2QL3A

Crystal structure of the c-terminal domain of a probable lysr family transcriptional regulator from rhodococcus sp. rha1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
VAGPIAVGCYPALGPTILPSMLYAFTAEYPRASVEFREDTQNRLRTQLEGGELDVAIVYDLDLSPEWQTVPLMTREPMVVLGAEHPLAGVDGPVRLADLAEHPMVLLDAPPSTNHAMDVCREAGFAPRVAYRTANFETARAFVGRGLGWTLLLQRPRVDVTYEGLPVVVKPIAEPKPASVAVVVAWHQEATLSRVARAFIRFVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the C-terminal domain of a probable LysR family transcriptional regulator from Rhodococcus sp. RHA1.
rcsb
molecule keywords Probable transcriptional regulator, LysR family protein
source organism Rhodococcus sp.
molecule tags Transcription
total genus 47
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2ql3A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2ql3A01
4KQPA 1M5DA 3FV2A 4NE4A 3EQ1A 3FV1A 1KWHA 1GTKA 3UN6A 1N3WA 3TCGA 5I2NA 2I0CA 3K4UA 4IY5A 5I56A 4YMBA 4WKMA 1PEBA 2QS3A 1MS7A 2DQVA 1LGBC 3MVYA 4AB6A 1IXCA 3C34A 1IIWA 2LAOA 4U1OA 1XT8A 3IB0A 2F35A 2HXWA 3K2DA 2OBGA 3IORA 2QRYA 1AOVA 2GH9A 3H6VA 4PFYA 1ATGA 2UVJA 1A54A 4I1DA 4EQ7A 3KN8A 1TT1A 1JVXA 2H99A 3RN8A 2F7BA 5ICQA 4DE8A 3O6IA 2E0SA 1F9BA 5CRYA 1B51A 3O66A 2DWJA 4PETA 2I4BA 4YMAA 1EH3A 2DE2A 2E1SA 3G3IA 1HSJA 1MDP1 3FJ7A 3QXMA 1B5HA 5I58A 3CFXA 2QJEA 3DM0A 1B7HA 4G77A 3H7MA 3U8QA 4HS7A 3PUYE 3E13X 1QKAA 3PUVE 1CB6A 4GD5A 4DCYA 2IA4A 1PB7A 1J1NA 3VFJA 1NH7A 5BWJA 3KN7A 1M5EA 3VE1B 2I48A 5J1DA 1JW1A 1PBQA 1B3HA 4YICA 3CSBA 3MC2A 3GXAA 1LCFA 3FXUA 4POXA 3TODA 3GBBA 3HN0A 5F7VA 2VOZA 1Y20A 2KLFA 1US4A 1NNPA 3FGSA 4XKNA 4JBZA 3S9NC 3O28A 3MP1A 5H8NB 1LFIA 5I2KB 4ELRA 1TXFA 2ANJA 2AL5A 4FEDA 4ONYA 3SETA 4GFRA 1L5TA 3TFLA 1FCKA 2PVUA 2X7QA 4DXUA 4YAHX 4EXLA 2H25A 1MY1A 4MLQA 2BJJX 3RUMA 1YCJA 1LFGA 2CMOA 4ZS9A 3ZKKA 3FD3A 4IO5A 5H8FA 2X7PA 5CMKA 3TTMA 1I6QA 3U92A 2DE3A 2UVGA 3PUWE 5DVFA 3T22A 2R9JA 1AMFA 2I6EA 2UXAA 1FTKA 3M3LA 3HHFA 3TAJA 2PMSA 1QKBA 2QSXA 2DSFA 3PUXE 1LLSA 4R73A 2ZNUA 3VXCA 1NNTA 4M4GA 5I56B 5L9OA 1S9TA 1RYXA 3K6UA 2QS1A 1Y4CA 2VD2A 4NF8A 3T93B 4R9GA 3THIA 4GL0A 1FTJA 3LSXA 2QS4A 3T66A 2ZYOA 2Q2CA 2Y7RA 1FQAA 5CBRA 4ELOA 3FJMA 1Q1KA 1M5BA 3T9HB 2HZKA 3FVKA 4GIZA 4G68A 4NMYA 3Q28A 3TTRA 4LZ7A 4LZ8A 5CI5A 3O2AA 3HV1A 1UTHA 3O9PA 3VVDA 3U93A 2NVUB 5DYHA 3KOTA 4G8MA 4PFWA 1URSA 4F3BA 4OFJA 1Q35A 1URGA 5I58B 1UTBB 3ZKLA 4LQ2A 4KD5A 1EZ9A 3ILTB 4BDRA 1ZIUA 5EYFA 3CSGA 1SW1A 3BBRA 3IJXB 1MH4A 2V3TA 2H4IA 3MVXA 4FATA 4HCYA 5CMBA 3PD9A 1HSLA 1N3XA 3FIRA 3HHGA 2Y7WA 3C9HA 3CIJA 4KYSA 1NMUA 1H45A 3EN3A 2REGA 3T96B 2AIXA 3MAMA 4LA9A 2Y7IA 1B7ZA 1URDA 3FVOA 3BFUA 4NF5B 3M3KA 2PX1A 4BDNA 3VLVA 2QPQA 3RT6B 1HSEA 5A5XB 2G29A 2RC9A 2XXVA 3PPOA 3OO7A 4H5FA 4NWCA 1B3GA 2DWHA 1LB8A 2DS9A 3MBPA 4ND9A 1OQHA 2QMWA 4R6KA 3PU5A 4LONB 4JDFA 4K3FA 2G93A 2V25A 3JZJA 2X26A 4JWOA 2HZLA 2OZZA 1XHYA 4R72A 4GRKA 3G3FA 1MQDA 1PDAA 4BLAA 3FUZA 5FTHA 4ESXA 5DEXA 4IO3A 3I3VA 2HAVA 1GR2A 1JNFA 1MDQA 4TLMB 4XXUA 1N0TA 4GF8A 1JVYA 5F1QA 4KFQA 4KPTA 4ELPA 3LUYA 1JW4A 1LFHA 3DP4A 1B5IA 1UIUA 4U22A 2AYSA 3U94A 5HPQA 4X1DA 1Y1ZA 3OENA 1SYHA 4NF4B 3V5AA 2F6GA 4NF8B 2QL3A 3PPRA 4RK2A 1QUKA 3PPQA 2PT2A 4U4SA 4G4PA 2A5TA 4RNSA 1B9JA 1LCTA 3FVGA 2GHBA 4QF9A 4MH5A 4RA1A 4F19A 1SVXB 4ESWA 4F2OA 2I3WA 1IXIA 1P1QA 3K01A 5I57B 2OCUA 3TEPA 4G68B 1II5A 3V83A 2ZYNA 3K1NA 1IQ7A 2F34A 1Y3PA 1JW5A 3KN3A 1UTHB 3B6QA 4YB7A 4H67A 4JWXA 1A8EA 4ZZEA 1LB9A 2XXUA 2Q89A 1YAEA 1S7YA 2FNCA 1B7UA 1POTA 4YZZA 4LATA 2H5YA 2Y7KA 3JV9A 3MW0A 1XOCA 2HQ0A 4Q30B 1USYH 4E0WA 1B0LA 4XKPA 4U1ZA 2UVHA 3RT8A 1ZKBA 3DP6A 5I59A 5EHSA 2QMXA 3L6HA 4DDDA 1D3KA 2M8CA 3HCQA 4P11A 5L8DA 3S9MC 2Y7PA 4OFLA 3OO6A 3C32A 1BTJA 3IOWA 4R6YA 1MQHA 4OQOA 3PMVA 3F11A 1B1HA 3LSLA 3HPIA 1AL3A 4JXIA 4JB7A 1NH8A 1R1NA 2F36A 2A5SA 3E9XA 2I4CA 1T0KA 1IXHA 2O1LA 4P0GA 1B6HA 4ZEDA 4NEDA 2DWAA 1WODA 4FJPA 2UYEA 3E4RA 3KZGA 1TFAA 3SEYA 1MQIA 1OQGA 1DPEA 2FA7A 2ONRA 1OMPA 2XX7A 3G7WA 4YKJA 3RTFB 3QUFA 4IO2A 2VHAA 3QIMA 1A7LA 2OWTA 2ZXTA 1A99A 3OOAA 4IO6A 3N5LA 2XXPA 3LR1A 5KCJA 4I8CA 3S2VA 4DLDA 2RC8A 4HCWA 3IOUA 4DXBA 4X9TA 2XX9A 3MQ9A 4H5GA 2VP1A 1B46A 3W9VA 2R71A 1BP5A 1EZPA 3Q25A 4BDMA 2REJA 5KZTA 3VDFA 4RYAA 4RY1A 5CMMA 4Q5TA 3ECRA 3TTKA 4LVQA 2OWSA 4LZ5A 4NF6A 4R75A 1MXWA 3KEIA 2IEEA 2DP8A 3MPLA 4BDOA 2NOOA 3T9XB 4F22A 2VGQA 1P1UA 2A5TB 5AA2B 3AXFA 1A8FA 2HFBA 2I49A 3M8UA 4U21A 1MY3A 4EF1A 1SW5A 3A09A 1Y3QA 4ELQA 4LQ5A 1B0HA 1N7XA 4RXLA 3I6VA 1H44A 1ZJLA 1LAHE 4KHZE 5AA2D 3D4CA 4G2ZA 3CFLA 2ABHA 3UIFA 3FVNA 4PFTA 1VFDA 4MBPA 3C36A 3GZGA 3UGWA 2UYFA 2NWJA 1I69A 2Z8EA 1A40A 5TPAA 1EZOA 3RPWA 1MY2A 3H3GA 3OD7A 1ANFA 3A3UA 2RC7A 4ZECA 2F6PA 2F7AA 4OESA 1MH3A 4IB2A 2XXHA 1MRPA 4OXVA 4GL8A 1O64A 1DTGA 1SD3A 4POWA 3TCHA 3N26A 1MXYA 4F2QA 2I0BA 1NL5A 2O51A 1B3EA 5I2NB 3G3JA 2H9BA 2DOJA 1FTLA 4ISUA 4XTCQ 1FW0A 5I59B 3TELA 3G3GA 2ESNA 3MZ1A 3GLBA 4XIGQ 3OELA 1QUJA 3FXQA 1PB9A 4RJZA 2XXXA 1O63A 5AE4A 2XXQA 4FEBA 3CG1A 5TP9A 1SI1A 2XXTA 4BDLA 1FTMA 3B6WA 4WEDA 1QUIA 2P2AA 3T9UA 2ZYKA 3TDJA 1H43A 3V8XB 5ITOA 1RKMA 4F1VA 5H8HA 4I62A 1ELJA 4DIGA 1PB8A 1DOTA 4KYEA 3CG3A 3TMGA 4L17A 4YU0A 2FYIA 1SYIA 1SW4A 5DVIA 1I6AA 4YB5A 4ZEIA 2XXIA 3R6UA 1B05A 4LP2B 1D4NA 3R26A 4KCCA 3PD8A 3T9VA 3FJGA 4UACA 5AA4A 3O97A 5KCJB 3TQWA 5TU0A 4N07A 3V89B 2PYYA 4WXJA 1LSTA 2Q88A 4THIA 3K6VA 2XXYA 1B2HA 4F3GA 2QS2A 1RYOA 3Q26A 3TZAA 3QUJA 4NF6B 1XS5A 4QSEA 1Y3NA 4ZEBA 1PC3A 1OLAA 3SDFA 4PQJA 1YTVA 2WKYA 4GOTA 2F5XA 5DTBA 4OYVA 3L6GA 4I9DA 5CM6A 4IO7A 1JQFA 2HEUA 4U23A 3OO9A 1Z7ME 4KR5A 4UA8A 3DLNA 2ONSA 1NNFA 2ZMBA 2YJPA 1B5JA 1B4HA 4EF2A 4ZZAA 5FHNA 1XC1A 2O1MA 3IOVA 2NXOA 4G8NA 3RTWB 5TPAB 5H8FB 3EHUA 2Z8DA 3BKIB 2V3QA 1MM6A 3DP8A 3CFZA 1JEVA 3USDA 1MPDA 3TTLA 4F3PA 4C1TA 2O68A 3CR9A 3E3KA 2RKMA 1ZTYA 1Y1MA 2GRVA 2V3UA 3ILUB 1I6BA 3LSFB 1BKAA 3IK6B 2F8DA 1DMBA 1UQWA 4TLLB 4ECFA 4FECA 3D4GA 2DVZA 1LAFE 4EUOA 1ZLQA 3IL1B 4Q8RA 1R6ZA 4H0WA 1OLCA 3EHSA 4EQBA 3N6TA 4OZ9A 3IAZA 1MY4A 1PBPA 3VVFA 4O3CA 2CZLA 2V93A 1IEJA 2Q2AA 3PPPA 2D3IA 3B6TA 3FZVA 4AB5A 5TP9B 4ZE9A 1DPPA 4XKRA 1FTOA 4OEVA 4QFLA 3PGFA 4H6DA 3KG2A 3TKDA 2DYXA 1IZ1A 1O7TA 2ZYMA 3MUQA 4E0XA 3TYHA 3IO6A 1Y9UA 3RY3A 2XD3A 5I2KA 3N94A 4H8JA 1ZU0A 4OHNA 5LOMA 2DXRA 3TCFA 4F18A 5L9MA 1IITA 3CVGA 4AQ4A 1B4ZA 3IJOB 1OVBA 3CI8A 3MJNA 5ICTA 4EDPA 3K0VA 3PMWA 2ALUA 2GFEA 4R9FA 2Z23A 4O3AA 3UORA 4YKIA 5AA4B 1WVJA 1ZMGA 3G3HA 5L9SA 1US5A 3SESA 2THIA 5H8QA 3RQTA 1TFDA 1N84A 4MF3A 5JTYA 1B52A 3N6UA 3IB1A 5HBCA 5ELVA 4Q0CA 1N04A 3ZSFA 2OLBA 2YPNA 4U4XA 3TPAA 4GWOA 4FAJA 2XHDA 3WAEA 1OIBA 3RNNA 1TWYA 3IOTA 2OK2A 2O69A 3H6WA 4GXSB 2I58A 3K6WA 2HCAA 3UP9A 3IR1A 3W9WA 1BIYA 2D5WA 3UA8A 4QSDA 1N7WA 4MLVA 4IY6A 1Z7NE 3Q27A 3OSQA 5DEXB 1BLFA 2UVIA 3C33A 4JSDA 3KSJA 4OVJA 1MY0A 2DWIA 1FQFA 1B3FA 1FQEA 3EHTA 4KCDA 4IGRA 3FASA 2GHAA 4QSCA 4H65A 3LSWA 2P1SA 1MG1A 4C0RA 4YKPA 4H1XA 1LAGE 5AA3A 1UTBA 4QFKA 1B3LA 4OERA 1QULA 3OXNA 4F39A 1SQYA 5DVJA 3C31A 4MFIA 3KOSA 3LBSA 3VLWA 1OVTA 4ZE8A 2PT1A 2O84X 1A55A 5CBSA 4RPOA 4C1UA 1XVYA 1POY1 3K1PA 2O7IA 2Z8FA 5CMCA 3VV5A 4NF5A 1B1XA 4WEPA 2OJTA 3O6GA 5A5XA 1EU8A 4PP0A 1FQBA 1P1OA 5FHMA 4DXCA 3EPEA 1R9LA 2PBWA 5KDTA 4G68C 4F1UA 5FHOA 4O3BA 3QK6A 4HTGA 3VXBA 2P0SA 4P0IA 3RGYA 1MXZA 3B7DA 3P7IA 3O6HA 3MPKA 2W7YA 3FATA 4DZ1A 2DVCA 4OWDA 2V84A 1USYE 3H06B 1QJMA 1LBCA 1NNKA 5K2YA 4X1BA 3S9EA 3IX1A 5AA1A 3K6XA 4YB6A 1FQDA 3GBAA 5H8QB 4FIMA 4OETA 3W15C 1M5CA 5JTYB 3PMXA 4QFPA 5BUUA 3DELB 1NFTA 5HM4B 3C35A 3KGCA 3R7XA 3OSRA 5ITPA 1UIVA 4KI0E 4F1YA 4NF4A 3QSLA 2ZNTA 3EF7A 3C4MA 4DCXA 3SEUA 4EXKA 3K02A 1XVXA 1MPBA 3LC8A 2Z22A 1B58A 3I5OA 3OO8A 3PPNA 1D9YA 1QW0A 1ZBMA 4QFNA 3KJTA 2F97A 5I57A 3MZ9A 4JSOA 1D9VA 4ZDMA 3SEXA 1QVSA 4OMBA 2ZNSA 5JEIA 3TQLA 1VE4A 1GGGA 3S4UA 4TOZA 5EHMA 4GVOA 1N76A 5B7DA 4R6HA 1YPNA 4R74A 3OEKA 2XD2A 5CC2A 1P1NA 3M3FA 3G3KA 5FTIA 1DTZA 1DSNA 3SKPA 1AH5A 3UK4A 2DXYA 1MXUA 3MWBA 1SDXA 1AIVA 1H76A 4F31B 3S9LC 1VSOA 3Q29A 3ZS6A 4YKKA 4N13A 4ZEKA 4GLIA 2H98A 3PUZE 3IB2A 2Q8JA 3IO4A 4KYDA 4M1VA 3FXRA 3KBRA 4QHQA 4OTEA 2O6AA 1JETA 2HAUA 3WAFA 3H03A 1FQCA 1B40A 1Y4TA 3H6TA 1SW2A 4XKQA 4HW8A 3HO7A 3KJ7A 3CRBA 3JYRA 3KSXA 4X48A 3ONMA 5M2VA 1VFEA 3QYTA 1MQJA 2AL4A 1WDNA 3PV0E 2B3BA 4U2RA 5KDTB 4FE8A 1VR5A 1MM7A 4BDQA 2RCAA 4R2BA 3U72A 4F3SA 1MXVA 3ODBA 3VLUA 3U1OA 5IKBA 3MVWA 4Z0IA 2F78A 4PFUA 3H4ZA 1H3DA 4Z7EA 2NUVA 1LBBA 3SEVA 3KFMA 5K2XA 2DE4A 3SERA 3MZBA 1JEUA 1M5FA 2XXRA 3MP8A 1R9QA 4RK9A 5I84A 2VD3A 2Y84A 2Q9TA 3MP6A 1MXXA 2I3VA 1SBPA 3H6UA 3O29A 4OEUA 4OFOA 4ZEFA 2XXWA 2XX8A 2RF1A 4GXAA 4RPNA 5DT6A 1NKXA 2RCBA 3QAXA 2ONKE 4F29A 3MVZA 3K1MA 3HSTA 4QFOA 4R2FA 1B32A 4IGTA 1IXGA 5AA2A 4NTLA 4GQOA 4JWYA 5H8NA 5B70A 5H8HB 3OEMA 1SI0A 4LUBA 4PE5B 3TTNA 3VVEA 2D21A 3RLFE 1GV8A 4FORA 2B65A 2YLNA 5IAIA 3K00A 1IUDA 2O7UA 1P1WA 4TQUQ 3BFTA 2B3FA 1LAXA 2RINA 3SEWA 4IO4A 5JK4A 4OENA 1CE2A 4N6PA 3TUSA 3A3CA 4EQ9A 2R6GE 2F7CA 4NWDA 1MQGA 1P99A 3OMBA 1GVCA 4QRZA 5ISUA 4H8IA 1S50A 4G8HA 5H8SA 1MPCA
chains in the Genus database with same CATH superfamily
4KQPA 1M5DA 3FV2A 4NE4A 3EQ1A 1FPEA 3FV1A 1EYIA 1KWHA 1GTKA 3UN6A 1N3WA 2CEYA 4PGPA 3TCGA 5I2NA 4PE3A 2I0CA 3K4UA 4IY5A 5I56A 4YMBA 4WKMA 1PEBA 2QS3A 1MS7A 2DQVA 1LGBC 3MVYA 4AB6A 1IXCA 3C34A 1IIWA 2LAOA 4U1OA 1XT8A 3IB0A 2F35A 3HFUA 2HXWA 3K2DA 2OBGA 3IORA 2QRYA 1LBYA 1AOVA 2GH9A 3H6VA 4PFYA 1ATGA 2UVJA 1FBCA 4PTKA 1A54A 4I1DA 4EQ7A 3KN8A 1TT1A 1JVXA 2H99A 3RN8A 2F7BA 5ICQA 4DE8A 3O6IA 2E0SA 1F9BA 1B51A 5CRYA 2WEFA 2DWJA 3O66A 4MEVA 4PETA 2I4BA 4YMAA 1EYJA 3FBPA 1EH3A 2DE2A 2E1SA 3G3IA 1HSJA 2KQZA 1FSAA 1MDP1 3FJ7A 3QXMA 1B5HA 5I58A 2XXKA 3CFXA 2QJEA 3DM0A 1B7HA 4G77A 3H7MA 3U8QA 4HS7A 2OX3A 3PUYE 3E13X 4N6KA 3EKIA 1QKAA 3PUVE 1CB6A 4GD5A 4DCYA 2P3VA 2IA4A 1PB7A 1J1NA 2QVRA 3VFJA 1NH7A 2VPNA 4GWYA 5BWJA 3KN7A 1M5EA 3VE1B 2I48A 5T3JA 5J1DA 4PF6A 1JW1A 1PBQA 4N8YA 4PGNA 1B3HA 4NX1A 2MKZA 4YICA 3CSBA 3MC2A 3GXAA 1LCFA 3FXUA 4POXA 3TODA 3GBBA 3HN0A 2Q74A 5F7VA 5ET8A 2VOZA 1Y20A 1FBPA 2KLFA 1US4A 5EQ8A 1NNPA 3FGSA 4XKNA 4JBZA 3S9NC 3O28A 3MP1A 5H8NB 1LFIA 5I2KB 4ELRA 4GWSA 1TXFA 2ANJA 2AL5A 4FEDA 4ONYA 3SETA 4GFRA 1L5TA 3TFLA 1FCKA 2PVUA 2X7QA 4DXUA 4YAHX 4EXLA 2H25A 1MY1A 5ET7A 4MLQA 2BJJX 3RUMA 1YCJA 1LFGA 2CMOA 4ZS9A 3ZKKA 3FD3A 2OWZA 4IO5A 5H8FA 2WYPA 2X7PA 1EYKA 2QFLA 5CMKA 3TTMA 1I6QA 3U92A 3SZPA 2DE3A 2QVVA 2UVGA 3PUWE 5DVFA 3T22A 4X8RA 2R9JA 2Y5LA 5IZZA 1AMFA 4PFBA 4HE0A 2I6EA 2UXAA 1FTKA 3M3LA 2XWKA 3HHFA 3TAJA 2PMSA 3KC0A 3B50A 1QKBA 2QSXA 3MSTA 2DSFA 3PUXE 1LLSA 4R73A 2ZNUA 3VXCA 1NNTA 1YYZA 4M4GA 5I56B 5L9OA 1NUWA 1S9TA 4I40A 4MNCA 1RYXA 3K6UA 4GX6A 2PFYA 2QS1A 2WYKA 1Y4CA 3B8BA 2VD2A 4NF8A 4XF5A 3T93B 4R9GA 3THIA 4GL0A 1FTJA 3LSXA 2QS4A 3IFCA 5IZ3A 3T66A 2ZYOA 2Q2CA 2Y7RA 1FQAA 5CBRA 4ELOA 3FJMA 1Q1KA 1M5BA 3T9HB 2HZKA 3FVKA 4GIZA 4G68A 4NMYA 3Q28A 3TTRA 4LZ7A 4LZ8A 5CI5A 4MHFA 3O2AA 3HV1A 3GYYA 1UTHA 3O9PA 3VVDA 3U93A 2NVUB 5DYHA 4NQ8A 3KOTA 4G8MA 4JVDA 4PFWA 1URSA 4F3BA 4OFJA 1Q35A 1URGA 4P3LA 5I58B 1UTBB 3ZKLA 4LQ2A 4KD5A 1EZ9A 3ILTB 4BDRA 2XWIA 1ZIUA 5EYFA 3CSGA 2CZIA 1SW1A 3BBRA 3IJXB 1NV2A 1MH4A 2V3TA 2H4IA 3MVXA 1FPKA 4FATA 4HCYA 5CMBA 3PD9A 1HSLA 1N3XA 3FIRA 3HHGA 2Y7WA 3C9HA 3CIJA 4KYSA 1NMUA 1H45A 3EN3A 1FPIA 2REGA 3T96B 4NN3A 2AIXA 3MAMA 2Q8MA 4LA9A 2Y7IA 1B7ZA 1URDA 3FVOA 3BFUA 4NF5B 3M3KA 1NV7A 4MJOA 2PX1A 4BDNA 1LBWA 3VLVA 2QPQA 3RT6B 1HSEA 5A5XB 2G29A 2RC9A 2XXVA 3PPOA 3OO7A 4H5FA 2FBPA 4NWCA 1B3GA 2DWHA 1LB8A 4H46A 2DS9A 3MBPA 4ND9A 1OQHA 2QMWA 4R6KA 3PU5A 4LONB 4JDFA 4K3FA 2G93A 2V25A 3JZJA 2X26A 4JWOA 4XEQA 2ZZXA 2HZLA 2OZZA 1XHYA 4R72A 4GRKA 3G3FA 1MQDA 1PDAA 4BLAA 3FUZA 4I3YA 5FTHA 4ESXA 5DEXA 4MIJA 4IO3A 3I3VA 4PBQA 2HAVA 4P8BA 1GR2A 1JNFA 1MDQA 4TLMB 1NV1A 2Y5KA 4XXUA 3T1BA 1N0TA 4GF8A 1JVYA 5F1QA 4UABA 4KFQA 4KPTA 4ELPA 3LUYA 4JVCA 1JW4A 1LFHA 3DP4A 4GX3A 1B5IA 1UIUA 2BJIA 4U22A 2AYSA 3U94A 5HPQA 4X1DA 4GWWA 4NF0A 4MX6A 1Y1ZA 3OENA 1SYHA 4NF4B 3V5AA 2F6GA 4NF8B 2QL3A 3PPRA 5I7IA 4RK2A 1QUKA 3PPQA 2PT2A 1FPFA 4U4SA 4G4PA 2A5TA 5IZ3B 4RNSA 1B9JA 1LCTA 2HHMA 3FVGA 2GHBA 2KR0A 4QF9A 4MH5A 4RA1A 4F19A 1SVXB 4ESWA 4N81A 4F2OA 2I3WA 1IXIA 1P1QA 3K01A 5I57B 2OCUA 3TEPA 1FJ9A 4G68B 1II5A 3V83A 2ZYNA 3K1NA 1IQ7A 2F34A 1Y3PA 1JW5A 3KN3A 1UTHB 3B6QA 4YB7A 4H67A 4JWXA 1A8EA 4ZZEA 1LB9A 2XXUA 2Q89A 3D1RA 2B4MA 1YAEA 4QBAA 1S7YA 2FNCA 1B7UA 1POTA 4YZZA 4LATA 2H5YA 2Y7KA 3JV9A 3MW0A 1XOCA 2HQ0A 3PTYA 3U65A 1K9YA 4Q30B 1USYH 4E0WA 2F3BA 4AS5A 1B0LA 4PAKA 4XKPA 4U1ZA 1DBZA 2UVHA 3RT8A 1ZKBA 3DP6A 5I59A 1IMCA 1LEVA 2B4LA 3KC1A 5EHSA 2QMXA 3L6HA 4DDDA 1D3KA 2M8CA 3HCQA 4P11A 5L8DA 3S9MC 2Y7PA 4OFLA 2V4CA 3OO6A 1IMAA 3C32A 1BTJA 3IOWA 4OVSA 4R6YA 1MQHA 4OQOA 3PMVA 3F11A 1G0HA 1B1HA 3LSLA 3HPIA 1IMDA 1AL3A 4DI3D 1KZ8A 4JXIA 4JB7A 1NH8A 1R1NA 2F36A 2A5SA 3E9XA 3RPLA 1FBHA 2I4CA 1T0KA 1IXHA 2O1LA 4P0GA 2VPOA 1B6HA 4ZEDA 4NEDA 2DWAA 1WODA 4FJPA 5I5PA 2UYEA 3E4RA 3KZGA 1TFAA 3SEYA 1MQIA 1OQGA 1DPEA 2FA7A 2ONRA 1OMPA 2XX7A 3G7WA 4YKJA 3RTFB 3QUFA 4IO2A 2VHAA 3QIMA 1A7LA 2OWTA 2ZXTA 3MYUA 1A99A 3OOAA 4IO6A 3N5LA 2XXPA 3LR1A 5KCJA 4I8CA 3S2VA 4DLDA 2RC8A 5A5LA 4HCWA 3IOUA 4DXBA 4X9TA 1FJ6A 2XX9A 3MQ9A 4H5GA 2VP1A 1B46A 3W9VA 4X04A 2R71A 1BP5A 2XWVA 4I3EA 3Q25A 4BDMA 1EZPA 2REJA 5KZTA 3VDFA 4RYAA 4RY1A 5CMMA 4Q5TA 3ECRA 3TTKA 4LVQA 1XI6A 2OWSA 4LZ5A 4NF6A 4R75A 1MXWA 3KEIA 2IEEA 2DP8A 3MPLA 4BDOA 2NOOA 3T9XB 4F22A 4NG7A 2VGQA 1P1UA 2CZHA 2A5TB 5AA2B 3AXFA 1A8FA 2HFBA 2I49A 3M8UA 4U21A 1MY3A 4EF1A 1SW5A 3QMFA 1DK4A 3A09A 1Y3QA 4ELQA 4LQ5A 1B0HA 1N7XA 4RXLA 3I6VA 1H44A 1ZJLA 1LAHE 4KHZE 5AA2D 3D4CA 4G2ZA 3CFLA 2ABHA 3UIFA 3FVNA 4PFTA 1VFDA 4MBPA 3C36A 3GZGA 3UGWA 2UYFA 2NWJA 1I69A 2Z8EA 1A40A 5TPAA 5IZ1A 3RPWA 1MY2A 1EZOA 3H3GA 3OD7A 4AS4A 1ANFA 3A3UA 2RC7A 4ZECA 4N15A 2F6PA 2F7AA 4OESA 4LN5A 1MH3A 4IB2A 2XXHA 1MRPA 4OXVA 4GL8A 1O64A 1DTGA 1SD3A 4POWA 3N26A 3TCHA 1MXYA 4F2QA 2I0BA 1NL5A 2O51A 1Q9DA 2PCRA 1B3EA 5I2NB 3G3JA 2H9BA 2DOJA 1FTLA 4GBVA 4ISUA 4XTCQ 1FW0A 5I59B 3TELA 3G3GA 2ESNA 3MZ1A 3GLBA 4XIGQ 3IFAA 3OELA 1QUJA 3FXQA 4O7IA 1PB9A 4RJZA 2XXXA 1O63A 1G0IA 2XXQA 5AE4A 4FEBA 3CG1A 5TP9A 1SI1A 2XXTA 1NV5A 4BDLA 1FTMA 3B6WA 4WEDA 1QUIA 5ET5A 2P2AA 3T9UA 2ZYKA 3TDJA 1H43A 3V8XB 2L5VA 5ITOA 1RKMA 4F1VA 5H8HA 4I62A 1ELJA 1SPIA 4DIGA 1PB8A 1DOTA 4JVIA 4MMPA 4KYEA 1QGXA 3CG3A 3TMGA 4L17A 4YU0A 2FYIA 1SYIA 1SW4A 5DVIA 1I6AA 4YB5A 1BK4A 4ZEIA 2XXIA 3R6UA 1B05A 4LP2B 3BIGA 1D4NA 3R26A 4KCCA 1NI9A 3PD8A 4PFIA 3T9VA 3FJGA 4UACA 5AA4A 3O97A 4O8MA 5KCJB 1FPGA 4O7MA 3TQWA 5LTCA 5TU0A 2F3DA 4N07A 3V89B 2PYYA 4WXJA 1LSTA 2P3NA 2Q88A 4THIA 3K6VA 2XXYA 1B2HA 4F3GA 2QS2A 1RYOA 3Q26A 4N4UA 4KXPA 3TZAA 3QUJA 4NF6B 1XS5A 4QSEA 1Y3NA 4ZEBA 1PC3A 1OLAA 3SDFA 4PQJA 1YTVA 2WKYA 4GOTA 1FBEA 4HE2A 2F5XA 5DTBA 4OYVA 4PC9A 3L6GA 4I9DA 4NGUA 2FIXA 5CM6A 4IO7A 1JQFA 4OVQA 2HEUA 4U23A 3OO9A 1Z7ME 4KR5A 1NV4A 4UA8A 3DLNA 2ONSA 1DCUA 1NNFA 2ZMBA 2YJPA 1B5JA 1B4HA 4EF2A 4ZZAA 5FHNA 1XC1A 2O1MA 3IOVA 2NXOA 4G8NA 4P1LA 3RTWB 5TPAB 5H8FB 3EHUA 2Z8DA 3BKIB 2V3QA 1MM6A 3DP8A 5DW8A 3CFZA 2HPGA 4PCDA 1JEVA 3USDA 1NV6A 1MPDA 3TTLA 4F3PA 4C1TA 4FBPA 2O68A 1FPJA 3CR9A 4PAFA 3E3KA 2RKMA 1ZTYA 1Y1MA 2GRVA 2V3UA 3ILUB 1I6BA 3LSFB 4HE1A 1BKAA 3IK6B 2F8DA 1DMBA 1UQWA 4TLLB 4ECFA 4FECA 3D4GA 2DVZA 1LAFE 4EUOA 1ZLQA 1LBXA 3IL1B 4GBWA 4Q8RA 4P1EA 1R6ZA 4H0WA 1OLCA 4XFEA 3EHSA 4EQBA 3N6TA 4OZ9A 3IAZA 1MY4A 1PBPA 4O94A 3VVFA 1FBGA 1NV3A 4O3CA 2CZLA 2V93A 1K9ZA 3LV0A 1IEJA 2Q2AA 3PPPA 2D3IA 3B6TA 3FZVA 4AB5A 5TP9B 4ZE9A 1DPPA 4XKRA 1FTOA 4OEVA 4QFLA 3PGFA 4H6DA 2ZZVA 3KG2A 3TKDA 2DYXA 1IZ1A 1O7TA 2ZYMA 3MUQA 4E0XA 3TYHA 3IO6A 1Y9UA 3RY3A 2XD3A 4N17A 4OVTA 5I2KA 3N94A 4H8JA 1ZU0A 4OHNA 5LOMA 2DXRA 3TCFA 4F18A 5L9MA 1IITA 3CVGA 4AQ4A 1B4ZA 3IJOB 1OVBA 3CI8A 3MJNA 5ICTA 4EDPA 1YXIA 3K0VA 3PMWA 2ALUA 4NAPA 2GFEA 4R9FA 2Z23A 4O3AA 3UORA 4YKIA 1FPDA 5AA4B 1WVJA 1ZMGA 3G3HA 4G61A 5L9SA 1NUZA 5J16A 1US5A 4MNIA 3SESA 4MNPA 2THIA 5H8QA 3RQTA 1TFDA 4N6DA 1N84A 4MF3A 5JTYA 1B52A 3N6UA 5IM2A 3IB1A 5HBCA 5ELVA 2CEXA 4N8GA 4Q0CA 1FBFA 1N04A 3ZSFA 2OLBA 2YPNA 4U4XA 3TPAA 4GWOA 3WAEA 2XHDA 4FAJA 1OIBA 3RNNA 1TWYA 4P47A 1IMEA 4NHBA 3IOTA 2OK2A 2O69A 4OA4A 3H6WA 4GXSB 5EQ7A 2I58A 3K6WA 2HCAA 3UP9A 3IR1A 3W9WA 1BIYA 2D5WA 1INPA 3UA8A 4QSDA 1N7WA 4MLVA 4IY6A 1Z7NE 3Q27A 4OVPA 3OSQA 5DEXB 1BLFA 2UVIA 3C33A 2FIEA 2VT5A 4JSDA 3KSJA 4PBHA 4OVJA 1MY0A 2DWIA 1FQFA 2QVUA 1B3FA 5EQ9A 1FQEA 3EHTA 1CNQA 4KCDA 4IGRA 3FASA 4QSCA 2GHAA 4OVRA 4H65A 3LSWA 2P1SA 2FHYA 2HXRA 1MG1A 4C0RA 4YKPA 4H1XA 1LAGE 5AA3A 4PAIA 4QFKA 1UTBA 1B3LA 3LUZA 4OERA 2GQ1A 1QULA 5F24A 3OXNA 4F39A 4PDDA 5ESYA 1SQYA 5DVJA 3RYDA 3C31A 1AWBA 4MFIA 3KOSA 3LBSA 3VLWA 1OVTA 1NUXA 4ZE8A 2PT1A 4MCOA 2O84X 1A55A 5CBSA 4RPOA 4OANA 4C1UA 1XVYA 1POY1 3K1PA 2O7IA 2Z8FA 5CMCA 4H45A 3VV5A 4NF5A 1B1XA 1RDYA 4WEPA 2OJTA 1NUYA 3O6GA 5A5XA 1EU8A 4PP0A 1FQBA 3E79A 1P1OA 5FHMA 4DI4B 4DXCA 2FVZA 3EPEA 3T0JA 1R9LA 2ZZWA 2PBWA 5KDTA 5FBPA 5EYGA 4G68C 4F1UA 5FHOA 5I3SA 4O3BA 3QK6A 4HTGA 3VXBA 2P0SA 4P0IA 3RGYA 1MXZA 3B7DA 3P7IA 3O6HA 3MPKA 2W7YA 3FATA 5EYHA 4DZ1A 1IMFA 2DVCA 4OWDA 2V84A 1USYE 3H06B 1QJMA 1LBCA 1NNKA 5K2YA 4X1BA 3S9EA 2WBBA 3IX1A 5AA1A 3K6XA 4YB6A 1FQDA 1KA0A 3GBAA 5H8QB 4FIMA 4OETA 3W15C 1M5CA 5JTYB 3PMXA 4QFPA 1D9QA 5BUUA 3DELB 1NFTA 5HM4B 3C35A 3KGCA 3R7XA 3OSRA 5ITPA 1UIVA 4KI0E 3FXBA 4F1YA 4NF4A 3QSLA 2ZNTA 1KA1A 3EF7A 4QXDA 3C4MA 1FRPA 4DCXA 3SEUA 3RPLB 5ET6A 4EXKA 4HXVA 1FBDA 3K02A 1XVXA 1MPBA 3CHGA 3LC8A 2Z22A 4PDHA 1B58A 3I5OA 3OO8A 3PPNA 1D9YA 1QW0A 1ZBMA 4QFNA 3KJTA 2F97A 5I57A 4N91A 3MZ9A 4JSOA 4P56A 1D9VA 4ZDMA 3SEXA 1QVSA 4OMBA 1FPBA 2ZNSA 5JEIA 1VE4A 3TQLA 1GGGA 3S4UA 4TOZA 5EHMA 4GVOA 1N76A 5B7DA 4R6HA 1YPNA 4R74A 3OEKA 2XD2A 5CC2A 1P1NA 3M3FA 3G3KA 5FTIA 1DTZA 1FPLA 1DSNA 3SKPA 1AH5A 3UK4A 2DXYA 1MXUA 3MWBA 1SDXA 1AIVA 1RDZA 1H76A 4F31B 3S9LC 1VSOA 3Q29A 3ZS6A 4YKKA 4N13A 4ZEKA 4GLIA 2XA5A 2H98A 3PUZE 3IB2A 2Q8JA 3IO4A 4KYDA 4M1VA 3FXRA 3KBRA 4QHQA 5IGAA 4GX4A 4IR8A 4OTEA 2O6AA 1JETA 2HAUA 3WAFA 3H03A 1FQCA 1B40A 1Y4TA 3H6TA 1LBZA 1SW2A 4XKQA 4HW8A 3HO7A 3KJ7A 3CRBA 3JYRA 3KSXA 1YZ0A 2DDKA 4X48A 3ONMA 5M2VA 1VFEA 3E78A 3QYTA 1MQJA 2AL4A 1WDNA 3PV0E 2B3BA 4U2RA 1VDWA 2WX9A 5KDTB 4FE8A 1VR5A 1MM7A 4BDQA 2RCAA 2R8TA 4R2BA 3U72A 4F3SA 1MXVA 3ODBA 3VLUA 3U1OA 5IKBA 1FTAA 3MVWA 4Z0IA 2F78A 4PFUA 3H4ZA 3ROJA 1H3DA 4Z7EA 2NUVA 3A29A 1RDXA 1LBBA 3SEVA 3KFMA 5K2XA 2DE4A 3SERA 3MZBA 3ISPA 1JEUA 1M5FA 2XXRA 3MP8A 1R9QA 4RK9A 5I84A 2CZKA 2VD3A 2Y84A 2Q9TA 3MP6A 5LDZA 1MXXA 2I3VA 5EQAA 4GWUA 1SBPA 3H6UA 3O29A 4OEUA 4PF8A 4OFOA 4ZEFA 2XXWA 2XX8A 4RPNA 2RF1A 4GXAA 5DT6A 2PFZA 1NKXA 2RCBA 3QAXA 2JJKA 2ONKE 4F29A 3MVZA 2WBDA 3K1MA 3HSTA 4GWZA 4QFOA 1LBVA 4R2FA 1B32A 4IGTA 1JP4A 1IXGA 5AA2A 4NTLA 4GQOA 4JWYA 5H8NA 5B70A 5H8HB 3OEMA 1SI0A 4LUBA 4PE5B 3TTNA 3VVEA 2D21A 3RLFE 1GV8A 4FORA 4P9KA 2B65A 2YLNA 3BIHA 5IAIA 3K00A 1IUDA 2O7UA 1P1WA 4MAGA 4PFRA 4TQUQ 3BFTA 2B3FA 1LAXA 2RINA 4GWXA 3SEWA 4IO4A 1NV0A 5JK4A 4OENA 1CE2A 4N6PA 3TUSA 3A3CA 4EQ9A 2R6GE 2F7CA 4NWDA 3NOHA 1MQGA 1P99A 1IMBA 3OMBA 1GVCA 4QRZA 2XWOA 5ISUA 4H8IA 1S50A 4G8HA 5H8SA 3KBZA 1MPCA
chains in the Genus database with same CATH topology
4KQPA 1M5DA 3FV2A 4NE4A 3EQ1A 3FV1A 1KWHA 1GTKA 3UN6A 1N3WA 3TCGA 5I2NA 2I0CA 3K4UA 4IY5A 5I56A 4YMBA 4WKMA 1PEBA 2QS3A 1MS7A 2DQVA 1LGBC 3MVYA 4AB6A 1IXCA 3C34A 1IIWA 2LAOA 4U1OA 1XT8A 3IB0A 2F35A 2HXWA 3K2DA 2OBGA 3IORA 2QRYA 1AOVA 2GH9A 3H6VA 4PFYA 1ATGA 2UVJA 1A54A 4I1DA 4EQ7A 3KN8A 1TT1A 1JVXA 2H99A 3RN8A 2F7BA 5ICQA 4DE8A 3O6IA 2E0SA 1F9BA 5CRYA 1B51A 3O66A 2DWJA 4PETA 2I4BA 4YMAA 1EH3A 2DE2A 2E1SA 3G3IA 1HSJA 1MDP1 3FJ7A 3QXMA 1B5HA 5I58A 3CFXA 2QJEA 3DM0A 1B7HA 4G77A 3H7MA 3U8QA 4HS7A 3PUYE 3E13X 1QKAA 3PUVE 1CB6A 4GD5A 4DCYA 2IA4A 1PB7A 1J1NA 3VFJA 1NH7A 5BWJA 3KN7A 1M5EA 3VE1B 2I48A 5J1DA 1JW1A 1PBQA 1B3HA 4YICA 3CSBA 3MC2A 3GXAA 1LCFA 3FXUA 4POXA 3TODA 3GBBA 3HN0A 5F7VA 2VOZA 1Y20A 2KLFA 1US4A 1NNPA 3FGSA 4XKNA 4JBZA 3S9NC 3O28A 3MP1A 5H8NB 1LFIA 5I2KB 4ELRA 1TXFA 2ANJA 2AL5A 4FEDA 4ONYA 3SETA 4GFRA 1L5TA 3TFLA 1FCKA 2PVUA 2X7QA 4DXUA 4YAHX 4EXLA 2H25A 1MY1A 4MLQA 2BJJX 3RUMA 1YCJA 1LFGA 2CMOA 4ZS9A 3ZKKA 3FD3A 4IO5A 5H8FA 2X7PA 5CMKA 3TTMA 1I6QA 3U92A 2DE3A 2UVGA 3PUWE 5DVFA 3T22A 2R9JA 1AMFA 2I6EA 2UXAA 1FTKA 3M3LA 3HHFA 3TAJA 2PMSA 1QKBA 2QSXA 2DSFA 3PUXE 1LLSA 4R73A 2ZNUA 3VXCA 1NNTA 4M4GA 5I56B 5L9OA 1S9TA 1RYXA 3K6UA 2QS1A 1Y4CA 2VD2A 4NF8A 3T93B 4R9GA 3THIA 4GL0A 1FTJA 3LSXA 2QS4A 3T66A 2ZYOA 2Q2CA 2Y7RA 1FQAA 5CBRA 4ELOA 3FJMA 1Q1KA 1M5BA 3T9HB 2HZKA 3FVKA 4GIZA 4G68A 4NMYA 3Q28A 3TTRA 4LZ7A 4LZ8A 5CI5A 3O2AA 3HV1A 1UTHA 3O9PA 3VVDA 3U93A 2NVUB 5DYHA 3KOTA 4G8MA 4PFWA 1URSA 4F3BA 4OFJA 1Q35A 1URGA 5I58B 1UTBB 3ZKLA 4LQ2A 4KD5A 1EZ9A 3ILTB 4BDRA 1ZIUA 5EYFA 3CSGA 1SW1A 3BBRA 3IJXB 1MH4A 2V3TA 2H4IA 3MVXA 4FATA 4HCYA 5CMBA 3PD9A 1HSLA 1N3XA 3FIRA 3HHGA 2Y7WA 3C9HA 3CIJA 4KYSA 1NMUA 1H45A 3EN3A 2REGA 3T96B 2AIXA 3MAMA 4LA9A 2Y7IA 1B7ZA 1URDA 3FVOA 3BFUA 4NF5B 3M3KA 2PX1A 4BDNA 3VLVA 2QPQA 3RT6B 1HSEA 5A5XB 2G29A 2RC9A 2XXVA 3PPOA 3OO7A 4H5FA 4NWCA 1B3GA 2DWHA 1LB8A 2DS9A 3MBPA 4ND9A 1OQHA 2QMWA 4R6KA 3PU5A 4LONB 4JDFA 4K3FA 2G93A 2V25A 3JZJA 2X26A 4JWOA 2HZLA 2OZZA 1XHYA 4R72A 4GRKA 3G3FA 1MQDA 1PDAA 4BLAA 3FUZA 5FTHA 4ESXA 5DEXA 4IO3A 3I3VA 2HAVA 1GR2A 1JNFA 1MDQA 4TLMB 4XXUA 1N0TA 4GF8A 1JVYA 5F1QA 4KFQA 4KPTA 4ELPA 3LUYA 1JW4A 1LFHA 3DP4A 1B5IA 1UIUA 4U22A 2AYSA 3U94A 5HPQA 4X1DA 1Y1ZA 3OENA 1SYHA 4NF4B 3V5AA 2F6GA 4NF8B 2QL3A 3PPRA 4RK2A 1QUKA 3PPQA 2PT2A 4U4SA 4G4PA 2A5TA 4RNSA 1B9JA 1LCTA 3FVGA 2GHBA 4QF9A 4MH5A 4RA1A 4F19A 1SVXB 4ESWA 4F2OA 2I3WA 1IXIA 1P1QA 3K01A 5I57B 2OCUA 3TEPA 4G68B 1II5A 3V83A 2ZYNA 3K1NA 1IQ7A 2F34A 1Y3PA 1JW5A 3KN3A 1UTHB 3B6QA 4YB7A 4H67A 4JWXA 1A8EA 4ZZEA 1LB9A 2XXUA 2Q89A 1YAEA 1S7YA 2FNCA 1B7UA 1POTA 4YZZA 4LATA 2H5YA 2Y7KA 3JV9A 3MW0A 1XOCA 2HQ0A 4Q30B 1USYH 4E0WA 1B0LA 4XKPA 4U1ZA 2UVHA 3RT8A 1ZKBA 3DP6A 5I59A 5EHSA 2QMXA 3L6HA 4DDDA 1D3KA 2M8CA 3HCQA 4P11A 5L8DA 3S9MC 2Y7PA 4OFLA 3OO6A 3C32A 1BTJA 3IOWA 4R6YA 1MQHA 4OQOA 3PMVA 3F11A 1B1HA 3LSLA 3HPIA 1AL3A 4JXIA 4JB7A 1NH8A 1R1NA 2F36A 2A5SA 3E9XA 2I4CA 1T0KA 1IXHA 2O1LA 4P0GA 1B6HA 4ZEDA 4NEDA 2DWAA 1WODA 4FJPA 2UYEA 3E4RA 3KZGA 1TFAA 3SEYA 1MQIA 1OQGA 1DPEA 2FA7A 2ONRA 1OMPA 2XX7A 3G7WA 4YKJA 3RTFB 3QUFA 4IO2A 2VHAA 3QIMA 1A7LA 2OWTA 2ZXTA 1A99A 3OOAA 4IO6A 3N5LA 2XXPA 3LR1A 5KCJA 4I8CA 3S2VA 4DLDA 2RC8A 4HCWA 3IOUA 4DXBA 4X9TA 2XX9A 3MQ9A 4H5GA 2VP1A 1B46A 3W9VA 2R71A 1BP5A 1EZPA 3Q25A 4BDMA 2REJA 5KZTA 3VDFA 4RYAA 4RY1A 5CMMA 4Q5TA 3ECRA 3TTKA 4LVQA 2OWSA 4LZ5A 4NF6A 4R75A 1MXWA 3KEIA 2IEEA 2DP8A 3MPLA 4BDOA 2NOOA 3T9XB 4F22A 2VGQA 1P1UA 2A5TB 5AA2B 3AXFA 1A8FA 2HFBA 2I49A 3M8UA 4U21A 1MY3A 4EF1A 1SW5A 3A09A 1Y3QA 4ELQA 4LQ5A 1B0HA 1N7XA 4RXLA 3I6VA 1H44A 1ZJLA 1LAHE 4KHZE 5AA2D 3D4CA 4G2ZA 3CFLA 2ABHA 3UIFA 3FVNA 4PFTA 1VFDA 4MBPA 3C36A 3GZGA 3UGWA 2UYFA 2NWJA 1I69A 2Z8EA 1A40A 5TPAA 1EZOA 3RPWA 1MY2A 3H3GA 3OD7A 1ANFA 3A3UA 2RC7A 4ZECA 2F6PA 2F7AA 4OESA 1MH3A 4IB2A 2XXHA 1MRPA 4OXVA 4GL8A 1O64A 1DTGA 1SD3A 4POWA 3TCHA 3N26A 1MXYA 4F2QA 2I0BA 1NL5A 2O51A 1B3EA 5I2NB 3G3JA 2H9BA 2DOJA 1FTLA 4ISUA 4XTCQ 1FW0A 5I59B 3TELA 3G3GA 2ESNA 3MZ1A 3GLBA 4XIGQ 3OELA 1QUJA 3FXQA 1PB9A 4RJZA 2XXXA 1O63A 5AE4A 2XXQA 4FEBA 3CG1A 5TP9A 1SI1A 2XXTA 4BDLA 1FTMA 3B6WA 4WEDA 1QUIA 2P2AA 3T9UA 2ZYKA 3TDJA 1H43A 3V8XB 5ITOA 1RKMA 4F1VA 5H8HA 4I62A 1ELJA 4DIGA 1PB8A 1DOTA 4KYEA 3CG3A 3TMGA 4L17A 4YU0A 2FYIA 1SYIA 1SW4A 5DVIA 1I6AA 4YB5A 4ZEIA 2XXIA 3R6UA 1B05A 4LP2B 1D4NA 3R26A 4KCCA 3PD8A 3T9VA 3FJGA 4UACA 5AA4A 3O97A 5KCJB 3TQWA 5TU0A 4N07A 3V89B 2PYYA 4WXJA 1LSTA 2Q88A 4THIA 3K6VA 2XXYA 1B2HA 4F3GA 2QS2A 1RYOA 3Q26A 3TZAA 3QUJA 4NF6B 1XS5A 4QSEA 1Y3NA 4ZEBA 1PC3A 1OLAA 3SDFA 4PQJA 1YTVA 2WKYA 4GOTA 2F5XA 5DTBA 4OYVA 3L6GA 4I9DA 5CM6A 4IO7A 1JQFA 2HEUA 4U23A 3OO9A 1Z7ME 4KR5A 4UA8A 3DLNA 2ONSA 1NNFA 2ZMBA 2YJPA 1B5JA 1B4HA 4EF2A 4ZZAA 5FHNA 1XC1A 2O1MA 3IOVA 2NXOA 4G8NA 3RTWB 5TPAB 5H8FB 3EHUA 2Z8DA 3BKIB 2V3QA 1MM6A 3DP8A 3CFZA 1JEVA 3USDA 1MPDA 3TTLA 4F3PA 4C1TA 2O68A 3CR9A 3E3KA 2RKMA 1ZTYA 1Y1MA 2GRVA 2V3UA 3ILUB 1I6BA 3LSFB 1BKAA 3IK6B 2F8DA 1DMBA 1UQWA 4TLLB 4ECFA 4FECA 3D4GA 2DVZA 1LAFE 4EUOA 1ZLQA 3IL1B 4Q8RA 1R6ZA 4H0WA 1OLCA 3EHSA 4EQBA 3N6TA 4OZ9A 3IAZA 1MY4A 1PBPA 3VVFA 4O3CA 2CZLA 2V93A 1IEJA 2Q2AA 3PPPA 2D3IA 3B6TA 3FZVA 4AB5A 5TP9B 4ZE9A 1DPPA 4XKRA 1FTOA 4OEVA 4QFLA 3PGFA 4H6DA 3KG2A 3TKDA 2DYXA 1IZ1A 1O7TA 2ZYMA 3MUQA 4E0XA 3TYHA 3IO6A 1Y9UA 3RY3A 2XD3A 5I2KA 3N94A 4H8JA 1ZU0A 4OHNA 5LOMA 2DXRA 3TCFA 4F18A 5L9MA 1IITA 3CVGA 4AQ4A 1B4ZA 3IJOB 1OVBA 3CI8A 3MJNA 5ICTA 4EDPA 3K0VA 3PMWA 2ALUA 2GFEA 4R9FA 2Z23A 4O3AA 3UORA 4YKIA 5AA4B 1WVJA 1ZMGA 3G3HA 5L9SA 1US5A 3SESA 2THIA 5H8QA 3RQTA 1TFDA 1N84A 4MF3A 5JTYA 1B52A 3N6UA 3IB1A 5HBCA 5ELVA 4Q0CA 1N04A 3ZSFA 2OLBA 2YPNA 4U4XA 3TPAA 4GWOA 4FAJA 2XHDA 3WAEA 1OIBA 3RNNA 1TWYA 3IOTA 2OK2A 2O69A 3H6WA 4GXSB 2I58A 3K6WA 2HCAA 3UP9A 3IR1A 3W9WA 1BIYA 2D5WA 3UA8A 4QSDA 1N7WA 4MLVA 4IY6A 1Z7NE 3Q27A 3OSQA 5DEXB 1BLFA 2UVIA 3C33A 4JSDA 3KSJA 4OVJA 1MY0A 2DWIA 1FQFA 1B3FA 1FQEA 3EHTA 4KCDA 4IGRA 3FASA 2GHAA 4QSCA 4H65A 3LSWA 2P1SA 1MG1A 4C0RA 4YKPA 4H1XA 1LAGE 5AA3A 1UTBA 4QFKA 1B3LA 4OERA 1QULA 3OXNA 4F39A 1SQYA 5DVJA 3C31A 4MFIA 3KOSA 3LBSA 3VLWA 1OVTA 4ZE8A 2PT1A 2O84X 1A55A 5CBSA 4RPOA 4C1UA 1XVYA 1POY1 3K1PA 2O7IA 2Z8FA 5CMCA 3VV5A 4NF5A 1B1XA 4WEPA 2OJTA 3O6GA 5A5XA 1EU8A 4PP0A 1FQBA 1P1OA 5FHMA 4DXCA 3EPEA 1R9LA 2PBWA 5KDTA 4G68C 4F1UA 5FHOA 4O3BA 3QK6A 4HTGA 3VXBA 2P0SA 4P0IA 3RGYA 1MXZA 3B7DA 3P7IA 3O6HA 3MPKA 2W7YA 3FATA 4DZ1A 2DVCA 4OWDA 2V84A 1USYE 3H06B 1QJMA 1LBCA 1NNKA 5K2YA 4X1BA 3S9EA 3IX1A 5AA1A 3K6XA 4YB6A 1FQDA 3GBAA 5H8QB 4FIMA 4OETA 3W15C 1M5CA 5JTYB 3PMXA 4QFPA 5BUUA 3DELB 1NFTA 5HM4B 3C35A 3KGCA 3R7XA 3OSRA 5ITPA 1UIVA 4KI0E 4F1YA 4NF4A 3QSLA 2ZNTA 3EF7A 3C4MA 4DCXA 3SEUA 4EXKA 3K02A 1XVXA 1MPBA 3LC8A 2Z22A 1B58A 3I5OA 3OO8A 3PPNA 1D9YA 1QW0A 1ZBMA 4QFNA 3KJTA 2F97A 5I57A 3MZ9A 4JSOA 1D9VA 4ZDMA 3SEXA 1QVSA 4OMBA 2ZNSA 5JEIA 3TQLA 1VE4A 1GGGA 3S4UA 4TOZA 5EHMA 4GVOA 1N76A 5B7DA 4R6HA 1YPNA 4R74A 3OEKA 2XD2A 5CC2A 1P1NA 3M3FA 3G3KA 5FTIA 1DTZA 1DSNA 3SKPA 1AH5A 3UK4A 2DXYA 1MXUA 3MWBA 1SDXA 1AIVA 1H76A 4F31B 3S9LC 1VSOA 3Q29A 3ZS6A 4YKKA 4N13A 4ZEKA 4GLIA 2H98A 3PUZE 3IB2A 2Q8JA 3IO4A 4KYDA 4M1VA 3FXRA 3KBRA 4QHQA 4OTEA 2O6AA 1JETA 2HAUA 3WAFA 3H03A 1FQCA 1B40A 1Y4TA 3H6TA 1SW2A 4XKQA 4HW8A 3HO7A 3KJ7A 3CRBA 3JYRA 3KSXA 4X48A 3ONMA 5M2VA 1VFEA 3QYTA 1MQJA 2AL4A 1WDNA 3PV0E 2B3BA 4U2RA 5KDTB 4FE8A 1VR5A 1MM7A 4BDQA 2RCAA 4R2BA 3U72A 4F3SA 1MXVA 3ODBA 3VLUA 3U1OA 5IKBA 3MVWA 4Z0IA 2F78A 4PFUA 3H4ZA 1H3DA 4Z7EA 2NUVA 1LBBA 3SEVA 3KFMA 5K2XA 2DE4A 3SERA 3MZBA 1JEUA 1M5FA 2XXRA 3MP8A 1R9QA 4RK9A 5I84A 2VD3A 2Y84A 2Q9TA 3MP6A 1MXXA 2I3VA 1SBPA 3H6UA 3O29A 4OEUA 4OFOA 4ZEFA 2XXWA 2XX8A 2RF1A 4GXAA 4RPNA 5DT6A 1NKXA 2RCBA 3QAXA 2ONKE 4F29A 3MVZA 3K1MA 3HSTA 4QFOA 4R2FA 1B32A 4IGTA 1IXGA 5AA2A 4NTLA 4GQOA 4JWYA 5H8NA 5B70A 5H8HB 3OEMA 1SI0A 4LUBA 4PE5B 3TTNA 3VVEA 2D21A 3RLFE 1GV8A 4FORA 2B65A 2YLNA 5IAIA 3K00A 1IUDA 2O7UA 1P1WA 4TQUQ 3BFTA 2B3FA 1LAXA 2RINA 3SEWA 4IO4A 5JK4A 4OENA 1CE2A 4N6PA 3TUSA 3A3CA 4EQ9A 2R6GE 2F7CA 4NWDA 1MQGA 1P99A 3OMBA 1GVCA 4QRZA 5ISUA 4H8IA 1S50A 4G8HA 5H8SA 1MPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQP A;  1M5D A;  3FV2 A;  4NE4 A;  3EQ1 A;  3FV1 A;  1KWH A;  1GTK A;  3UN6 A;  1N3W A;  3TCG A;  5I2N A;  2I0C A;  3K4U A;  4IY5 A;  5I56 A;  4YMB A;  4WKM A;  1PEB A;  2QS3 A;  1MS7 A;  2DQV A;  1LGB C;  3MVY A;  4AB6 A;  1IXC A;  3C34 A;  1IIW A;  2LAO A;  4U1O A;  1XT8 A;  3IB0 A;  2F35 A;  2HXW A;  3K2D A;  2OBG A;  3IOR A;  2QRY A;  1AOV A;  2GH9 A;  3H6V A;  4PFY A;  1ATG A;  2UVJ A;  1A54 A;  4I1D A;  4EQ7 A;  3KN8 A;  1TT1 A;  1JVX A;  2H99 A;  3RN8 A;  2F7B A;  5ICQ A;  4DE8 A;  3O6I A;  2E0S A;  1F9B A;  5CRY A;  1B51 A;  3O66 A;  2DWJ A;  4PET A;  2I4B A;  4YMA A;  1EH3 A;  2DE2 A;  2E1S A;  3G3I A;  1HSJ A;  1MDP 1;  3FJ7 A;  3QXM A;  1B5H A;  5I58 A;  3CFX A;  2QJE A;  3DM0 A;  1B7H A;  4G77 A;  3H7M A;  3U8Q A;  4HS7 A;  3PUY E;  3E13 X;  1QKA A;  3PUV E;  1CB6 A;  4GD5 A;  4DCY A;  2IA4 A;  1PB7 A;  1J1N A;  3VFJ A;  1NH7 A;  5BWJ A;  3KN7 A;  1M5E A;  3VE1 B;  2I48 A;  5J1D A;  1JW1 A;  1PBQ A;  1B3H A;  4YIC A;  3CSB A;  3MC2 A;  3GXA A;  1LCF A;  3FXU A;  4POX A;  3TOD A;  3GBB A;  3HN0 A;  5F7V A;  2VOZ A;  1Y20 A;  2KLF A;  1US4 A;  1NNP A;  3FGS A;  4XKN A;  4JBZ A;  3S9N C;  3O28 A;  3MP1 A;  5H8N B;  1LFI A;  5I2K B;  4ELR A;  1TXF A;  2ANJ A;  2AL5 A;  4FED A;  4ONY A;  3SET A;  4GFR A;  1L5T A;  3TFL A;  1FCK A;  2PVU A;  2X7Q A;  4DXU A;  4YAH X;  4EXL A;  2H25 A;  1MY1 A;  4MLQ A;  2BJJ X;  3RUM A;  1YCJ A;  1LFG A;  2CMO A;  4ZS9 A;  3ZKK A;  3FD3 A;  4IO5 A;  5H8F A;  2X7P A;  5CMK A;  3TTM A;  1I6Q A;  3U92 A;  2DE3 A;  2UVG A;  3PUW E;  5DVF A;  3T22 A;  2R9J A;  1AMF A;  2I6E A;  2UXA A;  1FTK A;  3M3L A;  3HHF A;  3TAJ A;  2PMS A;  1QKB A;  2QSX A;  2DSF A;  3PUX E;  1LLS A;  4R73 A;  2ZNU A;  3VXC A;  1NNT A;  4M4G A;  5I56 B;  5L9O A;  1S9T A;  1RYX A;  3K6U A;  2QS1 A;  1Y4C A;  2VD2 A;  4NF8 A;  3T93 B;  4R9G A;  3THI A;  4GL0 A;  1FTJ A;  3LSX A;  2QS4 A;  3T66 A;  2ZYO A;  2Q2C A;  2Y7R A;  1FQA A;  5CBR A;  4ELO A;  3FJM A;  1Q1K A;  1M5B A;  3T9H B;  2HZK A;  3FVK A;  4GIZ A;  4G68 A;  4NMY A;  3Q28 A;  3TTR A;  4LZ7 A;  4LZ8 A;  5CI5 A;  3O2A A;  3HV1 A;  1UTH A;  3O9P A;  3VVD A;  3U93 A;  2NVU B;  5DYH A;  3KOT A;  4G8M A;  4PFW A;  1URS A;  4F3B A;  4OFJ A;  1Q35 A;  1URG A;  5I58 B;  1UTB B;  3ZKL A;  4LQ2 A;  4KD5 A;  1EZ9 A;  3ILT B;  4BDR A;  1ZIU A;  5EYF A;  3CSG A;  1SW1 A;  3BBR A;  3IJX B;  1MH4 A;  2V3T A;  2H4I A;  3MVX A;  4FAT A;  4HCY A;  5CMB A;  3PD9 A;  1HSL A;  1N3X A;  3FIR A;  3HHG A;  2Y7W A;  3C9H A;  3CIJ A;  4KYS A;  1NMU A;  1H45 A;  3EN3 A;  2REG A;  3T96 B;  2AIX A;  3MAM A;  4LA9 A;  2Y7I A;  1B7Z A;  1URD A;  3FVO A;  3BFU A;  4NF5 B;  3M3K A;  2PX1 A;  4BDN A;  3VLV A;  2QPQ A;  3RT6 B;  1HSE A;  5A5X B;  2G29 A;  2RC9 A;  2XXV A;  3PPO A;  3OO7 A;  4H5F A;  4NWC A;  1B3G A;  2DWH A;  1LB8 A;  2DS9 A;  3MBP A;  4ND9 A;  1OQH A;  2QMW A;  4R6K A;  3PU5 A;  4LON B;  4JDF A;  4K3F A;  2G93 A;  2V25 A;  3JZJ A;  2X26 A;  4JWO A;  2HZL A;  2OZZ A;  1XHY A;  4R72 A;  4GRK A;  3G3F A;  1MQD A;  1PDA A;  4BLA A;  3FUZ A;  5FTH A;  4ESX A;  5DEX A;  4IO3 A;  3I3V A;  2HAV A;  1GR2 A;  1JNF A;  1MDQ A;  4TLM B;  4XXU A;  1N0T A;  4GF8 A;  1JVY A;  5F1Q A;  4KFQ A;  4KPT A;  4ELP A;  3LUY A;  1JW4 A;  1LFH A;  3DP4 A;  1B5I A;  1UIU A;  4U22 A;  2AYS A;  3U94 A;  5HPQ A;  4X1D A;  1Y1Z A;  3OEN A;  1SYH A;  4NF4 B;  3V5A A;  2F6G A;  4NF8 B;  2QL3 A;  3PPR A;  4RK2 A;  1QUK A;  3PPQ A;  2PT2 A;  4U4S A;  4G4P A;  2A5T A;  4RNS A;  1B9J A;  1LCT A;  3FVG A;  2GHB A;  4QF9 A;  4MH5 A;  4RA1 A;  4F19 A;  1SVX B;  4ESW A;  4F2O A;  2I3W A;  1IXI A;  1P1Q A;  3K01 A;  5I57 B;  2OCU A;  3TEP A;  4G68 B;  1II5 A;  3V83 A;  2ZYN A;  3K1N A;  1IQ7 A;  2F34 A;  1Y3P A;  1JW5 A;  3KN3 A;  1UTH B;  3B6Q A;  4YB7 A;  4H67 A;  4JWX A;  1A8E A;  4ZZE A;  1LB9 A;  2XXU A;  2Q89 A;  1YAE A;  1S7Y A;  2FNC A;  1B7U A;  1POT A;  4YZZ A;  4LAT A;  2H5Y A;  2Y7K A;  3JV9 A;  3MW0 A;  1XOC A;  2HQ0 A;  4Q30 B;  1USY H;  4E0W A;  1B0L A;  4XKP A;  4U1Z A;  2UVH A;  3RT8 A;  1ZKB A;  3DP6 A;  5I59 A;  5EHS A;  2QMX A;  3L6H A;  4DDD A;  1D3K A;  2M8C A;  3HCQ A;  4P11 A;  5L8D A;  3S9M C;  2Y7P A;  4OFL A;  3OO6 A;  3C32 A;  1BTJ A;  3IOW A;  4R6Y A;  1MQH A;  4OQO A;  3PMV A;  3F11 A;  1B1H A;  3LSL A;  3HPI A;  1AL3 A;  4JXI A;  4JB7 A;  1NH8 A;  1R1N A;  2F36 A;  2A5S A;  3E9X A;  2I4C A;  1T0K A;  1IXH A;  2O1L A;  4P0G A;  1B6H A;  4ZED A;  4NED A;  2DWA A;  1WOD A;  4FJP A;  2UYE A;  3E4R A;  3KZG A;  1TFA A;  3SEY A;  1MQI A;  1OQG A;  1DPE A;  2FA7 A;  2ONR A;  1OMP A;  2XX7 A;  3G7W A;  4YKJ A;  3RTF B;  3QUF A;  4IO2 A;  2VHA A;  3QIM A;  1A7L A;  2OWT A;  2ZXT A;  1A99 A;  3OOA A;  4IO6 A;  3N5L A;  2XXP A;  3LR1 A;  5KCJ A;  4I8C A;  3S2V A;  4DLD A;  2RC8 A;  4HCW A;  3IOU A;  4DXB A;  4X9T A;  2XX9 A;  3MQ9 A;  4H5G A;  2VP1 A;  1B46 A;  3W9V A;  2R71 A;  1BP5 A;  1EZP A;  3Q25 A;  4BDM A;  2REJ A;  5KZT A;  3VDF A;  4RYA A;  4RY1 A;  5CMM A;  4Q5T A;  3ECR A;  3TTK A;  4LVQ A;  2OWS A;  4LZ5 A;  4NF6 A;  4R75 A;  1MXW A;  3KEI A;  2IEE A;  2DP8 A;  3MPL A;  4BDO A;  2NOO A;  3T9X B;  4F22 A;  2VGQ A;  1P1U A;  2A5T B;  5AA2 B;  3AXF A;  1A8F A;  2HFB A;  2I49 A;  3M8U A;  4U21 A;  1MY3 A;  4EF1 A;  1SW5 A;  3A09 A;  1Y3Q A;  4ELQ A;  4LQ5 A;  1B0H A;  1N7X A;  4RXL A;  3I6V A;  1H44 A;  1ZJL A;  1LAH E;  4KHZ E;  5AA2 D;  3D4C A;  4G2Z A;  3CFL A;  2ABH A;  3UIF A;  3FVN A;  4PFT A;  1VFD A;  4MBP A;  3C36 A;  3GZG A;  3UGW A;  2UYF A;  2NWJ A;  1I69 A;  2Z8E A;  1A40 A;  5TPA A;  1EZO A;  3RPW A;  1MY2 A;  3H3G A;  3OD7 A;  1ANF A;  3A3U A;  2RC7 A;  4ZEC A;  2F6P A;  2F7A A;  4OES A;  1MH3 A;  4IB2 A;  2XXH A;  1MRP A;  4OXV A;  4GL8 A;  1O64 A;  1DTG A;  1SD3 A;  4POW A;  3TCH A;  3N26 A;  1MXY A;  4F2Q A;  2I0B A;  1NL5 A;  2O51 A;  1B3E A;  5I2N B;  3G3J A;  2H9B A;  2DOJ A;  1FTL A;  4ISU A;  4XTC Q;  1FW0 A;  5I59 B;  3TEL A;  3G3G A;  2ESN A;  3MZ1 A;  3GLB A;  4XIG Q;  3OEL A;  1QUJ A;  3FXQ A;  1PB9 A;  4RJZ A;  2XXX A;  1O63 A;  5AE4 A;  2XXQ A;  4FEB A;  3CG1 A;  5TP9 A;  1SI1 A;  2XXT A;  4BDL A;  1FTM A;  3B6W A;  4WED A;  1QUI A;  2P2A A;  3T9U A;  2ZYK A;  3TDJ A;  1H43 A;  3V8X B;  5ITO A;  1RKM A;  4F1V A;  5H8H A;  4I62 A;  1ELJ A;  4DIG A;  1PB8 A;  1DOT A;  4KYE A;  3CG3 A;  3TMG A;  4L17 A;  4YU0 A;  2FYI A;  1SYI A;  1SW4 A;  5DVI A;  1I6A A;  4YB5 A;  4ZEI A;  2XXI A;  3R6U A;  1B05 A;  4LP2 B;  1D4N A;  3R26 A;  4KCC A;  3PD8 A;  3T9V A;  3FJG A;  4UAC A;  5AA4 A;  3O97 A;  5KCJ B;  3TQW A;  5TU0 A;  4N07 A;  3V89 B;  2PYY A;  4WXJ A;  1LST A;  2Q88 A;  4THI A;  3K6V A;  2XXY A;  1B2H A;  4F3G A;  2QS2 A;  1RYO A;  3Q26 A;  3TZA A;  3QUJ A;  4NF6 B;  1XS5 A;  4QSE A;  1Y3N A;  4ZEB A;  1PC3 A;  1OLA A;  3SDF A;  4PQJ A;  1YTV A;  2WKY A;  4GOT A;  2F5X A;  5DTB A;  4OYV A;  3L6G A;  4I9D A;  5CM6 A;  4IO7 A;  1JQF A;  2HEU A;  4U23 A;  3OO9 A;  1Z7M E;  4KR5 A;  4UA8 A;  3DLN A;  2ONS A;  1NNF A;  2ZMB A;  2YJP A;  1B5J A;  1B4H A;  4EF2 A;  4ZZA A;  5FHN A;  1XC1 A;  2O1M A;  3IOV A;  2NXO A;  4G8N A;  3RTW B;  5TPA B;  5H8F B;  3EHU A;  2Z8D A;  3BKI B;  2V3Q A;  1MM6 A;  3DP8 A;  3CFZ A;  1JEV A;  3USD A;  1MPD A;  3TTL A;  4F3P A;  4C1T A;  2O68 A;  3CR9 A;  3E3K A;  2RKM A;  1ZTY A;  1Y1M A;  2GRV A;  2V3U A;  3ILU B;  1I6B A;  3LSF B;  1BKA A;  3IK6 B;  2F8D A;  1DMB A;  1UQW A;  4TLL B;  4ECF A;  4FEC A;  3D4G A;  2DVZ A;  1LAF E;  4EUO A;  1ZLQ A;  3IL1 B;  4Q8R A;  1R6Z A;  4H0W A;  1OLC A;  3EHS A;  4EQB A;  3N6T A;  4OZ9 A;  3IAZ A;  1MY4 A;  1PBP A;  3VVF A;  4O3C A;  2CZL A;  2V93 A;  1IEJ A;  2Q2A A;  3PPP A;  2D3I A;  3B6T A;  3FZV A;  4AB5 A;  5TP9 B;  4ZE9 A;  1DPP A;  4XKR A;  1FTO A;  4OEV A;  4QFL A;  3PGF A;  4H6D A;  3KG2 A;  3TKD A;  2DYX A;  1IZ1 A;  1O7T A;  2ZYM A;  3MUQ A;  4E0X A;  3TYH A;  3IO6 A;  1Y9U A;  3RY3 A;  2XD3 A;  5I2K A;  3N94 A;  4H8J A;  1ZU0 A;  4OHN A;  5LOM A;  2DXR A;  3TCF A;  4F18 A;  5L9M A;  1IIT A;  3CVG A;  4AQ4 A;  1B4Z A;  3IJO B;  1OVB A;  3CI8 A;  3MJN A;  5ICT A;  4EDP A;  3K0V A;  3PMW A;  2ALU A;  2GFE A;  4R9F A;  2Z23 A;  4O3A A;  3UOR A;  4YKI A;  5AA4 B;  1WVJ A;  1ZMG A;  3G3H A;  5L9S A;  1US5 A;  3SES A;  2THI A;  5H8Q A;  3RQT A;  1TFD A;  1N84 A;  4MF3 A;  5JTY A;  1B52 A;  3N6U A;  3IB1 A;  5HBC A;  5ELV A;  4Q0C A;  1N04 A;  3ZSF A;  2OLB A;  2YPN A;  4U4X A;  3TPA A;  4GWO A;  4FAJ A;  2XHD A;  3WAE A;  1OIB A;  3RNN A;  1TWY A;  3IOT A;  2OK2 A;  2O69 A;  3H6W A;  4GXS B;  2I58 A;  3K6W A;  2HCA A;  3UP9 A;  3IR1 A;  3W9W A;  1BIY A;  2D5W A;  3UA8 A;  4QSD A;  1N7W A;  4MLV A;  4IY6 A;  1Z7N E;  3Q27 A;  3OSQ A;  5DEX B;  1BLF A;  2UVI A;  3C33 A;  4JSD A;  3KSJ A;  4OVJ A;  1MY0 A;  2DWI A;  1FQF A;  1B3F A;  1FQE A;  3EHT A;  4KCD A;  4IGR A;  3FAS A;  2GHA A;  4QSC A;  4H65 A;  3LSW A;  2P1S A;  1MG1 A;  4C0R A;  4YKP A;  4H1X A;  1LAG E;  5AA3 A;  1UTB A;  4QFK A;  1B3L A;  4OER A;  1QUL A;  3OXN A;  4F39 A;  1SQY A;  5DVJ A;  3C31 A;  4MFI A;  3KOS A;  3LBS A;  3VLW A;  1OVT A;  4ZE8 A;  2PT1 A;  2O84 X;  1A55 A;  5CBS A;  4RPO A;  4C1U A;  1XVY A;  1POY 1;  3K1P A;  2O7I A;  2Z8F A;  5CMC A;  3VV5 A;  4NF5 A;  1B1X A;  4WEP A;  2OJT A;  3O6G A;  5A5X A;  1EU8 A;  4PP0 A;  1FQB A;  1P1O A;  5FHM A;  4DXC A;  3EPE A;  1R9L A;  2PBW A;  5KDT A;  4G68 C;  4F1U A;  5FHO A;  4O3B A;  3QK6 A;  4HTG A;  3VXB A;  2P0S A;  4P0I A;  3RGY A;  1MXZ A;  3B7D A;  3P7I A;  3O6H A;  3MPK A;  2W7Y A;  3FAT A;  4DZ1 A;  2DVC A;  4OWD A;  2V84 A;  1USY E;  3H06 B;  1QJM A;  1LBC A;  1NNK A;  5K2Y A;  4X1B A;  3S9E A;  3IX1 A;  5AA1 A;  3K6X A;  4YB6 A;  1FQD A;  3GBA A;  5H8Q B;  4FIM A;  4OET A;  3W15 C;  1M5C A;  5JTY B;  3PMX A;  4QFP A;  5BUU A;  3DEL B;  1NFT A;  5HM4 B;  3C35 A;  3KGC A;  3R7X A;  3OSR A;  5ITP A;  1UIV A;  4KI0 E;  4F1Y A;  4NF4 A;  3QSL A;  2ZNT A;  3EF7 A;  3C4M A;  4DCX A;  3SEU A;  4EXK A;  3K02 A;  1XVX A;  1MPB A;  3LC8 A;  2Z22 A;  1B58 A;  3I5O A;  3OO8 A;  3PPN A;  1D9Y A;  1QW0 A;  1ZBM A;  4QFN A;  3KJT A;  2F97 A;  5I57 A;  3MZ9 A;  4JSO A;  1D9V A;  4ZDM A;  3SEX A;  1QVS A;  4OMB A;  2ZNS A;  5JEI A;  3TQL A;  1VE4 A;  1GGG A;  3S4U A;  4TOZ A;  5EHM A;  4GVO A;  1N76 A;  5B7D A;  4R6H A;  1YPN A;  4R74 A;  3OEK A;  2XD2 A;  5CC2 A;  1P1N A;  3M3F A;  3G3K A;  5FTI A;  1DTZ A;  1DSN A;  3SKP A;  1AH5 A;  3UK4 A;  2DXY A;  1MXU A;  3MWB A;  1SDX A;  1AIV A;  1H76 A;  4F31 B;  3S9L C;  1VSO A;  3Q29 A;  3ZS6 A;  4YKK A;  4N13 A;  4ZEK A;  4GLI A;  2H98 A;  3PUZ E;  3IB2 A;  2Q8J A;  3IO4 A;  4KYD A;  4M1V A;  3FXR A;  3KBR A;  4QHQ A;  4OTE A;  2O6A A;  1JET A;  2HAU A;  3WAF A;  3H03 A;  1FQC A;  1B40 A;  1Y4T A;  3H6T A;  1SW2 A;  4XKQ A;  4HW8 A;  3HO7 A;  3KJ7 A;  3CRB A;  3JYR A;  3KSX A;  4X48 A;  3ONM A;  5M2V A;  1VFE A;  3QYT A;  1MQJ A;  2AL4 A;  1WDN A;  3PV0 E;  2B3B A;  4U2R A;  5KDT B;  4FE8 A;  1VR5 A;  1MM7 A;  4BDQ A;  2RCA A;  4R2B A;  3U72 A;  4F3S A;  1MXV A;  3ODB A;  3VLU A;  3U1O A;  5IKB A;  3MVW A;  4Z0I A;  2F78 A;  4PFU A;  3H4Z A;  1H3D A;  4Z7E A;  2NUV A;  1LBB A;  3SEV A;  3KFM A;  5K2X A;  2DE4 A;  3SER A;  3MZB A;  1JEU A;  1M5F A;  2XXR A;  3MP8 A;  1R9Q A;  4RK9 A;  5I84 A;  2VD3 A;  2Y84 A;  2Q9T A;  3MP6 A;  1MXX A;  2I3V A;  1SBP A;  3H6U A;  3O29 A;  4OEU A;  4OFO A;  4ZEF A;  2XXW A;  2XX8 A;  2RF1 A;  4GXA A;  4RPN A;  5DT6 A;  1NKX A;  2RCB A;  3QAX A;  2ONK E;  4F29 A;  3MVZ A;  3K1M A;  3HST A;  4QFO A;  4R2F A;  1B32 A;  4IGT A;  1IXG A;  5AA2 A;  4NTL A;  4GQO A;  4JWY A;  5H8N A;  5B70 A;  5H8H B;  3OEM A;  1SI0 A;  4LUB A;  4PE5 B;  3TTN A;  3VVE A;  2D21 A;  3RLF E;  1GV8 A;  4FOR A;  2B65 A;  2YLN A;  5IAI A;  3K00 A;  1IUD A;  2O7U A;  1P1W A;  4TQU Q;  3BFT A;  2B3F A;  1LAX A;  2RIN A;  3SEW A;  4IO4 A;  5JK4 A;  4OEN A;  1CE2 A;  4N6P A;  3TUS A;  3A3C A;  4EQ9 A;  2R6G E;  2F7C A;  4NWD A;  1MQG A;  1P99 A;  3OMB A;  1GVC A;  4QRZ A;  5ISU A;  4H8I A;  1S50 A;  4G8H A;  5H8S A;  1MPC A; 
#chains in the Genus database with same CATH topology
 4KQP A;  1M5D A;  3FV2 A;  4NE4 A;  3EQ1 A;  1FPE A;  3FV1 A;  1EYI A;  1KWH A;  1GTK A;  3UN6 A;  1N3W A;  2CEY A;  4PGP A;  3TCG A;  5I2N A;  4PE3 A;  2I0C A;  3K4U A;  4IY5 A;  5I56 A;  4YMB A;  4WKM A;  1PEB A;  2QS3 A;  1MS7 A;  2DQV A;  1LGB C;  3MVY A;  4AB6 A;  1IXC A;  3C34 A;  1IIW A;  2LAO A;  4U1O A;  1XT8 A;  3IB0 A;  2F35 A;  3HFU A;  2HXW A;  3K2D A;  2OBG A;  3IOR A;  2QRY A;  1LBY A;  1AOV A;  2GH9 A;  3H6V A;  4PFY A;  1ATG A;  2UVJ A;  1FBC A;  4PTK A;  1A54 A;  4I1D A;  4EQ7 A;  3KN8 A;  1TT1 A;  1JVX A;  2H99 A;  3RN8 A;  2F7B A;  5ICQ A;  4DE8 A;  3O6I A;  2E0S A;  1F9B A;  1B51 A;  5CRY A;  2WEF A;  2DWJ A;  3O66 A;  4MEV A;  4PET A;  2I4B A;  4YMA A;  1EYJ A;  3FBP A;  1EH3 A;  2DE2 A;  2E1S A;  3G3I A;  1HSJ A;  2KQZ A;  1FSA A;  1MDP 1;  3FJ7 A;  3QXM A;  1B5H A;  5I58 A;  2XXK A;  3CFX A;  2QJE A;  3DM0 A;  1B7H A;  4G77 A;  3H7M A;  3U8Q A;  4HS7 A;  2OX3 A;  3PUY E;  3E13 X;  4N6K A;  3EKI A;  1QKA A;  3PUV E;  1CB6 A;  4GD5 A;  4DCY A;  2P3V A;  2IA4 A;  1PB7 A;  1J1N A;  2QVR A;  3VFJ A;  1NH7 A;  2VPN A;  4GWY A;  5BWJ A;  3KN7 A;  1M5E A;  3VE1 B;  2I48 A;  5T3J A;  5J1D A;  4PF6 A;  1JW1 A;  1PBQ A;  4N8Y A;  4PGN A;  1B3H A;  4NX1 A;  2MKZ A;  4YIC A;  3CSB A;  3MC2 A;  3GXA A;  1LCF A;  3FXU A;  4POX A;  3TOD A;  3GBB A;  3HN0 A;  2Q74 A;  5F7V A;  5ET8 A;  2VOZ A;  1Y20 A;  1FBP A;  2KLF A;  1US4 A;  5EQ8 A;  1NNP A;  3FGS A;  4XKN A;  4JBZ A;  3S9N C;  3O28 A;  3MP1 A;  5H8N B;  1LFI A;  5I2K B;  4ELR A;  4GWS A;  1TXF A;  2ANJ A;  2AL5 A;  4FED A;  4ONY A;  3SET A;  4GFR A;  1L5T A;  3TFL A;  1FCK A;  2PVU A;  2X7Q A;  4DXU A;  4YAH X;  4EXL A;  2H25 A;  1MY1 A;  5ET7 A;  4MLQ A;  2BJJ X;  3RUM A;  1YCJ A;  1LFG A;  2CMO A;  4ZS9 A;  3ZKK A;  3FD3 A;  2OWZ A;  4IO5 A;  5H8F A;  2WYP A;  2X7P A;  1EYK A;  2QFL A;  5CMK A;  3TTM A;  1I6Q A;  3U92 A;  3SZP A;  2DE3 A;  2QVV A;  2UVG A;  3PUW E;  5DVF A;  3T22 A;  4X8R A;  2R9J A;  2Y5L A;  5IZZ A;  1AMF A;  4PFB A;  4HE0 A;  2I6E A;  2UXA A;  1FTK A;  3M3L A;  2XWK A;  3HHF A;  3TAJ A;  2PMS A;  3KC0 A;  3B50 A;  1QKB A;  2QSX A;  3MST A;  2DSF A;  3PUX E;  1LLS A;  4R73 A;  2ZNU A;  3VXC A;  1NNT A;  1YYZ A;  4M4G A;  5I56 B;  5L9O A;  1NUW A;  1S9T A;  4I40 A;  4MNC A;  1RYX A;  3K6U A;  4GX6 A;  2PFY A;  2QS1 A;  2WYK A;  1Y4C A;  3B8B A;  2VD2 A;  4NF8 A;  4XF5 A;  3T93 B;  4R9G A;  3THI A;  4GL0 A;  1FTJ A;  3LSX A;  2QS4 A;  3IFC A;  5IZ3 A;  3T66 A;  2ZYO A;  2Q2C A;  2Y7R A;  1FQA A;  5CBR A;  4ELO A;  3FJM A;  1Q1K A;  1M5B A;  3T9H B;  2HZK A;  3FVK A;  4GIZ A;  4G68 A;  4NMY A;  3Q28 A;  3TTR A;  4LZ7 A;  4LZ8 A;  5CI5 A;  4MHF A;  3O2A A;  3HV1 A;  3GYY A;  1UTH A;  3O9P A;  3VVD A;  3U93 A;  2NVU B;  5DYH A;  4NQ8 A;  3KOT A;  4G8M A;  4JVD A;  4PFW A;  1URS A;  4F3B A;  4OFJ A;  1Q35 A;  1URG A;  4P3L A;  5I58 B;  1UTB B;  3ZKL A;  4LQ2 A;  4KD5 A;  1EZ9 A;  3ILT B;  4BDR A;  2XWI A;  1ZIU A;  5EYF A;  3CSG A;  2CZI A;  1SW1 A;  3BBR A;  3IJX B;  1NV2 A;  1MH4 A;  2V3T A;  2H4I A;  3MVX A;  1FPK A;  4FAT A;  4HCY A;  5CMB A;  3PD9 A;  1HSL A;  1N3X A;  3FIR A;  3HHG A;  2Y7W A;  3C9H A;  3CIJ A;  4KYS A;  1NMU A;  1H45 A;  3EN3 A;  1FPI A;  2REG A;  3T96 B;  4NN3 A;  2AIX A;  3MAM A;  2Q8M A;  4LA9 A;  2Y7I A;  1B7Z A;  1URD A;  3FVO A;  3BFU A;  4NF5 B;  3M3K A;  1NV7 A;  4MJO A;  2PX1 A;  4BDN A;  1LBW A;  3VLV A;  2QPQ A;  3RT6 B;  1HSE A;  5A5X B;  2G29 A;  2RC9 A;  2XXV A;  3PPO A;  3OO7 A;  4H5F A;  2FBP A;  4NWC A;  1B3G A;  2DWH A;  1LB8 A;  4H46 A;  2DS9 A;  3MBP A;  4ND9 A;  1OQH A;  2QMW A;  4R6K A;  3PU5 A;  4LON B;  4JDF A;  4K3F A;  2G93 A;  2V25 A;  3JZJ A;  2X26 A;  4JWO A;  4XEQ A;  2ZZX A;  2HZL A;  2OZZ A;  1XHY A;  4R72 A;  4GRK A;  3G3F A;  1MQD A;  1PDA A;  4BLA A;  3FUZ A;  4I3Y A;  5FTH A;  4ESX A;  5DEX A;  4MIJ A;  4IO3 A;  3I3V A;  4PBQ A;  2HAV A;  4P8B A;  1GR2 A;  1JNF A;  1MDQ A;  4TLM B;  1NV1 A;  2Y5K A;  4XXU A;  3T1B A;  1N0T A;  4GF8 A;  1JVY A;  5F1Q A;  4UAB A;  4KFQ A;  4KPT A;  4ELP A;  3LUY A;  4JVC A;  1JW4 A;  1LFH A;  3DP4 A;  4GX3 A;  1B5I A;  1UIU A;  2BJI A;  4U22 A;  2AYS A;  3U94 A;  5HPQ A;  4X1D A;  4GWW A;  4NF0 A;  4MX6 A;  1Y1Z A;  3OEN A;  1SYH A;  4NF4 B;  3V5A A;  2F6G A;  4NF8 B;  2QL3 A;  3PPR A;  5I7I A;  4RK2 A;  1QUK A;  3PPQ A;  2PT2 A;  1FPF A;  4U4S A;  4G4P A;  2A5T A;  5IZ3 B;  4RNS A;  1B9J A;  1LCT A;  2HHM A;  3FVG A;  2GHB A;  2KR0 A;  4QF9 A;  4MH5 A;  4RA1 A;  4F19 A;  1SVX B;  4ESW A;  4N81 A;  4F2O A;  2I3W A;  1IXI A;  1P1Q A;  3K01 A;  5I57 B;  2OCU A;  3TEP A;  1FJ9 A;  4G68 B;  1II5 A;  3V83 A;  2ZYN A;  3K1N A;  1IQ7 A;  2F34 A;  1Y3P A;  1JW5 A;  3KN3 A;  1UTH B;  3B6Q A;  4YB7 A;  4H67 A;  4JWX A;  1A8E A;  4ZZE A;  1LB9 A;  2XXU A;  2Q89 A;  3D1R A;  2B4M A;  1YAE A;  4QBA A;  1S7Y A;  2FNC A;  1B7U A;  1POT A;  4YZZ A;  4LAT A;  2H5Y A;  2Y7K A;  3JV9 A;  3MW0 A;  1XOC A;  2HQ0 A;  3PTY A;  3U65 A;  1K9Y A;  4Q30 B;  1USY H;  4E0W A;  2F3B A;  4AS5 A;  1B0L A;  4PAK A;  4XKP A;  4U1Z A;  1DBZ A;  2UVH A;  3RT8 A;  1ZKB A;  3DP6 A;  5I59 A;  1IMC A;  1LEV A;  2B4L A;  3KC1 A;  5EHS A;  2QMX A;  3L6H A;  4DDD A;  1D3K A;  2M8C A;  3HCQ A;  4P11 A;  5L8D A;  3S9M C;  2Y7P A;  4OFL A;  2V4C A;  3OO6 A;  1IMA A;  3C32 A;  1BTJ A;  3IOW A;  4OVS A;  4R6Y A;  1MQH A;  4OQO A;  3PMV A;  3F11 A;  1G0H A;  1B1H A;  3LSL A;  3HPI A;  1IMD A;  1AL3 A;  4DI3 D;  1KZ8 A;  4JXI A;  4JB7 A;  1NH8 A;  1R1N A;  2F36 A;  2A5S A;  3E9X A;  3RPL A;  1FBH A;  2I4C A;  1T0K A;  1IXH A;  2O1L A;  4P0G A;  2VPO A;  1B6H A;  4ZED A;  4NED A;  2DWA A;  1WOD A;  4FJP A;  5I5P A;  2UYE A;  3E4R A;  3KZG A;  1TFA A;  3SEY A;  1MQI A;  1OQG A;  1DPE A;  2FA7 A;  2ONR A;  1OMP A;  2XX7 A;  3G7W A;  4YKJ A;  3RTF B;  3QUF A;  4IO2 A;  2VHA A;  3QIM A;  1A7L A;  2OWT A;  2ZXT A;  3MYU A;  1A99 A;  3OOA A;  4IO6 A;  3N5L A;  2XXP A;  3LR1 A;  5KCJ A;  4I8C A;  3S2V A;  4DLD A;  2RC8 A;  5A5L A;  4HCW A;  3IOU A;  4DXB A;  4X9T A;  1FJ6 A;  2XX9 A;  3MQ9 A;  4H5G A;  2VP1 A;  1B46 A;  3W9V A;  4X04 A;  2R71 A;  1BP5 A;  2XWV A;  4I3E A;  3Q25 A;  4BDM A;  1EZP A;  2REJ A;  5KZT A;  3VDF A;  4RYA A;  4RY1 A;  5CMM A;  4Q5T A;  3ECR A;  3TTK A;  4LVQ A;  1XI6 A;  2OWS A;  4LZ5 A;  4NF6 A;  4R75 A;  1MXW A;  3KEI A;  2IEE A;  2DP8 A;  3MPL A;  4BDO A;  2NOO A;  3T9X B;  4F22 A;  4NG7 A;  2VGQ A;  1P1U A;  2CZH A;  2A5T B;  5AA2 B;  3AXF A;  1A8F A;  2HFB A;  2I49 A;  3M8U A;  4U21 A;  1MY3 A;  4EF1 A;  1SW5 A;  3QMF A;  1DK4 A;  3A09 A;  1Y3Q A;  4ELQ A;  4LQ5 A;  1B0H A;  1N7X A;  4RXL A;  3I6V A;  1H44 A;  1ZJL A;  1LAH E;  4KHZ E;  5AA2 D;  3D4C A;  4G2Z A;  3CFL A;  2ABH A;  3UIF A;  3FVN A;  4PFT A;  1VFD A;  4MBP A;  3C36 A;  3GZG A;  3UGW A;  2UYF A;  2NWJ A;  1I69 A;  2Z8E A;  1A40 A;  5TPA A;  5IZ1 A;  3RPW A;  1MY2 A;  1EZO A;  3H3G A;  3OD7 A;  4AS4 A;  1ANF A;  3A3U A;  2RC7 A;  4ZEC A;  4N15 A;  2F6P A;  2F7A A;  4OES A;  4LN5 A;  1MH3 A;  4IB2 A;  2XXH A;  1MRP A;  4OXV A;  4GL8 A;  1O64 A;  1DTG A;  1SD3 A;  4POW A;  3N26 A;  3TCH A;  1MXY A;  4F2Q A;  2I0B A;  1NL5 A;  2O51 A;  1Q9D A;  2PCR A;  1B3E A;  5I2N B;  3G3J A;  2H9B A;  2DOJ A;  1FTL A;  4GBV A;  4ISU A;  4XTC Q;  1FW0 A;  5I59 B;  3TEL A;  3G3G A;  2ESN A;  3MZ1 A;  3GLB A;  4XIG Q;  3IFA A;  3OEL A;  1QUJ A;  3FXQ A;  4O7I A;  1PB9 A;  4RJZ A;  2XXX A;  1O63 A;  1G0I A;  2XXQ A;  5AE4 A;  4FEB A;  3CG1 A;  5TP9 A;  1SI1 A;  2XXT A;  1NV5 A;  4BDL A;  1FTM A;  3B6W A;  4WED A;  1QUI A;  5ET5 A;  2P2A A;  3T9U A;  2ZYK A;  3TDJ A;  1H43 A;  3V8X B;  2L5V A;  5ITO A;  1RKM A;  4F1V A;  5H8H A;  4I62 A;  1ELJ A;  1SPI A;  4DIG A;  1PB8 A;  1DOT A;  4JVI A;  4MMP A;  4KYE A;  1QGX A;  3CG3 A;  3TMG A;  4L17 A;  4YU0 A;  2FYI A;  1SYI A;  1SW4 A;  5DVI A;  1I6A A;  4YB5 A;  1BK4 A;  4ZEI A;  2XXI A;  3R6U A;  1B05 A;  4LP2 B;  3BIG A;  1D4N A;  3R26 A;  4KCC A;  1NI9 A;  3PD8 A;  4PFI A;  3T9V A;  3FJG A;  4UAC A;  5AA4 A;  3O97 A;  4O8M A;  5KCJ B;  1FPG A;  4O7M A;  3TQW A;  5LTC A;  5TU0 A;  2F3D A;  4N07 A;  3V89 B;  2PYY A;  4WXJ A;  1LST A;  2P3N A;  2Q88 A;  4THI A;  3K6V A;  2XXY A;  1B2H A;  4F3G A;  2QS2 A;  1RYO A;  3Q26 A;  4N4U A;  4KXP A;  3TZA A;  3QUJ A;  4NF6 B;  1XS5 A;  4QSE A;  1Y3N A;  4ZEB A;  1PC3 A;  1OLA A;  3SDF A;  4PQJ A;  1YTV A;  2WKY A;  4GOT A;  1FBE A;  4HE2 A;  2F5X A;  5DTB A;  4OYV A;  4PC9 A;  3L6G A;  4I9D A;  4NGU A;  2FIX A;  5CM6 A;  4IO7 A;  1JQF A;  4OVQ A;  2HEU A;  4U23 A;  3OO9 A;  1Z7M E;  4KR5 A;  1NV4 A;  4UA8 A;  3DLN A;  2ONS A;  1DCU A;  1NNF A;  2ZMB A;  2YJP A;  1B5J A;  1B4H A;  4EF2 A;  4ZZA A;  5FHN A;  1XC1 A;  2O1M A;  3IOV A;  2NXO A;  4G8N A;  4P1L A;  3RTW B;  5TPA B;  5H8F B;  3EHU A;  2Z8D A;  3BKI B;  2V3Q A;  1MM6 A;  3DP8 A;  5DW8 A;  3CFZ A;  2HPG A;  4PCD A;  1JEV A;  3USD A;  1NV6 A;  1MPD A;  3TTL A;  4F3P A;  4C1T A;  4FBP A;  2O68 A;  1FPJ A;  3CR9 A;  4PAF A;  3E3K A;  2RKM A;  1ZTY A;  1Y1M A;  2GRV A;  2V3U A;  3ILU B;  1I6B A;  3LSF B;  4HE1 A;  1BKA A;  3IK6 B;  2F8D A;  1DMB A;  1UQW A;  4TLL B;  4ECF A;  4FEC A;  3D4G A;  2DVZ A;  1LAF E;  4EUO A;  1ZLQ A;  1LBX A;  3IL1 B;  4GBW A;  4Q8R A;  4P1E A;  1R6Z A;  4H0W A;  1OLC A;  4XFE A;  3EHS A;  4EQB A;  3N6T A;  4OZ9 A;  3IAZ A;  1MY4 A;  1PBP A;  4O94 A;  3VVF A;  1FBG A;  1NV3 A;  4O3C A;  2CZL A;  2V93 A;  1K9Z A;  3LV0 A;  1IEJ A;  2Q2A A;  3PPP A;  2D3I A;  3B6T A;  3FZV A;  4AB5 A;  5TP9 B;  4ZE9 A;  1DPP A;  4XKR A;  1FTO A;  4OEV A;  4QFL A;  3PGF A;  4H6D A;  2ZZV A;  3KG2 A;  3TKD A;  2DYX A;  1IZ1 A;  1O7T A;  2ZYM A;  3MUQ A;  4E0X A;  3TYH A;  3IO6 A;  1Y9U A;  3RY3 A;  2XD3 A;  4N17 A;  4OVT A;  5I2K A;  3N94 A;  4H8J A;  1ZU0 A;  4OHN A;  5LOM A;  2DXR A;  3TCF A;  4F18 A;  5L9M A;  1IIT A;  3CVG A;  4AQ4 A;  1B4Z A;  3IJO B;  1OVB A;  3CI8 A;  3MJN A;  5ICT A;  4EDP A;  1YXI A;  3K0V A;  3PMW A;  2ALU A;  4NAP A;  2GFE A;  4R9F A;  2Z23 A;  4O3A A;  3UOR A;  4YKI A;  1FPD A;  5AA4 B;  1WVJ A;  1ZMG A;  3G3H A;  4G61 A;  5L9S A;  1NUZ A;  5J16 A;  1US5 A;  4MNI A;  3SES A;  4MNP A;  2THI A;  5H8Q A;  3RQT A;  1TFD A;  4N6D A;  1N84 A;  4MF3 A;  5JTY A;  1B52 A;  3N6U A;  5IM2 A;  3IB1 A;  5HBC A;  5ELV A;  2CEX A;  4N8G A;  4Q0C A;  1FBF A;  1N04 A;  3ZSF A;  2OLB A;  2YPN A;  4U4X A;  3TPA A;  4GWO A;  3WAE A;  2XHD A;  4FAJ A;  1OIB A;  3RNN A;  1TWY A;  4P47 A;  1IME A;  4NHB A;  3IOT A;  2OK2 A;  2O69 A;  4OA4 A;  3H6W A;  4GXS B;  5EQ7 A;  2I58 A;  3K6W A;  2HCA A;  3UP9 A;  3IR1 A;  3W9W A;  1BIY A;  2D5W A;  1INP A;  3UA8 A;  4QSD A;  1N7W A;  4MLV A;  4IY6 A;  1Z7N E;  3Q27 A;  4OVP A;  3OSQ A;  5DEX B;  1BLF A;  2UVI A;  3C33 A;  2FIE A;  2VT5 A;  4JSD A;  3KSJ A;  4PBH A;  4OVJ A;  1MY0 A;  2DWI A;  1FQF A;  2QVU A;  1B3F A;  5EQ9 A;  1FQE A;  3EHT A;  1CNQ A;  4KCD A;  4IGR A;  3FAS A;  4QSC A;  2GHA A;  4OVR A;  4H65 A;  3LSW A;  2P1S A;  2FHY A;  2HXR A;  1MG1 A;  4C0R A;  4YKP A;  4H1X A;  1LAG E;  5AA3 A;  4PAI A;  4QFK A;  1UTB A;  1B3L A;  3LUZ A;  4OER A;  2GQ1 A;  1QUL A;  5F24 A;  3OXN A;  4F39 A;  4PDD A;  5ESY A;  1SQY A;  5DVJ A;  3RYD A;  3C31 A;  1AWB A;  4MFI A;  3KOS A;  3LBS A;  3VLW A;  1OVT A;  1NUX A;  4ZE8 A;  2PT1 A;  4MCO A;  2O84 X;  1A55 A;  5CBS A;  4RPO A;  4OAN A;  4C1U A;  1XVY A;  1POY 1;  3K1P A;  2O7I A;  2Z8F A;  5CMC A;  4H45 A;  3VV5 A;  4NF5 A;  1B1X A;  1RDY A;  4WEP A;  2OJT A;  1NUY A;  3O6G A;  5A5X A;  1EU8 A;  4PP0 A;  1FQB A;  3E79 A;  1P1O A;  5FHM A;  4DI4 B;  4DXC A;  2FVZ A;  3EPE A;  3T0J A;  1R9L A;  2ZZW A;  2PBW A;  5KDT A;  5FBP A;  5EYG A;  4G68 C;  4F1U A;  5FHO A;  5I3S A;  4O3B A;  3QK6 A;  4HTG A;  3VXB A;  2P0S A;  4P0I A;  3RGY A;  1MXZ A;  3B7D A;  3P7I A;  3O6H A;  3MPK A;  2W7Y A;  3FAT A;  5EYH A;  4DZ1 A;  1IMF A;  2DVC A;  4OWD A;  2V84 A;  1USY E;  3H06 B;  1QJM A;  1LBC A;  1NNK A;  5K2Y A;  4X1B A;  3S9E A;  2WBB A;  3IX1 A;  5AA1 A;  3K6X A;  4YB6 A;  1FQD A;  1KA0 A;  3GBA A;  5H8Q B;  4FIM A;  4OET A;  3W15 C;  1M5C A;  5JTY B;  3PMX A;  4QFP A;  1D9Q A;  5BUU A;  3DEL B;  1NFT A;  5HM4 B;  3C35 A;  3KGC A;  3R7X A;  3OSR A;  5ITP A;  1UIV A;  4KI0 E;  3FXB A;  4F1Y A;  4NF4 A;  3QSL A;  2ZNT A;  1KA1 A;  3EF7 A;  4QXD A;  3C4M A;  1FRP A;  4DCX A;  3SEU A;  3RPL B;  5ET6 A;  4EXK A;  4HXV A;  1FBD A;  3K02 A;  1XVX A;  1MPB A;  3CHG A;  3LC8 A;  2Z22 A;  4PDH A;  1B58 A;  3I5O A;  3OO8 A;  3PPN A;  1D9Y A;  1QW0 A;  1ZBM A;  4QFN A;  3KJT A;  2F97 A;  5I57 A;  4N91 A;  3MZ9 A;  4JSO A;  4P56 A;  1D9V A;  4ZDM A;  3SEX A;  1QVS A;  4OMB A;  1FPB A;  2ZNS A;  5JEI A;  1VE4 A;  3TQL A;  1GGG A;  3S4U A;  4TOZ A;  5EHM A;  4GVO A;  1N76 A;  5B7D A;  4R6H A;  1YPN A;  4R74 A;  3OEK A;  2XD2 A;  5CC2 A;  1P1N A;  3M3F A;  3G3K A;  5FTI A;  1DTZ A;  1FPL A;  1DSN A;  3SKP A;  1AH5 A;  3UK4 A;  2DXY A;  1MXU A;  3MWB A;  1SDX A;  1AIV A;  1RDZ A;  1H76 A;  4F31 B;  3S9L C;  1VSO A;  3Q29 A;  3ZS6 A;  4YKK A;  4N13 A;  4ZEK A;  4GLI A;  2XA5 A;  2H98 A;  3PUZ E;  3IB2 A;  2Q8J A;  3IO4 A;  4KYD A;  4M1V A;  3FXR A;  3KBR A;  4QHQ A;  5IGA A;  4GX4 A;  4IR8 A;  4OTE A;  2O6A A;  1JET A;  2HAU A;  3WAF A;  3H03 A;  1FQC A;  1B40 A;  1Y4T A;  3H6T A;  1LBZ A;  1SW2 A;  4XKQ A;  4HW8 A;  3HO7 A;  3KJ7 A;  3CRB A;  3JYR A;  3KSX A;  1YZ0 A;  2DDK A;  4X48 A;  3ONM A;  5M2V A;  1VFE A;  3E78 A;  3QYT A;  1MQJ A;  2AL4 A;  1WDN A;  3PV0 E;  2B3B A;  4U2R A;  1VDW A;  2WX9 A;  5KDT B;  4FE8 A;  1VR5 A;  1MM7 A;  4BDQ A;  2RCA A;  2R8T A;  4R2B A;  3U72 A;  4F3S A;  1MXV A;  3ODB A;  3VLU A;  3U1O A;  5IKB A;  1FTA A;  3MVW A;  4Z0I A;  2F78 A;  4PFU A;  3H4Z A;  3ROJ A;  1H3D A;  4Z7E A;  2NUV A;  3A29 A;  1RDX A;  1LBB A;  3SEV A;  3KFM A;  5K2X A;  2DE4 A;  3SER A;  3MZB A;  3ISP A;  1JEU A;  1M5F A;  2XXR A;  3MP8 A;  1R9Q A;  4RK9 A;  5I84 A;  2CZK A;  2VD3 A;  2Y84 A;  2Q9T A;  3MP6 A;  5LDZ A;  1MXX A;  2I3V A;  5EQA A;  4GWU A;  1SBP A;  3H6U A;  3O29 A;  4OEU A;  4PF8 A;  4OFO A;  4ZEF A;  2XXW A;  2XX8 A;  4RPN A;  2RF1 A;  4GXA A;  5DT6 A;  2PFZ A;  1NKX A;  2RCB A;  3QAX A;  2JJK A;  2ONK E;  4F29 A;  3MVZ A;  2WBD A;  3K1M A;  3HST A;  4GWZ A;  4QFO A;  1LBV A;  4R2F A;  1B32 A;  4IGT A;  1JP4 A;  1IXG A;  5AA2 A;  4NTL A;  4GQO A;  4JWY A;  5H8N A;  5B70 A;  5H8H B;  3OEM A;  1SI0 A;  4LUB A;  4PE5 B;  3TTN A;  3VVE A;  2D21 A;  3RLF E;  1GV8 A;  4FOR A;  4P9K A;  2B65 A;  2YLN A;  3BIH A;  5IAI A;  3K00 A;  1IUD A;  2O7U A;  1P1W A;  4MAG A;  4PFR A;  4TQU Q;  3BFT A;  2B3F A;  1LAX A;  2RIN A;  4GWX A;  3SEW A;  4IO4 A;  1NV0 A;  5JK4 A;  4OEN A;  1CE2 A;  4N6P A;  3TUS A;  3A3C A;  4EQ9 A;  2R6G E;  2F7C A;  4NWD A;  3NOH A;  1MQG A;  1P99 A;  1IMB A;  3OMB A;  1GVC A;  4QRZ A;  2XWO A;  5ISU A;  4H8I A;  1S50 A;  4G8H A;  5H8S A;  3KBZ A;  1MPC A; 
#chains in the Genus database with same CATH homology
 4KQP A;  1M5D A;  3FV2 A;  4NE4 A;  3EQ1 A;  3FV1 A;  1KWH A;  1GTK A;  3UN6 A;  1N3W A;  3TCG A;  5I2N A;  2I0C A;  3K4U A;  4IY5 A;  5I56 A;  4YMB A;  4WKM A;  1PEB A;  2QS3 A;  1MS7 A;  2DQV A;  1LGB C;  3MVY A;  4AB6 A;  1IXC A;  3C34 A;  1IIW A;  2LAO A;  4U1O A;  1XT8 A;  3IB0 A;  2F35 A;  2HXW A;  3K2D A;  2OBG A;  3IOR A;  2QRY A;  1AOV A;  2GH9 A;  3H6V A;  4PFY A;  1ATG A;  2UVJ A;  1A54 A;  4I1D A;  4EQ7 A;  3KN8 A;  1TT1 A;  1JVX A;  2H99 A;  3RN8 A;  2F7B A;  5ICQ A;  4DE8 A;  3O6I A;  2E0S A;  1F9B A;  5CRY A;  1B51 A;  3O66 A;  2DWJ A;  4PET A;  2I4B A;  4YMA A;  1EH3 A;  2DE2 A;  2E1S A;  3G3I A;  1HSJ A;  1MDP 1;  3FJ7 A;  3QXM A;  1B5H A;  5I58 A;  3CFX A;  2QJE A;  3DM0 A;  1B7H A;  4G77 A;  3H7M A;  3U8Q A;  4HS7 A;  3PUY E;  3E13 X;  1QKA A;  3PUV E;  1CB6 A;  4GD5 A;  4DCY A;  2IA4 A;  1PB7 A;  1J1N A;  3VFJ A;  1NH7 A;  5BWJ A;  3KN7 A;  1M5E A;  3VE1 B;  2I48 A;  5J1D A;  1JW1 A;  1PBQ A;  1B3H A;  4YIC A;  3CSB A;  3MC2 A;  3GXA A;  1LCF A;  3FXU A;  4POX A;  3TOD A;  3GBB A;  3HN0 A;  5F7V A;  2VOZ A;  1Y20 A;  2KLF A;  1US4 A;  1NNP A;  3FGS A;  4XKN A;  4JBZ A;  3S9N C;  3O28 A;  3MP1 A;  5H8N B;  1LFI A;  5I2K B;  4ELR A;  1TXF A;  2ANJ A;  2AL5 A;  4FED A;  4ONY A;  3SET A;  4GFR A;  1L5T A;  3TFL A;  1FCK A;  2PVU A;  2X7Q A;  4DXU A;  4YAH X;  4EXL A;  2H25 A;  1MY1 A;  4MLQ A;  2BJJ X;  3RUM A;  1YCJ A;  1LFG A;  2CMO A;  4ZS9 A;  3ZKK A;  3FD3 A;  4IO5 A;  5H8F A;  2X7P A;  5CMK A;  3TTM A;  1I6Q A;  3U92 A;  2DE3 A;  2UVG A;  3PUW E;  5DVF A;  3T22 A;  2R9J A;  1AMF A;  2I6E A;  2UXA A;  1FTK A;  3M3L A;  3HHF A;  3TAJ A;  2PMS A;  1QKB A;  2QSX A;  2DSF A;  3PUX E;  1LLS A;  4R73 A;  2ZNU A;  3VXC A;  1NNT A;  4M4G A;  5I56 B;  5L9O A;  1S9T A;  1RYX A;  3K6U A;  2QS1 A;  1Y4C A;  2VD2 A;  4NF8 A;  3T93 B;  4R9G A;  3THI A;  4GL0 A;  1FTJ A;  3LSX A;  2QS4 A;  3T66 A;  2ZYO A;  2Q2C A;  2Y7R A;  1FQA A;  5CBR A;  4ELO A;  3FJM A;  1Q1K A;  1M5B A;  3T9H B;  2HZK A;  3FVK A;  4GIZ A;  4G68 A;  4NMY A;  3Q28 A;  3TTR A;  4LZ7 A;  4LZ8 A;  5CI5 A;  3O2A A;  3HV1 A;  1UTH A;  3O9P A;  3VVD A;  3U93 A;  2NVU B;  5DYH A;  3KOT A;  4G8M A;  4PFW A;  1URS A;  4F3B A;  4OFJ A;  1Q35 A;  1URG A;  5I58 B;  1UTB B;  3ZKL A;  4LQ2 A;  4KD5 A;  1EZ9 A;  3ILT B;  4BDR A;  1ZIU A;  5EYF A;  3CSG A;  1SW1 A;  3BBR A;  3IJX B;  1MH4 A;  2V3T A;  2H4I A;  3MVX A;  4FAT A;  4HCY A;  5CMB A;  3PD9 A;  1HSL A;  1N3X A;  3FIR A;  3HHG A;  2Y7W A;  3C9H A;  3CIJ A;  4KYS A;  1NMU A;  1H45 A;  3EN3 A;  2REG A;  3T96 B;  2AIX A;  3MAM A;  4LA9 A;  2Y7I A;  1B7Z A;  1URD A;  3FVO A;  3BFU A;  4NF5 B;  3M3K A;  2PX1 A;  4BDN A;  3VLV A;  2QPQ A;  3RT6 B;  1HSE A;  5A5X B;  2G29 A;  2RC9 A;  2XXV A;  3PPO A;  3OO7 A;  4H5F A;  4NWC A;  1B3G A;  2DWH A;  1LB8 A;  2DS9 A;  3MBP A;  4ND9 A;  1OQH A;  2QMW A;  4R6K A;  3PU5 A;  4LON B;  4JDF A;  4K3F A;  2G93 A;  2V25 A;  3JZJ A;  2X26 A;  4JWO A;  2HZL A;  2OZZ A;  1XHY A;  4R72 A;  4GRK A;  3G3F A;  1MQD A;  1PDA A;  4BLA A;  3FUZ A;  5FTH A;  4ESX A;  5DEX A;  4IO3 A;  3I3V A;  2HAV A;  1GR2 A;  1JNF A;  1MDQ A;  4TLM B;  4XXU A;  1N0T A;  4GF8 A;  1JVY A;  5F1Q A;  4KFQ A;  4KPT A;  4ELP A;  3LUY A;  1JW4 A;  1LFH A;  3DP4 A;  1B5I A;  1UIU A;  4U22 A;  2AYS A;  3U94 A;  5HPQ A;  4X1D A;  1Y1Z A;  3OEN A;  1SYH A;  4NF4 B;  3V5A A;  2F6G A;  4NF8 B;  2QL3 A;  3PPR A;  4RK2 A;  1QUK A;  3PPQ A;  2PT2 A;  4U4S A;  4G4P A;  2A5T A;  4RNS A;  1B9J A;  1LCT A;  3FVG A;  2GHB A;  4QF9 A;  4MH5 A;  4RA1 A;  4F19 A;  1SVX B;  4ESW A;  4F2O A;  2I3W A;  1IXI A;  1P1Q A;  3K01 A;  5I57 B;  2OCU A;  3TEP A;  4G68 B;  1II5 A;  3V83 A;  2ZYN A;  3K1N A;  1IQ7 A;  2F34 A;  1Y3P A;  1JW5 A;  3KN3 A;  1UTH B;  3B6Q A;  4YB7 A;  4H67 A;  4JWX A;  1A8E A;  4ZZE A;  1LB9 A;  2XXU A;  2Q89 A;  1YAE A;  1S7Y A;  2FNC A;  1B7U A;  1POT A;  4YZZ A;  4LAT A;  2H5Y A;  2Y7K A;  3JV9 A;  3MW0 A;  1XOC A;  2HQ0 A;  4Q30 B;  1USY H;  4E0W A;  1B0L A;  4XKP A;  4U1Z A;  2UVH A;  3RT8 A;  1ZKB A;  3DP6 A;  5I59 A;  5EHS A;  2QMX A;  3L6H A;  4DDD A;  1D3K A;  2M8C A;  3HCQ A;  4P11 A;  5L8D A;  3S9M C;  2Y7P A;  4OFL A;  3OO6 A;  3C32 A;  1BTJ A;  3IOW A;  4R6Y A;  1MQH A;  4OQO A;  3PMV A;  3F11 A;  1B1H A;  3LSL A;  3HPI A;  1AL3 A;  4JXI A;  4JB7 A;  1NH8 A;  1R1N A;  2F36 A;  2A5S A;  3E9X A;  2I4C A;  1T0K A;  1IXH A;  2O1L A;  4P0G A;  1B6H A;  4ZED A;  4NED A;  2DWA A;  1WOD A;  4FJP A;  2UYE A;  3E4R A;  3KZG A;  1TFA A;  3SEY A;  1MQI A;  1OQG A;  1DPE A;  2FA7 A;  2ONR A;  1OMP A;  2XX7 A;  3G7W A;  4YKJ A;  3RTF B;  3QUF A;  4IO2 A;  2VHA A;  3QIM A;  1A7L A;  2OWT A;  2ZXT A;  1A99 A;  3OOA A;  4IO6 A;  3N5L A;  2XXP A;  3LR1 A;  5KCJ A;  4I8C A;  3S2V A;  4DLD A;  2RC8 A;  4HCW A;  3IOU A;  4DXB A;  4X9T A;  2XX9 A;  3MQ9 A;  4H5G A;  2VP1 A;  1B46 A;  3W9V A;  2R71 A;  1BP5 A;  1EZP A;  3Q25 A;  4BDM A;  2REJ A;  5KZT A;  3VDF A;  4RYA A;  4RY1 A;  5CMM A;  4Q5T A;  3ECR A;  3TTK A;  4LVQ A;  2OWS A;  4LZ5 A;  4NF6 A;  4R75 A;  1MXW A;  3KEI A;  2IEE A;  2DP8 A;  3MPL A;  4BDO A;  2NOO A;  3T9X B;  4F22 A;  2VGQ A;  1P1U A;  2A5T B;  5AA2 B;  3AXF A;  1A8F A;  2HFB A;  2I49 A;  3M8U A;  4U21 A;  1MY3 A;  4EF1 A;  1SW5 A;  3A09 A;  1Y3Q A;  4ELQ A;  4LQ5 A;  1B0H A;  1N7X A;  4RXL A;  3I6V A;  1H44 A;  1ZJL A;  1LAH E;  4KHZ E;  5AA2 D;  3D4C A;  4G2Z A;  3CFL A;  2ABH A;  3UIF A;  3FVN A;  4PFT A;  1VFD A;  4MBP A;  3C36 A;  3GZG A;  3UGW A;  2UYF A;  2NWJ A;  1I69 A;  2Z8E A;  1A40 A;  5TPA A;  1EZO A;  3RPW A;  1MY2 A;  3H3G A;  3OD7 A;  1ANF A;  3A3U A;  2RC7 A;  4ZEC A;  2F6P A;  2F7A A;  4OES A;  1MH3 A;  4IB2 A;  2XXH A;  1MRP A;  4OXV A;  4GL8 A;  1O64 A;  1DTG A;  1SD3 A;  4POW A;  3TCH A;  3N26 A;  1MXY A;  4F2Q A;  2I0B A;  1NL5 A;  2O51 A;  1B3E A;  5I2N B;  3G3J A;  2H9B A;  2DOJ A;  1FTL A;  4ISU A;  4XTC Q;  1FW0 A;  5I59 B;  3TEL A;  3G3G A;  2ESN A;  3MZ1 A;  3GLB A;  4XIG Q;  3OEL A;  1QUJ A;  3FXQ A;  1PB9 A;  4RJZ A;  2XXX A;  1O63 A;  5AE4 A;  2XXQ A;  4FEB A;  3CG1 A;  5TP9 A;  1SI1 A;  2XXT A;  4BDL A;  1FTM A;  3B6W A;  4WED A;  1QUI A;  2P2A A;  3T9U A;  2ZYK A;  3TDJ A;  1H43 A;  3V8X B;  5ITO A;  1RKM A;  4F1V A;  5H8H A;  4I62 A;  1ELJ A;  4DIG A;  1PB8 A;  1DOT A;  4KYE A;  3CG3 A;  3TMG A;  4L17 A;  4YU0 A;  2FYI A;  1SYI A;  1SW4 A;  5DVI A;  1I6A A;  4YB5 A;  4ZEI A;  2XXI A;  3R6U A;  1B05 A;  4LP2 B;  1D4N A;  3R26 A;  4KCC A;  3PD8 A;  3T9V A;  3FJG A;  4UAC A;  5AA4 A;  3O97 A;  5KCJ B;  3TQW A;  5TU0 A;  4N07 A;  3V89 B;  2PYY A;  4WXJ A;  1LST A;  2Q88 A;  4THI A;  3K6V A;  2XXY A;  1B2H A;  4F3G A;  2QS2 A;  1RYO A;  3Q26 A;  3TZA A;  3QUJ A;  4NF6 B;  1XS5 A;  4QSE A;  1Y3N A;  4ZEB A;  1PC3 A;  1OLA A;  3SDF A;  4PQJ A;  1YTV A;  2WKY A;  4GOT A;  2F5X A;  5DTB A;  4OYV A;  3L6G A;  4I9D A;  5CM6 A;  4IO7 A;  1JQF A;  2HEU A;  4U23 A;  3OO9 A;  1Z7M E;  4KR5 A;  4UA8 A;  3DLN A;  2ONS A;  1NNF A;  2ZMB A;  2YJP A;  1B5J A;  1B4H A;  4EF2 A;  4ZZA A;  5FHN A;  1XC1 A;  2O1M A;  3IOV A;  2NXO A;  4G8N A;  3RTW B;  5TPA B;  5H8F B;  3EHU A;  2Z8D A;  3BKI B;  2V3Q A;  1MM6 A;  3DP8 A;  3CFZ A;  1JEV A;  3USD A;  1MPD A;  3TTL A;  4F3P A;  4C1T A;  2O68 A;  3CR9 A;  3E3K A;  2RKM A;  1ZTY A;  1Y1M A;  2GRV A;  2V3U A;  3ILU B;  1I6B A;  3LSF B;  1BKA A;  3IK6 B;  2F8D A;  1DMB A;  1UQW A;  4TLL B;  4ECF A;  4FEC A;  3D4G A;  2DVZ A;  1LAF E;  4EUO A;  1ZLQ A;  3IL1 B;  4Q8R A;  1R6Z A;  4H0W A;  1OLC A;  3EHS A;  4EQB A;  3N6T A;  4OZ9 A;  3IAZ A;  1MY4 A;  1PBP A;  3VVF A;  4O3C A;  2CZL A;  2V93 A;  1IEJ A;  2Q2A A;  3PPP A;  2D3I A;  3B6T A;  3FZV A;  4AB5 A;  5TP9 B;  4ZE9 A;  1DPP A;  4XKR A;  1FTO A;  4OEV A;  4QFL A;  3PGF A;  4H6D A;  3KG2 A;  3TKD A;  2DYX A;  1IZ1 A;  1O7T A;  2ZYM A;  3MUQ A;  4E0X A;  3TYH A;  3IO6 A;  1Y9U A;  3RY3 A;  2XD3 A;  5I2K A;  3N94 A;  4H8J A;  1ZU0 A;  4OHN A;  5LOM A;  2DXR A;  3TCF A;  4F18 A;  5L9M A;  1IIT A;  3CVG A;  4AQ4 A;  1B4Z A;  3IJO B;  1OVB A;  3CI8 A;  3MJN A;  5ICT A;  4EDP A;  3K0V A;  3PMW A;  2ALU A;  2GFE A;  4R9F A;  2Z23 A;  4O3A A;  3UOR A;  4YKI A;  5AA4 B;  1WVJ A;  1ZMG A;  3G3H A;  5L9S A;  1US5 A;  3SES A;  2THI A;  5H8Q A;  3RQT A;  1TFD A;  1N84 A;  4MF3 A;  5JTY A;  1B52 A;  3N6U A;  3IB1 A;  5HBC A;  5ELV A;  4Q0C A;  1N04 A;  3ZSF A;  2OLB A;  2YPN A;  4U4X A;  3TPA A;  4GWO A;  4FAJ A;  2XHD A;  3WAE A;  1OIB A;  3RNN A;  1TWY A;  3IOT A;  2OK2 A;  2O69 A;  3H6W A;  4GXS B;  2I58 A;  3K6W A;  2HCA A;  3UP9 A;  3IR1 A;  3W9W A;  1BIY A;  2D5W A;  3UA8 A;  4QSD A;  1N7W A;  4MLV A;  4IY6 A;  1Z7N E;  3Q27 A;  3OSQ A;  5DEX B;  1BLF A;  2UVI A;  3C33 A;  4JSD A;  3KSJ A;  4OVJ A;  1MY0 A;  2DWI A;  1FQF A;  1B3F A;  1FQE A;  3EHT A;  4KCD A;  4IGR A;  3FAS A;  2GHA A;  4QSC A;  4H65 A;  3LSW A;  2P1S A;  1MG1 A;  4C0R A;  4YKP A;  4H1X A;  1LAG E;  5AA3 A;  1UTB A;  4QFK A;  1B3L A;  4OER A;  1QUL A;  3OXN A;  4F39 A;  1SQY A;  5DVJ A;  3C31 A;  4MFI A;  3KOS A;  3LBS A;  3VLW A;  1OVT A;  4ZE8 A;  2PT1 A;  2O84 X;  1A55 A;  5CBS A;  4RPO A;  4C1U A;  1XVY A;  1POY 1;  3K1P A;  2O7I A;  2Z8F A;  5CMC A;  3VV5 A;  4NF5 A;  1B1X A;  4WEP A;  2OJT A;  3O6G A;  5A5X A;  1EU8 A;  4PP0 A;  1FQB A;  1P1O A;  5FHM A;  4DXC A;  3EPE A;  1R9L A;  2PBW A;  5KDT A;  4G68 C;  4F1U A;  5FHO A;  4O3B A;  3QK6 A;  4HTG A;  3VXB A;  2P0S A;  4P0I A;  3RGY A;  1MXZ A;  3B7D A;  3P7I A;  3O6H A;  3MPK A;  2W7Y A;  3FAT A;  4DZ1 A;  2DVC A;  4OWD A;  2V84 A;  1USY E;  3H06 B;  1QJM A;  1LBC A;  1NNK A;  5K2Y A;  4X1B A;  3S9E A;  3IX1 A;  5AA1 A;  3K6X A;  4YB6 A;  1FQD A;  3GBA A;  5H8Q B;  4FIM A;  4OET A;  3W15 C;  1M5C A;  5JTY B;  3PMX A;  4QFP A;  5BUU A;  3DEL B;  1NFT A;  5HM4 B;  3C35 A;  3KGC A;  3R7X A;  3OSR A;  5ITP A;  1UIV A;  4KI0 E;  4F1Y A;  4NF4 A;  3QSL A;  2ZNT A;  3EF7 A;  3C4M A;  4DCX A;  3SEU A;  4EXK A;  3K02 A;  1XVX A;  1MPB A;  3LC8 A;  2Z22 A;  1B58 A;  3I5O A;  3OO8 A;  3PPN A;  1D9Y A;  1QW0 A;  1ZBM A;  4QFN A;  3KJT A;  2F97 A;  5I57 A;  3MZ9 A;  4JSO A;  1D9V A;  4ZDM A;  3SEX A;  1QVS A;  4OMB A;  2ZNS A;  5JEI A;  3TQL A;  1VE4 A;  1GGG A;  3S4U A;  4TOZ A;  5EHM A;  4GVO A;  1N76 A;  5B7D A;  4R6H A;  1YPN A;  4R74 A;  3OEK A;  2XD2 A;  5CC2 A;  1P1N A;  3M3F A;  3G3K A;  5FTI A;  1DTZ A;  1DSN A;  3SKP A;  1AH5 A;  3UK4 A;  2DXY A;  1MXU A;  3MWB A;  1SDX A;  1AIV A;  1H76 A;  4F31 B;  3S9L C;  1VSO A;  3Q29 A;  3ZS6 A;  4YKK A;  4N13 A;  4ZEK A;  4GLI A;  2H98 A;  3PUZ E;  3IB2 A;  2Q8J A;  3IO4 A;  4KYD A;  4M1V A;  3FXR A;  3KBR A;  4QHQ A;  4OTE A;  2O6A A;  1JET A;  2HAU A;  3WAF A;  3H03 A;  1FQC A;  1B40 A;  1Y4T A;  3H6T A;  1SW2 A;  4XKQ A;  4HW8 A;  3HO7 A;  3KJ7 A;  3CRB A;  3JYR A;  3KSX A;  4X48 A;  3ONM A;  5M2V A;  1VFE A;  3QYT A;  1MQJ A;  2AL4 A;  1WDN A;  3PV0 E;  2B3B A;  4U2R A;  5KDT B;  4FE8 A;  1VR5 A;  1MM7 A;  4BDQ A;  2RCA A;  4R2B A;  3U72 A;  4F3S A;  1MXV A;  3ODB A;  3VLU A;  3U1O A;  5IKB A;  3MVW A;  4Z0I A;  2F78 A;  4PFU A;  3H4Z A;  1H3D A;  4Z7E A;  2NUV A;  1LBB A;  3SEV A;  3KFM A;  5K2X A;  2DE4 A;  3SER A;  3MZB A;  1JEU A;  1M5F A;  2XXR A;  3MP8 A;  1R9Q A;  4RK9 A;  5I84 A;  2VD3 A;  2Y84 A;  2Q9T A;  3MP6 A;  1MXX A;  2I3V A;  1SBP A;  3H6U A;  3O29 A;  4OEU A;  4OFO A;  4ZEF A;  2XXW A;  2XX8 A;  2RF1 A;  4GXA A;  4RPN A;  5DT6 A;  1NKX A;  2RCB A;  3QAX A;  2ONK E;  4F29 A;  3MVZ A;  3K1M A;  3HST A;  4QFO A;  4R2F A;  1B32 A;  4IGT A;  1IXG A;  5AA2 A;  4NTL A;  4GQO A;  4JWY A;  5H8N A;  5B70 A;  5H8H B;  3OEM A;  1SI0 A;  4LUB A;  4PE5 B;  3TTN A;  3VVE A;  2D21 A;  3RLF E;  1GV8 A;  4FOR A;  2B65 A;  2YLN A;  5IAI A;  3K00 A;  1IUD A;  2O7U A;  1P1W A;  4TQU Q;  3BFT A;  2B3F A;  1LAX A;  2RIN A;  3SEW A;  4IO4 A;  5JK4 A;  4OEN A;  1CE2 A;  4N6P A;  3TUS A;  3A3C A;  4EQ9 A;  2R6G E;  2F7C A;  4NWD A;  1MQG A;  1P99 A;  3OMB A;  1GVC A;  4QRZ A;  5ISU A;  4H8I A;  1S50 A;  4G8H A;  5H8S A;  1MPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...