2QL1A

Structural characterization of a mutated, adcc-enhanced human fc fragment
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
209
structure length
209
Chain Sequence
GGPDVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPLPEEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of a mutated, ADCC-enhanced human Fc fragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords IGHM protein
total genus 37
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ql1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ql1A01
4BFIA 3V7AE 1BBDL 2CK0H 4FQIL 1A7QH 4DEPB 3NN8B 1BJ1J 4M1GL 4GQPH 2A0LD 1HN1A 3RIAK 2AK4D 3BZFB 5KVEH 5TE6L 3U46B 1ZLSL 3RDTC 2X1QA 4XC1L 3L3GA 5C6PB 1GZPB 5DJCA 3VGDA 4YZFF 5FDYA 1AY1L 4I48B 1U8HB 3LIZH 5IMLB 3HC4H 4E9LA 5ID0B 1I9IH 1GC1L 1F4YL 4QHUB 5TH2B 3FOLA 3JTSA 4CJ1A 1MCFA 1OCWL 1AHWC 2W9DH 5F70A 4F37K 5K59E 4Y5YA 3KPSD 4H5SA 3OKEA 1B6DA 2C26A 1QFUL 3SE4A 3W9DA 5CGYD 5E00B 5E1HB 4RRPG 3W11C 1KTDA 4XC3H 4EBQH 5E24E 1TTGA 4LVHC 3CMOL 4ZO8A 3BYYA 2GCYA 1HKLL 4GJTB 3RVXD 2OL3B 4Y2DB 1OVZA 5C0EB 3PWPA 4F57L 2R0KL 2ZSVA 1AH1A 2FR4A 2ATPB 1UB5A 2AEQH 2VDKL 3BO8B 1T03H 4NRYA 1ACYL 4PJCE 3QUXD 1NMBH 1J0JA 1NC2B 3TP4A 5JHDB 2FHCA 2P24A 1CL7L 4WI4A 1PG7W 1QQDB 3HS0B 4LCYB 1R24B 2DIJA 5GGUB 5HGBA 5TF1H 5H2BB 1ZS8B 5JA8B 2VZ1A 5A16B 2GY5A 4QHMB 3PWLA 4GO6B 1NCAH 1FFRA 4GMTL 3S3JA 4M61B 3IU3B 3MRDA 4G8EA 5C3LD 2HA1A 4RAUA 4PGJA 4HDIA 1AP2A 5C8JB 1KJ3L 1G6VK 4YXHL 4ZUUA 3MRPB 3RIAF 2DJ4A 3MRBA 3STLB 3O6LL 3U7WH 5JLZA 3O45A 1NGQH 1U95A 3RPKA 3QDGA 4HGWA 4M6NH 1DLFL 3HNVH 2YMXL 4G6JH 5B39G 1NCDH 3N85H 2A6JB 4L3CB 1SEQH 2DYPA 2XFXA 2IBZX 3BRGC 5L7XH 4I0KA 2P1YA 4X98B 2I60L 2XTJB 3EW3B 3RY4A 5ICZB 2MOVA 4X7TA 3T8XA 2VZTA 3QUYA 1A7NL 5DJ2B 1I1AD 4WW1B 5SWSE 3T0EA 5JA9A 2VLJD 3Q1SH 3H6JA 5EBLB 3FB5A 1IAIM 1KLGA 1R3JB 2CK2A 4OCNC 4QO1A 1DLHA 3CVIL 3WIHL 1A02N 3QNZA 4JKMA 4OB5H 4NN7B 3U30B 2HFEB 5IFAL 4AH2B 3MPCA 5DJ6B 1I7UB 1QSFE 3SE3C 4LCWE 2EXYC 1J1OL 4MJIA 2YK1L 3TF7C 4Q2ZA 5J11B 1TQCC 3VRIB 4KRPD 4YE4H 1S7WB 5D2LF 3MRLB 4OFKA 5TQ2H 5EU5B 4LSSH 3QDGD 4JQXC 3PWJA 5C86A 3VFPB 3HA0A 3G6JA 4KJPC 2P47B 5MEOA 4ZFGL 5J1TC 5DMIH 1MFDH 4MGXA 4OCSH 5TE6H 4EI6A 5E94B 3C6LA 4P4KB 1JHKH 2W60B 3RVWC 4YDLC 2H2PC 4HCRA 4M6OL 1A7QL 1NAKH 4DKEH 2DM2A 2EEAA 2Z4QA 1KB5L 3DO3A 5I8KH 4XAWH 2ILLA 3QUMH 5HVHB 5CP3A 2DWDB 3SGKA 3OAZH 3TBTA 3TBYB 3DVNB 4CVXB 1OL0A 4HUVB 2VL5B 3ARFC 1P7KA 3BDYL 4FQ1H 2YR3A 3D0LA 5IB4B 3HNSH 1A14L 1A1OA 4PRHD 3VFTB 1S7XA 1GAFL 2GJJA 4Y5VA 8FABA 4TRPL 3HI6L 3PP4H 1EUTA 3ULVH 4DUXA 4R9HA 1LO4L 3VXRB 5C09B 1HDMA 2DDQH 2NX5B 2CDEA 4OZIF 1GOGA 3QUKA 1D3CA 4NIKB 5IVXA 5F9OH 3LKNA 3QDMD 5D7JD 5IW6A 3MXVH 3D5OF 4JQIH 1YYLL 2EC8A 2AJVL 1UG9A 5T3XH 4ZOEA 5CP3H 2XN9E 4JKPL 4KMQA 5CMAB 5EIIB 4JFOB 2GI7A 3OKMB 3MCLL 1LD9A 4X5LA 3ZHKA 4OLVL 1FE8L 4G43A 1AGDA 3K2MC 2O5XL 5E2TL 1ZA6A 3MA9L 1HQ4A 2R0ZL 2LFGA 2YBRA 1D6VH 1JPFA 4DQOL 4Q74A 3VE0B 1KB5B 1E6OL 1X5IA 3RTQA 1WFOA 1B4JH 3DWTA 4O2CB 4DJMA 1J5OH 4JRXB 4RGOH 1YPZA 3SCMA 1YEEH 4XP1H 1P1ZB 1XGPA 4FQQB 4PJ9C 3PJSB 4ZPVA 4TUKL 2CMRL 4Z6AT 4MXQC 4WDIA 2Q7YB 4HG4J 2VN7A 1C8PA 3ZZ1A 4YJZL 4ODWA 1UB6B 5ISZE 5E2WH 2P5EE 2C5DC 3MRIB 1R3IH 3VD3A 3QIBC 5IFJB 1X7QB 3P9MB 1EBAA 2NYYD 2AABH 5JIHA 3WJJC 1T21B 15C8L 4N0CD 3CDYA 1A6ZA 1P69B 2D7TH 2JK5A 4JDVA 1GJIA 1QBLL 4XVTL 3QB7C 3W9EB 1BFOA 3EYUH 1KPUB 2EH7L 3BGAA 1QBAA 3QQ4B 5I66A 5HI4C 3C2AL 1NEZB 5IQ9A 2Q7NA 4UINL 1NAML 3DV4B 3IJSB 3CDFA 3BQUC 3L95B 1Q1JL 4G9FB 4C56D 1KXQE 1IC1A 4HUMB 1INDL 2SEBB 4B5EA 2C1PB 3KPMA 5DT1H 1TZGH 4KRPB 2X7LA 4Z77A 4OFYD 1R5VB 3S4SG 4NZUH 1CGTA 4NP4H 2PO6C 1CLCA 2WK2A 2AW2A 1LP9B 5DGRA 3TPUA 3DETD 4N8CH 5DUPH 1QOKA 1CFTB 3DURB 4KROC 3QFJA 3REVA 4RA3A 3S6CA 3TESA 2X4SB 2DBJA 3H9HB 4OZ4B 1JBJA 3O2VL 3VXNA 4KJYA 2XG4A 1NAMH 1OPGL 5IFAH 1FVEB 4P4RA 2FB4L 3QWRD 4YQXL 4NQCB 3HTLX 1D5IH 4MQTB 4Y2DD 3LRSB 3K2UH 1IAMA 3QDHA 1J9CT 4YX2H 1TZIA 2GAZA 1DBJL 2EYTA 3P73A 4XVTH 3BPLC 2X4QB 2BSRB 2GFBB 4JLRA 4EUPA 4ELME 2PXYB 3ZHDA 4WHDA 5C92A 4CVWA 4MNHB 3W81A 1PG7L 2UZIL 2XWJA 2ZNXA 3NGBB 4NCC1 4U1JA 5KSUA 4B0MM 4PB0H 5F7DA 2FX8L 1YEGL 3HE6B 4JB9L 3O0RL 3C8DA 1ZANL 2EH7H 1H8NA 1RULL 3MLWL 3KAAA 3MJ7A 4P46D 1BHGA 4BH7B 5EBGA 25C8H 5JUEL 1WICA 5EWIL 3BXNB 1QR1B 3RZCD 4XCEA 3L3IB 3EO0A 2IFFL 4CN1A 4YGVA 2F8OA 5IB5A 1RIUL 2NXYB 2ZUVA 4BSWB 3NACL 1A7OH 2AXGB 4OZFG 3MODH 1KLUB 4YEFA 4ZFOA 2KQNA 1IGIH 3I85A 4JANA 2R0ZH 4XXDB 4K8RC 4YHIB 3LVEA 4LVOC 1FL6A 1T1YA 2OJEB 1RZJH 1YEJL 1EEZA 3QG6B 4PGEB 4PJDA 3PQYA 4CN4A 1OAZH 4EDWL 4H0HB 1FNEA 3IKCA 5E2TH 4ENED 4O51B 5CLTA 4WI6A 5GS1A 1GGCL 5I2IA 3PG2A 5IK3B 4JPWL 4HXBH 1MJ7H 1XGYL 2DTML 3BPOB 2WBWB 4HJGA 1FG2B 3I6LD 4NWUH 1YJDH 5CINH 4F7CA 4HFUL 3LHPH 4BZ2L 3CLEL 4MLIA 4XC3L 1YYLH 1VA9A 1I7TA 1KELH 1BIIA 2IG2H 3BGFC 5F9JA 4FP8H 2XYCA 1WBYA 2W9DL 2Z91B 1JUFB 1RZKH 2X42A 1QSZA 1RZIA 1BQLH 5HI5D 5DQDL 3PIQA 3HUJF 4WFFE 3N9GH 4DZBB 3MRHA 3D0VA 5GGSB 1INQB 5EOQH 1ZT7B 5EC1B 2C7UA 4WEUD 2X6MA 3A67L 5FCUL 3LH2L 2HRLA 3A6BL 4FNLH 4RAVB 3QZWB 3LSOA 1NLBL 2YD3A 1IEBA 3KJ4C 4PD4K 1HSAB 3T3PE 3KS0H 5ABDE 2WLZA 4XCNB 4HH9A 2QQLL 5I74B 3I3EA 3VXTA 4R2GB 4TOYH 2YSSA 4OLWH 1S3KH 3WO3B 4Y16C 1NBVL 1XMWA 3DV6A 3C60D 4WUUB 5C0AB 3ARPA 2BVOA 3RHWF 3LS4H 3QCVH 3ALPA 4YBLC 5E8EB 4PJBB 3MLTB 3S35H 5D93C 3GBML 2Y7QA 3N06B 4NGHH 1J88A 4FZ8H 3CVHH 3VXRD 4JFXA 3LD8B 4JM2F 4NQXA 2P43B 1BLNB 2IQ9L 2V5TA 3VD4A 3CX2A 1LE5B 4DN3L 1PKQE 3I9GL 4L4TA 1GSMA 4LF3B 4ONFH 2ADJA 1NCTA 4IMLB 1TVHA 2I60H 2FCBA 2J12B 2PTTB 5EBWB 5I9QB 4GW5A 3VWKC 3DETC 3ET9F 4OB5L 4JCMA 1NGZA 2R29L 1J1PH 3MUY1 3O4OB 1I4FB 3H9SB 4WFHE 5FGBC 1MJ8L 3RKPA 3ARQA 5F1KC 3ECBB 1D7FA 3QRGH 4PJGE 4GG6E 1IAKB 5D72H 1AC6A 1JMZA 2FX7L 5A3ID 3BP6B 1G7PB 4P46B 3NZHL 3O4LB 1EXUA 4Q9RL 3PXHA 1R5IB 3G6AB 1G9MH 3OKLB 2IH1A 3O8XC 2XKSA 4UTAH 3W0WA 4OLZH 1IVLA 4NQDE 1CLZH 3F7VA 1S9VA 1OAZL 4ZUVA 3QXDB 1QBMH 3HI5L 1L0XA 1IQWL 2WP3T 3HMWH 5K9KB 3VMPA 1UCBL 2BVUA 5I16A 4XZUA 3QFDA 4IBLT 1MCOL 1UM4H 1WZMA 1N7ML 4G8GE 5TF1L 5E1AA 4E42B 5DRWA 1NDMA 2JB5L 4PR5B 1FZJB 1AD0B 4N0YL 3TO2B 2UZYB 3U0PA 1KN4L 5JOEA 5TDPB 1N0XL 3AS1A 1NBZA 2D0HA 1IC5L 3HUJA 4GMTH 3GNML 1DQDL 4JHAL 1AXIB 3EJJX 1X5YA 3O3AA 1FGNH 5IG7B 3KYMB 5CJQH 4HX1A 3V4VH 4CADA 3KPRE 2DYPD 2R56H 2DMBA 2RB8A 2GJZB 1J8HD 4OGXL 5DEFB 1G7HA 5DZLA 5HBBA 5J6HA 1RMFH 1P4BH 3RJDA 1JGDA 5F3BB 3DXAB 3PDOB 1WLHA 4UIMA 3UP1A 2H9GB 4FFWD 4G42B 3IGAA 1AD9B 3L7FB 4Y4KC 3KPRA 3M17A 1NCBH 4G9FD 4DN4H 4ISVA 4GAJH 4Z7WF 2DJSA 5FYLE 4ZDHB 5E08H 4OTXH 5K9QG 3FAWA 1H8OA 4WWKD 1KF9B 1JNNH 4L4VD 3H0TA 2F54E 3HMXA 3IJHA 5I71B 3BISA 3D39B 1UKTA 4AT6A 3QO1B 1LO2H 3TNMB 4NDMB 1IFHL 2F5BH 4K94L 3GBMH 5IEHB 3TBVA 1MCSA 1P5UA 4XC1H 1T7VA 3AFLA 1OPGH 4NO0A 2CO7B 4Q6YA 5DD5H 3ARDC 3GMOB 4Q97A 1N4XH 1A3QA 4Z8FL 4JFEE 5FAAA 1QSVA 4NZTL 1FLRH 4I77L 4N1HB 3SDDB 3EYSL 5IJVA 4RMSA 3M8OH 4EN3D 4D94A 1WITA 5IESH 1U8KA 2VQUA 1FZMB 3IJYB 4N0FA 4NQVB 1I8LC 4IIQA 4ELKA 1YDPB 4MJ6A 1XGQA 5JNYB 2IFGA 1IC4L 1J12A 3DRTA 1NLBH 5KVEL 1BFTA 4OZGE 3DI2B 3DUUB 4JDTL 5FYLL 1U41A 4U3HA 4KI1A 4ODTH 4NPYB 1ZSDA 1ZHBA 1D5BB 2XZQH 5IT2L 2BHZA 4O4YH 4Y4HB 3IDXL 1FFNA 1F42A 5HD8D 4ODXA 3KPSA 3JUZA 1FRGL 1GVIA 4HIJA 4LSVL 4FQXB 5DQDH 4B7LA 2NY3C 5IOPB 1I1FA 4Y16A 5DURD 1RJZA 3RNQB 4UB0L 3RZCB 1GIGL 3AROA 1XF2B 5BS0D 1NC4B 4YGAB 4U4BA 5BMFH 5EZIH 3RDTA 5L2KD 3IVKA 5IVZA 2B0SH 1LMKA 3H7BA 4NWUL 4EZMA 2W0LA 1I9RL 4PJAF 5HY9A 1B0RB 5DSCB 3MCKB 4F37F 1QRNA 4OJFH 2I26N 3OAYH 4Y4KD 3S5LG 4BH8A 3C5JB 3MUZ1 1BX2B 3KDMA 3UYRL 1NANH 4G8IA 4QRTA 2XN9B 1CD9B 4GRWE 3BKCL 4HAFA 4M8VA 3FO1A 4U6VH 4WI7A 1CXHA 5EU6A 5L9DH 1DSFL 2E7CA 2CLRA 3QIWC 4JRWA 1SYSB 4U7MA 3RIFK 1U3ZA 5K9QI 1OB1B 2YD6A 4JM2B 5JXAL 4QHKI 5MENB 4OZHE 2BK8A 5CEYA 5IBLC 3CSYB 5HHVL 2NY7H 4NZRH 1U2CA 2Q1EA 2BJMH 3AXLB 3ZSTA 2Q86A 4JFFA 4PJ9B 5C3TA 2F5AH 4Z95H 3Q6FB 4WU5B 2A1WH 4ZXBA 3QWOB 4BUHA 3ARDB 1CK0L 1FYTA 3HZMB 3O41B 4GH7B 1PLGH 4OD2B 5ISZB 4ZTPH 3CXDL 1K8IA 5I76B 1DBBL 5AYQA 1GZQA 1U36A 2X9WA 1HWHB 1MFAL 2QSTA 1EHLL 1EAPB 2VIRA 3X14A 1LP9E 3I6GB 4M7LL 5D7LD 3W5NA 1Z5LB 3S3PA 2K1MA 4CW1A 3R1GH 1R5WB 4LLQB 3QUXC 1B6UA 1MCWM 1ADQH 1P7QD 4HWNA 3JZ7A 1LEIB 3VCLA 4S2SA 1JGVL 2CSPA 2KZ1B 1XGTA 3LKRA 4NKOA 2EXWD 4DKEL 1MREH 4C57C 4M48H 5E6YA 1X6LA 4YC2B 4G7YL 5KBNC 4OM1H 5LGJB 3VD9A 1MAML 2FEDD 5HDBF 4M8QA 1FSKB 2HT2C 1IKNC 2X9XA 4JO4L 2F8XC 5GRVK 4NZTH 4JY4B 1HH6B 2W65A 1D5XA 4X6CF 1N4XL 1J1OH 1RJLA 1XF5A 1A3RH 3QDMA 5D7JA 5F7WC 4N5ED 1UKQA 4EQ2A 1CXFA 4FXKA 4NO5A 1D9KB 1N6QL 3P30L 3QCUL 1BFSA 1CXIA 1ZAGA 5FUOL 2D7MA 1MSPA 1FNGB 5CJOH 3SDCD 3LDBB 1XGRB 1NUGA 3O6FD 4BSVA 3H3PL 1G0DA 2WMPA 4U1MA 1TCMA 4Z7WB 4AG4H 3CCHB 2WZPD 4Y4FB 3WHXB 2IC2A 4OZHF 3GMPA 2FJHA 2F54A 4QY8A 3V5HA 1FJ1A 3K81A 3P4NA 3UO1L 4FQJH 1YEIL 4KUCF 3S97C 1UM6H 4MCZA 1FNLA 1R0AH 5DLML 1EH9A 3L5IA 3ZMRA 3QIWB 1ORQB 2V5MA 2E7MA 5FA4B 2BOCB 4JFZH 3L5JA 3WLWC 4M6NL 1RUQH 4N0YH 4HWEH 2HVJA 4CVUA 3TT3L 5CEXB 3RWGB 2ZOKA 4RA0C 5JW4R 5AAMA 2I9LA 3OKKB 3MRNA 3CNKA 2N7AA 5MERA 1KV3A 3GSUB 3HPJA 4RCAA 4U1IB 2J8UE 4AJ0A 4JRXD 1X5JA 4BJLA 2GTZA 1DQLL 4X5XB 4XCCL 1D5ZB 4MHHG 5DO2C 5IKCB 4AIOA 1DEEA 5ETUA 5H94B 5D9SB 2Y07L 1M6OA 3RZCC 4JKPH 1QSEB 2P7TB 4K8RD 4JO1L 1J8HA 4YHOL 5IQ7H 4YHPB 5L8LB 1D5MB 3NA9H 4XNQB 2BMKA 5JZ7C 4YUEL 5B3JF 1HHKA 1P4IL 2FL5A 3MRCB 1JPTH 4IOIB 1KIQB 1FHGA 1T89C 4PJ8A 4DVRL 5FYKE 2IBGA 1LO4H 4L8DA 4ODSL 5JPMB 1CZ8H 1DL7H 1ZT4B 4DKAA 1ZGLB 1CGUA 4JGJA 4DVBA 2OTUB 1IGFH 1H3XA 4PP2A 4O2EA 5MEND 5DRXA 1WTGT 3C5SA 4PJAA 2DBLH 1I1AA 5CBAB 1U3JA 4K07A 2MKWA 4FXGB 3MLPA 4ZXBC 5ESAA 5BCAA 3WDJA 2PCPA 4KRNA 4MA3B 3MBED 4EN3B 4TUJA 1T2QH 4LSUH 3MOBL 3F7PC 3KYNA 1OTSD 3QEQD 2WW8A 1JGUL 2X4PB 5A2FA 4L4TE 3IDXH 4OD1H 4P0DA 3ZL4L 3QULB 5DD3L 3HC3H 1BAFL 2YWYA 4I3RH 3I6KB 1A2YA 2PYEB 4MD5A 5DMIL 3DOSA 4X7DC 1ZVSA 2QQNH 4JFDA 2OR9L 3LH2H 1A7BA 1DBML 5EO9A 1RZJC 5IESL 5DJ8B 4TOYL 3QUXA 5JOPE 4G3YL 4TTDD 1NL0L 4KROD 4RBPH 1BM3H 4YPJA 4F9LC 3HR5B 4QYOA 1NJ9B 1ORSA 4JN2B 5EO1A 3RI5F 3MXWL 2H41A 4HS8H 3MNVB 4OM0L 3F65A 5L8KB 5I0ZA 3ULVE 4FTVB 3CVIH 1YJDC 1I8MA 4Z7QE 1CDBA 3SDCB 2B1AL 3PXJA 5GQBA 2BVPB 2X70A 3FB7B 3VH8A 3BP5B 4ORGA 1MUJB 4H20L 4TSBL 5L0QC 4IRZL 1YN7B 3VFOA 3TN0D 1BQLL 3GJFB 3HNTL 1PEWA 5EO0A 3DRQA 4XMPL 4BYHA 4CU6A 1RFDH 3L9RB 1A5FH 1V3MA 2JJWA 1RHHB 5EUOA 1R3HA 2BFVL 4DZ8B 2Y6SD 4F7PA 1UGNA 2AKRA 2BY0A 2EDNA 2ZUUA 5DUML 1MVUB 2XTLA 3KS0J 2YC1B 3UTOA 2FD6H 2MCPH 2BVYA 1PKQB 5DK2A 1VGKA 2XOTA 2ESVB 1QA9B 2YRPA 3KYAA 1DUYB 1UWGL 3CUPB 3TGXA 4K3DH 4U1KA 4A6YL 3B9AA 3C8HA 3DGGA 1IM9B 4XNXL 5GIRA 3QYCA 2HT4C 3HMXL 1RIUH 4Z7UF 1YMHA 3ZT6A 1CGYA 1ZVYA 1I85A 3MV8A 4ZS6D 2D9CA 4YIQA 3ZE0E 3OPZL 2CLZB 2VDMH 3GBNL 2Y5EA 4MJ5B 4C55A 5TFSL 3DLQR 2EDWA 4FA8A 3H9YA 1Q94A 3BD5A 1NCUA 2J3SA 4P99A 4HK0B 3LZFH 2DI9A 2V2WB 2CKNA 2FX8H 4FFZL 1L6XA 3FRPG 4LP4A 2IBBA 3MRMB 4P2QD 1OTSC 4KC3B 2GSIA 2XQBL 1G9ML 4KMLB 4KGJA 4KQ4H 3HZYA 1FH5H 4LBEA 3QO0A 2AJ3A 3TNNB 4L9DA 3DUSB 4OZHB 4AIXA 5DMGC 4UMGA 2VITB 1U8IB 1KJMA 5T1MB 2IAMC 2OCFD 2NQCA 2Q76B 3B9EA 5TQ0L 3PUCA 4QRQB 5FYJL 2WUCH 2X1XR 4M9PA 4WV1B 4YBQC 3ARBA 4PIRF 4OQTA 5H37G 3TA3B 3MROA 3NCCB 2RIKA 5HDQH 4I18B 4MDIB 3WFDH 3AAZB 5J7CC 4PJ8C 1DBJH 2WINB 3L3KB 3PWNA 3WLWD 4L9LB 3FT3B 3KLHD 1LILA 1C7SA 5HHQB 4WEBH 3EO1A 1BVKB 3BGMB 1YPZE 1MRCL 2VO5A 3NCJL 4QF1B 3GSQA 4W6XB 4WHTA 4WENB 1FLTX 2VQTA 1ZLSH 1LNUA 1HXYB 1PQZA 3BKMH 2HH0L 4PGBA 1F90L 3T65A 4ERSH 4LCIL 5IMOB 3VGEA 4HHAA 1E0OB 5TE4H 2GQHA 3TM6A 1KPRB 3QDJB 2DOCA 5BXFB 2Z35B 4HF5L 4V1DA 5EUOF 1UZ6F 4PV8A 2FO4B 3V6BR 3LKOB 5EIVA 5SX5H 4QOKA 1A6AA 1QYGL 5GISH 1B3JA 4OQTH 3BKYH 2BSSA 2R0LL 4LMQE 5IW3A 1T83C 3VI4F 1QPXA 3QH3B 3QIUB 2Y72A 4QXGL 5MHSE 4M4RA 2EDBA 3FOMB 5I1JL 4U1GC 4FTVE 3VI3E 4PV9A 4LSUL 4LAJH 3N9GL 1A1MA 2IANA 4OF0A 5KSVB 5HYIA 3ESUF 1RVFL 3GMMA 2D0FA 3FQWB 5C1MB 4LLYB 5M7QA 5D70L 2HVKA 1QBLH 3B3IA 1ED3A 4MA8H 3QXUA 3Q2CA 5FECB 4RAHA 1IAOA 2XZAL 5DJZA 5ESQB 3TBSA 5D1QD 3QISA 4XH2B 2YPLB 1XR8B 5CJXA 3INUH 4MNQB 3P11L 4IM8A 3P40A 4PRIB 3BE1H 3EOBA 1OTTC 2ESVD 4HXBL 1KNOA 5H35A 3T2PA 3SGEI 5EU4A 3SPVB 1MCPH 5HPOA 4MXWH 3MBXL 4QRUB 5IF0B 4P5TB 3DIFB 4PRIE 2QSQA 3BOVA 4GRLB 4NM4H 5CIPH 2HTKC 3D69A 1AKJA 4K9EH 1OHQA 2FATH 4YO0A 1WCBA 1CTOA 3H42L 2Y36L 2UY6A 2V5YA 1CS6A 4EVNA 3RUGB 5FO9B 3BKCH 3HE6C 1DQLH 4JREB 2R4SL 1MCNA 5C0BE 5E8PB 4DQOH 4ZYKA 4MXWL 1FVCA 3BIBX 4Y5XC 2X4OA 4IOFC 3VWKD 5FB8B 2CUIA 5DD1L 5T1LD 3H3KA 4UZGA 4W81A 4OJFL 5B8CA 3PWUB 1T1WA 4PJ7A 2BCKB 4QHNB 4G6AC 4HMCA 2VDNH 3U0TB 2D4FA 43C9A 1PD6A 1KIRB 3IETA 1KENH 1A3LH 3D3VE 2FIKA 1QLFB 2PO6A 2HLFC 2XNAB 1U92A 4OF5A 2XY1A 1ZGLM 3NCMA 4HWZB 3VFMA 1QEWA 1YEDA 2EO9A 3B2UC 4IMKA 3T04D 1U3HD 1HILA 3EBAA 4I2XB 3D3VA 1NGXB 4LPCA 3MJ9H 4D9QD 1QFHA 2NY6B 4JM4H 4MVBC 4L8CB 4HWZA 2Z31C 4LSVH 4HV8B 4XAWL 1PG7H 4HIXL 5J12B 2AAVA 5FHAH 2A74A 3REWA 2PO6B 1Z9OA 2FIKB 1KIRA 43C9B 2H32H 3ZTJG 5I1IH 5ANMA 4Q9CA 5CGYC 4W68A 4QCIB 3LOWA 3GSXB 4U0QB 3S37L 1V3JA 1SBSH 3V7MA 3ALXA 4X8JA 3V0WL 4FMFA 1M7IA 1DP0A 2VDRL 1UYWH 1QR4A 5GRXG 3M8OL 4PRAB 3RUGA 2Z8SA 2WUCL 4ZOAA 1WCBB 2PF6A 1JHKL 3CLFL 5FA3B 3TN0A 2XWBA 2GEEA 1A4JB 4Z0XB 4I2XE 1LK3H 2XXMB 3DIFA 5HI4D 4ZFGH 1KACB 2CJUL 5JQHC 1RUAH 2DLFL 5EU4B 1O0VA 2GW5A 1S7UB 4G7YH 5H35B 5AZ2H 4X0KB 1HHIA 3IDYC 2AJUL 3EOBB 5FOJA 2YEZB 4HIHB 5F1IB 3RBSA 3G5VA 3FFCA 1QFWM 3FQUA 4MNQA 4Q9QL 1FGVH 4X80H 1XR8A 1TTFA 4XH2A 4KVNL 2RAMA 2YD7A 3U1SL 4EDXB 5DJZB 5FDWB 3TBSB 3T4YB 4NRZB 3ZT7A 1OP3K 4HKJB 3HC0B 1NCDL 3MR9B 2YMXH 4HIEB 4G6JL 3GMMB 4WFEE 1A1MB 2IANB 3I75B 4PV9B 1OAKL 4RGMB 4ZO9A 3AREA 1WZ1L 5F1OB 2I24N 4LFHD 4R4FH 4UQ3B 2R1WB 4Y8AA 1U58B 4MS8D 3LZFL 1W0VB 4PJFE 4WHCA 2Z31B 3MO1B 3TCXA 1JZ6A 4N90E 3IDJB 4NQEE 4ZFZB 4GKSA 4OD3L 3T0BA 2NMSA 1TPXB 1KN4H 5HHME 5KANG 5IHZA 3U7WL 3ZE2E 3K1KC 5BXFA 3QDJA 3IU4H 1T4KA 1KPRA 3QP3A 4MX7B 3TC9A 5GS0C 4HHAB 4RGOL 3P4LA 1G84A 1LNUB 1I7ZB 4R0LA 1QVOA 4FG6D 4OT1L 1CDHA 4AENA 1PEZA 4K3DL 4MXVF 5FO7A 4PJ8D 3GSQB 2Y4SA 3DHMA 5KN5B 2NTFB 4PJIE 3PWNB 2Y06L 2WINA 3GGWB 3L3KA 5FFLA 3NABL 1MCCA 5BZDB 5JO5A 3HG1D 3V5DA 3AAZA 4U6VL 1WWCA 2MHAA 5KSAD 3K3QA 1MWAH 3MROB 4DEPC 5DJYA 1YNKL 5ITBL 4EBQL 5DMYA 1BD2D 3DYMA 4EI5D 4KJWD 5KVGL 5DJYB 1VCAA 3NCFB 5T1KD 4KGLA 4ZD3L 2BHUA 3U9UB 1LEGA 3GSRB 2OMNA 5HGDA 3RVVD 4KWUA 4JO3L 5JO5B 3GGWA 4P4KC 2AJ3B 2OK0L 2X89A 3AS0A 5J4MA 1VKXA 3PP4L 4P9HC 4HCRH 4WWKC 4DKFL 2MKLC 4Y1AE 1QD0A 1CE6B 1QVOB 1CLYL 1I7ZA 4QEGA 5E6ZA 3FJTA 1VPOH 1I9EA 2J1KA 1BWWA 3GFUA 5KVFH 4JO2H 1TQCB 3FZUD 2EDHA 4MAYC 5F7FA 4MX7A 3VJ6A 2IGFL 3IB4A 1KJ2B 4N8VB 1T4KB 3R8BB 3GRWA 4IDJL 3MTRA 2B20A 2NXZD 4K8RH 3FRPA 1TDQA 3M45A 1DN2A 4KVCH 3U30C 1RY7B 4ZUSB 3CDGA 3ZDYE 5C0GB 3GJFH 3HRZB 1YMHB 2XZQL 3U9PL 4JFQB 2A77L 3MO1A 4H26A 5CEZL 2IWGA 1U58A 5AYUL 3V7AG 1FAKT 5MP6H 5LWYH 4JFFD 5I1EH 1IM9A 1K4CB 4LARL 3S9DB 1IGJA 4JZOA 4ZO6A 4HIEA 1EZVX 3MOBH 4TUOA 2XKNA 3IFNH 5IVXE 5HYJD 5C0CD 4OIIL 4WFGE 3T4YA 5SX4I 4EDXA 1I3UA 4OIBA 1XIWD 2AKRB 4NN6C 3T2NL 3NZ8B 3GRWH 3ALWA 3LS5H 1JYVA 4D0CA 4TQEL 3VFGH 3TN0C 5IFHH 1R3HB 1TITA 2F58L 3GO1L 3X3FH 2ARJA 3K1DA 4OCXH 3L9RA 4HIHA 3O8XD 2YEZA 4GRLC 1FL5B 1MCWW 3DRQB 1JVKA 4UOW0 2R4RH 3GJFA 4X0KA 1LP9F 4Z7NE 4HCRL 5ALBL 1YN7A 3BEWB 1PGRB 2BVPA 2X70B 4G6ML 1DCLA 1JGEB 3V6OC 1I8MB 1NCBL 2ADGB 2FBOJ 4FABH 5FA3A 1J0IA 3VG9B 5BVPH 4ODBD 1ORSB 2YD8A 1DLFH 3HNVL 4G6KL 4OUOA 4KI5F 2CXGA 4LOUD 3EOAB 3S7GA 2GJ6D 2VDOH 4Q0XL 5DDHB 2YD1A 3HZKB 4PJCF 4PJCB 4PJHF 2QR0B 4XPFH 3DNKA 1ZVSB 5GGTL 4MLSA 4HZAA 4G7VL 2PYEA 4DGVH 2A74B 5GRUL 3LEYH 4HV8A 4NHCL 1E4WL 2X4PA 1U3HB 4D9RE 1N7MH 2ZPKL 4PGCA 1DE4A 1NGXA 5J9PB 5AZEH 3SE3A 2BRQA 1VB9A 1HILB 4HUWB 5SWSB 2PCPB 4MA3A 4R7NA 1QEWB 5I15H 1TQBB 2DLHA 1DBAL 4UAOB 4CU7A 4M43H 4XP5H 2XNAA 4YXKH 1N64H 1FGVL 3QR2A 5DI8A 4JQXA 1G6RL 2A9MH 1RZGA 4O2EB 3TO4A 3WNMA 1JTOA 5BW7C 1KCUL 2QADC 3MV9E 2VE6B 2BCKA 3PWUA 1KCKA 4M6AA 5HJ3A 5FYJE 4ZAKC 2LVCA 1RUAL 3UBXB 3OAYK 4PJ8B 5E8PA 2KUTA 1OSZB 4C54A 1QACA 2FL5B 3MBEB 3MRCA 4R2GD 1NAMA 5K9JL 5FO9A 1J1PL 1U8LB 3ARXA 1WC7B 5FUOH 2BMKB 4K7PX 4YQXH 2VB5A 1N6QH 3ULSA 3LQAL 2P7TA 2QL1A 5DO2D 3FKUS 1ACZA 3OJVC 5TDNB 1CFVH 2ZJSL 1F4YH 4MA7L 1CF8H 3SPVA 4S1DC 2HYMA 4NGHL 4KY1H 1KNOB 4UU9A 4Y5VC 1JYXA 3V5KA 4PRIA 3TT1H 5HHXL 2NNAA 1LK3L 4J1UB 3NVQA 3GSUA 3HPJB 3EFFB 1RZ8A 2ZSWA 2YPLA 4KK9D 5FCSH 1XIWA 2DRUA 3BT2L 4HC1L 1EVTC 2YD2A 3O2WL 1IAOB 4HT1L 2YPVH 5FECA 3QPXL 4IS6B 4MAYA 4QRPD 5D7IB 3WMSA 4K7PL 2ZOKB 1ED3B 3QI9C 5CEXA 2EO1A 3B3IB 1I75A 5DFWH 2AERT 3SKMA 4J4PA 4JZNB 3W82A 5I15L 5KSVA 4P5MA 5DMKB 4PJ5B 1JYWA 1OSPH 3V95A 2BNRE 3BP4A 4JQVA 1EPFA 3ILQC 2MWCA 1FJ1B 3P4NB 2F54B 4QY8B 4R8WL 3SY0A 4D9LL 2VLRD 2OR7A 4P59H 3BRFA 1ETZB 3RTQC 4PD4J 2CLVA 2OLDA 4QOKB 1UWEL 5GGTH 4Z7WA 5IGXL 2J6EH 3CH1A 4ODUB 5C70A 4V1DB 5I1KL 2WQ8A 2I25N 1PLGL 4UNVA 1U6AH 4FP8L 3ZDXF 2P46B 4WGVB 1UT9A 3RY6C 2DQGL 1EFXB 4BK5A 4YBHA 4PRHA 3FRUB 3CC5B 1LGVA 3DVFA 2ENSA 2NY4B 3WIIH 1EEQA 2GK2A 4PGBB 1VESA 4G6KH 1FZKA 4XNUH 1DJSA 4HBCL 4NN7C 1D5XB 4S10A 5EZOH 3VMNA 1HH6A 1UH4A 2W65B 5DVMA 4NKIH 1BZ9A 1KTKE 1XH3A 4Z7UE 4L9LA 2CR3A 2G9HA 2NW3A 1S8DA 5LGHL 1I1CA 3F6LA 1FP5A 3L5WB 5JXAH 4EDWH 4I18A 3QI9D 4MYWB 3G08A 3U4AA 4PJEF 4WV1A 3ZE1F 1U3YA 4OCXL 5J56B 1B4RA 4ONGL 3SE9H 1MI5A 3VFGL 1U8IA 1A21A 5T1MA 2ADFH 3LKRB 4IJ3C 1UXWA 1C5CL 2FX9L 3GKZA 5EUKB 3TNNA 3QO0B 3ORJA 1FBIH 1OGAB 2H6PA 1MF2H 1TJGH 3D39D 5SX5K 2E7LC 3MRMA 1A9BB 2VZOA 3FB6B 5CSBA 3U79A 2BOBA 3I6GA 3WFHA 1Q94B 3ARVA 2W92A 5I1EL 4I5BA 1R3LA 3DJ9A 1MCLA 4PY7B 1BF2A 3D85B 5ISZA 4MJ5A 5D1ZA 4GLRH 3SDDD 3WNPA 4YIQB 3O41A 4PJXF 3EOTL 1EO8H 3MV8B 3JWOC 1YNLH 4M7ZC 4S1QL 1MCEA 2QHLA 4ZXBB 3Q6FA 1F13A 2OM5A 2QADD 4LMQI 2HH0H 3ELAT 5GSVB 2KL6A 4MNQE 1CDCA 3NPSB 1UADC 5GIRB 4P3WA 2P5WB 2Z8RA 4WWID 4U1KB 3TJHC 1GPOH 1IILE 4NT6A 4BKLA 4WEBL 1VENA 5CEYB 1UACL 1M7DB 4BELD 1F00I 2UVFA 4NC0B 4JM2A 5HYJB 4HMDA 1VGKB 1JZ5A 5FV2A 4IJ3B 5GJTH 3RL2A 2YC1A 2CLRB 1MVUA 1FLRL 4I77H 3W5MA 1CBVH 4H1LH 1I9JL 4ERSL 4GBXD 5EUOB 3E6FB 2EECA 3EIFA 4KK5C 3ARGA 1RURL 2EDLA 4AEHH 2VLKE 1P4BL 1MUJA 5E2JA 5DSCA 1TLKA 3KXFD 4TNWF 3UJIH 1A7RH 3G6DL 4NC1E 4DAGL 2J8OA 3RDTB 3IVKB 4OTXL 3B9KA 3MRJB 1UKSA 2Z9TA 4KUZL 3MNVA 2OTWB 4WUKL 5EO1B 4QRSA 1NJ9A 1JGLL 3HR5A 4QYOB 2JCCA 2YZ8A 1J05A 2BY2A 3RNQA 3C5ZC 1KJ2H 3OPZH 2E9JA 4HUKB 1I3GL 4U33A 4NHUB 4FQXA 5J6GB 3CD4A 4M7KL 2F53E 1MELA 1FN4B 3GBLA 5LKNA 5E9DE 4LRIC 4MD5B 4H8WC 1D5BA 3FZUC 4MAYD 4LPXA 1S5IH 4Q6IC 1NGPL 4GS7B 4KKCD 2ZNWA 5D1XB 2ED7A 5JNYA 2CMRH 1XGQB 5TFSH 4XPTH 4YFLI 4HPOL 4NQVA 3BZEA 5DZOA 1U8KB 4QNPF 4PLOB 1FFOA 3ULUL 4FFVC 4QOKD 1FC1A 2P8PB 4FXGA 1BPVA 1E4XI 5FYKU 3UX9B 1EV2E 3HMXH 1I1AB 3C5SB 4OAWA 4JE4B 4EKXA 3EDEA 1AO7D 1XT5A 2E7HA 3OR7B 1ZGLA 2NY1B 4X80L 3RVUC 1Y18B 1T0MA 3QUMB 4NDMA 4RWHA 1AGEB 4RX4A 4AT6B 3VI4E 1WFTA 4ZTOH 1RZFH 4K2UL 2XTJD 2GYSA 3ES6B 1KIQA 3ROLB 4D0DB 5T5NG 4FZ8L 1XZ0A 4KK6D 3NMEA 1CQYA 4KV5E 1HHKB 1OGAE 1A9EB 1IEHA 2FBJL 4X6FA 3OKYA 1UZ6E 3VFUA 2E5EA 4XPGL 2A9NL 2AQ3A 43CAA 3BIKB 4MS8C 4PG9B 1J0YA 1YMME 3L7FA 1M6OB 2LTQC 4DGIH 5H94A 1NBVH 4G42A 5ETUB 1AIFA 2WAHA 1JGDB 5F3BA 4BA8A 4X5XA 4ZAKB 4FXLA 1M4KA 2GTZB 5L6YL 2NLJB 3GMLA 6FABH 4ODVL 4CADB 2QADB 3WYRA 3S37H 3VDBA 1FFPA 2NY5L 1A14H 2R1XA 2ENYA 4W4NA 1GPOL 3HUJB 4F8QA 1BAFH 4HUUA 3MRNB 4O9HH 3OKKA 5BRZA 2VQ1A 4DFIA 4JPIA 4NYLA 3C8KB 3ZKNC 3IDMA 3TO2A 4TNWK 2HVJB 2NY3B 2PYEE 2VSDA 5H37H 4E42A 1TXKA 4GKNA 2IPUG 3U82B 5FA4A 3X3GL 3V4UH 3O2DL 5D8JH 4WO4B 1ZLWK 3V5HB 1S9VB 3TWCH 4KDTA 5EU6E 3O8XA 6FABL 4Y4FA 3WHXA 2XRAH 2OYPA 3CCHA 1QFWL 2OK0H 1MJUL 4Y8DC 3RWHB 2IH1B 2DMCA 1RZFL 4U2ZA 3VWJD 3OKLA 4KMTL 1TJGL 3RUGF 5ERWA 1EXUB 2YK1H 1JPTL 1JF6A 1LDPH 4OF7A 5CEZE 2DWEB 3RWFA 2XPGA 1F11A 4PS4H 1D9KA 2FBJH 4LSDA 4J3SA 5SV3A 3ECBA 4UV7H 1I4FA 3H9SA 3IDIB 5JR1H 1RJLB 1XF5B 4GW5B 3SOBH 2ZUXA 5EBWA 3GB7B 4JY4A 4IMLA 3TV3L 2JJVA 3P4MB 4OQ1A 4HFUH 4L4TB 4RFNC 4M8QB 1LE5A 1ONQB 1AR1C 4DWHA 4OGZA 3MV7E 4NQXB 5IHBA 5L2KB 1T3FA 1YA5A 1BQHG 3ZYIA 2UWEA 2WBKA 3E1F1 1V05A 3QFJE 3MLTA 3V2AR 4PJBA 3KXFB 4M5ZL 1VFMA 4TULH 3QQ3B 3EZJB 4X7EC 3RKDD 3OG6B 4Y4KB 1BGXH 4NKOB 5C0RH 5I30L 1XGTB 2BVOB 1OOAA 4LLAA 5C0AA 2WWMD 5D2NC 3VA2C 1VFAB 1LEIA 4HC1A 2EEBA 2YA2A 4XCCH 4CW1B 2O61B 3VXTB 3IDNA 3ARBC 3NFPA 1Z5LA 4XCNA 1S5IL 2X4TA 1RJYA 3F7YB 2CRIA 2VDLH 1HSAA 4LRIA 1PSKL 4JM2D 4CL7A 5I18H 2W1NA 4D9LH 5I0DA 2NY5C 2HLFD 4HFWA 5I8OH 1GZQB 5F7EL 5I76A 1BD2B 5GGSA 1OAYL 3MV7B 3RHWK 1OSPL 3AUVA 5JUEH 4HWBL 3MV8D 4JG0H 3ARDA 2FH6A 3QWOA 4WU5A 5DRNB 3BVNA 1RSFA 3EO9L 4PJ9A 3RTQD 4OZIE 4Q9QH 4UV4H 5T1KA 3NFNB 1NUDA 1I7TB 3VWJC 5IJKC 3CSYA 4XT1C 3LMJH 1ULVA 3OR6A 5MENA 4AQOA 5B22A 4PJDE 3MX0A 4HXAH 3WJJA 5GS1B 3FQTA 1UC6A 1TZGL 4LAQL 4OZGF 3SDAC 1XAUA 2JJSC 3HRPA 1H9VA 1FNEB 1MEXH 4P49A 4TVPE 4PJDB 4PGEA 2RHEA 3QG6A 4JCLA 4QRTB 4E41D 5IBTH 2E6JA 3C5JA 4BFBD 4JO4H 2P4AB 1FL6B 4PTTB 3O3EA 4XCYA 2D7NA 3MCKA 4IOFD 3F62A 1MOEA 4HUNB 5HY9B 2D7TL 1LQSR 4UT7L 3F58L 4ZFOB 3B5HA 3M07A 1CCZA 4NJ9L 5CZXD 2ZUYA 3F12B 1MHPH 3EO0B 3CFJA 1BJMA 1NC4A 4UV4L 2BC4A 3BXNA 2JELL 4EQ3A 2NY2C 1I1FB 2E6QA 5IOPA 4PJ5E 1B2WL 1KC5H 1MFCH 1FIGH 3O6ML 4HIJB 4MNGA 5DJDA 3SO3C 4M1CD 4XAKD 4ODXB 3PL6D 4F15B 1UH3A 3VG0L 1T1ZA 5C0JA 1CDGA 1FFNB 4POZC 5KSUB 1ZHBB 1KGCE 3LEYL 4MNHA 3THML 3DUUA 5HD8C 3JXAA 4MAUL 1MF2L 2BHYA 1MJJA 4BQ6A 3BJ91 3RVUD 2DF3A 2P8MA 2PXYA 4MJ6B 1YDPA 4JLRB 2BSRA 2GFBA 4IIQB 1JNHA 3GHEH 5EULV 4N0FB 1T5XB 2GAZB 2HP4A 5DD6A 3E2HC 3EYQC 2OZ4H 4OLVH 4U0RB 2HMIC 1HIML 5D2NE 5D1ZD 3SDDA 3CFCL 3VW3L 2VZSA 1HH9B 3KPPB 4IMKC 3H9HA 4DOHB 1NUFA 4UIKL 2JIXA 4UQ2B 4J4PD 2Y25A 1GGBL 2LAGB 4OF8A 4LPVA 3UYRH 3REVB 1T0NA 3BFOA 4NQTA 3G5YB 5DWUH 3U4EB 3E8UH 5ICYA 2IAMD 5ADOH 1CQKA 1IT9H 1D6VL 1MIMH 5BQ7B 3D39A 4NKIL 4GRWB 4LSRL 4DCQA 3H0TB 3IJHB 3WUWB 5F7LB 1EERB 2B0SL 1V5JA 1ZVHA 5T3ZD 1EAJA 2PN5A 5ACLA 3L3DA 1HXMA 3LEVL 1MI5D 1QNZL 5DEGB 3M17B 1DVFC 3KPRB 1ROWA 3S36X 3DV4A 1AD9A 3O9WC 4Y19B 1GGTA 5SWZB 1NEZA 5IQ9B 1KC5L 2H9GA 3LN5A 3PDOA 5GZNC 4JKWA 3VXMD 2A38A 1SM3L 1KPUA 3UTTE 2J4WH 2V7HA 3ZYOA 2NYYC 1B90A 1AE6H 2V17H 4HKXA 3BH9A 4HZLB 3S96B 5T1LA 3KYMA 1WT5C 5IG7A 4S0SD 4XVSL 32C2A 3EYFB 4CMMA 5F6HJ 1FNFA 4OFVA 2ZKHH 5TDPA 5C0NC 4NJAH 4V2BA 3U0PB 5CEZH 3DMMD 1FZJA 4QTHA 4PR5A 3GK8L 1NDMB 1T6WA 1BBJA 2AQ2A 1G9EA 2QEJA 4YE4L 1RUKL 4OZFH 1P1ZA 5I16B 1EO7A 1N2RB 2W91A 3QXDA 3KVQA 1TZHA 1U8PA 3GZKA 4O4YL 2EE9A 3KHQA 5CILH 3FMGL 2VDPH 5C0AD 5I1HH 3N1GC 2IJ0C 4LAQH 1ND0B 5SWQB 4XBPA 4MCYB 1KB5A 3QIUD 4KDWA 5L8JB 2G60L 3RWJB 1KB9K 1SMAA 3VXUE 3G6AA 3FN3A 3O3UN 4DKFH 3G04A 1FO0B 3IYLW 1YY9D 2R2CA 4Q9BA 1Q9WA 5JDSA 1CZ8L 2EIBA 1AGDB 1NCCH 1A7NH 1KBGH 3Q6GH 2W9EH 3U7AA 1S9KC 1HE7A 4YHMH 3SDXA 1IAKA 3O81A 4OLUL 2PW1A 4O5LH 4JO3H 2HG5A 2X40A 3I84A 1NLDH 5EIIA 5CMAA 4YXLL 4BQ9A 4TPRH 3TH3T 3D25B 3EZ8A 4XPGH 1IRAY 3PQYE 2VWEC 1IM3B 2X4NB 5KVGH 2F53B 4L4JA 1N5YH 2ICEB 1JZ8A 3GMQA 1TVHB 4KROB 6CGTA 4N0UA 4Z7OE 1NBYA 2AJZB 1A6WH 1EFQA 2LABA 3QUKB 4RMUA 5IVXB 4UDUA 4HAGA 3H9SD 4HWBH 1CGVA 2O5ZL 2R56L 1UJ3A 1BLNA 2NY0C 1JPSH 1EGJH 2ADIB 5C09A 4XX1G 1JNNL 3MGTB 5C6TH 3UXFA 1DQDH 8FABB 4Y5VB 5GRUH 4YXKL 4WW2C 3VFTA 4DN4L 5ITFA 5L7XL 2VMFA 1DBKH 4IRSB 4K3EL 1JL8A 5C71A 35C8L 5AZEL 5B4MC 1TMCB 3DV6B 4WUUA 3GSNL 4OZGA 2ERJB 3ULUC 2EYRA 4F7TB 4CVXA 4QTIH 1A7PH 1YEFL 1G6RA 1RIHL 3VU2A 3RVWD 4NKQB 1PZ5A 3U2SA 3BH8A 3IFPB 3QXVA 1P5VA 4XPBH 5CZVH 1IEBB 4LCCC 2OBGA 2W60A 3LV3B 1CGSH 4P4KA 2Y5TA 2AEQL 4CU8A 3CFDA 1IQDB 4Z76A 4DK6A 1N0XH 5C09E 2V5RA 2QSCL 4LLVB 1CIUA 3ABZA 5BRZD 2KKQA 3VFPA 5F7UA 2WBJD 4ZS7H 3KG5A 4M62L 2R39A 4NNXB 1Z9MA 3PIQB 1RZIB 1FORL 3DSFH 2Z91A 3EYVA 3QRGL 3QJFB 4X6DE 1DBKL 4FABL 1A22B 5FYKL 4GT7A 3ARWA 1IBGL 3KJ6H 5DJ6A 3UTPD 2I9TA 1GL4B 3LRGA 4DAGH 1CLZL 3SJVD 1OCWH 5F71A 1HCFX 3QHZL 4IRZH 3RRQA 4P4KD 2FEEL 5IR1A 1KLGB 2AJUH 2EEDA 1HZHL 4PRPE 3T0EB 4TYUA 2Z0BA 5D5MF 5IFHL 3QUYB 2X4UA 3BUYB 3T2NH 3PNWB 5C9KA 4JRYD 1U9KA 1QFUH 4LHUB 1JJUA 1L7TH 5HHMB 2DYPB 2VLJB 4YDVB 1BP3B 1QSFD 4JKKA 3BZ4B 4PRDA 1J18A 4GQ9L 2Q87A 1VDGA 3VG9C 4QRRB 1U95B 3LKQA 4BZ1H 3GM8A 1UCTA 1OP5K 5C08A 4CDGC 3O45B 4JANB 1GC1H 2F15A 3MRPA 3WSQL 4K3GA 1A4KB 5MP6L 4M1DL 3RX5A 1K5NB 3GIZH 4NQCE 3CSPA 3WIFB 5T3ZL 1UZ8A 4LPTA 1JGUH 4P2OA 4WTZA 2P5WD 2D03H 2NY1C 4OLXH 5A1AA 4BH7A 4S1QH 3QQ9C 2WV3A 3PWLB 5DVLA 1JMXA 1R3KB 4Y7MA 4X7CC 4N9GB 4OIAA 1QQDA 2P44B 1FAIH 3DGCR 4FQXD 5F7DB 1AGCA 1JFQH 4LPYA 4U1JB 3QDJD 3KLHC 1T0PB 3T4AB 4M4PA 2F19L 1YNKH 1A8JH 2DQUL 3BO8A 4FFYH 4EUPB 4U31A 2X4QA 4F80A 3P73B 2EYTB 4JPWH 1TZIB 2OMBA 1SMOA 2VXSH 3LRSA 2GCYB 3HE7C 3X17A 1FVEA 1KTDB 4KJYB 4XP6L 5E00A 3FFDA 5ID1A 3QDME 4OZ4A 4MA1B 3BP7B 1EDQA 1YQ2A 3RVTD 4JFDD 4NQSA 4K9EL 3QFJB 4KI5D 5KSBA 1TJIL 3DURA 3H9ZA 2XN9D 2XXCB 1E4XL 5ENWA 5TH2A 5DVKA 5JHDE 4AL8H 5D1XD 2DTMH 4L4VA 4OCRH 1BQHB 4ZSOE 2HAZA 3SDCC 3CZFA 3FONA 5DXWA 4PLKC 5T1DH 3RGVA 5AWNL 2AXJA 1FO0H 1WIPA 4I0CC 4PTUB 3IJSA 1DUZA 4JREC 4JKLA 3ARFB 3NN8A 4XBEL 1MPAL 1AJ7L 3QQ4A 5I66B 3MOAL 1NDGB 1RULH 3MLWH 5T33H 3W9EA 1FIGL 1J1XL 3O6MH 1DQJB 1A6ZB 4XBGA 4PJEB 5D71L 2JELH 3MLRH 4YDLB 5ISZD 4ZUTA 5KG9A 1QG3A 1QLRA 4UDTB 1UB6A 2YRZA 5EWIH 4PRNA 3QEUA 2Q7YA 4WDIB 4PREB 5TPWH 3T0ED 5K59F 5FGCB 1QFWI 1IGML 5IIEB 1MRDH 3SCMC 4JRYB 1AHWA 1T04A 4J3OC 3VRJB 5JW3L 1YPZB 5TE4L 2M26A 1QRNE 3DXAE 4JRXA 1WQVT 2H26B 1F90H 1TPXC 4G6AD 5D96B 4YZFE 2ICCA 4Y19E 5SWZE 1VGEH 4C56E 1NCCL 3WO4B 1JNLH 1MVFA 4KHXL 5LAXA 4DGYH 1JPFB 2R23B 1HQ4B 4M9OA 3Q48A 5JHLL 1PVHA 4P3DA 1UACH 2MQ3A 1S7QB 5FK9A 3FT2B 3VXSA 1F5WA 2VDPL 5I1CL 4KKBD 4UTBH 5EFIB 1VGEL 2OQJA 1ES0B 2OJZH 3CU7A 5DA0B 5FHAL 3WXWH 2HWZL 4PJFA 2Q8BH 4X4MA 1N5AB 3OHXB 3LKNB 5IW6B 5DUPL 2I5YL 3IFOB 3H8NA 4F58H 3PWPD 2CDEB 1K2DA 2NX5A 1OTTD 3VFSB 1HDMB 3VXRA 2HLAA 1S9YA 2RJMA 5TPWL 4M7LH 3FQXA 4R7DA 3I2CH 2W0PA 2IH3A 1S7XB 1V7ML 1JWSB 1A1OB 1Q1JH 4P2RA 4YPGB 1KCRL 4JM4L 2VDNL 4DK3A 1A6TA 5C7XL 2J4WL 2NW2A 4PB9L 4QRPA 5BOZG 3QHFH 4MMXC 2CRYA 2DWDA 1A1NA 4PBXA 5T33L 2APWA 4PG2A 3QNYB 4FQLH 3RWEA 5C6WH 2CXKA 1XF4B 1E4WH 1P4LA 4DFHA 2X44D 2BSTA 3BWAA 2A6DA 4Z0BH 4LRNL 1CVRA 2C1OA 4U1SB 5I30H 4QNPE 1YUHB 2UUDH 3MLSL 2ZUQC 4XNXH 2IAND 3VA6A 1C1EH 4MD0A 1C7TA 2X9YA 5MEOB 5CWSA 5C08D 1ZHLB 3PWJB 1SY6H 4RGND 1PYWA 3RP1A 4WI9A 2R0WL 3MRLA 3JTTB 4RDQG 1S7WA 1OWRM 2GTWA 3VRIA 4MJ4A 1ZWIB 3V6ZA 4MJIB 1P7QA 4XVJL 1PJ9A 5JW4M 1B0GB 1E4XH 2NY6C 2WSKA 2I07B 3DX7B 2EKSB 1JHTA 3KYKL 3MNWB 5KS9A 3D48R 2MPAH 1MCDA 4MA8L 3B43A 5LXGH 1FSKC 2DL9A 2R2EB 3FB5B 1SVZA 2DDQL 3MREA 4LKXA 1G0XA 4Z7VF 5FKAA 2DJUA 3D18A 2H3NA 4Z7UB 4JAMA 4LU5H 1N8ZA 3FCTB 4YBQD 5HGAA 1ZLVK 3PF2A 4QXGH 4X98A 5ACMA 3CVHL 2OSLA 3X3FL 1Y6MR 5D7LA 5T3XL 1VSCA 4UB0H 3BKYL 5D7KD 1D6EA 2GSGB 3T0XA 1OD7A 2DQIL 1IZJA 4X99A 2DICA 1FAIL 5F7NC 4POYA 1EJ6A 2DM7A 1I8KA 3UTSD 4M5YH 5HYSA 3SGKC 5F9WC 3O2DH 1CXEA 3STLA 3SBWA 4LQFL 3STZA 1KG0B 1F4WH 4ZSOA 1PDKA 4PLNC 1AXTH 1JTTA 5KS9E 3IDGB 5C9JB 1AP2B 2OL3H 2MCG1 3UJTH 1OF2B 4Z18A 4GAYB 4PJDF 1VADB 4BFEA 4Z9KB 1EZVY 4K55A 5JXED 3ULVF 4LVNB 3S98A 1EEYA 3IFLL 5A16A 4APQD 1ZS8A 5H2BA 4XGZA 4WUUD 5HGBB 3UTQB 5C0FA 2X2YA 2AV7A 3TIDB 1LDSA 4LCYA 2C3VB 3FT4B 3VXUB 3JWDH 3BPNC 1T2QL 3KHOA 2NZ9D 3RAJH 3PGDA 1NAKL 3C5ZA 1RZKL 1AFVL 4S1SH 5KVFL 4PJXE 1OD9A 3VWJA 3SCMD 5TQ0H 1MRCH 3NCJH 1WFNA 2VXUH 2WM0A 4OKDA 3Q5TA 5F88B 1U3HC 3B8YA 1GXEA 3CVHB 2ICWB 5JDJA 2ICWJ 3PWPB 5C0EA 1OAXL 3LEXB 2OL3A 4LSSL 4Y2DA 1HZHH 5CJ8A 4K2UH 3QA3B 4X9GA 2BXZA 4V1DD 5JPNB 1EEUA 4TNVK 5FYJH 3WFBL 1Q0XH 5D96C 1XGUA 4XTRC 1TTUA 3VFWA 5A2KH 3OKEB 5GGQH 4Y5YB 5HGHB 2AEWA 4E0RA 1IE5A 1CWVA 4WFHD 4U1LB 3BPNB 4LQ1A 3IRPX 1JPGA 5D6DC 3T1WA 1J0HA 3O6LH 1PX4A 5FKPA 2DQDL 4WW2B 5ID0A 3JWOH 4NRXA 5DF0A 1Q72H 4RDQF 2VZ3A 4WTWA 3HZVB 3VMOA 3MFFA 2EIZB 4Z7VE 2ZCHH 3U46A 3ROOB 4AIZB 2P5EA 4G7VH 2FLRT 3BZFA 4HGMA 2AV1A 5B39A 1DEDA 3DPBA 3OJ2C 3VXSE 3MUGA 3ZTNH 1AJ7H 4LLMA 1BFVL 2BVTA 1MCOH 4BFIB 4HPOH 4NN6B 3WN5A 2B8OT 3EUUA 1I8IB 1WZLA 5DRZA 2IAMB 3IXTA 3X12A 1IGYA 2OX5A 1W8NA 4GBXA 4L8SB 2EDDA 1KJ2L 5DS8A 1CI5A 1NH6A 4HK3N 4JB9H 5CSZA 3STBA 1GHFL 4HUXA 3UTTA 2W0FA 4RQQA 3S34L 3MYJA 2YUZA 2VZVA 4LKCB 1F45A 3HNTH 4E5XB 1CFBA 2IPUK 3ISWA 3P77B 5C6TL 2PETA 3KPRD 3ARYA 3VFRA 5HGGS 2BNQD 4KPHH 5IB2B 1MJ8H 4XPAH 3T0AA 3FQRB 2IADA 3QEQA 2D9QB 3IXAB 4LEOA 5CJ5A 2JCCE 1QSEE 1NLDL 4LCUB 5IB2A 5I8CA 2C9AA 5E8OB 3NIGF 4KMTH 4RMVA 5AG9A 2HJKA 2ARJQ 4L4VE 1K9TA 2QSVA 4LEXH 4XRCB 1AY1H 1UH2A 3CMOH 3DMMB 4ONOA 1X4ZA 1RURH 2OR9H 3OJDB 4LARH 4JY5H 3K4AA 3MYJB 4P23B 1JFQL 1PBYA 1W72B 5AYUH 4HUXB 5I1HL 5CSZB 3PABA 1CVSC 4P2QB 2YXFA 2R8SH 1U91B 4PY8J 2CKBA 4G80B 5DD3H 1NL0H 4GBXB 3OKOA 3VXPA 4OLWL 1JF1A 1KUMA 2IAMA 3X12B 5E4EC 5T3XE 1Q9KB 1YZZA 1JRHI 2HT2D 4LLMB 4NN5B 5IP4A 2IGFH 1UA6H 4N9OB 5B39B 3EYUL 1WT5A 3IDUA 2B4CH 2AV1B 3AMLA 5EZJA 5F89B 4NJAL 4X6CB 1YN6B 4G8FB 1TIUA 5C07E 4J3VA 2EIZA 1IEAA 4L5FL 1EHNA 5GJSH 4GKOA 3D2UB 1N6UA 4HJ0D 5D4QA 1OAQH 3CJJA 4D0BB 2CIIA 3S8WA 5EBMB 1CT8B 5D1QB 1KPVA 1UJTA 5FKPB 3ZTJH 5LVEA 1JPGB 3MJ6A 1CG9A 5F96L 5EOTB 4MQ7B 1JWUA 4X4XA 1C12A 4Y4HD 2CIKA 2A1WL 5ESVA 5LBSL 3UROR 1AQKH 2F5AL 2ADFL 4H25B 3VFWB 2PW2B 5BS0E 3KYOB 4OV6F 1YJDL 4XVJH 5CINL 4WNQA 2EIEA 4I3SH 1A64A 2BJML 5EU3A 3B8SA 1ZMYA 4RGNB 1W72L 3QA3A 3HCVB 1FBIL 3GSVA 2R0WH 2V2XA 3LEXA 4P57A 5DD1H 4YHKL 1XF3A 1C16A 1HHHB 3LKPA 5F6HI 1T2XA 3CVHA 1J10A 2CD0A 3UPCA 5GGRA 5I73B 3FFCE 2OXHA 5F88A 4EIZC 5FYKH 2CDGA 2N4IA 5CD3A 4NQDB 2NR6C 4RZCA 3PGDB 5IMMA 4G9DA 4MJ2A 4GRLD 2XT1B 3NTCH 1AO7B 1VFOA 1S7RB 2IF7A 3Q3GA 2HFTA 4HWEL 4ZFFB 3R0MA 5C0FB 1S5HA 2YUXA 4P3CL 4XGZB 4YDJA 2A83B 4ETYA 2BY1A 4AM0A 2VAAA 4U7KA 1FCGA 4GG6B 2J6EL 1V3LA 4P2OD 4PJ9D 4XNUL 5DC4B 1T22B 3U4BL 2WWKO 5ECJE 4NCC2 4C58B 4FRWA 2FDBP 5C9JA 2NY0D 1UVQB 2XZAH 3GSWA 1P2CB 1A7PL 1YEFH 5IW1B 3SDAA 1S7SB 1VACB 3PHQB 4U05A 4ZSOB 1Z9SA 1UWXK 2JJSA 4WI8A 1GIGH 3STZB 1NGYA 3Q5YA 2FO1A 2GT9A 1NGYB 1X3DA 2PO6D 5GRYA 2LU4A 5T5NF 5GZND 4C56B 4X99B 4OZFB 5IW1A 1P2CA 3GSWB 4PYGA 3SDAB 2AS5M 1UVQA 2FGWH 2GSGA 5C7XH 1DN0A 5EA0L 1T22A 5D7LB 2NXZC 2RQ8A 3F5WA 4PJAE 1JZ3A 5HPMB 4Z7QF 7FABH 3RPIB 1N8ZB 4GW4A 2BNQA 3IF1B 3KLAA 5AZ2L 3R06A 5FUZL 1HNGA 4AM0B 3MV01 3B9VA 3D18B 3TT1L 5CP7B 5E8DH 3QDAA 3UZVB 4ZPTB 2R2EA 4X7SL 4OM1L 1N5YL 1S7RA 2GY7B 1MQKH 1UXSA 1OP9A 5DHVH 1EUUA 4RZCB 5IMMB 4TPRL 2YPVL 1JHTB 5E6IB 4J4PC 4WO4D 2CDGB 2G5BB 1HEZA 4GXVL 3OF6D 4P2RE 1UYWL 1P7QB 1GOHA 3KR3H 5D5MB 1OWWA 1JI1A 4I1NB 1C16B 2HMID 3JTTA 4Y4HC 5HVFB 1SBSL 1ZLVH 2V2XB 3J7HA 1R6VA 3MCG1 1CFVL 2NX5E 2ZJSH 3OMZA 1W0YT 2APVA 1Y6KR 3LMJL 3TZVB 1JN6A 1YUHA 3WD5L 2QV2A 4I9WD 4H25A 2C1OB 4U1SA 3O4LE 1N3NA 3ME0A 2HFGL 4F9PC 3BWAB 1BQSA 1K4DB 3KNBA 4XPHL 4IRJC 5DQJA 4MQ7A 5K9JH 1CG9B 1MQKL 4UI2A 3RWEB 3EJYC 1MRDL 5DHVA 4M43L 2IALB 5H8DA 5EBMA 2DQHH 1EVUA 3D2UA 2YD5A 4KQ4L 4P5TC 4L8BB 1NSNL 3V4PL 4OLEA 2M1KA 4P2RB 4JFYA 3BDXA 4G8FA 4LASL 4RFNB 5F89A 5I71C 2UUDK 3CPLA 5B3JE 4J3WA 1M71B 3EJYD 4CGTA 5GGVY 5GGSY 1ERNA 4NOBA 2HLAB 4IRJD 3MZGB 4EUPH 1N6VA 1Q9KA 1I3VA 2E6PA 2VDML 3IFOA 4KTDL 3OHXA 4C83B 5FYJU 3O9WB 5IMKA 1DSFH 1MY5A 3OKDB 2ZCLH 3UZQA 5C0RL 2FJFA 5C2UB 1ES0A 3OKNA 3QT2A 3TH2T 4WEMB 3QUYC 1IT9L 2D7PA 1S7QA 4JRXE 4P3DB 1SJVA 2DD8L 4JN1L 4JZJC 3HE7A 1RK1B 4JEGB 2R23A 4OCWH 5E8OA 5KZCD 4WO4C 1SQ2N 5LAXB 4LCUA 1KIPA 1KJVB 1HKLH 2DAVA 5BZWB 2MCPL 1JI2A 3SKOB 5DQ9B 3IXAA 3D9AH 3L6FB 5F8QC 1LK2B 3FQRA 3WNNA 1KCVL 1T04B 2H1PL 3VRJA 5J1SC 3OF6A 3KPQA 5A2JH 2VISA 3ZKXB 4A6YB 3OG4B 1N59A 1C5BL 1QKZH 1I9RH 1UM5H 3VFRB 1DQTA 4H20H 4PREA 3LN4A 4AQ1B 1I8LA 1CR9L 1V3KA 3EFDL 5I1JH 4E5XA 4KRPC 4L5FH 4LKCA 4P59L 5C0BB 3RGVC 4ZOCA 1GAFH 1WJ3A 4UDTA 1QFWH 2W0FB 4RQQB 3UTTB 2MMXA 3BD4A 3TVMD 5INDB 5JW4N 4HWUA 4LCCB 3VXOB 2ICWI 2LTQB 5DGQA 2YOCA 1HYSC 2CKBL 4LNVA 1IGYB 3S35X 5JW4Q 1WWWX 3C60B 2AK1L 2LU7A 4LGRB 2ORBH 5KAQG 5J1AA 2DQCL 3ARGC 2Z93B 1QP1A 4M6OH 3ARFA 2J8UA 4Z8FH 1XEDA 4EI5B 4CBPA 4X5WA 3FAXA 5HDBE 2Z8VC 2P5EB 3ROOA 2D0GA 1HKFA 4ZNCD 3HZVA 4K7FB 3RGVB 4M6MH 5DZNA 3D2UD 3T2QA 3HC3L 2WUBL 2P49B 3CZFB 2FIRT 4UT9L 4NRXB 5F93C 4L4VB 2NCMA 4WW2A 4AEIL 5HYFA 2VUYA 4JFHE 3S4SA 2QTEA 3QHZH 5DD0L 5KSBB 4O58H 4NQSB 5CGMA 5HGHA 3DI3B 2AK4E 2DQFB 2R8SL 1H3GA 4PLKD 3BP7A 3RQ3A 3WNLA 1XGUB 4FQXC 5TGBB 5I19L 2ZCKL 3UC0H 4ZFOL 2JE8A 2OR8A 5JPNA 4X6BA 3U6RB 3ULVD 2BVQB 3Q1SL 1IC7H 2MJWA 1GGIH 3BEVA 4OCWL 3HPLA 3C9NA 2ICWA 3B9KD 1TNNA 3V79C 2EIDA 3VWJB 2UWEF 2XKUA 3T4AA 2BP3A 1N26A 5EH1A 3FTGA 3I50L 3P0VH 1AGCB 5I6XB 2VLMD 3PL6A 2C3VA 3FT4A 1MCIA 3VXUA 1JTPA 1YEJH 2AV7B 3TIDA 2WIIA 2XY2A 5HHPA 3WEXB 2PKDA 3DYOA 1R3KA 5D1QC 2FJGB 3ULUH 5HHOA 3JSSA 3QIBD 1QFPA 5FUCC 1IQWH 2CQVA 3OV6A 3WIHA 4P2OB 4S0TD 5J3HC 2X89D 3PWVA 5BS0B 3WIFA 4GAYA 3BPOC 3P9LB 4PP1C 5IB1A 4A6YH 4KKAC 3GIVA 1K5NA 4MJID 1BVLB 4JGUA 4L3EE 3IDGA 4R3SB 1YNTA 1DANT 1DZBA 5TF0A 2YUWA 4UILH 1HSBA 1A6PA 4Q0XH 5HYSB 5C08B 1I8KB 3LKQB 4QRRA 1CIDA 1CFNB 3VXMB 5D2NB 2EE6A 1S7TB 35C8H 2VLJA 1ACYH 1R0AL 1NANI 5D6CB 1F8TH 4LHUA 1RZ7H 4FQHB 2DM3A 2OSLB 4XCFL 2XV6B 5DHYA 5HGAB 3BUYA 3FCTA 3OXSA 1G7MA 4JAMB 4Z7UA 5DC0A 4P2QE 5FKAB 1MFEH 1G1YA 2LAAA 5IR1B 2VUOA 2FWOB 1U8NA 5KAQF 5CJOL 4R4BA 4OV5B 1K85A 1AR2A 3EHBD 2CJUH 4XI5D 3DBXA 4L3EB 1CN4A 2I9TB 4PRPB 1Y0LA 4MHHI 3DX7A 3CSGA 2VZUA 3MLVL 4JVUA 4DTGL 3ZSSA 1EMTL 4GXVH 4RRPA 4EN3C 1ZTXL 1ZWIA 3FB8B 2IQ9H 3EYVB 1LO3H 5I1LA 5AAWA 1KCSH 3RU8H 4YHML 5HYQA 1HWGB 5IWLC 4R90H 5SWSD 3ARDD 2VLJE 2P45B 4KDTC 4OI8A 4XWOD 1PYWB 4NBXB 3TJEL 4OKVB 1TVDA 4YAQA 5CWSB 5GRWA 5BW7A 4LLVA 5ANME 3V8OA 3X13A 4MD0B 4Z76B 3CFDB 1YPZF 4F33B 1G7IB 2IEPA 4PJXB 5GGRY 2A6DB 5CILL 2A77H 2BSTB 5ADPL 4LCWD 1XF4A 1PZ5B 1BBDH 3TBWA 4KVCL 1KB9J 3QNYA 4RMWA 3O4OC 4X4ZA 4F7TA 3QDGE 2XA8H 1RPQA 1G7JA 1Q9LA 1JZ2A 2D7OA 5FCUH 2WIMA 1QNZH 5ITFB 1JWSA 1OQOA 3M1BB 1IKFH 2DB8A 3FQXB 3NOIA 1FDLH 2YKLH 5MI0B 3MGTA 4LIQH 3RNKA 1S9YB 4LSRH 5MHSD 4IRSD 3VFSA 4B7IA 4WTXA 1K2DB 2XWTB 2Y9RT 1NMCC 4UDUB 2EDFA 3IAGC 1P4IH 3SGJC 2AJZA 1N5AA 2H1PH 4TSCL 4N0UB 2DMKA 4HH8A 2IG2L 5BO1L 3CSBA 2ICEA 1LO5A 1MRFL 1Q0YH 5I8EB 1U8OB 4PUBL 2OQJB 2YA0A 4UIKH 5EFIA 3D25A 4ONGH 2ITDB 2HG5B 3SE4C 3HI1A 2PW1B 4Y89A 4LNRA 3SDXB 5DK0A 3FT2A 4HD9A 5FK9B 3VXSB 4JQVC 1GGCH 3IT8D 2X1OA 4R26L 5J57B 4Z7VA 3G04B 2ESVE 3QIBB 5A2IH 5ACZB 2BDNL 3RWJA 2E27L 4MWFA 4MCYA 3QJHB 4XBPB 5FGCE 3KYKH 2C3GA 4KAQH 5E99L 1HINH 3BE1L 1WISA 2FATL 4PRID 2NXYD 1MCQA 3LY6A 4LHQB 5E5MB 1TZHB 4U3CA 2G5RA 1OP5H 1N2RA 3TPKA 4JRYA 1FCCA 5IIEA 3MBXH 3CFCH 1P9MC 3VW3H 2VTFA 2DQGH 3O3BB 3BGFB 2JB6A 4JFZL 1CFSA 4PJIA 5FO8B 3CU1A 4HW6A 1KFAH 3QEUB 3TIEA 4LVNC 1A7OL 4PRNB 4YDKH 1TETH 5KVDL 3E6HA 1ZA3B 3GI8H 4Z5RB 1QLRB 1F6FB 1Z2KA 3V6FB 2KBGA 1JRHL 1JE6A 3V4PH 1HHJB 4MAUH 2CDFB 1CD8A 4CMMB 3U7YL 3EYFA 2JTDA 32C2B 2Q8AL 4NQEB 4W70A 4XBGB 5T1LB 1DQJA 3BH9B 4HZLA 4NN5C 3S96A 4HKXB 3CFKA 1U93B 2V7HB 1OT1A 4YC2C 1K8DB 1CFQA 3OB8A 5E4EB 3ARBD 3BHBA 12E8H 1P53A 1DUZB 4PTUA 3LQZB 4M93B 2P5ED 5DEGA 1HXMB 5CS7A 1MEXL 3L3DB 1B9ZA 2VABA 3MNZB 4P23C 1T66D 3BKML 4OQTL 2WNGA 5HHOE 4I0PC 3FONB 3QEGH 4N8CL 1BQHA 3WUWA 3UBXG 1KEGH 2EICA 5ENWB 4EJ1C 2YN5A 4YHNA 4KTYA 1MHHB 1BIHA 3U4EA 5KS9F 3G5YA 2X09A 1D9KD 1T0NB 4XHJD 1INDH 3P9WB 2JIXB 4UQ2A 4POZD 4HLJA 1EA9C 4NZJA 4MB3A 1J0KA 5ID1B 3FFDB 1HH9A 3KPPA 1ADQA 4YNYA 1KEGL 1T7YA 2OXGA 4LDOB 5EOCJ 5DD6B 2RR3A 1JNHB 4JG1L 3BSZL 2P8MB 2PXYC 1JNLL 3ILPB 5KANI 1MJJB 5C0CA 3S34H 4KQ3H 3AM8C 4WGWB 1T1ZB 5C0JB 1BOGA 4N9GA 3CX5K 3N0PB 4HSQA 2MTPA 5FIEA 5JXEA 1A0QH 1T80A 2XI9A 2UVEA 4P9HH 3GBNH 2MSPA 3C6SA 2Q3AA 1X6NA 5F7EH 1UZ8B 2VR9A 1JRHH 3EJZC 2ARWA 4TULL 5DYOA 3FL7A 3MUJA 5T1DL 1ZKAA 2NY7L 4KHTL 5KSAB 1A4KA 1G7QB 5BV7H 4XP1L 5HI3C 2R4SH 4PTTA 5EOCH 4S1DD 1RIVL 4PRDB 3BZ4A 1IL1B 5KSBF 3TFKC 3VFNB 4YDVA 2ZG2A 5E99H 3L3HB 2QKIA 3U0WL 2WBJC 1NMBL 2XZCL 5BO1H 3PNWA 2EH8H 3PGFH 2X4UB 3DX8A 4OLZL 3FQTB 4OCYH 1FE8H 3AY4C 4KFZC 3K46A 3JUYA 2L7UA 1GGIL 1IC7L 3OR6B 4J8RA 1MJUH 5DC9B 2VJXA 1FFQA 4PUBH 1QTYT 2R4RL 3S37X 3MLXL 4JQIL 2EDYA 2FEDC 5T1KB 1SEBA 3WJLC 2EDEA 3OGCB 2E8YA 3BVNB 4YHYB 3QJFA 5DRNA 3UYOD 1HI6A 2B5IB 3NAAH 2VC2L 4NNXA 5IM7A 3MV7A 2FZ3A 1BD2A 3EYOA 2IBZY 5BVJB 4HEME 1IQDA 5LJYH 1KTRL 2OP4L 3H2WA 4KK9C 2Y5TB 3QSKB 1IARB 2DQUH 5FYLH 3LV3A 4LIQE 4Y1AD 1CL7I 4Y2DC 4OGAD 1FNSL 2GK0B 4HS8L 3C2SA 4UT6L 4LVHB 1AXSB 3BH8B 3IFPA 3U2SB 3NFPB 1CD1B 3MLYH 3IDNB 1G6RB 4M1GH 1S3KL 4WFFD 2EYRB 4F7MA 3ZDZF 4OZGB 3JBG7 1LO3L 1VFAA 2AK1H 4IRSA 4GG8B 5IBUB 1RK0B 5FGSA 4IHOB 1SBBA 5I1DA 3KXFA 5C2BH 3MJ9A 5HHXH 5IHLB 3L7EB 1UFUA 1NFIA 2Y1VA 3TYFA 2ED9A 3WL9B 3TA3D 4RFEB 4LLUB 3OAZK 2BY3A 1T3FB 2ADIA 1UJ3B 5K9OB 3SHSA 2CO6B 1ONQA 2XIDA 5HDQL 4OFIA 3BIAX 3P4OA 1HQRB 1NBYB 3HAEB 3W0WD 1UM5L 3P4MA 1NEUA 1BECA 3ZHLA 3GMQB 3GB7A 2F53A 5HYJE 1FIEA 1IM3A 2X4NA 3GJEB 2MPAL 4ZQKA 4K23L 2VRAA 4HS3B 4MQXC 5F1NA 3W39A 1IGFL 3DVGA 3KPOB 2H2SC 3OSKA 1CLOL 4GBXC 1F11B 3RWFB 2DWEA 5JDSB 1Q9WB 1X5KA 3FO9B 1FO0A 2Y07H 4BK4A 5ERWB 4I4WA 2QLVB 2B2XL 5GS2H 3MGAA 4GMSH 1IAIH 1S78D 5B8CC 3W11D 3RWHA 4RWYH 3RL1A 5SWQA 1MAJA 1ND0A 1FGNL 2IQAB 3BRDA 2ZUQB 1NC4D 3DMMC 3OTTA 1SEQL 3O8XB 1URLA 4KK8C 1U8PB 5IQ7L 4QXWA 2VXTH 4TSAH 2HJLA 1U8MA 1E4KA 4OUUB 3O6FA 1WBZB 3DSFL 1J8HE 4X6EA 3GUTA 3JV6A 3OQ3B 4LOUC 1BBJB 3SKJH 4NHCH 4QTHB 5JXEC 1KEMH 4XPTL 5F97E 5I9QC 1LEKB 3NCEB 4NYLB 2VQ1B 1JZ4A 5K33A 3O9WD 5GZOD 3MMEA 5M94B 5GS0L 5ALCH 3IS1X 1Z0MA 1TVBB 4XPBL 5CZVL 1PKOA 1RD6A 1AGBA 2R0KH 4Q9RH 4G8GD 1AC0A 3NCYS 1AIFB 3LN5B 3CK0H 4Y19A 5SWZA 2FNBA 3BIKA 4PG9A 1QFOA 1UM6L 5IBUG 5C0ND 1T03L 3RUGE 3B5GA 5MEQB 1T1XB 4JFED 2L0DA 5GHWL 1A9EA 5EIQA 3B83A 5KSAC 5GJTL 4HIIB 3QUZA 4HKZA 4DCQB 1DDHB 5AD0A 3K4ZA 4WI5A 5BQ7A 5FM5M 4JZJA 2A2QT 3UC0L 1IZKA 5INCA 5ICYB 3QUMA 3AS2A 1D5IL 4NFCA 5CJBA 3LS5L 5IV2A 2YXMA 5EORL 3ESVF 3G5ZA 2QQKH 5HHNB 4G9FE 1SJEA 4K7PY 5FYLD 5MEPB 1MWAA 3AU1B 1EX0A 4QHLB 3W2DH 3Q6GL 2F54D 4OI7A 1K3IA 1T5XA 1REIA 4N8PA 4QXUH 3WKNA 4M6ML 3BZEB 5D7IF 2UY7A 1KT2A 1NKOA 3VFVA 2HKHH 3HFMH 4MDJB 4BUGA 5DT1L 1WVZA 2AEIT 1UQSA 3PV6A 1ZT1A 2CR6A 1FN4A 1G1CA 3ULUD 4GAGH 5JORB 3DX9A 2VAJA 2YPKB 4MNGB 5DJDB 1VEMA 2V2TB 2VXQH 5J6GA 3C2AH 4QRPE 5EDXA 4NHUA 4XP9L 5KOVC 1AI1L 3CXDH 3EYQD 2DQIH 1QKZL 5CKAA 3SDXE 1N0LA 3OGOE 2QHRH 3DTXB 2YPLD 3JV4B 4GOSA 4B50A 2BC4B 2J8HA 5LCVH 1E28B 2JCCB 4RNRA 4QRSB 3CFJB 2OTWA 3HLAA 3F12A 1LVEA 3MRJA 2BNRD 3B9KB 1DL7L 4R0LC 2Q6WA 1EO5A 4ONHA 2VLRE 4Z78A 3LPFA 4MD4A 2J8UF 5AWNH 4NZRL 3C5ZD 4XCYB 3MJ8B 3O3EB 5GZOC 5AUMA 2JF1A 5LXGL 1MLCA 1W8OA 1KCVH 2NY4D 1T5WB 3TJHD 5DJXB 2BNRA 3D9AL 3BUTA 1KIUA 4POUB 3I02A 3LRHA 5GS0D 1G9NH 5GRVL 4ACPA 3BX7C 2VL4A 2DD8H 4JN1H 5E2UL 3RL2B 3QIUC 5HYJA 2E27H 3CFBB 4LLDB 2DQJH 5LGHH 1M7DA 2FEEI 1MCKA 2VH5H 3SJVA 3E8UL 2AJXL 4M00A 4LRNH 3THMH 1UEMA 4P5KA 2IFFH 1JWMB 2BVEA 5L9DL 3NFNA 1UWXH 2J88L 4XVUD 3WFEH 5D7LE 3RY6A 5GSVA 4QRRE 1TQBC 4TSCH 2F74A 4MVBD 1PW3A 1ZHNB 2UYLB 4KUCD 3TCLB 3BKJH 5D1ZB 5F6IC 5I1KH 4AYFA 3D85A 1GYAA 4X6DB 3B2UD 1R3LB 3UTSA 1V7MH 4HFWB 4R4FL 2D03L 3B4NA 1F3JA 2HFGH 2N7BA 3WFHB 4JHZA 2EDKA 5IHUH 3RVXC 4Z7NF 3FB6A 3BSZH 1RJYB 3F7YA 4I18C 3HNSL 2X4TB 4ODTL 1L7IL 2IPKB 3TA3C 3H3PH 1HHGB 1OGAA 2H6PB 2O61A 2DLEA 1SHMA 2GITB 2ZOLB 1AI1H 5JOFA 5F9DC 1CF8L 5EUKA 3S36L 2H32B 1AR1D 1UXWB 4IRJA 4RIRA 4Y4KA 3LQAH 1MI5B 1DVFB 3QQ3A 3KPNA 3PHOB 1RAMA 3CFEA 3DROB 3QCTL 1RHFA 4P2YA 4RISH 2E7LA 4HPYH 3G08B 5MI0C 4OCSL 5IEKA 2UWEB 3TH4T 4YDIL 2ATKA 1XF1A 4YFLF 5DJ0B 3RDTD 5L2KA 5EORH 3L5WA 4JJHA 1ZXQA 4LCWB 1S8DB 1CXKA 2G9HB 2NW3B 4LSTH 3CZJA 5EZLB 4R90L 4HMEA 3UPAA 4S1RL 1BZ9B 4KI5C 4M48L 4PFEA 3IDIA 3NFSL 4QLRA 3RKDC 3ILQD 1N64L 1CICC 3ZKND 3KWWB 3KPLB 4GAJL 3FRUA 1Q8MA 1EFXA 2XPGB 2MQCA 4YHZH 1JHLL 3D6GA 5DTFA 4U6XA 5CIPB 1VFBA 3WNKA 3RWCB 4J3TA 3CH1B 2VLKD 2VSCA 1H15A 1EK3A 4UUJB 5FOBA 1H3PL 2CLVB 5L2JA 1J8KA 4OGXH 4X4ME 1OT2A 2EKJA 3MLZH 3ARGD 4R97B 2FH8A 4UBDC 3RBGA 2E3VA 4EEEA 5FM4A 3GNMH 4WO4A 4LSQL 4OBSA 1MHCA 3UJJL 5D2LB 5DMKA 3QQNA 4P5MB 2JJTA 3HE6D 4GKNB 4JG0L 4PJEE 3E0GA 2NY1D 4GRWF 4Z95L 3IDMB 2P8LB 3MRQB 3C8KA 2VLLB 2WLYA 4JPIB 4IS6A 4MAYB 5D7IA 3V8CA 5BRZB 4HUUB 3PGCA 4NBZB 2F53D 2HT3C 4XMKL 4WJ5A 4EIGB 4NO2B 1XIWB 2R1XB 1RZ8B 2ZSWB 1UJ3C 4JFPA 4DGVL 1S9XA 3QPQD 1FFPB 4J1UA 4P3CH 3V5KB 2NLJA 3GMLB 2DIAA 5FYKD 4XPFL 2NY0B 4ZAKA 3MRFA 1Z9LA 1Q72L 2KH2B 1UWGH 3QEHA 5ALBH 1FYTE 1BZ7B 5KVMC 3MV11 4FFVD 1G9NL 43CAB 3HI5H 3ZE2F 1XR9A 3SDXF 5B4MD 3ULSB 3VFUB 4K3HA 2EZ0C 4X6FB 4ODHH 4HBQA 4L1HA 1XCTA 2VKXA 1U8LA 2P48B 2BFVH 4OSUH 3QRFM 1NAMB 2XZZA 1XZ0B 1Q0XL 3MBEA 3ES6A 3ROLA 4D0DA 1VFUA 1KTLB 1KN2L 1IAIL 3PP3H 3HB3C 1AGEA 5HJ3B 1T0MB 4YFDB 1Y18A 4QWWC 1S7VB 5KTEH 2APXA 1AQKL 3G6JE 3OR7A 5EPMB 5EU7E 4GSDL 1RZGB 2CGRL 2ITCA 4OAWB 5F96H 2FYYA 3DO7A 4LPWA 2B1HH 3NCYP 3VD5A 5J11C 2P8PA 1KYOJ 4CVZB 1FFOB 2ZUWA 5GJSL 4MA1C 4PGCB 4IDJH 2ZUTA 3OXRA 1U3HA 1VEPA 2G2RB 3O11B 5I1AB 2X1PA 3UTZB 4U1GB 2AGJH 5D1XA 1S9WB 2R0LH 3R4DA 2V9QA 5MENE 5GISL 1ZE3C 3NIDE 2X10A 3CXHK 1I3RB 1PY4A 3E3QE 3LCYA 5B3NA 3A6BH 3CAFA 2Z92A 3UJTL 3LKSA 1X44A 2QR0A 1JCKA 4LEXL 1GGYA 4PJCA 5FHBL 5HXMA 4Z7WE 4JJ5A 3MLYL 2QBWA 1J05B 2A9NH 3KPSE 4XNYH 4L4TD 4DTGH