C 1O0VA 2CLZB 2FEEI 3L9RA 3V0AC 1AO7E 1PSKH 2AJUL 2G9HA 2YOCA 5BOZG 2C9AA 5L9DL 4RFOH 3PGFH 4ZTPL 2R69H 5GSRB 4ZNEE 2YK1H 4HS8H 2EXYC 5F3HA 3T0ED 1FVDA 3I2CH 4NSKA 3U9PL 4YHPB 2MCPH 5BO1L 5E5RB 1VFOA 5HYJB 3OAYK 5JDSA 3L3KA 3DX8A 5CP7A 5T1MA 4FFZH 3WLBB 4F2MB 2V2TA 3GHBH 1U0QA 1PZUB 4MDJA 1KB5A 4X0KB 2WWMC 5GGUB 1NCCH 4UTAL 1UH2A 3LKSB 2AV7A 2XRAL 5I9QB 4ZO8A 5FCSH 1MEXL 5FIEA 4WI4A 1XGYL 5F9AC 3P40A 3QBTB 5F3BB 4RRPA 3BZ4A 1HIMH 1F4XH 4O2FB 2DQEH 1FNHA 4L3EA 4PJIB 3NOIA 3ARBC 1VFBB 2O5ZL 3LSOB 4XPTL 2Q86B 4JO1H 2GI7A 2VDKH 4L8SA 1FL3A 2VRAA 4U6XA 3BZEA 4C59B 1FG9C 1PG7W 2DJ4A 1X4XA 4KK9D 3IF1B 4E42A 1KIPB 4U4BA 3B5HA 3VDCA 4A6YH 1GXEA 3AVEA 3JV4A 3T8XB 3BPNC 2A6JB 5E00A 1OP9A 4MAUH 5L0QB 3MRGB 1B2WL 2LU3A 3ZSSA 4P23A 3VXRB 4HIEB 3CXHK 4JQIH 4LRNH 3QFJD 4NNPH 1W0VA 1E27B 3RI5F 5CINL 1QTYT 3PWLA 1BVKB 4JLRB 4WFFE 1PEZA 4YH6A 4V1DD 3QUYD 4UINL 5EH1A 1LDSA 1HQ4A 1GGUA 4JQXA 4QRSB 4PR5B 4KQ4L 5T5NF 1CDUA 3TWCH 2XZAL 5D6DA 3LKOA 3GSNH 1LP9F 4KKAC 4P2RB 2FBJH 3DVGB 3R06B 1NAMB 1GGCL 3VXSA 4WDIA 4ZYKB 2Q8BH 1U8OB 1AXTL 4H8WH 4FTVE 1U2CA 5C6WH 4JY4A 2BZDA 2HMIC 2I9TA 1XFPA 4OGXH 4P3WA 5JW5A 5C0BE 3MR9B 3ZKND 1HXYA 2VR5A 3V6OC 2MHAA 4FNLL 3S35H 4YK4B 4DWHA 3J7HA 4PJHA 1MJUH 4FQQB 4BSVA 4Z77B 3TZVB 1ORSB 3O9WA 2J88L 2OJEB 4PRIA 2QEJA 1RUAL 3VGDA 5K33A 2W92A 4X4ME 3QQ9D 3IKCA 1I4FA 1WITA 5E8OA 4UV7L 1FJ1B 4HV8A 3OHXB 2ZG1A 3AS1A 3ECBA 5DJAA 1ZT1B 2MQCA 1PKQB 4K3EL 5EU7E 4RGMB 2QSCH 3G6DH 5ID1B 4K3JL 4LAQL 1UCBL 1JIBA 2BY3A 3FT3A 5HYJE 5K9QI 2R2BB 2CSPA 2FL5B 4OZFH 4BFEA 4JFYA 3QPXH 5DZOA 3X14A 3NACL 8CGTA 1TZHB 2R1YA 1DFBL 3GMMB 5F9JA 4GFTB 5I74C 5FA4A 4Z78A 4QRQB 5CD5C 1JNNL 4CW1A 5J13C 3V0WH 1H3XA 1RK0A 1WWBX 4OIAA 1B90A 1FFQA 5HD8C 1ONQA 4D9RD 4U3XA 4NKQB 1YN6B 1AFVL 3LQAC 4PJIE 3LS4L 1QQDB 1QFUL 5IMOA 2VLME 2EYSA 4UTBH 2Z91A 4NZUL 4NZTH 4JHBA 3V6ZA 2EKSA 5BV7B 1FVEA 2HT2C 3FRPG 3GI8L 5J3HC 4M7JH 2P5EA 4GJTB 3DVFA 3PABB 2UY6A 4G6FB 3CCHA 3O3UN 3P0YH 4L1DA 1EEUA 5IB5B 3SDXF 3UAJC 5EBWA 5GHWL 1IEAB 3QHZH 3TNNB 5ESAB 3EFDL 4NC0B 4BELD 2IADB 4JFDE 1ZT7A 3Q5OA 1CG9B 3ZKXB 4U1MA 3EYVB 1CGSL 1PY4A 1U8MA 4MAYA 2ICWB 3FQWB 3O3AA 3ARXA 4R8WH 4KY1H 4S0SD 4WU5B 1EJOH 1FPTL 2IFFL 3TPKA 2X09A 4GG8A 4R0LA 3VDBA 4WI7A 5DJXB 4Y2DA 2X70B 2HJFB 5IT2L 4R7DB 4RISH 3VFMA 3SQOL 3WUWA 3E0GA 3GB7B 3P77B 4L8CB 1ZLVH 1CLOH 3MLTB 4RZCB 4H5SB 4I3RL 2CIKA 3HR6A 1ED3A 5SV4A 4ZUUB 4Z0XA 3PQYB 5BJTB 5MHSD 5D70L 1F00I 4R7NA 3QFDA 4P2RE 3GIZH 3HE6C 4LLAA 4JQVA 4PGEB 4L9DA 1UADC 3WLWD 4Y4KD 1WT5C 1HZHL 3TP4A 1EHNA 2HH0L 25C8H 4NYLB 1BIIA 2VAAA 1EBPA 3DIFB 3ZE1F 2ZUQC 3U6RB 4GXVH 5KSUA 2QR0B 1WQVT 1T6VN 3S6CA 4TQEH 1A7PL 12E8H 1FC2D 1XGRB 2W60A 4ESKA 4GAJH 3DARA 1XR8B 3WNKA 2J8UF 2Q1EA 2NY3B 4P0DA 3TA3B 4YPGA 3VWKC 4Y4FA 4PG9B 1T1WA 4E41B 2PO6C 5L2KB 3QXTA 3MLSL 3VRJB 1D5BA 1PKQE 4XI5C 4H0GA 4Y19D 2V2WA 3RIFF 2FBOJ 4MXVF 2A6DA 4XRCB 4DK3A 2X1WL 4Y5VC 1FFNA 4XNQA 3O8XC 3SN6N 3HC3H 1N7ML 4GSDL 4PRHA 1X7QA 3FFCB 1F11B 3BN3B 2FLBT 4NN7B 3L5JA 3AM8A 5B38B 2JB5H 2JJSC 5JW4N 3HG1A 3UC0L 4QY8B 5JW3H 2Y5EA 5IB3B 4G9DB 2FWOA 4GKSB 5EIIB 3FT2B 2ENYA 1T7VA 4PRNB 5BS0A 2HTKC 5HDOA 4XNUL 4WW2B 2CO6B 4P57A 3OKEA 4TRPL 4U05A 1CVSC 5DLML 4F9PC 3MA7A 5F96H 2FR4B 5FYJU 4LLWA 4HWZA 1D7FA 3UTSD 1QZ1A 4N5UA 2XA8H 2VIRA 1QKZH 4ZFFB 3JWDC 1DANU 3FO2B 4U1IB 3ILQD 4TYUA 3VFTB 1K5NB 4JFXA 2L0DA 3RWHB 1N5YH 1OTSD 2G60H 4NRYB 1A6VL 5E99H 1LWRA 5HPMA 4NC2B 4YHKL 2A6KA 3GEWB 4WO4C 3CLFL 4HUWA 2VDQH 4EDXB 4M5YH 2YSSB 2QQKH 4NHUB 4OTXH 1D5MA 4KQ3H 5KW9L 4J23A 3U0WH 3KPSA 1EXUB 4OCYL 4RWYH 4OKVB 1H8NA 2X2YA 3HHRB 3E6FA 1A4KB 3LOWA 4GKZB 1AGFA 3MXWH 4PJ9D 4Z7UB 3RGVC 3DMMC 4BKLB 4NN6B 4BJLA 1X5AA 3IU3B 3PQYE 3RPIA 4C4KO 1IKNA 1NC4A 4CMMA 2AEPH 2ATPB 4CVZB 1L7TL 4WFFD 4JJ5B 4UOJA 3CC5B 4G7YL 3VMPA 4KI5D 1S9WB 1AE6H 1TJIL 3T4YB 1WK0A 1IZJA 1FIGL 1QP1A 1RK1B 2BVYA 3N1QC 1QSVA 1NL0H 4GRLB 4S1SH 4EI5A 1CBVH 4XZUB 4F3FB 5JIHA 4Z7NF 3IXTB 5JO5B 2IQAA 4M1GH 4WHYG 1FG2A 1Z3GH 3UTPD 4AM0A 5I15L 5TE7H 2KDGA 4FTVD 3QEGH 5F7DA 1CGTA 3RX5A 5BXFB 5DD6A 1I7TA 4MA3B 4XWGH 4YXKH 4AIZB 3ULVC 8FABB 1YQVH 4LPTA 3MJ6A 4QRRD 1OARL 4YJZL 1RU9L 1DQLL 3BZFA 3OXSA 3HE7C 1Q94A 1UC6A 1J18A 4E41E 5L2KE 5DD5L 2AI0H 4U1NB 3BEVB 1MAMH 3HI5H 5EFIB 3MRQA 3ARFB 1TQCC 4MJIA 4Y8AA 3I3BA 2CDGA 1TJHH 5KVDH 5ILTH 4WHCA 2FEDC 4X9FA 4PRPB 3EIFA 1W8OA 2Q87A 3REWA 3S9DB 1VKXB 4LBEB 1K8DA 1WISA 5JORA 3FQRB 3BD5A 1MRFH 5EZOH 5TDNA 43CAB 3FFCE 2BOBB 3GSQB 2VDNL 1UT9A 4L4TA 3H8NA 3SE8H 5HYJD 5DJ8B 4ODUA 1M1SA 5T5NG 3WIFA 1T5XB 2R4SH 2C1PB 1XF5B 3DURA 1OPGL 1CDYA 1T7ZA 4LRIC 5K9KB 3L3IA 4OLWL 4YDJB 1I9RL 3BGAA 3JWOC 3IDGB 5LKNA 5F9OH 1AY1H 3MTRA 2ESVB 2X7LA 5B21A 4GRWF 4IOSD 2BMKA 3SKUD 1UWXH 3ZDXF 3VXNA 3DV6B 3B9DA 3C5JB 3KLHD 3CDGA 2X4QA 3QHFH 1YEFL 2C3VA 3JUYA 4K7PX 4U33A 2QTEA 2QV2A 3RWCA 2W9EL 2X10A 2A9ML 3D0LA 3U7YL 3VGEA 5GGVL 5CBAB 3GNML 4JG1H 1EHAA 1IT9L 1Q1JL 1U8LA 2GY5A 2W9DH 5TQ0L 1G9NL 2VQ1A 2BRRH 2BX5A 3IGAB 3ARYA 1FZMA 3UBXI 4BZ1L 2APVA 3T2NL 5IWLA 3LIZL 3OR6B 3OJ2C 5E03A 4H25B 5KSBF 3TT1H 3D69B 3TCLA 3VXRD 3QWRD 4RAUA 2YPVL 3IFOA 5KVEH 4PJHF 1OLLA 4XBPB 4Z7UE 3KHQA 1NCNA 2XNAA 4Z7VA 2XTJC 4AJ0A 1MNUL 4N68A 4W4NA 1GGBL 2LVCA 1TZGL 3TVMA 3G9AB 5JDJA 1S78D 5HI3D 4Y5YC 1BAFL 5JPMA 3MLXH 4ZXBA 1MCSA 2BVPB 3K4DA 1MWAH 1V3KA 1DTUA 3BXNB 4KK5D 2DLHA 3EBAA 3H9SA 4WWKB 2CGRL 2HLAB 5L7XH 5F1NA 4LIQH 2LAGB 5EN2A 3TH3T 1QG3A 1UEMA 4Y16B 4DVBB 1EVTC 4KAQH 5B8CB 1ZLWK 1I1AC 3LPGA 4ZMAT 4LFHD 3BP5B 4M7LL 1D5ZB 1TXKA 3L6FB 2R4RL 3MC0A 3C8DA 4LCIH 1I1YA 1EPFA 4UIMB 2IANA 1NLDL 4NKDA 1LO4H 1NBZB 5F7LB 4LKXA 3GI9H 5J1TC 3WS3B 5BZDA 3VXUB 4NQUA 2DMCA 1CE6A 1MHEA 1RUKL 2XXMB 1MIEH 4PRPE 1T5WA 4P2OA 2AJYL 5IOPA 3HNTL 1B88A 1FBIL 2UZIL 3NGBC 2DS4A 3PL6B 1J1OL 4XPGL 5FHAL 3OKNB 2DTMH 4F58H 1IAIL 1XEDA 1YDPB 1AGBA 1S7TB 3LKPB 4EI6A 4IS6B 5CEYA 3S35X 2Y36L 4P49A 1C08B 4M4RA 43C9B 1DDHA 2UUDH 1E4XI 3BI9X 4TNVK 1T1ZA 3QNZB 4TVPL 3GJFB 2Y7QB 4DZBA 4KMTH 2WIIB 5FYKL 5HYQB 4U7MA 4Y1AB 1KG0A 1R5IA 5E56A 3IJSB 3NA4A 1DVFC 2OR9H 4LVHC 2G5RA 3DETD 3OKMA 1J1PL 2ESVE 1WIPA 3MOAL 4N0FA 4N8VB 1HWHB 5DK0B 4ONFL 5CJOL 5IVOA 1CZ8L 4DEPC 1YC7A 4WTWA 1WGOA 2DLGA 2E9IA 2Z31A 1ZLSH 1U8JA 2V17L 2IBZY 2BFVH 5FECA 3VXOA 5EU6A 1HSBA 4G8EA 4NQDB 5I1DB 2WUBH 3KVQA 4F37K 3TPUB 3IDIB 4G6FD 3JTTA 4OFKA 1LE5A 1BVLB 5C8JA 1S7VA 5BW7C 2BNUA 4CUCA 5IEHA 2B4CH 1IVLA 2DICA 4WUKL 1A9BA 2PCPB 2GTWB 1P5UA 4GRMB 1AD9B 4G8FB 2NTSP 3CU1A 1K6QH 5D7KE 2YMXH 5DEZA 1JVKA 4PJ5A 1YC8A 5C3TA 3H7BA 4FQXA 5I1JH 1XGTA 3FT4A 4CKVX 1VADA 1ZTXH 4G8GD 3B9KB 1KC5H 3FN3A 3KPRA 2VABA 2A74A 4NCC1 3JZ7A 2QLVB 3C9NA 4NQXB 4NQSB 3MRHA 1P7QA 3PQYD 4WHDA 5HGBB 4BYHA 4YBLB 3FFDA 5SX5K 5DK3A 4Q2ZA 3HZMB 3RVXC 2EDBA 1PSKL 5HPOA 3GGWB 5F7MC 5DI8B 1R5WB 5B4MD 1UEYA 3L5WA 3QUXC 4G42A 2IJ0C 1Y18B 5AWNH 5FO8B 1QOKA 3BISA 4WFGD 4RFOL 3PGFL 5ANMB 2R69L 1BQHB 1DLFH 2YK1L 4Z95H 1M6OA 1H3PH 4J8RA 5E6IC 3C5SB 4HZLA 1U42A 1F13A 3I2CL 3MLZH 2Z92A 3GSUA 2VLJB 1EAPA 2OSLA 1LEKA 2R1WA 3VXUE 2MCPL 1JWSA 2PYEA 5I8KH 4U6YB 2G2RA 4A2LA 1F4WH 1G0YR 4AEEA 4I5BA 2QADC 4D9LH 4FFZL 2NYYD 3BIKA 3QAZC 1JUFB 5MI0B 1OM3L 4E41D 5L2KD 1EO8L 1NCCL 1YA5A 5E08H 4M9OA 4YQXL 2ZOKB 3SGDH 3BQUC 3U46B 2IH3B 5T1LB 3MRFA 5DK2A 4CRPA 4JFFB 1HIML 1FCCA 4M1CD 3AS2A 4NN5B 2DQEL 2R8SH 3OSKA 3FFCD 2ZG2A 4Y1AE 2H3NB 5FOBA 3U4EA 3QI9B 5EUOB 4XXCA 3MRKB 2F53A 2ZP0T 4GS7C 2X6MA 3IU4H 3U30B 2VDKL 1D9KA 4NM8H 3ZKQD 3QXDA 3FQUB 4K3DH 4AH2A 5CEZD 1A9EA 4WI5A 3BYTA 4OFDA 1AXSB 1FFOB 1SEQH 1VPOL 1H15A 1A7QH 4RMUA 1K3ZA 4A6YL 5GGRA 2WM0A 3DX6B 4FOMA 4KJQD 3HI6H 4OLZL 4X99A 3TBYA 4DKFL 4NQDE 2IH1B 5GS0D 1PG7X 1KPVA 2YR3A 1JN6B 5EU5B 3ULUF 3T3PF 3TV3H 3AAZB 5HJ3A 4X6EB 3PWNB 2AQ3A 3S88L 4C56A 1W0YT 4Q58C 4QT5B 2YD5A 5DJCB 1T1XA 1H8SA 4MMXC 3M17A 3SDDB 3WJJC 1DUYB 4PJ8C 4YHIB 3GSOA 4GT7A 2Z4QB 1U2HA 1Z9SA 5GRJL 1P7HL 4MD4A 2JKXA 5E6YA 3T0WA 3FONB 1IGTA 2JK5A 2KPNA 5MEND 3TWCL 5CILH 5T3ZH 2PTUA 4JDTH 4FMKA 1I3RA 2Q8BL 1JPFB 2BJMH 4MXQD 3ILPA 4HPYL 4RDQF 4PRBA 5IB4B 5JR1H 4R96A 1RZIA 4OGXL 4AY0A 3U2SA 1J12A 2X89A 1GH7A 1NGWA 1X5LA 3RWJA 3S35L 3S4SA 2EE3A 5KVMC 3NCFB 3MUJA 4HKZB 3MRMA 5JHDD 3WUZA 3UMTA 2CK0L 4MQ7A 4F9LC 1JF1B 1V3JA 1EJ6A 1E4KA 1Z9MA 2IAMB 4FHBD 1WBYB 3I6KA 4RX4D 5F1OB 4ZUTA 4GRLD 4R4NC 1Q0YH 5ANME 1BEYH 2A0LC 2C3GA 2UY7A 2VLJE 5I8EA 3V0VA 1JFQH 5DMYA 2QSCL 3G6DL 5A2KH 5E1AB 1M7IA 4TTDD 3L95A 3S34L 4LASL 5ACLA 1BM3L 3QZWG 1K4CA 4X6BB 5D7LB 3GKWH 1YNLL 4NNXB 2YD7A 3TBSB 4FQCH 1Z6JT 2FHCA 4HUKB 4M03A 2NXZD 5C07B 3RDTC 2DQUH 3L3HB 2WAHA 3O2WL 4PRPD 1F6AA 2PW2A 1JPSL 3CUPA 4GOSA 4JFFE 2EIEA 3IB4A 1UJ3A 2EC8A 5BMFH 2OXGA 4UTBL 4XVSH 4NZTL 5GGTH 5EUOE 3DROA 4U1HB 4RQQB 4M7JL 3IFLH 5F88B 3SCMC 5DGRA 2DMBA 4XMPL 4JM4L 1P69B 3TIEB 1OQXA 4IOFC 3BN9C 2XN9D 5D2NC 2VN4A 5D71H 1OTUD 5ADPH 1S7XB 2CKBH 4HIXL 5T1DH 3QHZL 2VLLB 3SE9H 4I1NB 3CFKB 1VCAA 3M8OL 4P5TC 4KDWA 1WCBB 4PJ7E 4HKBA 2B2XH 2ESVD 32C2B 3BKJL 1N2RB 3QQ3B 4Z7VF 4R8WL 4KY1L 4JRWA 3MFFB 1EJOL 4LSRH 4QTHB 3GO1H 2NQCA 3HPJA 4OLXH 5FF6B 5IGXH 5FGCB 3NPSC 4Z5RB 2PW1B 4APQD 2R15A 3DRQA 1WWWX 1VEOA 1ZHLB 4RISL 5DD1H 4PRDA 5DMKB 4UU9B 1XCTB 2HFFA 5J9PB 1CLOL 4BH8A 3TJEL 3HAEB 1UXSA 3PDOB 1S9VB 1EGJA 1QA9B 2ZKHL 2Y6SC 3CFBB 4M6NH 3IFNH 2YC1B 2JCCA 4WI9A 1QO3A 2RB8A 5DEGB 5AAMA 3RU8H 3IDNA 3KYOB 5HHQB 1MCKA 2ITDA 4LARL 2VZOA 3WD5H 4ODHH 1D6EA 1MF2H 5EO0A 4N0YH 4KXZI 1R3JB 3MROA 4N8CL 4PTUA 1FGVH 1EERB 3FO0H 5EORH 3NVQA 2XWBA 4WGVB 4TQEL 5INDA 2FECL 2EDLA 4ZUSA 4PPTA 3DWTA 4JM2B 4KWUA 4GAJL 4XTRD 3WUWG 1R3KB 2VC2H 1RY7B 3WIHA 1AJ7H 4WWKD 4NO0B 3MV01 4FQIH 2ERJB 4Y16D 4NUJA 2DQFA 5E2WH 1NJ9A 3SDAC 2AEWA 4H88L 4KROD 4K2UL 1HI6A 5F9DC 1GGYA 3VD5A 1N26A 3QJHB 5K9OA 4P99A 3PGCB 2MKLC 5D7LE 3ZT7A 1GZQA 2VLKE 3NFSL 1RZ8A 4HUUA 3HRPA 3F58H 5C07E 1Z5LA 4KKCC 3WFDH 1J8HD 1U91B 5JW3L 3RVTD 1JGDB 3HB3D 3OGCA 5AZ2H 4X8JB 3F7VA 3STZB 1N6UA 3PL6D 3QDAA 2FIKA 4ALAH 4XT1C 4ZAKA 2X4TA 3ARGB 3ULSB 1FNSH 2EO1A 4KZEH 1MVFA 1MCCA 3OKLA 1KN2H 3EOBB 3WKMH 3V5KA 2NR6C 3D39B 2ED7A 5F96L 2XA8L 5B3JF 5FDWA 5FCUL 1PQZA 2RFXA 2V5MA 3MRNA 4ACPA 3BWUC 4ZUVB 3Q6FA 3EFFB 1E6OH 1N5YL 3OAUL 4OD3H 5DRXB 2EICA 1JHLH 5EPMA 2OP4H 5A3IC 1ITCA 3R0NA 3ES6B 5CMAA 1KPUA 1NLBH 1FNFA 2VDQL 5SWZB 4M5YL 4OTXL 1BGXH 3BHBA 2DQHL 4LP5A 1MCQA 4OZHB 3ARBA 4ERSH 2GUOA 4POZD 1XIWD 4OZIB 5JHLL 4IIQC 4M8QA 3TF7C 3E6HB 4OLUH 2PTTB 4X7TB 3REVA 4JG0H 4Z7WA 1YEEL 1GPOH 4UDTB 3LV3A 3D1MC 4W81A 2A9NH 4D0BA 3EZ8A 2AEPL 4NRZA 3QUMA 3HZYB 5SWSB 4JO3H 4NO3A 4ISVB 2HJLB 1KIQB 1RHFA 4PREB 2Q20A 2AK4D 4O02L 4J4PD 4Q7DA 1OAKL 5TGBB 2AJZB 2HAZA 2YZ8A 2CDFA 4ZTOH 4M1GL 4JGJA 2P5WD 4RFEA 3B9KD 4AZ8A 1DBML 2EIZB 1NFIB 5TE7L 1IQWH 1UB5A 3QEGL 1I9JL 2AXHA 1IM9A 4XWGL 1EHXA 2OL3B 2G5BB 2O5YH 4PB0H 1YQVL 1BD2D 2BHUA 4X4XB 3C09B 3I75A 1H3UA 1KBGH 3QJFB 1S7UA 4MCZB 1DEEA 5BQ7B 2D31A 1G0XA 5CIPA 3OQ3B 3HI5L 3TNMB 5KVDL 1MRDH 1XZ0A 1P84J 2XKUA 4YHNB 1FO0A 5EZOL 1L9MA 3V6OA 4QYOB 5HYSB 4X5XB 3GSNA 2UV3A 1ZWIA 1EFQA 2CK2A 2IALA 2GJZA 3P30L 4EQ3A 1D5IH 2QQLH 1J7VR 3H9YA 1HHJA 5SX4H 4IRSB 4AEIL 2W65B 2AXFA 4D2NA 3VFRA 1XCQA 4GW5A 5HBBA 1DQQB 3LKNB 3LKQB 1RZJH 2PR4H 3GSVA 4RDQG 4PD4K 3L7FB 5E8PB 5T1LD 5F9OL 1AY1L 1A6AA 3VWJB 1VDGA 2VXUH 2R2EB 4PGZA 3C5ZC 1H5BB 15C8H 1R3LB 3T1FB 1SBSH 3D39E 2CDEB 5FA3A 4JFFD 5LGJA 4IM8A 1KXQE 1S7SA 2HLFC 4IRJB 4X5WB 3VXPA 3D0VB 4PJFA 5IQ7H 1I8KA 3MXVH 2BK8A 4CVXB 5IB2A 2CIIB 1A8JH 2GK0B 4OCMC 3WFBH 1ZLUK 3JV6B 5IFAL 1V5JA 1HEZB 4K9EH 4JG1L 4OZFA 3MRLB 2DD8L 1PZ5A 4JN2B 5SWZE 3BRGC 3KPNA 3RWFA 4B7LA 3L3GB 3MNZA 5DDHA 1CD1B 2ZWLT 4MXWH 2QL1A 4OZHE 4CVUA 2YEZB 1IKFH 3G5YA 3E3QE 2HFGL 2X4SA 4OZIE 3B5GA 4G5ZH 4F7TB 3MV8E 3ESUF 4HJ0D 3GMRA 5FM4A 4L8DB 5KVEL 1SYVB 1T66C 5I9QC 3KPLA 3MLWH 1NCDH 3MLYH 4WEUD 4GUPA 3RY5A 1RULH 3ARWA 3D25B 3SDDD 4OQTH 4CADA 3EDDA 3QCTL 1GL4B 1MREH 3MJGX 5SWSE 4P5MA 5ESQA 4L4VA 4ZFZB 4LMQE 3W2DH 4P3DA 3VU2A 4OUUB 1VGKA 4M7LT 4ONHB 5DURB 1MWAL 3IDJA 2F5BL 3B6SA 1I8MA 4OFVA 4KRLB 4LCWB 1ADQH 1LO0H 5L7XL 4JN1L 4LIQL 2IG2H 5DMGD 1UA6L 5DJ2B 1HKLH 1WUNT 2BDNH 4JGMA 5FAAA 1C16A 1U92A 1G9MH 4UUJA 4GAYB 4HIHA 4ETQB 3OB0K 4RMTA 3UTTA 4LCIL 1CXIA 3HMWH 2ADFL 3VG9C 4N5EC 4XXDB 4QXUH 5CZVH 3LY6A 1LO2H 4EUPB 1ZGLB 4YWGH 3HE6A 5L8JB 1VGEL 5HHOB 3MGTA 4JANA 4S10A 2ADGB 2UZXB 3O45A 1WT5A 4U1KB 1HDMA 5C0EB 4ZPVB 3QDGA 1IGIL 3L7EA 2AV1B 2WP3T 4G6JL 1GZPA 4AYFA 4DGIH 1QEWB 1YNTB 3C6SB 2GJ6B 4F58L 1P7KA 2Q6WB 4U49A 3VFSB 5KZCB 1GGIH 1NC2A 3GUTB 3DBXA 4J7RA 1FSKC 2Q76A 3LPWA 5DJ6B 3DJ9A 1MLCB 3VWKA 5DQJB 2APWA 3MLUL 5T1KB 2E7MA 2PO6A 4X6CB 2OR9L 5J11B 2BSED 4CN6A 3FO9A 4KUZH 4MYWB 5C07D 1BQLL 3MRJB 3CMOL 4CJ0A 5JLZB 1O7VA 4Y5VA 1H9VA 3O8XA 1OGAA 3TZVC 1Q9LA 1F3DH 3MRCA 3WDHA 3B3IB 3MA9L 1EHLL 2HN7A 2Y07H 1ZLSL 3W0WD 2ZG3A 1A4JA 2JJSA 2VZSA 1U41A 2WUBL 1CFNB 3DGGA 3U0TA 2NX5B 3L5HA 1P9MC 2JCCF 3PG2A 4RGMC 4OZGE 1C5BH 3H0TB 1RUPH 2B4CL 2E6JA 4F33B 2YA1A 4R97B 1G7PA 3B9VA 2YN3A 3MJ9A 4KJWC 3KDMB 5I1KH 2CQVA 4HPOH 4TUOB 4AMKH 4TNWK 1KIRB 3U0PB 3PHQB 2XPGA 4ZSOE 3M1BB 3DV4B 2YMXL 2FDBP 4F9PA 4N0UA 5BV7H 1E4JA 4QRTA 4B7IA 3QIWB 4IDJH 2HT4C 3MYZA 3CFDA 4YFLF 1YEDB 4JB9H 1ZTXL 3FCTA 2BY2A 5GGSA 5H2BB 1GAFH 5HI5C 5D96B 2VXQH 1BOGA 2CJUL 3WEXB 4LLYA 5GS2D 5I6XB 1IAKB 3O81A 5D6CA 4WO4A 1WC7B 1AKJB 4LPYA 2PXYB 4HDIB 4TSCH 2WUCL 3NCJH 1YMMA 4PGBA 3WHXB 1LEGA 1JF5A 5CP3H 5AG9A 4LCWE 4CMHB 1FYTA 5D7IB 3WYRA 2M8XA 1ZSDB 2ZPKL 4F7MB 2XOTA 1F3JA 1CE1H 1A6TA 5AWNL 1NDMA 3WFEH 3MRIB 3RGVA 1DLFL 3ZKXC 4K8RD 3EGSB 1ZK9A 2VNCA 5MEOA 4WUUA 3RUGB 1XH3A 3CD4A 3MLZL 1RV6X 5I8KL 3CZFB 1GC1C 4CDHA 3X13A 2FD6H 4BZ2H 3MREA 4XH2A 2GEEA 4XCFH 3IJHB 4D9LL 3BUYA 5CLTA 1YEJH 2DQTL 4DZ8B 4NO0D 2NY0C 1LE9A 1G7LB 4G3YH 3WJLC 5JQ6H 4Y4HB 2GJ6E 5KJRH 2ITCA 5KAQF 3IETA 4XP5H 2D0HA 3BEWA 3P4LA 1YPZB 5I2IB 4UILH 4BQCA 4S0TD 3G5VB 3BPLB 1OAQL 4JFOA 4KTYA 1OAYH 1IC7H 4HEPG 3U7WL 5DVLA 2R8SL 1D6VH 3HE7A 4LPVA 5D4QA 4R4FL 3OF6A 3MMEB 4X6CE 4ZFOA 3IU4L 3K8LA 4X98B 4NM8L 1R5VA 2KZ1B 4K3DL 1PBYA 1MIMH 3KLAA 4HT1L 3EO1B 4HH9B 4LCYA 3C6LC 4NHCH 1QLFB 2P8MA 1AGEA 5EU3B 1NGYB 2J8UB 3ARGD 3EHBD 5IB1B 4CL7A 5AUMB 2NY3C 4HG4J 1WIUA 3NPZB 1J11A 3TA3C 1AQDA 4OB5H 3DUHA 3HI6L 4Z7WF 2C1OA 1NBYA 4I9WE 5BRZB 2ZJSH 1G9EA 3DECA 1DEDA 2NX5E 1QVOB 2AJ3B 1I1FB 4ZQKA 3TV3L 2XKNA 4XAKE 1EO5A 3BAEH 2B39A 3H7LA 4LRIA 3QIBD 1A0QL 1U8KB 3DTXB 1BFOB 3TT3H 4OIBA 3RL2A 1RHHA 2H2PC 5CEZH 3DYPA 4XPFH 5FGSA 5CKGA 2OTPA 3NZ8A 3PXHA 2DL9A 1SMAA 3KWWB 4NO2B 1KCSH 3S7GA 3CGTA 1N4XH 1S3KH 3MRBB 1XF3A 4HX1A 5GS0H 4P2QA 3WSQH 1ES0A 4LNRB 1KTLA 3HFML 2HVJA 5IK3B 4QRPB 5CD3B 2GTZB 4LEOA 4M02A 1A6ZB 4I0CC 1TTGA 5E5MB 5JR1L 2GQHA 5DRWB 1WWAX 2IQ9H 5FV2A 4X4YA 3K81A 2R39A 2EEAA 3EDFA 2RIKA 1EA9C 1Y0LA 5D7IE 1G7IA 3MV9A 3P9MA 2BXZA 4LSSH 4Z7OF 4Q9QH 5DHYA 4QHMA 2I26N 1J5OH 1ULVA 3ZDZE 1BEYL 1RIHH 3SKMB 1I7ZB 3RUGE 2WQRA 4NT6B 2P8PB 1JFQL 1ZA3B 2FZ3B 1TTUA 2D2OA 4NZRH 1TVBA 3FOMB 1IEBA 4NM4L 5EUKB 2MQ3A 1JTPA 4JVPA 1S7RB 1U8NA 1GIGH 1ND0B 2JIXB 4Y5YA 5AD0A 4JDZB 4DOHB 5GGQH 5C0DA 1HHHA 2RQ8A 5TF1H 4OJFL 3BH8A 1C7SA 3MBXH 4FQHA 5GGVY 5DGQA 3O2DL 4WV1B 4FQCL 3S4SG 3OKOA 4NN6C 3GBLA 3L9RB 1YPZE 4DVRH 4G9FB 3CXHJ 4QLRA 1YECH 4PJFF 4PJCB 3STBA 2Z93A 2I9LA 2AABH 4D0CA 2HP4A 4H0IA 4XVSL 2R9HD 4TVPE 5FYKE 3FQTA 3IS0X 1CVRA 3IFLL 3QO1B 4XWOD 5KANI 3MRRB 3FO1B 5ERWA 3WXWH 1TCRB 4DK6A 1MHCA 4IRSD 4JKMA 3B9AA 3RHWK 2V2TB 2ZSWA 5GZND 3ZTJG 3GMQA 1HNFA 1A3LL 2CKBL 5DQDL 4I0PC 2VZTA 4LP4A 3BDXA 2J8UE 3RZCD 4DN3H 5I1AA 4XVUC 5ICXB 3VWJD 1TQBC 2B2XL 5HY9B 3LN4B 5BRZE 3AREC 5HVFB 1NEUA 3BZ4B 4IRJD 1M4KA 1WFUA 1TVDA 3ARFC 3MV7A 2H9GA 1JCKA 3GO1L 1E6JH 1HCFX 3SOBL 2A73A 1FNAA 1T2QH 5IGXL 1YN7B 1DVFA 2OI9B 1YEKH 2Y23A 4OCSH 5DD1L 1HOCB 4P9HH 1FL3B 1INDH 4U6XB 3BZEB 4O4YH 3GFUA 3B4NA 1T0MB 2VISB 4MVBD 1QHPA 1DQDH 4YR6A 1IQDB 2GCYB 4TNVF 1OAXH 3IFNL 2NZIA 3VGFA 5D1QB 4CU6A 4U0QB 1SBBA 3RU8L 4BQ8A 1WEJL 3ARDB 3I02A 1KNOB 3HPLA 1FLTX 4XBEL 4QRPE 4LKCA 2H32A 5CJXC 2Q8AL 2H45A 1MCLA 3KXFA 3WD5L 1FORH 3EYOA 1MF2L 2ED9A 4N0YL 1FL5A 2YD2A 5HGHA 5BW7A 4GRWB 1FGVL 4J6RH 3RVVC 1BWWA 1AI1L 3PWLB 4KK6D 1J0YA 1DN0A 2ZUTA 3H2WA 1ZKAA 1AGCB 4RBPH 1AJ7L 1B4JH 2OTWA 1V7MH 4UV4H 2GSGB 3GMLA 5J12B 5KSAD 1K85A 4GO6B 1Q9KA 3K7UA 4FQIL 4OM0L 3QDMA 3EYFB 3FB6A 1GGTA 4HBQA 5E95B 5GIRA 2YXMA 5E2WL 4MWFB 3PHOA 3BGFB 5AYUH 1P6AB 4XPAH 3QZWB 5C7XH 2MHAB 5KSBB 3HKFA 5F7NC 6FABH 4DOHE 4HC1H 2NZ9D 3QULA 4XHQA 1YMHA 4BSVB 5HHOD 4MA1B 3E1F1 1UB6B 4RNRB 3F58L 3NN8A 5C6PB 3IYLW 1IM3B 4G9FE 4PV8A 3UDWC 4PRIB 3WFDL 3LZFH 3QUXA 2VLRB 3MCLH 4M6AA 4PJCE 2QQNH 5SWQB 1T21B 1CXHA 5AZ2L 1QSFA 2YD3A 1DANT 1I4FB 4MD0A 4XTRC 5E8OB 4JFEA 5E6IA 2IPUK 5AZEH 1RZFH 3GRWH 1EAJA 1FNSL 3ECBB 5DHVB 5DJAB 5CJQL 4BQ6A 4KZEL 5KZCD 3TFKC 4Z7NE 1KN2L 5JIPA 1AD0B 1MELA 1W0WA 5E2TH 2PN5A 3BT2H 3NAAL 3ARQA 3EYQC 1U36A 2NY2B 3QSKB 5C9KA 2IBGA 1QRNA 4Y16C 4JFYB 4GW4B 3UP1A 3X14B 4DGYH 1U8PB 5B8CC 3MCKA 5I16B 5EC1A 1CDIA 3C60B 1JGUH 2VB5A 2IGFH 3S37X 4OD3L 4OV5A 3LB6D 3IFPB 2EDQA 4LPUA 1JHLL 1RZKH 5K59F 4Z78B 5D9SB 4CW1B 5CSZB 5D7JB 2W0LA 3TN0B 4FG6D 1RK0B 4MA7H 1Z0MA 3B9EA 1Q0XH 1NLBL 1ONQB 3PWUA 1BGXL 4XBGA 1MFAL 4FQJL 2EYSB 2EKSB 4O2CA 1RZKC 2E8ZA 3CH1B 3GHEH 3GJFH 5F8QC 4HEME 4YE4H 4YZFF 4P23C 1N8ZB 4F7PB 2NX5D 1MCDA 4OLUL 5FK9A 5KS9A 4XAKD 3CCHB 3JUZA 1FV1B 4HFUH 4D8PA 2VKXA 1GPOL 1JWUA 4PGDA 4XHJD 1CDGA 5HHNB 5EBWB 2RBLA 2W0PA 4S11A 1Y6KR 5EA0H 3I50L 1KV3A 4KGLA 3NTCL 4X9GA 4K7PY 1UACH 1F58H 4EDWH 5IQ9B 2NLJA 4U1MB 4UBDC 1P1ZA 1U8MB 4JO3L 4PJXA 1NMCB 5GJTH 5TJWK 2OMNA 5GXBB 4X6DA 1NEZB 4OI9A 3AMLA 2E7CA 5I30L 4GRWE 3QXAA 5TDOB 1EFXA 1JZ2A 1R24A 4ZTOL 3VFMB 3QDJA 4G8IB 3WJJA 1IQWL 4PJ8A 3ZHLA 3EOTH 4PJDA 4LVNB 3NCYS 1VEPA 2O5YL 1CU4L 3WNOA 4POZC 1AKJD 2CIKB 1ED3B 1Q72L 5MEQB 4GH7B 4HKXA 5DWUH 2NXYC 3PP3K 1KBGL 4X7DC 2DYPB 3FB8A 4R7NB 2EDDA 1MLBA 3QFDB 4EXPX 5IBTL 5IV2A 3ULVF 4G6AC 4AT6A 1VFUA 2HG5B 2ILLA 2AJSH 4MD5A 1NGZA 1MRDL 4LOUC 3VW3H 5KSBE 3IJYA 4OD1H 4X5LA 5TH2B 4BM7A 1OGTA 5I8CA 1KSRA 1QBMH 1T2XA 1PGRB 2ADJA 3ARPA 4LHUA 4O5LH 4YX2L 3FOLB 2DKUA 3DXAB 4O58H 1D5IL 2QQLL 3KPMA 3L3JA 2MWCA 4F9LA 1CR9H 4PP1C 2CR3A 1SY6L 4HWUA 2VLRE 4A2MA 4YPGB 1RZJL 2Y1VA 4Y4HD 4HW6A 5MEPB 2VXUL 2V2WB 4YBLC 3SGKA 3TO4D 2A6DB 15C8L 5E2UL 1SBSL 2VZ3A 1KCRL 1FFNB 4ELKB 4XNQB 3BP6B 4KV5E 3G6AA 4PRHB 5C86A 4H26B 5B39A 1FH5H 4ZS6D 4MCYB 4RMVA 2EDHA 1YJDH 3X12A 4PTTA 4ZS7L 4LLVA 5EO1A 4P4KC 4Q74A 4K9EL 2C3WA 3RDTA 4P46B 4OF3A 3AFLA 1N64H 2FSEB 4KDVA 2FWOB 4F7CA 2NW2A 4MNQE 1TTFA 4MXWL 1HHKA 2V9RA 4JFPA 2QKIA 4U31A 3DI3B 1IAOA 2B0SH 1TJGH 5C1MB 3SCMA 5D1XD 2IC2A 2NY6B 4LLWB 4HWZB 3V4UL 3HZKA 5BVJB 1T4KB 2VIRB 3L1OL 5D2NA 1NCDL 2CRMA 3MLYL 4M6ML 5GGTA 3RWIA 1MHPL 1QSEB 1RULL 4KRPB 2WQ8A 2IMNA 4OQTL 4NN5C 5J6HB 5HPMB 5C09D 1MREL 2IPTH 3ROOB 3S36H 3HMXH 3QI9C 2A6KB 4EBQL 3O6FD 1S7QA 4LDLB 4P5KA 3U30C 1KCUL 5FKAB 2BHYA 1D5MB 5D1ZB 3TBWB 4JFHD 4K07A 1ADQL 1LO0L 1KLGB 1J1XH 2EIBA 1HKLL 4QRPD 2BDNL 5HDLA 1BZQK 3O0RH 1LK2B 1AGFB 1G9ML 2EZ0D 4ODBD 3BSZH 4K94H 2JTDA 2ATKB 2YUWA 4YHZL 5DS8A 3HMWL 3RPIB 3D3VB 4QXUL 4RWHA 3L3OB 5CZVL 3OAZH 1LO2L 3DUSA 3R1GH 3WFHA 4YWGL 3ZDYF 4XPBH 3VD3A 2MFNA 3BE1H 3VI4E 3Q6GL 3QH3B 5DJDA 1MUJB 3S37L 4Q0XL 1G1CA 3UCRA 5E8NA 3O4LA 4L1HA 5E7BA 3W39A 1VFAB 4NRXA 3GJEA 3BKYH 1XGQA 1ZVSA 3DXAE 3FB7A 4S1DC 5JXEC 4HHAA 4L9LB 1GGIL 2Z9TA 1I7TB 1KFAH 3JSSA 4PJEB 5DRNB 5I1EH 4MMZC 2JIXD 5C2BH 3GMNA 5LXGH 3BZFB 4JRXA 4WFHE 4LQ1A 4EZMA 1A6WL 2I60L 3MRQB 4KKBC 3LQZA 4KUZL 4MJIB 1JV5B 1SJXA 3L3DA 4Y5XB 3SDAA 3DVNB 2CD0A 3MRPA 4JKWA 4NC1E 5ICYA 4I13B 5JORB 3RVUD 1OTTD 3D2UB 4IMLB 4PRHE 4WW1A 5TDNB 2IAMC 3SE3C 3HUJB 2Y07L 4NDMA 4NQTA 4R2GD 5JOPE 4ODUB 4R9HA 3K0WA 3WIFB 1BLNB 1A7NH 2C7UA 1G6RA 2P46B 3OBAA 1C5BL 3QXVA 3O11A 1N59B 5IF0B 4UTAH 1I7RA 4NJAH 2A83B 4V2CB 4GMSH 3SJVA 5JW4M 4OGAC 1PYWA 2ZSVA 2P49B 3PWJA 1MEXH 3FTGB 1MCIA 2X7LB 3WNLA 3B43A 3UBXA 3ISWA 3VFGL 4TOYH 3BMVA 1OCWH 2EE6A 5TE6H 3PXJA 4L3ED 2R56H 2YUVA 4XVTL 1AO7A 1NKOA 1T22B 2X4QB 2XZCL 2C3VB 4WHTA 4IDJL 1QSEE 4RGNB 4XPTH 1HK6A 2VWEC 4FFWC 4JB9L 3N1FC 1NMAH 1B9ZA 2FGZA 4U6HA 3VGGA 1AIFB 4NWTH 4JO4L 4KKNA 3SBWC 2X4OA 1JNHA 3WHE1 3OJDA 4XAWH 1XF2B 5F6HJ 3BPOB 2ICES 3VI3E 1T0NA 4CVWA 1BBJA 2E9JA 1IL1B 1IGJB 1MWAB 3ZYIA 2VZ1A 4IIQA 1C5CL 1WAAE 2IPKB 3V8CA 1B2WH 3TCLB 5FB8A 4RAUB 3BRFA 3VFWB 1IAII 4HF5L 2V9TA 3Q5TA 3ZYJA 1JPGB 2J4WH 5IIEA 4Z7VB 3BKMH 3D3VE 1R3HB 1G0DA 4XCCH 5FDYA 5GS2H 4NPYA 3ROLA 3OPZL 1YZZA 3P0VL 1W72L 3KNBB 1VERA 3QO0B 2DI9A 5JPMB 1YEJL 3VFUA 3D5OF 4FABH 4G3YL 5JQ6L 2D03L 5F1NB 5KJRL 4H1LA 1O7SA 5EN2B 3VXSD 4XP5L 4UILL 4NGHH 2B7DT 2GITA 4PJEE 3KHOA 2J8OA 2W59A 4K71B 1OAYL 1IC7L 2ICEB 4TPRL 4FNLH 2VDRH 3GIVA 4YC2B 4N9GB 2IANB 2EYTA 4LPXA 3CPLA 4CNIB 4DFHA 5BCAA 3WXVL 3TJHC 3O9WD 5I0ZA 5JMOC 1MHEB 4NFDA 3MO1B 4MJIE 4JEGB 5IHZB 4PRID 2J88H 2D9CA 4MJ5A 1MIML 2WNGA 2IF7A 4UT7H 1FFPB 4P2OB 3PWPA 2JJTC 2EIDA 4JM2C 5IW1A 3LVEA 1AGDB 3AXLB 4UV7H 3HUJE 3B2UD 5KS9F 4K3EH 3V6BR 4EI6B 1A6UH 4K3JH 3PV6B 4LAQH 1UCBH 4XC3L 5CEYB 4NJ9H 1DDHB 2ZJSL 3RTQB 1BX2A 2NY2D 2N4IA 1OP3K 4XB8A 2F5AH 3NACH 2F54B 2YRLA 4WIQA 2KBGA 4S1RH 5I73C 3QWOA 4FTVA 2ZCLL 3OKDB 3QUZC 3DO7A 3TT3L 1DFBH 4YHML 3VJ6A 4PJXF 1PX4A 2W0FA 5CEZL 4LK4A 5C0BA 1UH3A 4XPFL 3D87B 3MGOB 4XNXH 1UZ8A 1XGPA 4X6DF 3C5ZA 3LEYH 3P11H 4N0FB 5DTFB 3M07A 2CLZA 3N1MC 1UWEH 5HGDA 3WBDA 4DTGL 5FO9B 1YY9D 3LS4H 4Q97A 3X3GH 4NZUH 4RGNE 5GS0L 2Z31B 3QPQD 4PJDF 5I76B 2E7HA 4EIGB 3CX2A 3WSQL 1PX3A 3GI8H 3TO2A 2P5ED 3VXOB 4EVNA 5GSRA 1U8HB 3DSFH 4G8EB 3I6LD 4X4MA 1PAMA 1KJVB 3JTTB 3SO3B 1FDLH 2IQ9L 4JZOB 4NNYA 5IJVA 4YHPA 3VD4A 2YRPA 4RCAA 5GHWH 2J3SA 5HYJA 3ABZA 1K8IB 3EFDH 1DZBA 2YHGA 1K4DB 2LV4A 3WLBA 3RVWD 4LSSL 4Q9QL 5E2VH 2FYYA 5GGUA 3QIUB 5JXAH 4MAYD 4LIQE 3DHJA 4G80B 1J5OL 4DFIA 4ZXBC 3WL9B 3H7BB 1FPTH 4J3WA 1J88A 1RIHL 4O2EB 2E9BA 1ZT4B 4PS4H 4OCNC 4Y2DD 4Z7VE 1KB9K 4YBQD 4LL9A 2MKWA 4CU8A 4O2FA 4NZRL 3KPRB 4PJIA 2VABB 2A74B 3HC0A 3NIGE 2Q86A 3LSOA 3E3QC 2HT3D 4YUEL 5EOTB 2ID5A 4I3RH 1P7QB 5IVZB 3FAXA 5GGQL 2DYPD 3FFDB 5HTSA 3MBXL 1ZGLM 5IMKB 3IF1A 5HYIA 1D3CA 1KIPA 5L6YH 5ISZE 4MNGB 3MLRL 3LH2H 5LQBL 4DVRL 4Z0BL 3L5WB 3IAPA 1YECL 3T1WA 3D18B 5JA8B 2HH0H 4JFDA 2I07A 4X7SH 2A6JA 3ZL4H 1CIDA 3T0EB 2C4XA 1TENA 2OL3H 4HIEA 1A3RL 1UH4A 1A7PH 2OSLB 4C55A 1LEKB 5F6IB 1IGCH 1DN2A 1T20A 1OOAA 1KJ2L 1FNEB 2YN5A 4GKOA 1CICC 1E27A 3SY0B 1WFNA 3U7AA 1BVKA 3EKCA 4HUMB 4JLRA 4WFHD 4Y4FD 4PFEA 3IS1X 2UYLB 3MLSH 1J8KA 4JO2L 3BMWA 4O51B 1UKTA 1HILA 3K2MC 1CCZA 3MRFB 4P2RA 5DMJB 3DVGA 3R06A 1NAMA 1RIVH 4GSDH 2F54E 3CLEH 4ZYKA 4PRHD 1E6JL 1U8OA 5I17A 5JNYA 1T2QL 3U4EB 1LILA 2DTSA 2I27N 4JAMB 5D2LB 2DWDA 5DQ9B 2P42B 2EDYA 4YDKH 4NUGL 5IHUH 1CXFA 4P9HL 1KENL 3LMJH 1INDL 3HG1D 3QXDB 4Q6YA 4P46D 4PG2A 3PNWB 1A9EB 2VDOL 1DQDL 2Y5TA 2J6EA 4WTZA 4X9IA 3WV0A 1WLHA 3TZVA 1T03L 1ORSA 1YEHL 4Z76B 3ELAT 3RBSA 2VE6B 4ENEC 5BS0D 1LEIB 1JRHL 1HH9A 4XNUH 5I1HH 2GIYA 1EEYB 4FQ1H 2NY6D 3FB5B 1KPVB 3NA9L 1FORL 3C2SA 3OHXA 1S5IL 1P9MA 4K7FA 2R2CA 5ID1A 2RR3A 3D9AH 3QFJB 1PW3A 1QSED 1T1XB 1H3WM 4UT6L 1MFDL 1KN4H 3M17B 4OI7A 4ZNCD 2NY4B 1I85C 2H8PB 4MS8D 4YHKH 1MAJA 4MD4B 3QUYB 5CEXB 4HGKC 2Z0BA 3GMMA 3ALWA 3T0DA 4QXTA 1B4JL 2JK5B 4UV4L 2BNQE 3FQXB 4QRQA 1JF6A 4Z8FH 1FE8L 1VEMA 4OCYH 5T3XL 3ZKSD 1YN6A 3KPRE 2OMBA 3T0BA 1KLUB 3U2SB 1Q9OB 5C7XL 1JMZA 3RWJB 3ULUD 5EULV 6FABL 2AJXH 1NC4D 4AENB 3PABA 5D5MB 4HC1L 5IR1A 3MRMB 1CFTB 1LO3L 5C08A 4MNGE 4G7YH 4HIIA 3AU1A 5IB5A 2Z8RA 4WHYH 1TJIH 1IEAA 3TNNA 4I18C 2DDQH 3LZFL 1INEH 3I6KB 4OM1H 2VYRE 3SPVA 3MCLL 1FIGH 4EI5D 4ZUTB 2IADA 2QQNL 1DUZB 2F74A 2UWEB 2HTLC 3H3PH 3EYVA 3T0EE 2HA1A 2PKDA 2CKNA 1FLRH 2ICWA 3F7YA 3FQWA 4L3AA 5I8EB 4WU5A 5IEKA 1LDPL 5I15H 5E5UB 1IAIM 5E2TL 3F62A 5DJXA 2RHEA 5JUEL 5CLWA 2X70A 2HJFA 1OARH 4R7DA 1RU9H 2O5XH 3GB7A 1E4WH 1DSFH 3WJLA 3MLTA 1JGUL 3A6CH 2IGFL 4RZCA 4H5SA 4UMGA 1CDHA 2XIDA 3WS6C 1D9KC 3EYSL 2CKBB 5CGYD 5K9QG 4MJID 1W8NA 4ZUUA 2APTA 1C12B 5BJTA 2FJGB 5FUZL 2PW2B 3GDBA 3OX8B 1Q0XL 5FO7B 4PGEA 1H8OA 5J1AA 2BSRB 4KKLC 4DKAA 4YHYB 4JGUA 5D2LE 4L4TD 4LF3A 2P4AB 5D8JH 2KZWA 4N0RA 4NYLA 3DHMA 3DIFA 4P48A 3NFPA 3U6RA 3MNVB 2Z8VC 1OPGH 2FECI 4ZFGH 1K3IA 3IT8D 3C6LA 1XGRA 4OLWH 1C8PA 4E9LA 5EA0L 4NO5B 4I8DA 4RMWA 4HWEH 1XR8A 1UACL 3TA3A 4H0HB 4HKBB 4PG9A 4E41A 3IDMA 3GSXB 2BHZA 5GJTL 3LKRB 3FAWA 3BESR 3QFJE 3HPJB 5A43C 4XRCA 2W9LA 2F9BT 3N1GC 4FQLH 3MNWA 5KTEL 1DBKL 4PRDB 5INCB 3U7YH 5IBUG 2ZUXA 3EOTL 3Q2CA 1UGNA 3UYRH 1Q1JH 4QHLA 3HTLX 4LCUA 4F8QA 2OR8A 4MJ6A 5A2FA 1G9NH 1TVHA 3EJZD 5DWUL 2OZ4A 2JCCB 3MUHL 3ZZ1A 1BFTA 4QY8A 3KG5A 4BZ1H 3UO1L 1JZ7A 2OK0H 2HWZH 4PP2B 5KOVC 1A7OH 4R97C 2AJSL 5EIIA 2OQJA 2X1OA 5F93C 1AHWC 1G9NC 3VW3L 4LSUH 1G84A 4OD1L 3MROB 4M3JA 2AKRB 4MLIA 4PTUB 5I1IH 2DAVA 5D5ME 2FR4A 4N1CA 2XWBB 3O4OC 4O58L 5F7KC 4ZFFA 3QIWC 3MYJB 4U1IA 1C1EL 1CR9L 1GGBH 4U2ZA 3TVMD 1KTDA 1K5NA 1TZGH 1KEMH 3GM8A 3VFTA 4HUVA 1KGCE 3RWHA 5F70A 1M05B 5EZJB 1FCGA 2UWEE 3H9SD 3TYGL 2CGRH 1H3VA 4LVOC 5I6XC 2AERT 2V7NB 2PXYC 4EDXA 2DQFB 3P4NB 4Y19B 3IDXH 4CMHC 1U3ZA 4M7LH 2R4RH 2H2SD 2CPCA 1F97A 2IAND 1A4KA 4GKZA 1FH5L 5K9OB 1Z2KA 1GZQB 4Z7UA 5C0NC 1RZ8B 3MGAA 3RKDD 3F65A 4BKLA 4PLOB 4LHUG 4UT9H 4RA3A 2OTUA 1RUKH 3GMOB 3BGMA 4P2OD 4UDUB 3CDCA 4CVZA 2AJYH 4D9RE 4JJ5A 1HNGA 3HNTH 2YUXA 4PYGA 3CC5A 4HUNB 4ZOEA 4HJGB 4XPGH 5FHAH 5DJZA 1X4YA 3T4YA 1IAIH 1U3HC 1Y6NR 4RX4A 1RK1A 3UJTL 2H41A 1TJGL 3JWNC 3ZTNL 2H6PB 3V5KB 4KJPC 1L4IA 2BERA 3IXTA 1BBDL 3UTSB 5FDWB 4TVPH 1CT8B 1PQZB 2DL2A 2D7NA 1FQ9C 4MA3A 4AIZA 3Q6FB 8FABA 3IDUA 2AAVA 2MJWA 4TUJB 5B39G 1DR9A 2YA2A 2IPTL 3MOAH 5J6GB 5IUSA 3AREA 4ONFH 1CK0L 4U1NA 4BSJA 3BEVA 3MACH 1CZ8H 5EFIA 3ARFA 3BHBB 3RHWF 1MCFA 3O2VL 2Z31D 4PJIF 3ARBB 4PRPA 2KQNA 1VKXA 4LBEA 5EU6D 1NANI 3FQRA 4M8QB 3HC4L 3G5ZB 1T04A 1H3TA 4I4WB 2C4FU 4NCC2 2BOBA 43CAA 1OB1B 3REVB 3BSZL 4K94L 5DA4A 3W9EA 4Z7WB 4PJ9B 4R3SB 5KVFL 3AMKA 4YO0B 4PD4J 1SQ2N 5C0CA 3DO3A 1B0WA 4WUKH 3AB0C 4DQOH 2RCSL 4D0BB 1T5XA 2JCCE 2V9QA 2C1PA 4I48A 5AG8A 3VFVB 3QUMB 3QQ4B 5K9KA 3BPNB 3QIUD 2DKSA 3JV0A 4YDJA 5CJXA 5IP4A 3IDGA 4PJ5D 1A22B 4F80A 4AK1A 5HYEA 1QD0A 4HWBL 3EO0A 2IMMA 5KSVB 1OL0A 3BKYL 1AC0A 2VH5L 4ORGA 3DV6A 3QRFM 3KPOB 3KPRD 1UB5B 2BOCB 1IM9B 4PBWD 5I1EL 1NH6A 1P7QD 5C2BL 4QRRB 4O00A 3U9UB 3TCXA 3I75B 5CBAA 4NFBA 3G08A 1S7UB 3C8KB 4U1JB 3Q48A 2Y25A 3PP4L 4Y19E 3IGAA 1YEGL 2DOCA 3HZVB 3G5XA 3O3DA 3THMH 4P3CH 2BP3A 3OR6A 4ZAKC 4H25A 5DUBB 1JGLH 1TPXC 3IAGC 3QA3A 2GJZB 4XBPA 5I19L 2PYED 3FJTA 1IC1A 4K7PH 4TN9A 3MX0A 1A7NL 1F8TL 5FM8A 3UDWA 2R2HA 1WFOA 3VFRB 1OVZA 3BP4B 1OM3H 3HCVA 1EO8H 5IVXB 2VXSL 3GSVB 4NJAL 4GMSL 4YQXH 4GAFB 4HD9A 2AGJH 1A6AB 2BVPA 1CQYA 3C2AL 1JGVH 3KYAA 2HLAA 2NY5L 4WV1C 3BFOA 4TOYL 3UTSE 2EEDA 1OCWL 5TE6L 2R56L 4Y16A 2D4DA 3VXPB 5B8CA 2YD1A 4PJFB 1G7JB 3L5XH 1ZXQA 3PGDA 2F53D 5ACZB 1D5ZA 5IB2B 2EDXA 3L6FA 1OWRM 1OTTC 1NMAL 4UIMA 3EZJB 1KB5H 4MA8L 4FFVC 5J13B 4NWTL 1K2DA 1MI5B 2GT9A 1JNJA 3WKNA 1I3VA 2VJXA 5TFSL 3VXUA 4XAWL 1M7DB 1VPOH 4BFGA 5DDHB 4HBCL 4TUKH 2ARJB 4OLZH 2WZPD 4DKFH 5ID0B 3BUTA 3BDYH 4JFZH 3GMRB 4N0CD 3OKNA 5TF0A 2CUMA 1SHMA 1YDPA 1S7TA 3LKPA 4IS6A 3UBXG 4C56D 3S88H 1C08A 4GBXC 43C9A 2J4WL 1LMKA 1JZ5A 3BKML 4XCCL 2NY4D 3QNZA 3GJFA 4CADB 2WIIA 5HYQA 4Y1AA 1S7WB 5GRJH 2V7HB 3IJSA 4KI5E 3P73B 4L4VB 7FABL 2OR7A 4P3DB 2DLTA 4MLSA 1F02I 2XZQH 4FABL 4J1UB 1AR1C 3HS0B 4KJYB 5DK0A 5LCVL 4BK4A 4EN3C 3MUY1 4XP1L 3UTPE 1JGEB 4HPYH 5D1QC 1A1MA 4K8RL 1U92B 2B20A 4GRWH 4NGHL 4UUJB 2X4PB 1J05A 1T3FB 2X89D 3ARDC 4QRRE 2VDRL 4NQDA 5I1DA 2FX8L 3UTTB 4F57H 3IDIA 1BVLA 5A2LH 3ZE0F 2CK0H 4OGZA 5KN5B 4H8WC 2Z35B 1HH6A 2I24N 3HE6B 3MJ8A 1FNGB 1KGCD 3O45B 1MY7A 1HDMB 4UT7L 3MOQA 3JVGC 3L7EB 4GRMA 2L7JA 3ARRA 4JZJB 3QQNA 1KXVC 1WZMA 1DQJB 4U1LA 4X6FB 4OZ4B 1SEBA 1CXEA 1A6UL 4H1LG 1CFQB 1X5IA 4NJ9L 5HHXL 4L3CB 1E4XL 4HKJB 3ZKMC 3STLB 3S34H 4LASH 1CIUA 1E0OB 2F5AL 3B9KA 3KPTA 4NFCA 2ADIB 4S1RL 5IVXE 1BM3H 3MRDA 2D7QA 1YNLH 4HK3J 5E4EB 4NQSA 4LHJB 3DGCR 3L5IA 3FO9B 5LGHH 2V5RA 4F7EB 3EUUA 4FFYL 4XNXL 5HGBA 1JYWA 3LEYL 3O2WH 3P11L 1JPSH 1UWEL 4WGWB 3HZMA 4MA1C 5IBLC 2BSSB 3LD8B 5DHVH 1OGAB 2Z8WC 3GGWA 3F7QA 5DI8A 1UQSA 3X3GL 1V7NH 4PJFE 3RQ3A 5FO8A 1MCOL 1Y18A 1MCWM 2GJJA 2HN7B 2XWTA 5C6TL 5ANMA 1BQHA 2QQQA 3DSFL 5GS1C 4P4KA 4XMPH 2B8OT 3C5SA 4JM4H 5F9WB 3U0TB 1V3MA 1MI5E 1FDLL 1HYSC 2VLJA 4U6YA 4HIXH 3V4VH 3EJYD 1A1NB 4JZNA 3UTOA 3M8OH 3KPQA 1B0GA 3BH9B 5DR5H 4NQVB 3RL1B 1KTRL 3BJLA 2E6QA 4HCRL 5E2VL 2XPGB 3BKJH 4JREC 3C60C 3WNNA 4ETYA 5JXAL 1CD9B 3VXRE 3SGDI 3O3BB 4YBHA 3U46A 4Q9RL 2IH3A 2QSVA 4QRTB 5D7JC 5CZXD 3TN0C 4PS4L 3S96B 5IESH 3CFDB 4FZEL 2BNRB 4YGVB 4JFFA 4ZO6A 4HULB 4G8GB 5GGSB 3VGHA 2P43B 1BOGB 2DQGL 2H3NA 3TJEH 2XV6B 3EYUH 3QI9A 5EUOA 4JPKH 3MRKA 2AJVH 2ZKHH 2BVOB 1QR1B 1CD0A 1YMMB 3BO8B 3MODL 3CVHL 4PGBB 1W72B 5ADOH 3FQUA 3H42L 1RZGA 1FYTB 3SKNB 1Q9WB 2AS5M 1AXSA 4M1DL 4XPHH 5L6YL 1FFOA 3ET9F 4GQPH 1CL7H 3LH2L 1F3JB 4RSVA 4LARH 3DX6A 1VHPA 2ZNWA 4PJ7A 3DMMB 4X7SL 1C5DB 4Z7UF 2IH1A 4P4RA 4NKMA 4N8CH 3ZL4L 3UTTE 4WUUB 4JPIA 1XH3B 1CTNA 4Q6IB 1X5JA 5ACMA 2OL3L 3AAZA 4L4JA 2GFBA 2DF3A 4X6EA 1IGCL 4WI6A 4ORZC 2WBWB 3X13B 1RUMH 1Z9OA 3FZUC 5EIQA 5E0QA 4QT5A 4XH2B 5DJCA 3AY4C 4YHIA 2E6PA 4WCYL 3D6GA 3KYMB 1LE9B 5GRVK 1MQKH 1S9KC 2HT3C 2ITCB 3FONA 5HHPB 1MVUB 4WVRA 5JXEA 1XF4B 2OBGA 4H88H 2F8XC 1D5XB 2DQIL 2P8LA 4K2UH 5FUCE 4HMCA 1RIVL 1EO7A 3CLEL 1JPFA 1U6AL 3S5LB 3PDDA 1PG7H 3VE0A 3RNQB 4ZDHB 5JZ7D 1CFBA 1UM6H 1CF8L 2MNUA 3NFSH 2H26B 4ZFOB 4YDKL 2CUIA 5IHUL 2WBJC 4RFNB 3LMJL 1IBGH 4HFWB 5HDQL 4HXBH 5E8EB 4KVNH 4HKZA 4RMSA 3KLAB 4BUGA 1NKRA 1SYSA 5I0DA 1OGAE 1FZJA 1JBJA 2EXYD 4MQSB 3K1DA 5CWSA 1AH1A 2IAMA 3SE3A 1WBYA 5I1HL 3V52H 4PLJC 3D85B 4FQ1L 3VH8A 3KYKL 2VR4A 4ZQKB 3W11C 5FCUH 4KMQA 1CFSA 1FZKB 1MRCH 3GMPA 3D9AL 4LSPH 5E1AA 3V5HA 2WWMD 3T77A 4LHQB 1JL8A 3CFCL 4OCXH 3V4PL 4QXGL 4PUBL 3RL2B 1I7UA 3OAUH 1KN4L 3QEHB 5T5FL 3NZ8B 4X6BA 5D7LA 4NNXA 5K59E 3TBSA 2VLKA 1EEZB 1MH5A 4Z8FL 5MENB 2DQHH 2F58H 3ARBD 4HX1B 1XF3B 4HK0A 2BNRE 3EOYG 1ES0B 4MB3A 1KTLB 1KJ3L 5JHLH 2HVJB 4G8GE 1JI2A 5F8RC 4LEOB 2GKIA 2DI8A 3N06B 3H3KA 2X9XA 3SBWA 1YEEH 4X4YB 4U1HA 2ZUWA 4YZFE 5F88A 2AJXL 2Y72A 3QYCA 1OF2B 3P9LB 2X1PA 5JHDB 3OTTA 5EIVA 3QP3A 3MV9B 4PJBB 1S7XA 3K80A 3RA7L 2VLLA 4KRPC 2DDQL 1INEL 1DQTA 4OM1L 2J2ZA 4LLUB 4WFGE 1DL7L 4O02H 4XX1G 1OAKH 4RMQA 2DLFL 2IPUG 2GW5A 5F89B 3H3PL 3SEPA 1CD8A 1FLRL 3E8UL 3KPPB 1DBMH 1R6VA 1QFOA 4UZGA 3MFFA 3VCLB 4WU7A 4QTHA 1I9JH 1IM9D 5D1ZC 4IOIB 4U6TA 5FF6A 3ULUH 1X5HA 4NBXB