2QL1A

Structural characterization of a mutated, adcc-enhanced human fc fragment
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
209
structure length
209
Chain Sequence
b'GGPDVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPLPEEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IGHM protein
publication title Structural characterization of a mutated, ADCC-enhanced human Fc fragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ql1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ql1A01
1LE9A 2R2HA 3T1WA 5IMMA 4GG8A 5C09E 5IFAL 1MVUB 3M1BB 5AZ2H 4W4OC 5GSVA 1CVSC 2OTWA 5DGQA 2EIBA 1A1MB 2G75B 1XH3A 4ZXBC 3IB4A 5C0DB 4HC1H 5D1QC 3SEPA 2R1YA 4KKNA 2MCG1 3S4SG 3ZKSD 4NZRL 1T3FA 1H3VA 4LRIA 1U8QB 1S9KC 1BVKA 4YHPA 5GGTH 4CAGA 3QWOB 1A47A 3TYFA 3QNXA 1V7ML 3DIFB 1BF8A 1BF2A 4QGTA 2C7UB 5E99H 1RUPL 5B39G 3VFRB 2Z35A 4IRJC 1MCIA 4I3RH 4X7DC 4N8VA 3P30L 3D2UB 1N5AB 1KG0B 1HHKB 1UACL 3KPSB 2BNRD 5A2JH 2L0DA 4K71C 3K2UH 1QPPA 3LCYA 4OIAA 2ZPKL 1CL7L 2R2EB 1P5VA 3GM8A 2O5XL 4NQCB 2I24N 1ZVSB 4HK3N 2MKWA 3IKCB 5IB1A 2AJSH 1NQBA 2FYYB 4NUGL 3TT1H 2YMXL 3MBXH 3G5XB 4PIRF 3X12A 4AEIL 5SWZB 1KTDA 4PJEE 4Y4HA 5HGHB 2K7PA 1U9KA 4U31A 4WCYH 1X4XA 4ZO8A 3LKPB 5B38B 5J56B 3KVQA 4K9EL 3QDMB 3VG0H 4KKCC 1I75A 1QHOA 1YPZF 2OMBA 1XIWD 4PP1C 3GBNH 4TSBH 1KLGA 1A21A 2FBJL 3VXUB 4FXGB 4S1QL 3KLAA 3F62A 2DWEB 3VD4A 4QXUL 5HI5D 4K7PY 2DQEH 4NKIL 3FO0H 3QUZA 5FB8A 2UWEB 4PJ8B 4GKOA 2HMIC 2AJVL 3B9KA 4OJFH 5F6IB 4P9HL 2W9EL 4JEGB 1AO7B 3GB7A 3OX8B 4YXHH 3MV7B 3WFBH 4PJHF 3S5LG 4DVRH 1EMTL 3DTXA 5HGGS 1BVZA 2WQRA 1SQ2N 4OBSA 4TNVF 4FFWC 3HE7C 4Y5VB 3CZJA 3MMEA 4U0QB 1IC4L 3HB3D 5E2WL 3V2AR 3DGGA 1Z3GL 1CFBA 1JYNA 3ZDZE 1OPGL 4Y19B 1T5XA 4L8DA 5B3JF 4P9ML 4MVBC 4NO0B 3BPOB 1QVOB 1E27A 3G5ZA 3O0RH 5ABDE 5I1KL 3DX8A 5EU5B 4HEPG 4AT6B 3CIQA 5D9SB 1OGTB 1AKJB 4RGNC 5HYEA 1GCFA 3S96A 3V7MA 1EBPA 3D1MC 5FK9B 5JUEH 2VZVA 4ZQKA 2N7BA 4NQXB 4LVEA 4OV6F 1LNUB 5IMOB 3P9LA 1DN0B 2WIIA 1TZHA 1ZA3B 3AVEA 3HI6H 4F9LA 4XZUA 4KPHH 1JN6B 1LE5A 1Q72H 1WISA 3KPMB 3SE3C 2HG5A 1YEEL 4L8CA 2D9CA 3GNML 5EC2B 2X1WL 4OZIA 3QIBA 5H35A 1I1FA 3C60B 3O3BA 5JOEA 5AUMB 1C5DB 1IL1A 3OB0K 4XNUH 2Q7YB 4PJGE 4W4NA 5IB3B 1QSFA 3VWJB 3DI3B 4Y5YC 4PJCA 2X4RB 2WK2A 5GGRA 4BFEA 3ULVF 3ZZ1A 5DS8A 1F58L 4CJ0A 2YA1A 4JO3H 4JANB 3S35X 2VLJD 5F9WC 2ADIA 5HXMA 5EDXA 2DQFB 2IFGA 1CCZA 1YN7B 1QKZH 4NPYB 1MCDA 1I8LA 3CJJA 5E6ID 3T4YA 3O2DL 5T3ZL 3ZDXE 1SHMA 3MRKB 4OFDA 3ZHLA 4KK9D 1ZS8B 3ZT7A 1Q9KB 4AMKL 4G9FA 4GXUN 4ODHL 2Z31A 4PYGA 5IP4A 4R4FH 5J3HC 1IGFH 4XBEL 3MLXL 4KKAD 1EJOL 5DK0A 4F2MB 2F9BT 4BH8A 4WHTB 2FHBA 4OLXH 4PJAB 1RFDL 2ESVE 4YBLB 2ICEA 3LEXB 3O4LD 3AMLA 4QTIH 3ES6B 4U1HA 3SOBH 4CU7A 3QNYA 1DBAL 4LCYA 4OB5L 3OZ9H 1FNHA 5EC1A 4OAWB 2HJKB 2CXGA 5BXFB 3RIAF 3IF1A 5T1KA 3QQNA 2VDQH 1RZKL 4PGDA 1K6QL 3RPKA 4PLJD 2QQNL 2CD0A 3HMWL 3SQBA 4NNPL 3FT4B 2I27N 3IVKB 3S3JA 1JPFB 2MJWA 1NMBL 1J8HA 4IRSC 4PRHD 1OAUH 2VL5B 5C0IB 4ONGL 5F7NC 3QUYC 1II4E 4ELKB 1QQDB 1L4IA 4LSTH 1GSMA 4PRPA 2XTJE 5FEBA 1U3HC 2NY2C 3DMMA 4KWUA 4B0MM 2PW1A 5AZ2L 2NR6C 3UCRA 1G7LA 2I07A 1CD1B 3FRPA 2BVOA 1QFUL 1OW0A 4P2OB 1ZXQA 1Q94A 5DD1H 4D9LH 3L3DA 2VR5A 4RWYH 4HMCA 4IIQB 3NFNB 3QEUA 4OM1H 2V2XB 2CUIA 4JFYB 5TH2A 3WS6C 5IW6A 5GGTL 5CWSB 5FM5O 2HJLA 4OLWH 2E6QA 1ADQH 4KDTC 4E0RA 1F4WH 2X4SA 4R97C 4I3RL 5BZWB 1P2CB 5MP6H 3TT3L 4PJ7A 2R0ZH 1IC5L 4R90H 1RUQH 1N8ZA 3KXFE 2VISB 4D9RD 3K2UL 5ELIA 5FCUH 1KGCD 3T8XA 3G5YA 2CLVA 4X6DA 5KSVA 4U1GB 3WMSA 2AJSL 2VLME 3ULSA 3TT1L 5HHXH 4XVSH 2EYSA 1S5HB 2ZP0T 3DLQR 2B39A 1EEQA 5F44A 3RTQD 4NT6A 5D7IF 1HIML 4R4BA 3RDTC 4LLDB 3V8OA 2NLJB 3PGFH 3VG0L 4GO6B 5IW1B 3TCLA 4JRYE 3E8UH 3OKLA 3FQWB 5FDWB 5EU7E 3WFHB 3GBNL 4TSBL 2EDKA 1ACYH 4KRMB 3S97C 4HCRH 3RA7L 4NM8L 1KB5B 5GRUH 3P4LA 1ORQB 4XP4L 1RUAH 2ZCHL 5DQ9B 3EO1A 1UWEH 2JCCB 3EUUA 4MA7L 5JXEC 3W11C 2YD8A 4KROB 3D39D 1QBLL 1G7HA 3WFBL 4Z7WB 2VITA 1ROWA 4HMDA 4K7PX 4M5ZH 1FNGB 1S7QB 1SBSH 4K94H 4PB9H 5B22A 3MJ8A 1EBAA 1A6ZA 4YHYC 4LNRA 5CSGA 5IB5A 3QHFH 4MDJA 1XF2A 1KCSH 5J89A 4QYOA 4U0RC 4OQ1A 3CFIC 2X4NA 3DUSA 5D7LA 3I3EA 3SCMA 1QLFB 1OAZH 3QJFA 5T1LB 3CFBB 2EICA 3CDGA 3O6FC 3O0RL 5HHNA 2GSIB 3KPSE 1WQVT 2VZTA 5K9QG 2NX5D 5KAQF 4AH2A 1CGVA 2XWTA 3GI9L 3AAZA 3IAQA 4KVCL 4N9GB 1LK2B 3QDGD 4S10A 3K81A 1MHEB 5I2IB 4M93C 4HLZH 4NQCE 3RNQB 4UAOB 5JHDB 1JF1B 4AG4H 1YNLH 2XNAB 1JGLH 1DANU 3EYUH 1A8JH 5JUEL 3O9WD 1JGDA 3H3PH 1T1ZB 5SWZE 3VXPA 1U8OA 1FFPA 4Y8DC 4JFDB 4PPTA 1KN4L 5L0QB 4M7KH 3HI6L 1W2KT 3KYMB 3QDME 1OLLA 4KPHL 2ZSVB 4PJ9B 4XBGB 2D3VA 1Q72L 3SE9L 3ARRA 1A7PH 4PB0H 1WICA 4XNYH 5DD3L 3IJSA 3AGVA 3VXUE 1IFHL 5IROC 1VGEH 3DV4B 4XNUL 2D0GA 5M94B 1UCBL 1JRHH 3M07A 3QUMB 3T77B 3TH4T 1UVQA 4OZHB 1R5WA 2UWEE 3B8YA 3DBXB 4JHWH 1RIUH 4BK5A 2YPKB 5I1AA 4JO3L 4X9HA 3P0YH 5FYLH 1UEMA 4KH2A 2DL9A 2Y25A 2OR7A 1U91A 1QKZL 3D6GA 1J1OL 3BZ4B 1FL5B 1HKFA 2OM5A 3WNMA 4POYA 2CRZA 5GZND 4GKNA 3ECBA 3NTCH 1H8NA 5HHMB 2GSGA 3QEQB 3NMEA 4ZOBA 3P77A 4Y19E 3TZVC 2E8ZA 5BVJA 5C0CA 4LASH 2H32H 4L8SA 4MNQD 7FABH 4M8QA 3N9GH 5FM5M 4R4FL 1IGFL 5F97E 1I1RA 4HUUA 1XF5A 2VMFA 1FZKB 3HG1A 3INUL 3LEVH 2HFTA 5J57B 3RL2A 5CBAA 4D8PB 4S1SH 4OLXL 3FO9B 1B6DA 2MQCA 3NA9H 4KK5D 5TGBA 3DHJA 2DQIH 4P5TB 4JO4H 2BY0A 4O02L 1T0MB 2V9QA 2NY6B 4QTIL 4F7MB 2JJUA 3U46A 1IT9L 5JHLH 3OZ9L 2IQAB 2NW3B 3BKML 2E7HA 4XRCB 3UTQB 1VB9A 3IAPA 3UTSB 4OZIF 4QRSA 5F88A 2VDQL 3KG5A 3OGCB 2DF3A 1OAXL 3P73B 4PJXA 4MDIB 1ZT1B 4PBXA 1BZ9B 4PJCF 2DWDB 3B5TA 2E9IA 3GRWH 4XC1H 1PAMA 4HIJA 2ZSWA 4JFEA 1OLZA 4JZNA 4KRNA 2L4OA 5CSBA 3CD4A 2A0LD 2YPLB 1ZLSH 2D4DA 2VZ1A 1T7YA 4EUPH 5CIPA 4U3XA 2XA8L 2X9XA 5IF0A 3DROB 4I5BB 3T0EB 3JWDH 2FH8A 3G6AB 3QXVA 4J8RA 2A77H 3U0WH 3NCYP 4JFZH 5DD1L 5FGSA 4F8TA 2ARWA 4WWKA 2ZOLB 1MREH 4RWYL 1I7ZB 3CLFL 1SJEB 3QXUA 2BOBB 3VCLA 4X4ZA 2XWJB 1LO2H 4XPTH 2AJYH 4CVZB 1T7VA 1S78D 3EFFB 2CLRA 5IIEB 5JQHC 2XN9A 4HIXH 4PJAE 3RVUC 5MP6L 2R0ZL 2V5SA 4R90L 1RUQL 4L4TB 4OD1H 3I02A 4LDLB 5C3LD 3QCTL 3DURB 1TCMA 2DIAA 1WIOA 4M7ZC 4OLZH 1D5ZA 2NY1C 1QLRB 3GHBH 4D9QE 3IDGB 4F9PC 1MIMH 5CJOH 3MXVL 5FF6B 3PJSB 4U6XA 2ADFH 5HHXL 3QZWB 4XVSL 1QRNA 4HS6B 4I4WB 1G6RL 4Y2OA 1EVUA 4C83A 2BC4B 3KNBB 4HUWA 3UPAA 5IMLA 3PGFL 4JDZA 5KJRL 3E1F1 1KB9J 2FJFB 1X5XA 4YNYA 1M71A 3LS4L 4S1RH 5DHVA 1I7RA 4HCRL 1DDHB 5C0JB 1FNLA 5FYJH 2N7AA 1ZK9A 3B2VH 5GRUL 3BGMA 1RUAL 3QUXC 1NBZA 4RGOL 1X5ZA 3R0NA 1H3TA 3V5HA 1K5NA 4O4YH 4POUB 4OUUB 4P3WA 3IU3B 3WV0A 1YJDL 1CF8H 3SJVB 3AFLA 4M5ZL 1IQWL 2PYEA 2XZCH 3SY0A 5I1LB 2QHRH 5C0ND 1NC2A 1UZ8A 4UB0H 4I0PC 3CFEA 3SE8H 4PG2A 4PJ7F 1HHHB 1KCSL 1QO3B 3FQNB 3H9ZA 1IEAB 4F57H 1KIPB 4P59H 5ISZD 4BM7A 2GJZB 4APQB 5EUOF 5TJWK 2CRYA 2OJZH 4NQSA 3UYPA 5IFHL 4X6DF 2D7PA 4QOKD 4MGXA 4K3GA 4FA8A 5D1ZB 3OXSA 4YZFF 1JGLL 5C0AA 4FQLH 4Q9RL 1HCFX 1TZIB 2WBJC 3FQTA 1ZHNA 3H3PL 4PREA 1VSCA 2XIDA 3IDIB 3K8KA 1BFTA 2RQ8A 2LTQB 4M7KL 2GITB 5HYJA 5DTFB 4PRIA 1H0DB 3MUY1 4CADB 5ACMA 4L29A 4QHNA 4PB0L 2Z4QB 3RVVD 4R7DA 3OHXA 5E1AA 4P4KD 5IGXH 1VGEL 2UUDH 5JW4N 4OCYL 5FO8B 1JRHL 3JWDC 4LFHG 5HHVL 3TPUB 2NXZD 1GAFH 2XKNB 1IC7H 2E7CA 3EOBB 2JCCE 2VERN 3QQ3B 4NRYB 1HXYB 5A3IC 4JE4B 4JHWL 3SDAD 2F8OA 1NEUA 1J1PL 3GJFA 4KY1H 3I3BA 4N0UB 4Z7WE 5FYLL 2WUBH 2XICA 3V6OC 1CE6B 1NC4B 3FB7A 3FKUS 3TBTA 3H7LA 3NTCL 4HXBH 2YC1A 4H25B 3RPIB 4OCRH 2H8PB 5E2VH 4LHUB 4LASL 2HVJA 3V5DB 7FABL 5J1AB 3DNKA 4F58H 4UV4L 3FZUC 4HWZB 2O5YH 3SKMA 3OSKA 3OKOA 3BI9X 3LEVL 2X09A 1QYGL 3DARA 3JV5A 3FQRB 2D31A 5FXCH 3BHBB 4U1JA 5CINL 4S1DD 3RZCD 3NA9L 5JHDE 2FX7H 1Q9OB 1BPVA 3VGAB 4LGRB 4JO4L 2QKIB 1RI8A 4MJ5A 1U8LB 1CDHA 1TLKA 1G7IB 1NGPH 1BD2A 5TDOA 3MO1B 5JHLL 4CUCA 1NANI 4JFDE 3MNZA 3TNMA 4ZODA 4KKLC 1LO0L 1ACZA 1TJHH 3D85A 4G6JL 3W0WB 4XT1C 5BS0A 4Z7NF 1B0GA 2OX5A 4L3ED 4WTZG 1X44A 5CS7A 3VFSB 4XC1L 2VYRE 2YWZA 3MV8A 4XCNB 4OZHE 4ZUVB 3ZDYE 2C1PB 3C6LB 4JFPA 4KMLB 3QWQB 2P4AB 3WL9A 3CDFA 5CP7A 2QSCL 2D0HA 1ZLSL 2Y6SC 5JA9A 5CHNA 1MCRA 3C8HA 4JFQA 3T1FA 1BEYH 5MENA 3JWDL 4LLAA 5D7JA 4DWHA 1IAKB 1K2DB 4JDTH 3GMLB 4LOUC 2A83B 2AXGA 4NUJA 1RY7B 3OWEA 5CJBA 3U0WL 2FIKB 4RAUB 4JFZL 4DGYH 2WWMD 3PWLB 3MRLA 1KIRA 4ELMA 1MREL 1I8IB 1CWVA 5D1XB 2PO6C 3MLTB 2J88L 1ZLVH 1WBXB 2JK5B 3GJEB 4XPTL 1NUDA 1CGUA 3C08H 3R06B 2EYTA 4BUGA 1MQKH 5E1HB 4M6AA 2HAZA 4OD1L 3L3GA 1EPFA 5FGCB 1ZV5A 3W9DB 3ARSA 5KW9H 4OLZL 4JFOB 4P3DB 3ARYA 3DX6A 1KTLB 1MIML 4PJXF 4P46D 4X7CC 5CJOL 2BSSA 1LD9B 1D9KB 4MQ7A 4F15B 2ADFL 4QNPE 1FLTX 5ID1B 1JHKH 2X4TB 3T3PE 5D71H 4R0LC 1OAQH 3BZEA 1KCRL 1IMHC 1RJYB 3MOQA 6FABL 5EOTA 4G8GA 3BRDA 3MRHA 5KOVC 4LLVA 4WHCA 2LABA 1A6AB 3MRCA 1FPTL 4OM0L 4XVJL 4S1RL 5FOBA 1X3DA 1JWMA 2YPLE 4LHUG 1U8PB 3B2VL 3EZ8A 4UI2A 4YWGH 1S7TA 3T0EE 5EUKA 2X89A 1TMCB 4CW1B 3TN0A 3CFDA 3A6CH 1INQB 1KV3A 4R7NB 4O4YL 4U6HA 4O9HH 3AXLA 3L7FB 5DXWA 1P7QD 1CF8L 3L3OA 4JN2A 4GH7B 5I75C 1NLDH 3BPOC 4KDVA 1X6LA 1M7IB 2BMKA 1ONQA 4H5SA 1AD9B 4UB0L 2G60L 4Q6IB 3SE8L 4I2XB 5IVXA 3WHXB 3H0TA 3O3AB 3RWGB 3VGEA 3LD8B 1X5GA 1Y0LA 3KPRA 5HDQH 4L4TE 5C08B 1FFRA 5TDPA 4DCQB 1UXWA 2GTZA 4GLRH 5K9JL 4HWNA 1DEEB 2GKIA 1I1AA 5FGBC 3BPLC 4TNVK 4FQLL 2VXQL 3LV3B 2X4PA 4GKZA 1C1EH 5FKAB 5J1SC 1ODAA 4YBQD 1NGZB 1FNEA 3V5KA 4S0TD 2C4XA 3N0PB 3VWJC 2E7LA 2EEBA 4M6MH 2F5AL 1CTOA 4NJ9H 4Y2DA 2R0LL 3ULUF 2EDDA 4GQ9H 4MD4A 1I9RH 1EHNA 2G9HB 1AGEA 1DLHB 2QADB 3QIWB 4JQIL 2UY6A 3ARGD 3QI9C 5J11B 1G7JA 1KB5H 1F11A 1PKQB 1MRFH 4GFTB 4Q9BA 4MZ3A 4G8IA 4KRPB 4KTDL 4J3VA 4FN0A 5FUOH 2EKJA 3X3GL 1U3JA 4YAQB 4X9FA 1NMCB 1GJIA 4XNXH 2PYFA 1G7QA 4KY1L 4GMSL 4JG0L 1YEFH 5CBEB 4OI9A 3SJVE 2WUBL 5E94B 2OXGA 3EO0A 3QQ4A 3S3PA 3RUGB 3AREA 2X41A 3NIFF 3TIEB 1LO3H 4HXBL 1LO5B 1QFWM 2BNQB 3I75A 4JGMA 3S36H 2C3VB 4OCRL 4X0KA 3QHZH 1CDUA 3PGDA 5E2VL 4YUEH 3MYJA 4MSWB 2YEZA 2CSPA 4PTUA 3FQUB 4HAFA 1ERNA 1S7RB 2GJJA 2R4SL 5I1CL 2O5YL 3GSQA 1CGSH 3QCUH 2OCFD 4WI5A 2A74B 4S2SB 3P4MB 4JVUA 3GSWA 5IHZB 1OOAA 2FX7L 4OCWH 3AS3A 1WV7T 5EU4B 4N5ED 1BX2B 2ZWLT 3MREB 5ILTH 1NGPL 4KTYA 2PR4H 3PXHA 2OK0L 3ISWA 3U9UA 4ACPA 5DGRA 5HHOB 5KSBE 4M1GH 1FG2A 2H6PB 3GO1H 4QHUA 4Z7QF 3DETC 4FZEL 2P8PB 4LPYA 4ZFFA 4WEUD 1OGAA 4EDWH 2EDRA 3OV6A 3U48A 1MCOH 1T4KB 4J2XA 1BIIB 1FVCB 2XPGA 2QSTA 4GAJH 1HSAB 5I1GH 3QUKA 3C2SA 4ZFZB 4LLMB 3DUUA 4M6OH 1OP3H 5EH1A 1BEYL 3RIAK 4JZJB 1KELH 4D0CB 1EFXA 2J8UB 4U1NB 1LP9A 1X6NA 3J8F7 5E70A 3X3FL 3WYRA 5HVFB 3PQYA 5DJ6A 4CMHC 2D4FA 5JNYB 4DGYL 2VDOH 3ZYIA 5HTSA 1S5IH 1VA9A 4DZBA 1QFOA 3DX9A 5EFIB 1WSST 2EEDA 1IM9D 4KV5F 4X4MA 1RJZB 2Q6WB 1G7PB 4NOFA 3U6RB 1DP0A 2FJHB 3BEVB 2YPVH 3C08L 2VSDA 2CMRH 5I16B 4U1GC 4F7CB 1MQKL 4JREB 4YDVB 5GHWL 4ENED 2RB8A 4X5XB 4FOMA 4YDJA 5C0BA 2BNRA 4NHUB 5KW9L 4XI5D 4GW4A 1NDGB 2P8LA 4F7PB 4WEMB 5L2JB 4YR6B 3WHE0 4G8EB 1JHKL 5CKGA 2IAMA 3MLRH 4MS8C 5D71L 3X17A 1OAQL 1CIDA 1F5WA 3HZMB 3EOTH 4U1SA 3VWKB 4PJFA 3L7EA 3ARBB 1F3JB 2ESVD 2E6JA 4M00A 1JMZA 4PLKD 4QKXB 5ESAB 3BVNB 3VI3F 3T0DA 2ICCA 4JY4A 1P1ZA 1KPVB 4YWGL 1DE4A 5GS3A 4NHCH 5CEXA 1PDKA 5EIIA 3UTTA 4XGZB 1SVCP 4ELMF 3GFUA 3TYGL 3DYOA 4JGUA 3A6CL 5ALBH 2AABL 3P3YA 4EOWH 3OAZK 4QCIB 2AK4D 2ZUSA 1FJ1B 1CG9B 1KCUH 3N85L 1PX3A 2DQTH 5I0DA 2NY4B 2UY7A 4HUVA 1BQSA 2CLZB 4U6TA 1MLCB 1WC7A 3VXQA 2AJUL 1W72B 5H37H 2XTJD 3PL6A 4X80H 5F96H 5D8JH 1FO0L 1Z9OA 4NRXB 4RZCA 4Z7UA 5HDQL 1AIFB 3P11L 4TVPH 2D7TL 1PD6A 5FGCE 1ZHKB 1FZMB 1I8KA 1KCLA 4JCMA 5CD5C 4KI5E 5HGBB 4HH8A 3RY5A 4JDVB 1FVDB 2B0SH 3ZYJA 4N0CC 5HVWA 1C1EL 1TQCC 2NY3D 1NLBL 1ITCA 1C08B 1T21A 3FCTA 3VU2A 1XZ0A 4M6ML 3VRJB 5DUPH 3K1KC 1AHWC 3L3HB 4NJ9L 1DBKH 5K9KB 1T03H 3I6KB 2VUOA 1I9RL 4XNQA 5EBMB 3QXTA 1MQ8A 5JXAH 1DQJA 3B3IB 4H26A 4Y4FB 4XPFH 4XXCA 1MLBB 4MX7A 2VLMD 5E03A 2HT4C 1I7TA 2ZOKB 5HGDB 4O58H 3RWCA 5FUOL 2J6EH 4NQEB 2EXYC 1I3RA 3WIFB 4KZDH 5HDOA 4X7SL 2VLJA 3P9MA 5IVXF 3MR9B 3NCCB 2QLVB 4YIQB 1URLA 3IDMB 2V2TB 1RK1B 3ARDB 3RGVB 1NFDA 4GS7B 1VFBB 4DUXA 1GZQA 1X5JA 4J1UB 2CDEA 4I2XE 5JDJA 4DJMA 3WDHA 3AM8A 1N0LA 2BOCB 3EDKA 2ATKA 3QHZL 4LVNB 1NCTA 4C57C 1XGTA 4K2UL 4LGPB 1R5IA 4NBYB 4YUEL 5CP3A 3TA3B 2BVQB 4RCAA 5JDSB 4P5TC 1JMXA 1UGNA 5C9JA 5C08E 1RV6X 1N6QH 4DKEH 3QCUL 1CFNA 3CDCA 4X5LA 4Z0XB 1XCTB 5IHBA 1WBZA 4G8FB 4ALAH 3CLEH 4LSQH 3V6BR 2APWA 4OCWL 1AP2B 1KCVH 1N3NB 1AQKH 4HKBA 4X7TA 3WO3B 2FX9H 3MRIA 5ILTL 1EGJA 1KF9B 4FHBD 1OTUC 3UXFA 3B8SA 1UJ3B 4M8VA 3KPSD 3GO1L 3IDYB 1KXTB 5I8KH 3D0VB 4YGAB 1OM3H 2VRAA 3K7UA 5FECB 3CFKA 2HVKA 9CGTA 4EDWL 1PKQE 4QRPD 1BZ7A 2ZUXA 1B4JL 3T65A 1MCOL 4PRHA 3CVHA 4UOW0 4G6AC 4P57B 5SWZD 3AB0B 5I1GL 4FQJL 3QQ9D 5FDYA 3HI1A 4M6OL 1FNSH 3QDMD 4WFGD 3CXDH 4XVUC 3KYOB 4M1DL 1QEWA 3HUJB 3RUGE 1SBBA 1P53A 4LAQH 2BNQE 4QRRE 4I18A 4OZFB 2OR9H 2VDOL 4F33A 2WSKA 3ULVL 3OF6D 1CFTB 4P23B 4BH7B 1KENH 1S5IL 1ZHLB 3TO4C 4PJ8D 2CKNA 3IFPA 2V5YA 1U93B 5ERWB 1TJIL 3VGGA 2APVA 3KPNA 5DK2B 2YPVL 4HS3B 3EAKA 5CJXA 1T89A 4WIQA 4NC0B 4AM0A 1U8MB 3HZYB 4L9LA 4PGBB 2IANB 4OGAC 4J6RL 3LEYH 1GOGA 5HHOE 2FZ3A 2VXVL 3V4UH 2YXFA 4R96A 3RBSA 2BSTA 1CBVH 3CC5B 3MLRL 1A5FH 1M6OB 1RZJH 4OF6A 1AKJD 4M7LT 3SDCD 5DVOA 4WI6A 3QG7H 1D5MB 4QRQB 4PV8A 1KXQE 2YD7A 3S37X 1YNTA 1R3JB 3BGAA 1OTTC 4LVOB 2NXYC 5DJAA 5GGSA 3U7WH 3QPQD 1LP9F 2XFXB 3E2HB 5A2LH 3S35H 3TBSB 2ED9A 2EYRA 2J8UE 3MCKA 1KPUA 3MV9A 3C60D 3QG6B 3BT2H 4MCYB 3O8XA 3RKDD 3VXNB 1F45A 2WLYA 2DLIA 2F54B 5ESQB 5GS1C 2C1OA 2VLRB 3HNSH 3E3QE 1CN4A 1WWCA 3KAAA 4LRIC 1MFAH 3BP4B 4UIMB 3BP5A 2MHAB 1NL0L 4QHKJ 4DZ8A 3BH8A 3JTSA 3N1MC 5IK3A 3UO1H 3R8QA 1MAMH 3QO1A 1KTRL 4P48A 3U30C 5DFVC 5F7EL 2ZUQB 4X80L 4KI1A 5F96L 5D8JL 4NKMB 3V0VB 4HKXB 2X4OA 1UKQA 4ZS6D 4TVPL 1VGKA 4X99A 4GOSA 3MRNB 1MY5A 3QO0B 5H94A 1TCRB 1D5BA 3Q1SL 4Y1AB 1YMMD 3LPFA 1R24A 1BQHG 1U8NB 4EVNA 2B0SL 4EDXB 4PJFF 5C6TH 1RJLA 4P2QA 5BVPH 4Y4HC 5T3XH 4C56A 5F7YC 1J87A 3MROA 4WU5A 5DUPL 1QACA 4WI9A 1T03L 5IWLA 2I9TA 3Q48A 4OZFG 5JXAL 1UZ6E 3IU4H 3BKYH 3MBEB 4LQFH 4D9QD 2DICA 4XPFL 4LGSB 2OSLB 4YK4B 1WFUA 2OTUA 4JFFD 4XH2A 4K3EH 3B9KC 4KUZH 2J6EL 4WW1B 4MJ6B 1S9XB 3SGDH 4ZO6A 3MACH 3KJ4C 2BVUA 4KK6C 3QRFM 1XGPB 2AJ3B 2E9WA 4L5FL 5HY9A 1IAII 4X83A 1S3KL 4Z7UF 3QFJA 5J9PA 5D4QA 2OTPA 1YPZB 4X5WB 1P7KA 4X8XA 5DC0A 4LLWA 1RIVL 3C5SB 4EI6A 1DQMH 4Z8FH 1CIUA 4HFWB 4Z76A 1N6QL 4P2OD 2WW8A 4DKEL 3CVIL 3FN9A 4PRAA 5A2FA 4R8WH 5JPNA 4ALAL 3CLEL 1LILA 2YD3A 4LSQL 4NC1E 2Q8BH 4Q58C 3C5ZC 1MJ7H 1KCVL 1AQKL 3FOMB 1F00I 3PNWA 4QHKI 1RZJC 3U9PL 2MMXA 1JPST 1KPRB 4M03A 4ZUWA 4YDKH 4LKXA 3SDDC 8FABA 1WBYB 1JZ7A 3G04B 3QFDB 1LQSR 3TH2T 1NGXB 5L6YH 1OM3L 1JF5A 3HS0A 3QIBC 4K3DL 3O3UN 1CFQB 4ZFGL 1AJ7H 3BIAX 4IRJA 1WIUA 1Q0XH 4WUKH 5HI4C 1NCWL 3RI5F 4ZPTB 4JM2D 3OKKA 3T3ME 2B5IB 4NQEE 3KHQA 3MRDA 4HDIB 4NCDA 1FNSL 5D1XC 1NFDF 1BOYA 3CXDL 2WV3A 3QH3A 2LVEA 1JWUA 4K7PH 1FFOB 3OR6B 1JYXA 5E9DB 4UINH 4HZLA 1FL6A 2Y07H 1EHLH 3VI4E 2OR9L 4V2BA 4RNRA 4HBCH 3IFNH 5DD6A 1KENL 5EZOH 3SKOA 4EN3B 4XTRC 3JSSA 4XC3H 4FQXA 1IILE 3KYAA 3VG9B 2AI0H 4JY5H 3V0WL 3ZE2F 3H9YA 3S98A 2IG2L 3ZHDA 3TJHC 1A0QH 3BQUC 3GHEH 3A6BL 4RX4A 2YRLA 3UTZB 1I8MB 4U33A 4JY6B 2AJZB 1R6VA 4RMQA 5JORA 3Q3GA 2LAAA 5KVMC 2ZCKH 3O2DA 1I4FA 3E6HB 3LEYL 1PQZA 2D2OA 1J0IA 5EO9B 5AD0B 1S8DA 2X1QA 4JZOB 3V4UL 5CJ8A 5EWIL 4J23A 4U6YB 1H5BB 4K8RH 1NAMB 3HE7A 4LSVH 1A5FL 4PUBH 5I74B 1BBJB 3VXRA 4W6WB 1RZJL 4ZXBD 4WO4D 5D7SH 5B4MC 2P24A 5JHDD 5EO1B 4FXLA 1JV5A 3BZDA 3BRFA 3STZB 2VIRA 4JKPH 2CGRH 3F7YA 3TP4A 3PHOA 4XMPH 1OP5K 4HW6A 5IJVB 4UBDC 3U7WL 1XEDA 3DOSA 4JFDD 4Y16B 4Z5RB 35C8H 4P2RA 4AIZB 4XBPA 4EI5B 3S35L 4PJ9D 4L4VA 3DMMC 1A3LH 1QFWH 2DQDH 1SMOA 2VABA 3EDFA 3HUJE 4ETQB 2QTEA 5JIHA 5INDA 3QEHB 4K3HA 4DAGL 1OW0C 4YHLL 5K9OB 3LD8C 2R1WB 3BX7C 5ANMB 2Z91B 1M7XA 1DVFB 2EIDA 3QJHA 5KZCB 32C2A 3B43A 2WINB 1WFNA 4NO2B 3HNSL 1IJ9A 1MFAL 1Z6JT 2UV3A 4HV8A 5DJYB 3SE3A 3DRQA 4X6EA 3EW3B 3A0OA 2R2BB 4ISVA 5C6PB 5FYKE 3G6JB 1Z5LB 3UP1A 1NFIA 4I3GA 5D2NE 5LGHL 3TIDB 4ONHA 4KK8C 3IDXH 3ROOA 2B8OT 1ZLUK 4HC1A 1YEKH 2EE3A 5ICXB 3MODH 4K7FB 1BJMA 15C8H 4WNQB 3ZMRA 5LGJB 2AXFA 3PABA 3QIWC 5C6TL 2FATH 3FO1B 5GGTA 2ATPB 3FN3A 5T3XL 3GMPB 4HIEB 5EU3B 4KZEH 5MI0C 3DSNA 5DO2C 4KRPC 1FAIH 2EH8H 1CXHA 2O26U 3CSPA 4JO1H 5F7HA 5TDNB 4QF1A 4YXLL 5JOPD 1QBMH 3FHQA 2NY6D 1NMCC 2NMSA 4WDIB 3IU4L 1CZ8H 5J12B 1T1WA 2H2SC 5J0BA 3DRTA 4KQ4H 3O6MH 4KDWA 3GBMH 4FRWA 4E5XA 2P42B 4P99A 4DEPB 4ZNEA 1SEQH 4R4ND 1U8KB 4MVBD 4K3EL 4RAVA 4P5MA 4XPBH 2CKBB 1Q9LB 3QDJA 4KUZL 3CCHA 4ZO7A 3RX7A 3WBDA 1XIWB 4EBQH 3SDAA 5J06A 4XXDA 1DUZA 3DX7A 2C26A 2F54E 1U8IB 4C54A 2VLRE 1Y6NR 4PP2A 1VKXB 5I1DB 4YGVB 3BIKB 5DF0A 3PWPA 1DQDH 5IFJB 2OQJA 3ILQD 5ADPH 2GK0B 1W72H 2HA1A 2JE8A 5BV7H 1IBGL 3T0ED 5I8OH 1ZHBB 3H9HB 2GAZA 3SCMC 2DLEA 4RRPA 4GG8B 2ZG3A 4DKFH 3WFEH 3U0PA 2HFFB 4R8WL 1XH3B 3NA4A 1JHTB 4I48B 2Q8BL 3VRIA 5GIRB 2CJUH 1HHIB 4HWUA 2FL5A 1MJ7L 3VXTA 4LFHD 4K8RC 2VZ3A 5D72H 3RX5A 1T3FB 1HXMA 2FO4B 2Y4SA 1IEBA 1CK0H 4G80A 4XCFH 2HT2D 3LQAL 2EKSB 2F8VA 1WITA 4LKCB 2BCKA 2XQBH 1WTGT 1N4XH 3IFOB 3LSOA 3C9NA 4F7EA 2Z35B 1KNOB 4WEBH 5L6YL 1P5UA 3WS6A 1RHHA 1MH5B 3NFSH 4JZJC 5HI3C 4KDTA 3EYVA 3RJQB 5CSZB 1JFQH 3BXNA 2YA2A 3ZYZA 4HQQH 5TF0A 2R29H 2Q76B 5GS2H 5LCVH 4NGHH 3LKNA 3ZT6A 4LMQI 2XTLA 4YC2C 1KTDB 3TNNB 3VGBA 3LB6D 4LCWB 5JZ7D 2Y36H 2P46B 4RFNC 2R9HD 4DK6A 5DEFA 3STLA 1SEBB 2PXYD 4CDHA 4UINL 2DYPD 2BVPA 4GRLB 3ARFB 3HZVB 4HIHB 3PWVA 2BZDA 4OCNC 4HBCL 4NDMB 3IFNL 5E5MA 3HRPA 1YPZE 3RDTA 5IVOA 3U7YH 3TWCL 1V8HA 4IOIA 4L8SC 4XC3L 5D5MB 5I8EA 4YDIH 1AI1H 4I9WD 3U0TB 1YECH 2QR0A 3SJVD 2DS4A 1MFNA 4LEOB 5DDHA 1T5WB 1A0QL 3GB7B 3GHEL 3MLPA 2W0PA 4IRSD 4AZ8A 1PY9A 3BYYA 3IDNA 3DTXB 4PY7A 4R3SB 2WIMA 2E9JA 3QUYD 3ARBC 1G1YA 3BN9D 8CGTA 1NDMA 3V6FA 4UZGA 4APQD 4Z7OE 3DGGB 5HHQB 1RHFA 2DJ4A 3KJ6L 3D5OF 1P84K 1HDMA 4LU5L 4K8RL 1EV2E 4PUBL 2HKFH 4XHJC 4ZSOB 1JI1A 3MRFB 1E27B 3O4LB 1ZGLM 4WU7A 2EDHA 3X11B 3UJIH 4EJ1C 1FGVH 4FQQA 3ARVA 3GSRA 2YD6A 3B9VA 5C8JA 4HUMB 1XGRA 3EOAA 1EFQA 2HH0H 2M1KA 4JKPL 2CGRL 3SDXA 3T0BA 1RZGA 3O6FA 2YN3A 5FO9A 3WLBA 35C8L 5HSFA 4M7LH 3BFOA 1K9TA 2NY4C 1NGQL 3L3KA 1QFWL 3FAXA 1G9NH 4YHIA 4W6YB 2PW2B 5KSUB 3R0MA 4UNVA 4XZUB 5E9DE 5BV7C 2C3XA 4L8CB 3KPQA 4TSCH 3WLWD 4WWKC 4OZIB 2YUWA 5KVEH 3GJFH 4PJIB 4TUJB 5IG7B 1FN4B 4OD2A 4OZGA 4FABH 1ETZA 1QSFB 1TVHA 3FN0L 2LV4A 3IKKA 2FO1A 1RZIA 5GRVL 1GVIA 1NKRA 3IETB 1MWAH 1T0NB 5C09A 4LF3B 4RA0C 4BFIA 5F1NB 3ULVE 4N8VG 1GHFL 3LPWA 4KGJA 2KKQA 3EJZC 4PTTA 1PZ5A 4H1LB 4HF5H 4Y7MA 4L9DA 1RIHH 1YEKL 1NGWB 4MAYB 5E8PB 2UZYB 3MODL 1YY9C 3GEWB 5B3NA 15C8L 3QA3A 4LNVA 4G9FB 2Z31B 5F72S 1V3KA 4M5YH 4Y4FC 1A9BB 1ADQA 4KZEL 1A6WH 3BGFC 5FIEA 3ZTJH 2EH8L 2V2WB 3RWFB 1T7WA 4LSPH 4JO1L 4BH8B 1QFPA 1AGCA 1SYVA 1CZ8L 3BDXA 3RVTC 1QZ1A 3U1SL 4KQ4L 3O6ML 1MI5B 3BUYB 3GBML 4U1HB 5KVGH 5SWQA 3RGVC 1W0WA 1SEQL 5ITFA 3MLYH 4GS7C 4RFEB 3RWJB 1VACA 4Q7DA 4XPBL 2JIXA 4HK0A 3IF1B 5T1KB 2QQKH 4EBQL 3BKCL 3OAYH 5ANME 1UWXH 1NCUA 2SEBA 4OGXH 5H8DA 3D18B 4WGWB 3T4AA 2F74B 3DYMA 3C6LD 1AE6H 4WVRA 2EIZA 3V79C 1DQDL 4HCRA 5GGVY 5D2LA 5ADPL 5BV7L 3D39B 5I8OL 5D6DC 1H3WM 4GW1B 3G6JE 1UM4H 4M62H 2ED7A 3GSNB 2FEEL 4DKFL 5I9QB 5IKCA 4MD5A 4PV9A 2BVOB 4P0DA 4CMMB 2CJUL 4HFUH 3L3DB 4NWTH 5D72L 1HNGA 1P4LB 1H15A 3B5HA 3F8UB 3TO2A 4O00A 4GAFB 1CK0L 1FLRL 2NX5B 4XCFL 2EXWD 3MJ7B 2OR8A 2YRZA 3HE6D 1TIUA 5F89A 5GGUB 1FL3A 4KI5D 4FZ8H 2OL3A 4OFYD 2QSQA 1JPSH 3O9WB 5EUOB 1JCKA 3NFSL 3WFDH 1G9NC 1D9KD 1XF4A 3L5XL 2XKSA 3QT2A 3KDMB 4HQQL 2R29L 2EDOA 2XOTA 5CGMA 5LCVL 4NGHL 3ZKMD 4GAGH 5C07A 3RWDA 4LPCA 4U05A 1KT2B 3I85A 4CVUA 4KUCF 5L8KB 3L5HA 3GMMA 2A38A 1UM6H 4FP8L 1MSPA 3OR7A 2PTUA 1T04A 4D2NA 5D7IE 3U83A 3MCLH 1T1XA 2IF7A 5EZLA 1MHCB 3L5WA 3TFKC 1CDJA 1RURH 1CICB 1MCCA 1I1CA 1GH7A 2V7HA 1OB1B 1ND0A 5JPMA 1R3HA 4YDIL 1AI1L 5F3BA 1YECL 4U2ZA 4HX1B 4A6YB 2KH2B 1WIPA 2H26A 3KPLB 2XXMB 4IMKC 2BY2A 1IAOA 3QUXA 4MCZB 4MNQB 5IMKB 3O3EB 1PEWA 4YX2H 3MGOB 4NN5C 1GGUA 4NM4L 2H32A 2EZ0C 5C08D 5IQ9B 3F7VA 2B2XL 2DIJA 1O0VA 4LVOC 5D7LB 4JRXA 4BSVB 3JV6B 3QJFB 3SN6N 4YPJA 2VAJA 4H8WH 3HR6A 3SKNB 3E2HC 1KJ2B 1S7UA 3RWHB 1U8JB 4IOFC 2CDGA 2VDKH 1FGVL 1NCNA 3S4SA 3A6OA 2HH0L 3H7BB 5KVDL 5FHAH 4XMKH 4YE4H 1EHAA 1ZGLP 5DMKB 3WJJC 1FAKT 4F7TA 3KLHD 4H88H 4MD0A 2X7LB 2OI9B 1MOEA 4LCWE 4XP6H 1FFPB 2NY7H 3DVGA 1S9YB 5B39A 1UFUA 1G9NL 5D7JC 3QXAA 4FFYH 4O2FB 2R15A 2QADD 2WBJA 3VFMB 1HHJA 5DJ8B 1NGYB 3BDBA 4YXKH 3HZKB 2YR3A 3GRWA 3TBWB 3CUPB 3LQMA 4YQXL 2LFGA 4OIBA 4UV7H 1B88A 3IJHA 5I76B 2ZUWA 1R5WB 5D5ME 3I9GL 3MLZH 3PP3H 5B21A 3REVA 4EUPA 1MWAL 2FEDC 2JB6A 2P7TA 4GW5B 4FTVA 1JI2A 2CIIA 1TZGH 1CL7I 2BNQD 4HF5L 1N2RA 4QRRD 4M4PA 4HKZB 1A02N 5T5NF 1OSZA 4GAYB 5MEQA 3GMOA 5MERB 5EU6A 5CGYD 4QY8A 1ULVA 3P77B 4IS6B 4LRNL 3V6OA 1NAMH 5BVJB 4M8QB 4ZSOE 5DMGC 3O4LE 4HUUB 5SV4A 1XF5B 1A6WL 4Y89A 2FHFA 3SDXF 5KN5A 1IAIL 1NSNH 3MRGB 4NNYA 5A16A 4LSPL 5CBAB 1U3YA 4WFFD 1KC5H 1AGBA 3KXFA 4U1IA 5GSRA 1IGJB 1TPXB 1T80A 4HIIA 5CUSH 4I0PD 5KVFH 3NBNA 5HHOD 2EE9A 2IPUK 3E6FB 3MLYL 1BVLB 2JJTA 4KXZI 4P5KA 3K46A 3TN0C 4OGZA 2QQKL 2YBRA 5AG9A 1JGUH 43C9A 3BIBX 3PF2A 1FC2D 4OZGF 1EEYA 4OZIE 3O4OB 4JRYA 1FV1A 4LVHC 5DJCA 1AE6L 2Q86A 1Z0MA 2OJEA 4U1KA 3UMTA 1QSFE 2PTTB 4PJCE 1CXFA 2WMPA 4JFEB 4JZNB 1UM4L 1YC8A 2DQJH 1A1OA 1IGMH 4M62L 5CIPB 5DT1H 1A1MA 4H0IA 4LLQB 4BSJA 5C0DA 5T33H 2B20A 3IDUA 1I1AC 1CGTA 5ISZB 3LAFA 4HFUL 4NWTL 2E27H 4H8WC 4G9FE 1T2QH 3QWOA 2JB5H 5JQ6H 1NUNB 1A64A 3DIFA 2C7UA 3UYRH 3VFRA 3NAAH 4QOKB 2E7LC 4J3SA 3D2UA 1N5AA 4Y2DC 2CLRB 4XPHL 1HHKA 4UMGA 3KPSA 3T04D 3GSUB 2DQGL 3UYOD 2OZ4H 2R2EA 1JPSL 3ARTA 3WFDL 4NQCA 4Z0BH 1D5ZB 1MI5E 4HPYH 5CJQL 3IDJB 3IKCA 4BZ2L 2FYYA 4TOYH 4U7SA 4JO2H 3VFPB 2VB5A 3OGOE 4NKOB 1KN2H 4B7LA 3Q5TA 1T20B 5HGHA 3VWKD 4O2EB 4G43B 4XCEA 4P4KB 1IM3B 3LKPA 4LSRH 5B38A 3QDMA 3GMQB 3C6SB 3QP3A 2AXHA 3QRGH 4R2GD 4C83B 5D2LF 1J8HE 1MVFA 1UM6L 5CZXC 3EDJA 1SYSA 3EYFB 3VXUA 2FNBA 4FXGA 2DM3A 1V7NH 4R0LA 1S7VB 3MCLL 2DWEA 3KPOB 4GSDH 3GK8H 4H0GA 3D39E 2NZ9C 5DHVB 1I7RB 5FV1L 3MLWH 2P47B 3OF6A 4U1LB 3TVMD 3RI5K 1KEMH 2UWEA 4PJ8A 3IT8D 2RAMA 1MCBA 4H20H 2YRPA 3TH3T 1A14L 1YNKL 1AO7A 1SJXA 3OX8A 3B5GA 1Q0YL 2DD8L 3HPJB 3MV7A 5DFTA 5LJYH 5FFLA 1JVKA 5CLTA 1G6VK 5GS0D 4HS8L 2NYYC 3QB7C 4RSVA 4KJYB 5ETUB 3CH1B 4U4BA 5JW5A 1NC2B 1UZ8B 1NEZB 2NX5E 3CFEB 3NCMA 5FHBL 4YX2L 4Y19A 3WDJA 4YBHA 4UTBH 5DJDB 1IARB 4NO0A 3P0VH 3RZCB 4G6MH 4MA1B 4PJ7E 3WD5H 4XPGH 5CLWA 4H8WL 5EU5A 4MXWH 2F5BH 4Y16C 4AT6A 5D9SA 2ID5A 5CILH 1QHPA 1OGTA 5EUOE 1NCDH 4NRZB 2VDKL 1BQLH 2KZWA 3TEUA 2PO6D 4XNMB 4L1DA 1N5YH 1M1SA 4AY0A 5FK9A 5FHAL 3F7RA 4XMKL 4YE4L 5C0AB 3LN9A 4NQXA 1DVFC 5IMOA 3NPSB 3FQTB 4PREB 4H88L 1DN0A 1ZA3A 5DLMH 4XP6L 4L3EB 4LP5A 1X7QB 5FGBA 1JN6A 3PWNA 1GC1C 1Z9MA 3KPMA 4Q9QL 3MUJA 5DJZA 3C60A 4YXKL 1C5DA 5DJ2B 2Q7YA 5E1AB 2O93L 1VFAB 3NZHH 5IB3A 3VWJA 1HSBB 2X4RA 1Z0NA 4UV7L 1LEGB 4MA3A 2AJXL 4ODXA 5DC4B 4X9GA 5FUCC 2CPCA 1HZHH 5DUMH 2DQFA 4Z77B 3ARDD 2YSSB 4OF0A 1H3PH 3WIIH 3ZDXF 4ODSL 4NPYA 5CP3H 4MNQE 5IEHB 1UENA 5CEYB 3FB7B 2KZ1B 4JPVH 1NFKA 5F7FA 3MRKA 2QV2A 1ZS8A 1Q9KA 1A7NH 3GMRB 3PGCB 5I6XB 5D7LE 5J12C 5SX5H 5IR1B 5TE4H 4F2MA 3HNTH 4WHTA 3SKMB 4PJAA 5DR5H 4EKXA 4BKLA 2ICWJ 1KC5L 1R3KB 2D31B 3LEXA 1XF3B 3I3DA 3BH9B 1JPTH 5C7XL 2W1NA 1ZEAL 3ES6A 5CUSL 4PJDB 2BRQA 1ED3B 2ILLA 1FCGA 1BD2B 4HD9A 5HI5C 4OAWA 5BXFA 1TTUA 4NJAH 3TNMB 3M17B 4RMWA 4G42B 4HG4J 3FT4A 2B1HH 4GRWB 5I1JH 4ZS7H 1T22B 4KHXH 2W9LA 1JPFA 3ZE0E 3MNVA 5ID0B 1QSED 5DURB 1B0GB 4W70A 2V9RA 2VL5A 5C0IA 4XCYB 2DMCA 2XY1A 1GC1L 4Z7NE 1OSPH 3MV8B 4CN1A 4ELKA 1QQDA 3HB3C 2EC9U 5CP7B 5F3HB 5CHNB 3WFCH 4QHMB 1CD1A 3DHMA 4H1LH 4Y4KB 4P2OA 5A43C 1FZJB 1UG9A 3NN8B 4P23D 2DM4A 4IIQA 1KXVC 1CQKA 3NFNA 3QEGH 4NKQB 1KIRB 3RHWF 4ELMB 2E27L 2V2XA 5CFHA 4QEGA 3FB6B 4GBXD 1T2QL 4ZAKD 2JB5L 5JQ6L 3HPLB 4NP4H 3B6SA 5FYKD 3BMWA 3UYRL 3HAEB 1P2CA 1JUFB 4DQOH 1IGCH 2RCSH 4EEEA 1X5FA 3KGRA 3HFMH 4JJHA 3F12B 2VISA 4XNZB 5JTWA 4NZDA 1S7XB 3GIZL 5DD0H 4XXCC 4HPYL 1YEGH 4Y0GA 4NCC1 4XP9H 3BMVA 4TOYL 4JO2L 4LCCC 1CE1H 3U36A 1S5HA 2EEAA 2EH7H 3CMOL 1CLZL 3WFZA 3EFDH 2VXTH 1YYML 2DTML 4LSRL 4LLDA 2NLJA 1DTUA 5CEZE 3ARGB 5I66A 3QRGL 5BW7A 3FQWA 2K9UA 3CFJB 3WFHA 3PXJA 1IE5A 3MRHB 5KSAD 1V7NL 5IEKB 2F58H 4WWID 3AM8C 4V1DD 1KB5A 4GSDL 3GK8L 4JFEE 5E6IC 3WHE1 1ORQA 2AV7B 4OTXH 1DQTA 4KK9C 5DQ9A 3K0WA 2JCCA 2IFFH 3QWRA 4H20L 2CIKB 1OAKH 3QPXH 2DI7A 3EGSB 3LPGA 1V5JA 3BPNB 1PY4A 4Z7WA 2F54D 2GFBB 2VLRD 1FNGA 1RUMH 3O2VH 1S7QA 1AGFA 4JCLA 3WUWA 4JHZA 4NN6B 5DVLA 1ONQB 5GISL 3A67L 2VLLA 1QLFA 1Y0LB 5T1LA 3CFBA 1FH5L 3FT3A 4DN3H 3P0VL 1MCJA 3WD5L 1I7UB 4XPGL 4FQ1H 4PLJC 4MXWL 2F5BL 5DRXB 1CXIA 1UH4A 4N9GA 4NQDD 3VE0B 5CILL 1LK2A 5TDPB 1MHEA 1NCDL 1UXWB 3RNQA 2VR4A 1WTLA 1BQLL 3M45A 5SWSD 1JF1A 1QRKA 3V95A 1N5YL 4PLOB 1FNAA 1JZ4A 5HD8D 1T1ZA 2W9DH 1U41A 3WEXB 1LDPH 2VN7A 2GY5A 3BWUC 4JFDA 5DLML 1FNEB 3KYMA 3RVXD 2ZSVA 4XBGA 3OJDB 3CZFB 2DM7A 4UQ3B 3MBED 1EAPB 2VQTA 4X9BA 3MTRA 5DVNA 5CZVL 2BK8A 2UWEF 3DV4A 3RVWD 5MEOB 3NZHL 3S88L 2IQ9H 2YN5A 3LS5H 1E4KA 3QUMA 4RGMC 3ULUE 1E4WH 5I15H 1F11B 1AHWA 1D3CA 4OZHA 3D25B 3DBXA 2YPKA 2FD6L 4WHYH 2X42A 1K3ZA 1L0XA 5F1IB 3T09A 3BP6B 1RK0B 4LPTA 3D0LA 5CJXC 4PJGB 5JW3L 3DV6B 1H3PL 3WIIL 5E8EB 3LMJH 3BZ4A 1FL5A 2JLLA 4FQ2H 1HINL 3PV6A 4DN4L 2PYEE 4JPVL 5DYOB 1OWRM 3QEQA 1BQUA 3WDIA 4X0KB 4Z6AT 4OZ4B 3O2WH 5IESL 1PX4A 3B9AA 1FZKA 3Q6FB 1ORSB 3QAZC 3MLVH 5HYSA 3HNTL 3L95A 4D8PA 3RTQC 5DR5L 1U42A 2XZAH 4PJ5B 4P5TA 5F6HJ 1T0MA 1KUMA 1S7WB 5C0AE 4F7MA 2IQAA 3UTQA 4XRCA 2Z92B 3UTSA 3BW9B 4L3EE 4NJAL 4J4PD 4M9OA 1RZFH 2MQ3A 1ZMYA 3JBG7 5D70H 1ZANH 1FG2B 3CVHL 3P73A 1CR9H 4G9DA 5I73B 3SPVB 1TQBB 4MDIA 3MPCA 4ZS7L 1J0KA 2ZKHL 1A4JB 5CD5D 1BZ9A 4KHXL 2DWDA 3RAJH 4ZFFB 4ZG1A 2RIKA 2GJ6A 1MJUL 1ZVHA 4MZ2A 4Z7QE 4XP5H 5FM4A 5HJ3B 1FSKC 1OSPL 4KMQA 2I5YH 2YPLA 3RJDA 2XPGB 4QGYA 2FLRT 1PG7W 3LKOB 3DROA 4I5BA 3DUUB 1HCVA 3WFCL 2AK4B 4DOHB 3G6AA 4XWGL 5E9DD 2YK1L 1EFXB 1TETH 2HKHH 3QIUD 4UOW1 1ZLWH 2ZOLA 5EBLA 1I7ZA 4MWFB 2A1WL 1SJEA 1T66D 1P4BH 3QEGL 1MCNA 1CGWA 2BOBA 3MRQB 1UM5H 4PJAF 2XWJA 1A6VL 2DJSA 1OQOA 4NP4L 3EFFA 4BQBA 5IIEA 3ULVD 1IGCL 2RCSL 5I0ZA 4HJ0D 1SM3H 4KV5E 2VNCA 4L4TA 2VAAB 3HFML 4N9OB 4HGKC 3DURA 4QLRA 1I9JH 5C0BB 2Y1VA 4PJDE 4UUJB 4FQHB 3IDGA 5GZOD 1BD2E 5E5RB 4EIZC 1YEGL 3WO4C 1INDH 4XP9L 4U7KA 5HHPB 1MJ8L 3S5LB 3QZWA 4HS6A 2XQYK 5AZEH 4I4WA 4PRDB 3VFOA 2EH7L 5I1IH 4MQXD 2VL4A 3EFDL 1YEJH 3WJLA 1H3GA 2BC4A 3KNBA 4U1SB 3BOVA 5AYQA 4F8QA 2ZJSH 1TVBB 3MV8E 1P4IL 5GZNC 1DDHA 5D7KE 3IYLW 1D5IH 4PGEB 4EI5D 1Z9LA 3TV3L 3UAJD 3K1DA 1P1ZB 2CQVA 3D87B 2IFFL 4OI8A 3VI3E 5C0GA 3C5JB 5EIIB 3UTTB 5F1OB 2R39A 3WS3A 4CVXB 1OARL 3SJVA 5KZCD 3EYOB 3BAEH 3O2VL 4WTZA 1ES0B 2YD9A 1FYTA 3WNPA 4KK5C 4ELME 2ICES 3DXAA 3NOIA 5I1LA 2X4QB 1WWBX 4OFKA 3TBYB 4G6AD 1KYOK 1Z2KA 1HHHA 1QO3A 3FQNA 1KIPA 4ZUSB 3EHBD 2GJZA 3ZSTA 3RL1B 4N0YH 1WC7B 1J12A 1I1YB 3VXQB 5GS1A 5D93B 1KJMB 5F7DA 5E08H 1FC1A 5CKAA 4GMTL 3ALWA 1S9WB 3PL6B 3M8OL 4ODTH 4X7FC 2YUZA 12E8L 3OL2A 3N06B 3H42H 4CJ1A 4Z78B 4Z7UB 1MRDH 4FQ1L 4GJTB 4ODVH 1CFVH 4OKVB 3RGHA 1BFSA 3PWUB 4N90E 2D7MA 3RNKB 5D1ZA 3DECA 3TJEH 3ZKXB 1TZIA 4HUXA 2IBGA 3RFZC 3CK0L 2W9DL 3IDIA 4CDGC 1ZWIB 4X4YB 2A0LC 4L1HA 1HEZB 5IV2B 4CADA 1LVEA 1PFCA 4MB5A 1XZ0B 4QRPB 5FOJA 1PYWB 5M7QA 2AEIT 2Z4QA 1E0OB 2JCCF 5FO8A 1M4KA 2IQ9L 4H26B 3TPUA 1E4WL 2X1PA 2XKNA 5I15L 4XPAH 1LO4L 3EOBA 5JMRA 4MX7B 4Z7WF 3QQ3A 3EOYG 2L7JA 1HN1A 1HXYA 5T1DH 1KIQA 4FQXC 4RDQG 5L88L 4N0UA 5FA3A 4XP1H 2FECI 1S78C 1V3JA 5I30H 4KHTH 5BOZG 2IPKA 1CE6A 4K55A 1NC4A 4I77H 4UT9H 2IEPA 1R5VA 4FQ2L 3MUHL 4ZDHB 1NFDB 1TDQA 4H25A 4L8BB 3RPIA 2NXYD 5GRWA 2CDEB 3OAUH 4DK3A 4J12A 4LHUA 3V5DA 5CCKL 1UXSB 5J1AA 3O2WL 3KR3L 2P5WB 1NJ9B 2KDGA 2IPUG 5AAWA 3FQRA 1MCPH 1U6AH 4ZNCD 4JQVC 3HLAB 3NCJH 3BHBA 1MCKA 4QRTB 4CKVX 1EZVX 3GIVB 1T6WA 1YN6A 4UTAL 1Q9OA 3UJJL 3BDYH 2QKIA 4HXAL 5DVKA 2D7OA 1G7IA 4MAUH 2KPNA 2VDNL 4TTDD 2H45A 4W81A 5DFVD 3C5ZA 3MLSH 3SDCB 2VSCA 1CR9L 3W0WA 4JFXB 4LP4A 3SQOH 2MPAH 4OZHF 4XAKE 4FQIH 1WZMA 2HVKB 2VR9A 2FGWH 3SDDA 4XCNA 1XCQA 4B5EA 4ZUVA 2C1PA 3C6LA 3VD3A 4XP5L 5C0NC 3P4NB 5IW3A 1YZZA 4WI4A 2COQA 2I5YL 4IHOA 4GRMB 1NCAH 1I3UA 2M26A 4Y4HD 4LCWD 4PYHA 1X5YA 4NWUH 1Q1JH 5FGRA 1JL8A 4LDEB 1GRWA 1IAKA 1XGUA 1K2DA 1E6OL 1UH2A 2A83A 1WLHA 2DBLH 5EG6C 2FIKA 4RAUA 1TETL 3FQXB 4GRLD 3PIQB 3ARFD 5EOCH 2HKHL 3PWLA 5TE6H 1I8IA 1CVRA 3H9SB 2A6IB 4BSWB 5D1XA 3MLTA 1CTNA 4UIKL 2HP4A 5JR1H 1WBXA 5IT2H 3QUZD 2O5ZL 3IXTB 2JK5A 5MEPB 3B9KD 3ZTNL 1B90A 4L4JA 3C2AL 5IVNA 4M43L 4MNHB 3R06A 4LIQL 1GIGL 3FRUB 1SM3L 4OGYH 1YMMB 4TQEH 2AEPH 4PJ5E 5HVGB 3W9DA 3RVVC 4IDLA 4NN7B 4P3DA 2VXSH 4L9LB 1HYSC 3T3PF 2X44D 1KTLA 4TNWF 4EXKA 3BQUA 5J13B 1D9KA 1INDL 2NXZC 3NVQA 5ID1A 2X4TA 1YC7A 4M1CD 3VJ6B 5I1IL 4GRWH 3SDAC 1RJYA 2V17L 1KBGH 1YEJL 3STBA 4X6FB 1PBYA 4KJPD 4QHLB 1A6AA 1WGOA 2ZJSL 5B8CB 4JFFB 3DO7B 3HC0B 3I6GB 1D5IL 1U8PA 4KTEL 4NFBA 4N68A 1ZE3C 3RY4A 2AK4E 2W91A 4G6KH 1OQXA 1VESA 4DOHE 4CW1A 1M05B 2I60H 1INQA 2HTLD 3MCKB 4R7NA 2EDBA 5F9JB 3LQZA 3QIBD 5KG9B 3PQYE 4YDLB 3BAEL 3O8XB 4S1DC 3RZCC 4HHAB 1QSFD 1M7IA 4YEEA 1AD9A 4Q6IA 1BOGB 5J6HB 2KQMA 3O3AA 1PJ9A 3KPPB 4HC1L 3O3DA 5IK3B 4N0YL 4UNTA 3HAEH 5E08L 5E8NB 4KMTH 4ODTL 5C08A 1D6VH 1MRDL 4DCQA 3BP7B 5GQBA 4ODVL 2W0FA 1CFVL 4MAYD 5C0BE 4D0DB 1DEEA 4Y5XC 4O2CB 1AC0A 3V6ZB 2IH3B 5E99L 1F3DH 1XR8B 1D5BB 5J1TC 3HMXA 3LV3A 4G9FD 3UX9B 1R24B 1MFDH 2Z31D 2PUQT 1U36A 1EAJA 1NGZA 2X9WA 4PY8J 4LSSH 4PRNB 1OWWA 3B9EA 4XHQA 4C55A 3WN5B 4C56B 1ZT7B 1DN2A 3EYSH 2G9HA 2P43B 3QXDB 3MBXL 3QIWA 1DLHA 4JM2B 3T0VA 4F3FB 1LHZA 4MXVE 1MI5D 1PKQA 3L5IA 2WWMC 4JVWA 2ORBH 4WCYL 5CD3B 4QWWD 2VWEC 3ME0A 2D7NA 5C0RH 5T1KD 5T1DL 4YAQA 4XH2B 1A2YB 2A9NH 3UTTE 5EULV 3WCYA 1VFMA 1A1NB 4WTXA 5I30L 4KHTL 1HHGB 5E94A 4XAWH 2DQEL 1BFOA 1J8HD 3FO0L 4I77L 4UT9L 5I6XC 3RUGA 5A40E 3TIEA 3AC0A 2IMNA 4OJFL 1B3JA 2YHGA 2BNQA 2DI8A 2QJDA 3AMKA 1S9VB 4YXHL 5HY9B 3G08B 2VZOA 3OAUL 4DVRL 2ZG1A 3BO8A 4P46C 2UZIH 4PRPD 4HWBA 4L3CA 3FQUA 3DMMD 5IBTH 4HT1H 1S7RA 1OVZA 4FG6D 5K9QI 4I13B 4Z7UE 4YHOH 1A7OH 4EI6B 3FT2B 1MCPL 1U6AL 3U7AA 2A74A 4S2SA 3P4MA 5IHZA 2ERJC 1KSRA 3NIDE 2DLGA 1BX2A 3MREA 2DIBA 4WENB 3SHSA 4GQPH 1L6XA 1LGVA 2OL3H 5HHOA 4ZXBB 1D5XB 4WO4B 3LIZH 3MLSL 2H6PA 5D1QB 4QRPE 3VXSA 3X13A 4KC3B 2P8PA 1J0YA 5KOMC 4WV1B 4I3SH 4LCIH 3SQOL 3PDOB 3TLRA 1ZSDB 4P3CH 4FQIL 3HS0B 4LPXA 3K4DA 2DLTA 3IFLH 1BHGA 4PRBB 2FGWL 1BIIA 2NY5H 4WFGE 1FVCA 4IRJB 5BJTB 1OD9A 3JV0A 4BZ1H 1M7DB 4ZFZA 1NCAL 3OKKB 4LLMA 1QSZA 4NWUL 1Q1JL 3MRDB 4JZJA 1A7BA 4ZFOL 4D0CA 6CGTA 4U1NA 2J8UA 5EN2B 1TENA 2BERA 4GLRI 4KJWC 3P4OB 3EJYD 2DBLL 4S11A 1NFDE 3LY6A 5JNYA 3T0AA 2NNAB 3LRSB 5TE6L 3LDBC 1CICD 4GXVH 5EFIA 3MA7B 5JR1L 1RJZA 1NCCH 2Q6WA 5IT2L 4P2CG 2EC9T 1WCBB 4CL7A 2FHCA 1G7PA 2P5WE 3LRGA 1WT5A 3SKOB 1YQVH 1R3LA 2ENYA 1EDQA 1WFTA 1XAUA 2FJHA 3BEVA 4YBQC 3U6RA 5I16A 5L9DH 5F7LB 4QRUB 2EDJA 3W82A 4F7CA 2BHYA 3UJTH 4OGYL 4ODUB 4TQEL 3MRMB 2AEPL 2DM2A 4CRPA 4FQCH 1JZ8A 1NDGA 2IH1B 2VXSL 3VMNA 3ZE2E 4O51B 4F7PA 4J3WA 5L2JA 4PGCB 2AKRB 4YR6A 1I4FB 3MRRA 3CX5K 4G8EA 5D7LD 3G5VA 2R8SH 1P6FA 5F21B 3MRBB 3BSZH 3VWKA 3ARBA 3HE7B 3SOBL 2Y5TB 1A3RH 4NO3B 2P24B 3VMOA 5ESAA 1SJHA 3BVNA 1K4DA 2GT9A 2NY0D 5C1MB 3REWB 1KPVA 4HBQA 2AEWA 1K8IA 4G6KL 5IB2A 1OAUL 3GM0A 4L4VB 1DBJH 5DJ0B 2I60L 4RGNB 3PG2A 4NN6C 2VABB 4QCIA 1FJ1A 1CG9A 3H9SE 3LN5B 4LSTL 2AVGA 5HI3D 5BQ7B 4K94C 4NQTA 2CLZA 1FVEB 5JLZA 4MJ2A 1W72A 4RIRB 4D9LL 1PEZA 3DRQB 4KI5F 1WEJH 4NRXA 4KMTL 1YMME 4ZTOH 4YHMH 4OM1L 1ZHKA 1FZMA 3UZEA 2VTFA 1FFNB 1QNZH 4ONHB 3V4PH 2PN5A 3GSOA 5HGBA 1UYWH 4Y5YB 4JDVA 4OLWL 1ADQL 5JIIA 4ZTPH 1F4WL 1VCAA 1KLUB 5F9WB 5JW4R 5C0CD 4HJGA 2G5BB 2P5EB 4YHZH 2VOTA 1C08A 4LSSL 2AXFB 3HG1D 5DI8B 5HYQB 5FCUL 3GMNB 1XGYH 1MCWM 3VRJA 3L3HA 3LKQA 3EYSL 2NY5C 1QR4A 3I6KA 2F19H 3VFGH 1YDPB 5EBMA 4NO5B 4JFFE 4UDTA 4S0SD 3B3IA 4Y4FA 5KBNC 1MCHA 1MLBA 2ITCB 2ZOKA 5HGDA 1T1WB 4E9LA 5CJ5A 3DRTB 2LU4A 3E8UL 2VC2H 5C0RL 2FR4B 5FYKU 2GEEA 3UZQA 4NQEA 1ACYL 1ZA6B 3WIFA 5I1EH 4LLUB 2PXYB 1CDCA 2YXMA 3MV9E 3SO3C 2XYCA 5CEZD 3QHTC 4POZD 2DYPB 3MR9A 5GGVH 4YIQA 4XAWL 2Y7QB 3IDMA 2UUDK 1DUZB 2V2TA 1RK1A 3ARDA 3RGVA 4OFIA 5CMAB 1UWEL 1VFBA 1JWSB 4J1UA 3EDEA 1AXSB 4JFED 4XI5C 2BOCA 4PG9B 3PWPB 1U3ZA 3K74B 2GUOB 4M02A 2MSPA 3TA3A 2BVQA 1WZKA 2UZIL 3UDWC 1YUHB 1P6AB 4HT1L 1SBSL 4K94L 4PB9L 1G0DA 1NBYB 4IRSB 1P7HL 2OMNA 4NYLB 2VQUA 4Z0XA 3QHFL 2ZUTA 4MXQD 3QUYB 3BD5A 5AAMA 4PFEA 5D6DA 5BRZA 1N3NA 2J3SA 5I73C 1OAZL 5F7KC 3DJ9A 3UZVB 2V7NB 1U3HB 2B4CH 2A9MH 2OL3L 4LHQB 3VRLF 1UJ3A 2MQ0A 3VFVB 4H0HB 1IEBB 1GXEA 3BESR 4G80B 4C56E 3LIZL 2XN9D 1KJVB 1BMGA 1JPGA 4AG4L 2BCKB 1YNLL 3D0VA 3EYUL 5KANI 2LU7A 1TITA 4I3SL 5FECA 1FYHB 2H2PD 2I9LB 4P3CL 1RHHB 1I85C 3UPCA 4FFVD 4D3CH 5KSBB 1YY9D 2UYLB 1IKFH 2NY5L 3U4EA 1J05B 4K23H 3EYVB 2NTFB 4R97B 2IALB 1BBDH 1A7PL 3L3IB 4XNYL 3BKJH 3K8MA 1QRND 4OCXH 3TESA 4MNGB 3N50A 3RUGF 1QLEH 2XTJC 2APFA 3LKNB 1UB5B 3KYOA 3MLUH 3OQ3B 4IBLT 4ONFH 5HPMB 1RIUL 4X98A 3STLB 3RVTD 4PR5B 3ULUD 4QXTB 1WF5A 1YEDB 1CFTA 4Z95H 1JNHB 3P0YL 4IMLA 4BH7A 3EDDA 1ZHLA 4GXVL 3PWVB 1FZOB 1NCCL 1U93A 5F1KC 3MOAH 2DOCA 3CSBA 5SX4H 2NY3C 1YQVL 5L9DL 4N0FB 4HS3A 1MWAA 1F4XH 2XWBA 2XQYG 3UJTL 3HKFA 3N9GL 1U8MA 3HZYA 2PYED 4PGBA 2IANA 1J11A 1SMAA 4HULB 4FQCL 1NC2D 2C4FU 4PY7B 2F53A 1ZLVK 3VXMB 4ODWB 1DQLH 3V0AC 3MFFB 4S1SL 3FB8A 3FOLB 1C16B 2CO6B 2R56H 1IGYB 5FA4B 4IMKA 2JJTC 3VDCA 2DQIL 2R8SL 5E6YA 4E42B 1M6OA 1VEPA 3BSZL 2H3NB 3ARQA 4YHYB 4GKSA 1A3RL 4WU7B 4QRQA 5EU7C 4U0RB 5C0AD 3CSGA 3GSRB 2HN7B 2J8UF 1YEIH 4UILH 3QNZA 3O6FB 2XFXA 2IWGA 4MB4A 3ZKND 2P8MB 3GRWL 5E00A 3TBSA 3WLBB 1Y6KR 5HYJD 4PRID 1XR9B 1A6TB 2HRPH 1DBJL 2FSEB 2BY1A 4JM4H 2GCYA 2EDLA 3QG6A 4MCYA 3WJJA 5I17B 7CGTA 5DEGB 5LWYH 5ESQA 5D93C 2F54A 3GKZA 5EO0B 5T5FH 3L1OH 2EC8A 3BP4A 2MHAA 3PWJA 4RISH 2A77L 2GTWB 2CR6A 2GHWB 3ZKXC 3V0VA 4HKXA 1MRCH 4ZTOL 1X5HA 2B4CC 3N1PC 3MRNA 3V4PL 3QO0A 1UYWL 1LO2L 1TCRA 2UVEA 2AJYL 5I18H 5BZDB 2A6JB 4Y1AA 4LSDA 4ZTPL 1U8NA 5T3ZE 4EDXA 4LIQE 4HIXL 2IADB 3LKSB 1DUYB 3L3JB 2FECL 3HE6B 3O45B 5JOPE 2FWOB 4MMXC 1XGYL 2XKUA 3VXRE 3GHBL 5HYFA 1UZ6F 2XG4A 1UQSB 4JB9H 2F19L 3VFGL 4JJ5A 1IKNC 3TZVB 1U95B 3MBEA 1BD2D 4YO0B 4JKKA 3ZE1F 4KU1A 3VH8B 2OSLA 2EDXA 2G5RA 4PJ8C 3HTLX 4DGIH 5F6IC 4JFHE 4L4VE 2EZ0D 5ITFB 4RGNE 3VFWB 5I1EL 4WW1A 5C2UB 3D85D 5BS0D 4MJ6A 4G3YH 5DURD 5JO5A 1S9XA 1G6RB 3R4DA 5FYJL 3UPRA 5IJKA 5GGVL 2OP4H 2P45B 3ARWA 3KYNB 2AJ3A 4Y5VC 3GSVB 5IVZB 2C5DC 3MV8D 3JZ7A 5D7KD 4MLIA 5JOFB 1F2XK 4HGWB 4ZPVB 1W8OA 1YPZA 4X5WA 1RZ7H 5ALCH 4OIIH 5D2LB 3BD3A 3VMPA 3C5SA 5I1HH 2XZCL 4HFWA 4Y4KD 2QHRL 4J3TA 3VFUB 3ZL4H 5DQDH 3OTTA 5T1MB 1YMHA 5EOQH 5IKCB 4F57L 1GYAA 4P59L 3SDCC 1FRGH 2OJZL 2P5EE 1KPRA 4Q0XH 5AG8A 3QPQC 5HGAA 3TO2B 1WBYA 1V7MH 2XV6B 1J0JA 1C12B 1MCSA 3QFDA 3MA9H 1NGXA 3P30H 3C60C 3SGEH 4N90D 1CFQA 3RKDC 1VEOA 43CAB 3D3VA 4D3CL 4HZAA 1W0VB 4ZPTA 1IKFL 1UADC 4K23L 1JZ2A 1BBDL 3BN3B 5GGQH 4ZNEE 1F6LL 4OCXL 4NUGH 2YMXH 3WNOA 1NKOA 3RWEB 4CBPA 5IGXL 5ACZB 3MUZ1 3CMGA 1QLEL 2NY1B 2IBZX 5E2JA 1FFOA 3OR6A 1GAFL 1AR1D 4RMRA 4ZS6C 1IC7L 3VW3H 5E9DA 1U92A 3PHSA 4ONFL 3TBVA 3AROA 5F1SA 3PWPE 3OR7B 4JVPA 4I9WE 1G7MB 4UOJA 3ZYOA 1OP3K 3L5WB 4EN3A 2X89D 3MOAL 3FL7A 2VJXA 2ADGB 3TN0D 4P9HH 2KBGA 4QRRB 4BYHA 4NNXA 5J13C 3RRQA 3UTZA 1I8MA 4XVTH 4YBLC 4JY6A 2AJZA 2M2DA 5HDBF 4JHBA 4F58L 1ITBB 4MHHI 1LDSA 3VH8G 3E6HA 4KKBD 1IC4H 5EO9A 1JP5A 5AD0A 1Z3GH 2G2RB 4JZOA 4OSUH 3L9RB 3GBLA 2R56L 4U6YA 5B8CC 1H5BA 2PTVA 4P9MH 1NAMA 2ARJB 1I9IH 3WIHH 5C92A 4WUUB 1BBJA 4RA3A 4JRXB 3SGDI 2HLAA 4I0PB 2CDGB 3STZA 2R69H 3IXAB 3ZO0A 2EIEA 1TJHL 1LEKA 4UILL 3ZLQC 4MNGE 4RWHA 4Y16A 4Z5RA 2BHZA 4TNWK 4AIZA 3OKNA 3DVNB 4EI5A 4F7TB 1MJJA 3QUMH 3T2NH 4CNIB 1RZ8B 1HH9B 4WW2B 1OHQA 2NPLX 4P2OC 4XAKD 5ANMA 3DO3A 4BQ9A 4WI7A 2Z91A 1DVFA 2YUVA 5LWYL 4DW2H 4IIQC 4NO2A 5T5FL 3VD9A 1IGTB 1L0YA 3L1OL 5DJYA 5GGRY 4JDTL 4X6CA 5DA0B 2IBBA 5K59F 2R2BA 2PKDA 3G6JA 1Z5LA 1JNNH 3REVB 3TIDA 1MRCL 1VENA 3DWTA 2EE2A 4HKJA 3F5WB 3ARED 5CZXD 2HFEB 5GJTH 5I18L 3VXME 3IJYA 4U2YA 4P2YA 5ICXA 1JGEB 1UB6B 4HLZG 1N0XH 4OLYH 4K7FA 3MCG1 5MEQB 4WNQA 4JM2C 4ODHH 3FO1A 5EU6B 3IGAB 2ATPA 4HIEA 2CRMA 5EU3A 3MLXH 1JIBA 1PG7H 3GGWB 4WY7H 1N7MH 4PJ5D 4X6BB 5BW7C 4KRLB 1F8TH 4JB9L 5TDNA 1RFDH 5F9DC 2Z93B 4NSKB 1OF2B 1EEZB 2NYYD 2QQQA 4X8JB 2OZ4A 4U1IB 3G6DH 3SDXE 1MHHB 1KB9K 1U8HA 5ICYB 4PGJA 4OB5H 5HBBA 1U8KA 5LG1A 2CKBA 4DGIL 4R2GB 3K80A 1XIWA 4KROC 4PBVC 1RZKH 3FO2B 2V5TA 3W5MA 1K6QH 3HMWH 1U8IA 1OGAD 2OP4L 1QA9B 2JJSC 2ZUYA 4WJ5A 1VKXA 5I1DA 1EEYB 1QBBA 4YGVA 3BIKA 3I84A 1IZJA 4WHDA 3TVMB 1FV1B 5DUBA 3CU7A 5DHYB 5IFJA 4P9HC 3SDYH 2Q86B 4O9HL 4RBPH 3O11B 4MQSB 1RZ7L 3H9HA 1EEUA 2A6DB 1NLDL 5I1HL 3I50H 1VADB 5E7FA 3Q5YA 1EFXD 1A9EB 2A6KB 1A1OB 3ZL4L 1WUNT 1N59B 2HFFA 5DQDL 1B0RB 5L2KB 3PQYD 1QFUH 1JHTA 4I48A 4WO4C 1TFHA 5EOQL 5GIRA 1HHIA 4UAOC 1FRGL 3OKMB 1AQDB 4JHAH 4WV1C 2FO4A 3VGHA 1EERB 1G1CA 2D0FA 4Q0XL 3ARZA 2EKSA 5DZNA 5DRNB 4LKCA 1QFWI 5L0QC 1K8DB 3IFOA 4PJ9C 1L7IH 3MA9L 1KNOA 3TT3H 2V5MA 3O41B 1HQ4B 1IC5H 2MWCA 2PO6B 1ZVYA 5C0BD 1MH5A 1MELA 3H8NA 2HWZH 1E4KC 5MHSE 5CSZA 3VD5A 1E6JH 4P4RA 1QD0A 2Q76A 2PCPB 3BPCB 5GGQL 4GQ9L 3FONA 3O6LH 3MFGB 4G7YH 2IAMD 4XWOD 5KS9A 1C7TA 2OS7A 1OL0A 3TNNA 4EUPG 4LCWA 1KB5L 1IGIH 2E5EA 1DANT 1MRFL 4XCEB 1HIMH 1HOCB 2JJWA 3VW3L 3LH2H 3SGKC 1SEBA 3ROLB 2W65A 4LCCA 4GRLA 3ARFA 3HZVA 4HIHA 4XNXL 1SYSB 1H8SA 4NDMA 4R0LB 1PVHA 1YEFL 4O5LH 5J6GA 2DL2A 3RA7H 4NM8H 3SE4A 5D2LE 3D69B 2WZPD 4XP4H 2ZCHH 4UQ2B 2HTKD 2VDPH 3UTTD 4OLVH 2R1XB 4MA7H 5D5MA 1LO3L 2BXYA 3U0TA 3S36L 3MV01 1DCLA 4LEOA 5E6IA 1T5WA 1QBLH 2DJUA 1EA9C 4XVTL 4X4XB 3ARPA 3ZHKA 4Z7OF 3WKNA 4R3SA 2H9GB 4RQQA 2NY6C 5ESVA 1G0XA 3HR5B 1CGSL 4ZO9A 5HHQA 4OSUL 5JW5B 3PL6D 5ENWA 5IOPB 3C8DA 1CFSB 4R4NC 4YPGB 1I9IL 3AY4A 3WIHL 5I75B 4ZSOA 5DRWB 3MRFA 3O4LA 2PR4L 3BISA 3K4AA 3X11A 3GI9H 4KVCH 5EB9A 2Q3AA 2BNUB 4M1GL 2R69L 4ZYKA 1RZKC 3SKUD 1C8PA 2N1KA 4NKDB 2FB4H 5DSCB 3X14B 4YHNB 1CD0A 3ILQC 3T0EC 5C07E 1QSEB 2FEEI 2QEJA 3QUML 1KN4H 5E8OB 2PW2A 3T2NL 3JVGA 5KSUA 1BQHB 2CK2A 3PWNB 2W0LA 1L9MA 3BPLB 1MAJA 3SE9H 4GAJL 3W39B 5DD3H 1HH6B 1RPQA 4QTHB 1YYLH 1R0AH 1IFHH 4DW2L 5DJZB 2Q8AH 4RMTA 4PJIA 4TUJA 1KELL 1UCBH 5IG7A 1FN4A 3T0XA 1QR1B 1F42A 3ARXA 5IBLD 4GG6B 2AQ1A 4MA3B 3IETA 1T0NA 4ODXB 2HT2C 1LEIB 4LF3A 1JNJA 1JNNL 5F1NA 4M61B 2E3VA 2VKWA 3QI9B 5FYLE 5D6CA 4NFCA 4H1LA 4MJIB 1J1OH 5GJTL 5E24E 4X7EC 1NGWA 4GBXB 4MAYA 4ZAKB 5E8PA 5I71B 1N0XL 4OLYL 2CMRL 3FFCB 5H2BB 1ZGLA 5D2NB 1J1XH 2P5WD 2XI9A 5DC9B 4WFFE 4WUUE 5E56A 2JKXA 1A9BA 4JRXE 3WJLC 2A73B 3INUH 1CT8B 1PG7L 2V2WA 3RWFA 5B38G 4WY7L 1N7ML 3LB6C 5JZ7C 1F8TL 4G5ZH 1Y18B 3HRZB 2R9HC 5EORH 4BKLB 2Y23A 5FO7B 4YFEA 2PXYC 3ALPA 3G6DL 2AW2A 2FJGB 4O02H 3EOTL 2J1KA 1MI5A 3BUYA 3RTQA 1IT9H 2X6MA 3HCVB 3RWJA 4RFEA 3BKMH 1HQRA 1E4XH 4HUKB 3NIGE 5A2KH 4M3JA 3KWWB 1OAXH 4OFVA 5KSAB 1WFOA 3D18A 2VO5A 3MGTB 3OB0H 4X6CF 4V1DB 4NHCL 2IGFH 2F74A 4D0BB 3MNVB 4Z7VB 4LPVA 3G6JF 3W81A 3SDYL 3AU1A 5ALBL 3HC3H 3GUTB 1EUUA 3H3BC 3BN9C 4EOWL 1GGBH 3D39A 4M7JH 4APQC 1FIEA 4GW1A 2ENSA 1KCUL 4KJQD 2DQTL 3I50L 2XA8H 3GSNA 4PJBA 5JA8B 4FTVE 4BELD 4UDUA 4OV5A 3H9SD 2VQ1B 4CMMA 1HK6A 2WQ8A 5D1ZC 4JHAL 1GGYA 1J88A 2ADJB 1P4LA 3CLFH 2FGZA 5EU6E 4LLYB 4OKDA 3V6OE 2NX5A 3MJ7A 3L5JA 2LTQC 3B6SB 4NQDB 3QDGA 5GGUA 4CMHB 1O7VA 2DDQH 5SWSB 1L7IL 3EBAA 2YD4A 1FO0B 1KOAA 3QCTH 4AEFA 3P2TA 5EPMB 3O9WA 1EK3A 5EUOA 3EYQD 5F8QC 2MTPA 3WLWC 2HWZL 3B2UC 4JN1H 3ILPB 3HI5H 1E6JL 3KDMA 1DBKL 4LARH 1DR9A 3MXVH 3O6LL 4ZOEA 4G7YL 2AV1B 5HVHB 3U36B 1KT2A 1G6RH 1IGIL 2AS5M 1E28B 4TUOA 1GL4B 4O58L 3LH2L 5I66B 5KJRH 2XACC 2GYSA 2RBLA 5HYIA 2XXCB 5DJXB 3MNWA 4KZDL 1MHCA 3LS4H 4U49A 4O5LL 1CICA 1YY8B 3MRJB 4RMUA 5FYJE 3UBXA 1F6AB 1OB1A 2VDPL 4OLVL 1OTSC 5ADOH 5DFWH 3MV9D 1Q9WB 5IQ7H 5L2KE 4RGOH 4AENA 4HX1A 4A6YA 3O8XD 3VFTB 3PV7A 1YJDH 3KPLA 3F6LA 3VGAC 1LMKA 1IQWH 4MCZA 4MNQA 4MQTB 2YD5A 4NQVB 1AGFB 1FGNH 5IMKA 3O3EA 3MGOA 3WUWB 2ZUVA 1RMFH 4AK1A 4N8PA 5C70A 5IQ9A 3HMXH 5LAXB 2VLLB 2FX9L 1L7TH 4BSVA 3JV6A 1S7SB 4Q2ZB 1GGIH 3FT3B 3HNVH 3SKNA 5IFHH 1KJ2A 3RWHA 4PJHB 1MCEA 1D6EB 1U8JA 2H41A 1D7FA 1IAMA 4ESKA 5KS9F 2HLFD 2C4FT 3H7BA 4GUPB 3FFDB 3C6LC 1LK3H 1R3IH 5I8KL 3RWIB 5DMKA 4Q9RH 2FB4L 3U2SA 1K4CB 3MRPB 4P2QD 2BXZA 4NC2B 2X7LA 4C56D 1EXUB 1S9YA 1RQ5A 3I2CH 2ZCLH 4Q9CA 1GZPB 4O2FA 5IB4B 3OMZA 3VFMA 3CAFA 4P49A 5DJ8A 1NGYA 3HZKA 3TBWA 1YYLL 1R0AL 1TQCB 4JLRB 2Q8AL 4OD3H 3CUPA 2YUXA 5D5MF 4ZOCA 1AD0B 4OCYH 4N1CA 4BFGA 5HHVH 5I76A 1AHWB 3LKRB 1C5CH 4LAQL 1MUJA 3NFPB 2EXWC 1AO7E 1FG9C 1J1PH 3QIUB 3MV7E 3HE6C 4GW5A 2QQLH 3D0LB 5C0EB 4HWBH 1DL7H 4IJ3B 4KI5C 4HKZA 4GAYA 3PV6B 5MERA 3QFJD 3T0WA 4YLQT 5GRVK 1D9KC 4U1MB 4F15C 4IS6A 3J7HA 1J1XL 4ZUUB 4ZUTB 4UV4H 3ZKMC 4QT5B 2X9YA 1QYGH 3MRGA 5HYSB 1X5IA 3L95B 3F7PC 4G5ZL 3OKEB 1IGJA 5CINH 5EORL 1CBVL 4E41B 3SBWA 5LQBH 1XGQA 5C9KA 4JQVA 4ORGB 3E6FA 5A1AA 4JPIB 5D1QD 4UT6H 1BVLA 1J0HA 3QG7L 1E4XL 1QSEE 1BLNB 5F70A 4DVBB 2DTSA 4IEFB 1AGDB 1LO0H 2JTDA 4PJIF 2CDFB 3QULB 3DGCR 4G9DB 4G6JH 3ESUF 4BJLA 5DD5H 2AP2A 2IGFL 2VLKB