2QL7A

Crystal structure of caspase-7 with inhibitor ac-iepd-cho
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ql7A00
1RE1A 3UOAB 4QUIA 3D6HA 4HQRA 3KJQA 2H4YA 4QU5A 1PAUA 4D3ZA 4D3XA 3PD1A 4I1PA 3H13A 3V4LA 2HBQA 2QL5A 1ICEA 1RWMA 3DEHA 3R6LA 4NBLA 4PRYA 4QUBA 4QULA 5I9BA 3V3KA 1RWVA 4PS1A 3S70A 2QL9A 1CP3A 1SC4A 3R7NA 2C1EA 2CNOA 3DEJA 3R5KA 2FQQA 4PRZA 1I4EB 2QLBA 2XZTA 4NOKA 4JB8A 1PYOA 2CJXA 4QTYA 4I1RA 2XZDA 5IANA 3V6LA 1QTNA 2AR9A 3R7BA 2HBRA 4ZVPA 3RJMA 2HBZA 4JR0A 5IBRA 4ZVRA 5I9TA 2K7ZA 4LSZA 1RWNA 1RHKA 3P45A 4N6OA 2J30A 5IC4A 2CDRA 3PD0A 4ZVTA 3E4CA 1K86A 3KJNA 4AWBA 4EHHA 2C2MA 4FGUA 3H0EA 3R5JA 4ZVQA 4HQ0A 1GQFA 1NMQA 1SHLA 5JFTA 2WDPA 2H5IA 4PS0A 3GJQA 3H11B 3H1PA 2XYGA 4QU8A 5K20A 2H54A 3SIPA 4M9RA 2H51A 2CNKA 1RHJA 4NOJA 1KMCA 4NBNA 1M72A 2XYHA 5IAEA 2C2OA 3NS7A 4DCJA 5IASA 4JJEA 4QUHA 4ZVUA 4IYRA 4EHNA 4AW9A 4NOLA 3SIRA 3QNWA 4QU9A 1JXQA 4EHFA 4JQZA 1SC1A 3BIJA 3KJFA 4FXOA 4EHAA 5LU9A 2P2CA 1F1JA 1GFWA 2DKOA 3DEKA 4N5DA 3R6GA 4N6GA 1RWXA 3PCXA 4ZVSA 4QU0A 5IC6A 4JR2A 3D6FA 4DCOA 1I51A 4JJ7A 3V55A 1RWWA 1NMSA 3D6MA 1SHJA 1RWPA 4DCPA 4HVAA 3NKFA 3EDQA 1NW9B 3ITNA 5LU8A 5IABA 1QDUA 2FUNB 2QL7A 5LUAA 4QUJA 2CJYA 5IAJA 1RHUA 1BMQA 4AWAA 3EDRA 1F9EA 1I3OA 4IEFB 2HBYA 3V4OA 1RWKA 2Y0BA 3S8EA 1RHRA 4QUEA 4JQYA 2J33A 2H4WA 4EJFA 2CNNA 2NN3C 4QTXA 1RHQA 3GJTA 4QUDA 4ZVOA 5H0IA 1NMEA 5IARA 3GJRA 3R7SA 4EHKA 2J31A 2J32A 1IBCA 3UO8B 4JR1A 2H65A 4N7JA 4EHLA 3V6MA 2C2ZA 2QLFA 4QUAA 1RWOA 2QLJA 3K7EA 4QUGA 1QX3A 2CNLA 3H11A 3NR2A 2Y1LA 3P4UA 4EHDA 1K88A 2C2KA 4FDLA 2H48A 2XYPA 2FP3A 5IBPA 2H5JA 3DEIA 4D3YA 4N7MA 5IAKA 4NBKA 3IBCA 3GJSA 5IBCA 3IBFA 4N6NA 1I4OA 4FEAA 5LUBA 4NOMA 5IAGA 4JJ8A 1CVRA 1SC3A 1RHMA 3OD5A
chains in the Genus database with same CATH superfamily
1YJ8A 2LV8A 4AJLA 2ORED 5LL6P 5J9FA 3F6EX 3D2AA 4UDYX 1OE0A 4CFZA 2WHXA 4UTRA 1SG6A 1EMDA 4II2A 2OAGA 1RZRD 1CEQA 1JHZA 1YQTA 4FYKA 4WLVA 1Z83A 4CM4B 2HC9A 1LFAA 4V0ME 4C5CA 4P7KA 2OV8A 1I4EB 2EZTA 1QCYA 2B2CA 3IOMA 4REQB 4B3FX 3R0QA 1N33B 4MUMA 2GSDA 2IYVA 1KMIY 2JDID 1KZ1A 3W1WA 4GRDA 3QE9Y 3TWOA 3HWSA 3M0EA 1GLNA 2XE7A 4EG4A 3J7AC 2PBFA 1PR3A 2I2XB 2WHQA 1EDDA 2DWPA 3GIDA 4NBUA 5G0SA 4ZYYA 3UUGA 3DDCA 1N6LA 3ER9A 2BEUB 2P6UA 4Y8VA 4ZZIA 3OQOA 4EBBA 2ZZNA 4JFRA 4C7VA 4ZFNA 1OZ0A 5EJMA 5A4MS 1NSTA 1S3GA 1LDMA 1YSCA 1JEJA 4G5SA 5DULA 3RIGA 3IILA 3S99A 4DR3B 1DKOA 1H1LB 3HUEA 2BHRA 3H2YA 1X7XA 4DGQA 1S8FA 1J0CA 3H1PA 2RHWA 4X85A 3BHIA 2FX2A 1SUDA 1JZTA 3ICVA 5JTUA 3I5XA 4KKXB 2HO5A 2FW1A 2DFNA 3NEJA 3A25A 2FEWB 3B3JA 1TQ8A 1M1XB 3ADPA 3A6DA 4G81A 4NOJA 4F3RA 4DJFC 2JHCA 4W7HA 5GONF 4B3JA 1U0FA 2MR5A 5B64A 1V16B 1BGXT 1FRNA 3DE7X 4OHVA 3U62A 5JVDA 1X1QA 4TS9A 4UMVA 3HCCA 5T3UA 3VKUA 2RJOA 5TJHA 2O4CA 4CKBA 3DXZA 2R68A 3LQYA 2JIPA 3CX7A 3RW9A 4PXYA 1EEXB 2P6MA 2HLPA 4UAGA 1KK2A 4XLTA 5GONA 3PQCA 2HLDD 3TTUA 1G0OA 1EPUA 3AY0A 5IVPA 1OXSC 2ID8A 1C30A 2XB8A 3BS4A 4AI6A 2HCBA 3JQFC 2PD4A 4DA4A 2JGAA 3WK5A 2FW7A 1IZ7A 3CX3A 4UNSA 1TPZA 2Q8QA 5C18A 2IYUA 4LF9B 4RCVA 5K3SA 3AZPA 3SZRA 4D4JA 2CV2A 3R5FA 5G0UA 4TROA 2NZYA 3KXDA 3JQAB 1IXKA 3OE4A 1PIWA 3OJFA 3OWHA 3QVMA 4X45A 3S2FA 5IYZA 1CUCA 1A2BA 2GN0A 3QMMA 1Z15A 1LI7A 4BLUA 4WXHA 4A2PA 1FFXA 3G8BA 1GUFA 2W2NA 3ISJA 3QLTA 4FFVA 1WCXA 3R41A 1ACLA 1E3LA 1YUNA 1U2GA 2LIPA 3H3FA 4UE6A 3WJ2A 4A5OA 5DNWA 1AMOA 2PL3A 2VT6A 3A3NA 1NVGA 1UZNA 5JSKA 1BEEA 3JAMA 2OM6A 4C20A 4FW9A 4RPHA 1U94A 4GYWA 5JNRA 2ZDGA 2GN2A 3L6BA 4X71A 2PYZA 5DLEA 2WJJA 4INZA 4LJKA 4C07A 3A6ZA 3K1TA 1BYIA 2QP3A 4Q3EA 3R5TA 4YS6A 1PBTA 2IELA 1ZZGA 1GR0A 1DCMA 3K5WA 1IK4A 3IERA 2NQ2C 4YQFA 3MOIA 2CXUA 3QZUA 5JCOA 1R6BX 1X74A 5BXQC 5JJBA 3UUWA 4TLEA 1KYYA 4RKFA 2F55A 3LDFA 4R2MA 1TVKB 4X20A 4UTXA 3VJKA 1R15A 4HQRA 3NHPA 2ZI6A 1H66A 3V1NA 2PT6A 4RC9A 3JALA 2R8RA 4HJRA 1A5BB 4MEAA 3GGSA 5BWOA 4FBGA 1STOA 3PQ4A 1LW6E 4JWKA 4DR7B 1V5EA 2ID7A 4WFIA 4DDKA 1UP6A 2CXNA 2PWBA 1IY9A 4JVOA 1F60A 3KIPA 3F71A 5AHKA 4ZHSA 5KPJA 1Y9AA 2HPHA 3CH7A 3UW1A 1HMYA 4C06A 3GGCA 2C7BA 4KV9A 4WKBA 3PC6A 4YXWA 4BNKA 2QROA 4WADA 1LDYA 3BCSA 3WFIA 2P0AA 2WYUA 1N1DA 3B89A 2CZQA 3C16C 3V7WA 4Z5XA 3KOWA 1EVIA 3AK4A 1QHXA 1R7RA 1G8JA 5AW9A 3H86A 1UJCA 3KRTA 4K6GA 4BNZA 1VG9B 2PX5A 2VHCA 3GNQA 3SMQA 3GGOA 4P7JA 2Y76A 5CDYA 3PNYA 4GOMD 1WX1A 2GFIA 3PITA 1XAIA 3OU7A 4KLAA 4YALA 5KAMA 3GLGE 3UICA 3UKOA 3EMBA 1QXSA 4EENA 3I6MA 4B34A 4U00A 3IR5A 3O1JC 4QQRA 2WJIA 2XUZA 1P80A 3PXEA 4IRUB 3G2OA 4G25A 2FCAA 3AIMA 2YN4A 3BMOA 3S2GA 2WWIA 1UKVY 3WZMA 1KVTA 4YDQA 3MOGA 5LCXA 2EZUA 1U8XX 2MSLA 2Z2XA 4LE1A 1M34E 3WZLA 1HDIA 3VOAA 1GYRA 3RNOA 3IO5A 4D99A 3K6SB 1JQ5A 3BXEA 1HRKA 5AKGA 5HW0A 4CF7A 1OTYA 1EU1A 3HA7A 1NMZA 3KOXA 1NE7A 3TW4A 1HZZA 4MQFB 3KWMA 1MW9X 3VR4D 4EB0A 4EFNA 1LJLA 3DDUA 2HRZA 3QF7A 4J75A 2PANA 4EHAA 3SJ7A 4BJ3A 1BJRE 2VNHA 4KNYA 2ZYSA 3H5RA 3W90A 4DIDA 3ME5A 5DSZA 4G1UC 4NJEA 1ML4A 1XVUA 1X9GA 2ABWA 3UV7A 4INOA 3AP2A 4GUAA 1M76A 4MYUA 4OB8A 4TSFA 2B4TO 4H4EA 4RH1A 4FDUA 4QJ3A 2EHDA 1GQSA 4CM8A 1ZNXA 2JCYA 2J8ZA 2IU6A 1J24A 3O8OB 3GEDA 3KS9A 4YO8A 2VQEB 5DM1A 3GEPA 3EXHA 3VZRA 4K9PA 1J90A 3L93A 4FINA 2ZCUA 5SZHB 4L76A 4LQCA 4C3OB 4RF4A 3RAFC 1JFSA 3RT1A 3OHMA 3ZD8A 2DGDA 1KBOA 4A8HA 3IT1A 4HNSA 3DCIA 4L6IA 2G3YA 3ZIAA 4DIOA 1EUQA 4BVAA 3JS5A 4OA8A 2O59A 3QEKA 4OHFA 5CEFA 1GITA 2VYCA 1JIXA 2GZAA 2X14A 3K1ZA 2J3IA 2IUUA 1MTOA 2C7PA 3L7IA 4TRRA 4CQMD 4MROA 4U0JA 3WO1A 1MJFA 5BMVA 4MUGA 4OHXA 2JGLA 4KQMA 1K7FB 1TQ6A 4MDHA 5BNZA 4G84A 4RL6A 2A0WA 4ZU1X 1FNNA 1J22A 2ZQ5A 2EFHB 4QO8A 3U7JA 3W4KA 4PRKA 4NBSA 5DH9A 2I2CA 1C9MA 1T24A 3RFTA 3FYUB 1WF3A 3D6JA 2CHVA 1W9MA 4HNQA 4Y0AA 4EJ0A 1Z5PA 2BONA 1GNTA 4JASB 3AEQB 2BSQA 1O7JA 4OHCA 1VPLA 5ENZA 4XE5A 3S6JA 1JWBB 5CFNA 1VIMA 4N5IX 2O8BA 1F5NA 4KVAA 1YL5A 2WAXA 4EQ6A 1XCPA 2XDQA 2XXJA 1VCHA 3SK0A 1O97C 3T3GA 3VYWA 4RS4A 4B6EA 5BMOA 3OJXA 2NVUA 1JPJA 1O77A 2ZT6A 5GJWC 2IGTA 1H2HA 4PX5A 3SX4A 1V3UA 4RZXA 3EYAA 3CT6A 1NW5A 4TLCA 1F38A 1RZUA 2G04A 4FW8A 1OI3A 3ETCA 5C1DA 1FS5A 2PKCA 4JI4B 4RGBA 3URMA 4FN5A 4BZQA 1MAVA 1M2HA 1WULS 2NPFA 1W0CA 3SZGA 1EX9A 1J2JA 1IXZA 1M0TA 3GUZA 3AR2A 4YMVA 2QVXX 4JN6B 5JO9A 3DONA 3D4OA 2BBOA 3R5SA 3F7TA 1RI1A 2VS1A 3ISVA 3QJYA 3ZU4A 5LLTA 3DHNA 3PWTA 2IT1A 4AXXA 4ZVTA 3DR3A 1G17A 4IQ4A 4MIKA 3NH6A 1EFDN 2A35A 1M6VB 1YIOA 1OH7A 1HNXB 5ECGC 1POXA 1UZLA 2D8MA 3E48A 4E32A 3DGEC 3C39A 3BT7A 4GICA 2E89A 1G8PA 1RPNA 1ZGAA 3GK3A 4LGCA 3AHIA 4D9GA 2CXPA 4OG2A 5CLJA 2X9VA 1KIFA 1VGVA 3CUSA 4E5DA 2ZJ4A 3O7MA 4GL2A 3OF3A 2IITA 4YIHA 4EHNA 1F7VA 4YCNA 4O8CA 1I36A 3A1CA 4MVJG 5ALHA 2PZMA 3CGGA 3TL2A 2IIQA 2WHPB 5E6RA 4CEIA 3LS2A 4TYYA 4I3FA 1LPPA 1XZPA 3D4LA 5HZGA 2CLFB 2VT7A 4Q4HB 3RRJA 3UT5B 4DA9A 3TQCA 1WWKA 2VJDA 2IEYA 4ZPXA 4M1OA 1IHOA 4IDQA 1L0BA 1WDMA 1EESA 2I29A 1NUTA 3AKDA 4MGKR 1F1BA 2VBGA 3ENVA 5LP6A 1E3IA 2QMEA 3DEYX 4FDVA 4K6KA 2QL7A 5FYQA 2HM7A 1QHHB 1F4LA 4YO7A 3VFDA 4EJSA 2RK4A 1YZ3A 4WL0A 2HT6A 3OTQA 2WD7B 1U2DC 4ICIA 5AVOA 4UM8B 1V1RB 2OBNA 2PNJA 3FPJA 3GFQA 1TIKA 2GZ3A 3WNZA 4N48A 5D85A 3O83A 1E3DA 3GWGA 2R6FA 3S3TA 4PPGA 1W48A 1MP0A 2E82A 4GLJA 4BQNA 5JBIA 1CK4A 1RM3A 1ZYUA 2GVNA 4RHEA 4DIUA 3R9IA 2V4MA 5CVCA 1PTJC 1IOLA 4G0PA 3ORSA 1FTNA 1KSHA 3HN7A 4QUAA 3V9AA 4CLOA 2Z4RA 3MOSA 2QAGC 1ISRA 3LBYA 1A27A 3OM1A 2HA0A 1NF3A 1W8DA 1GDDA 3PE4A 2I6QA 3G0IA 2ORYA 3O4GA 5DHSA 5TQ0A 4E15A 1IM8A 2BFPA 2Z6VA 2BGUA 1WUJS 2VJQA 3GT3A 4I1IA 1Q12A 5AK6A 5ALRA 2C2HA 2YYZA 4J6FA 1SOUA 5EIFA 3BREA 4KITB 1ZG3A 3DDNA 1U2PA 3LXMA 4F3TA 1PI3A 1MO6A 3BCUA 1JJFA 2ZWOA 2GETA 3RADC 1SUPA 2AJ8A 2QLMA 3OE7D 3GEGA 1JF8A 5H83A 3UOAB 4BPRA 5BT8A 2R8PA 5AW2A 1XHLA 4XYLA 3GH1A 4RF2A 1XXHA 1KEVA 4KPUA 4B73A 3DHVA 1SXHA 2NLOA 1JIUA 4LF8B 5CH3A 1CY2A 1T9ZA 3RAGA 3PX7A 3UT6A 1N9GA 1Z6QA 1CP3A 2HL6A 2YV3A 2Z98A 4AWXA 4EX7A 4Z7QB 3EJWA 1X8XA 2H1LA 1ESNA 2PJRA 5A0TA 3FJ1A 4CKXA 2XODA 1OZGA 2QLBA 3KE8A 2BDTA 1L4BA 4CWAA 1OGIA 3SKYA 1ODCA 3BMQA 1GD1O 3E23A 5F4ZA 4U2DA 1VJCA 1SXJA 4RE6A 2HREA 2PBLA 1N4AA 3NTLA 5EZ6B 2BF4A 3ZE7A 4J8PA 1OX6A 1WF6A 2BFEA 4PLFA 1ZM3A 1JSXA 2OCIA 4KQHA 4P82A 2VNJA 2IIVA 4OSEA 5DWQA 5H3CA 4MJ7A 3WYBA 3SN6A 4ZAZA 1Q95A 3BJEA 4AKHA 2XAAA 2X2PA 2PT5A 1VJGA 1DTWA 4H59A 5C4GB 3I1IA 3VR6A 1XJQA 3C97A 4PC6A 1GA4A 3GAMA 5JRZA 2J4FA 4G1EB 3FMIA 1RYHA 1R0ZA 1D3AA 1M2VB 1LB1B 4MPJA 1Y4AE 4NCNA 4C7MA 1WS6A 3F90A 1IRIA 4FHGA 4EIWA 4FUQA 5F3RA 4H0FA 2RGUA 1JJAA 3KM0A 1R6AA 2JAXA 1GZDA 2ATEA 4HMOA 5A0FA 4UDNA 3R3HA 4DNXA 1MNQA 1R8JA 1NVMB 1K5DA 4DJJA 1Q0TA 5J4LA 1LJUA 2EV9A 3TTWA 2IYWA 1F3OA 5CIYA 2PFKA 2BKAA 3QEJA 4FGZA 4HGOA 5AFSA 1QS0A 1J2UA 1QIIA 1TZJA 3I6QA 1RYEA 1DLIA 2BVNA 3EXG1 4TKUA 4CIBA 3AQIA 1HK7A 3GMTA 5CNJA 1KSGA 2A9OA 4BP1A 2H3EA 4BFXA 3WSVA 5AUOB 5IH7A 1LSSA 1FFGA 3S7ZA 2FWPA 2QW0X 5EHIA 1ZU5A 4P08A 5FBZA 1T5SA 3HCAA 1JPVA 5L3VA 1JE1A 1NT4A 1IWPB 2NSHA 2R4TA 2MWMA 2CXOA 1IC6A 2R6CA 2VPWA 3BRWA 1NVVR 5F33A 4WJLA 1PR0A 1Q17A 3NOXA 4KQEA 4RHTA 1C9JA 1QO0A 4X61A 2DFDA 1E9CA 3OIGA 4WKGA 1XZGA 2Z5LA 2BI4A 3BWVA 3M49A 3OBIA 1XL1A 3U6KA 5DK6A 2B83A 2CNBA 1LC0A 1O94C 3JWGA 5ALXA 4BZPA 4NV3A 1YTUA 1T8WA 2PFGA 1E0DA 5EYPB 4DB2A 4A6EA 1N6OA 1W88B 1WU8A 3Q3EA 3TNDA 4L2IB 3CZAA 1ZD4A 5CEEA 4RVUA 2ZJ2A 1CDDA 3ETJA 3GF4A 3E35A 3MF4A 1PFQA 3SSOA 2GJ4A 3KQLA 3NATA 3CONA 4OU4A 4QM7A 4O5OA 4ODIA 5T64A 3VHXB 1KI4A 3IHLA 5DTEA 4P3XA 2BJHA 2PSJA 3E84A 1L7VC 3WLHA 3E0XA 3FUTA 4GX0A 4L85A 1E9SA 4OHPA 5JDCC 1TE2A 3TKLA 3UGKA 3V3TA 3ZQ4A 1IVNA 4WNAB 3N0TA 4TLBA 4BBAA 1DDIA 1KU6A 4IO1A 2ZRBA 3QEMA 2FK8A 5E1MA 5IBPA 5L3SB 2JIQA 3SKXA 5DXAA 1L1RA 4LJRA 4NBKA 4E22A 4K88A 3V48A 3P9CA 5K6AA 1DIOB 1TO6A 2Z8XA 4FFOA 2X8WA 3L6UA 5FL3A 1HFEL 3IV6A 1BDIA 1N1EA 4MWCA 4ZALA 2I54A 1PAUA 5E1DA 2Z1NA 3ON5A 3ZV6A 4PTYA 1ANKA 1OFUX 4DMLA 4L50A 4P5EA 5DJ5A 4KIWA 5G2OA 1UDXA 3QU9A 4LJ9A 4X1YB 1QORA 4UU1A 4XYGA 4E88A 1II8B 1C9YA 2BBTA 2ZYIA 4MIEA 3QQPA 5SV2A 1OA1A 2C9CA 4W5JA 3SVTA 2R1TB 5IX8A 4CLRB 4EVIA 1LF5A 4NCHA 3OIYA 1WY7A 1EVYA 1G4HA 2GCIA 5DM70 1YA6A 1VHDA 3O5AA 2Z2JA 2AJTA 2I78A 1EFHA 1N8KA 4PLZA 2C7RA 3I2IA 4MGEA 4R2WA 2VF7A 5K6TA 2IEBA 1L3CA 3G85A 5IRCD 1PTJA 2X5XA 4PLCA 4B7AA 1FQJA 3MSXA 2V6IA 1WP4A 5CAEA 4OUDB 1DTEA 3DBHB 2JHFA 9ABPA 3PD0A 3LDHA 3WWOA 4Q4CA 2JBAB 3T35A 1IL0A 3SVZA 3TUIC 4CIVA 4HQ0A 2JH8A 5KYWB 3H87A 5FI1B 4UMEA 1KY5A 5IDYA 3T52A 5C80A 4C7OA 3LVBA 5T41A 4OMUA 2IW1A 3JYOA 5CB6A 2P0YA 1NBWB 2XYGA 2JI7A 3CLSC 3G0OA 3HO8A 3SOZA 3BOSA 5FX2A 3CPSA 4OXRA 4YP0A 5FBKA 4CQJA 2VC2B 3F8SA 3NM6B 3TH5A 5GINE 3FPKA 4QGAA 4TSRA 2XYHA 1H9AA 1KFBB 1Q1ZA 3B48A 3EXIB 3P9IA 1OU0A 4L3OA 1L8LA 4R7ZA 1REQA 3WFJA 9LDTA 5K8LA 2EKZA 1WB9A 2QE7A 2QYSA 5EJAA 3FG9A 4PLTA 5YASA 4DDVA 1CZHA 3U13A 5I51A 5IVKA 3CX6A 4NYJR 3LKBA 1B8PA 3ESDA 1G2OA 3H84A 3MCUA 2CHFA 3N0WA 4D5GA 1JHUA 4I3GA 4M83A 4IM7A 4GD3Q 4JL8A 1KHHA 4B74A 1PX0A 1XC7A 5TS2A 5F2OA 3GJYA 1K27A 1T35A 2ZUBA 4GLFA 3GY0A 1QE0A 5TNXA 1TEXA 5J47A 4PSVA 3QM1A 1PQPA 3D8TA 3LO5A 4EA8A 1FLNA 1Q2UA 4DV2B 1GGVA 1E2HA 3O38A 1PT9A 1TF2A 1BHJA 2ZWAA 2CJYA 3R40A 4GBGA 4IDGA 5JNVA 5F76A 3N8KA 3G9UA 3NCTA 3NRBA 2FQWA 1YOVB 1ZOOA 1Y9DA 1Z07A 2VK4A 5CX1A 4BO2A 1Y89A 4UTVA 1ECJA 3LYHA 4D9EA 2AC4A 2C8VA 2C7GA 1MPTA 1XO1A 3KYJB 5LKRA 3I2GA 3S2ZA 1NTOA 1TIPA 2H57A 1FS6A 5AJWA 5CM8B 5E8JA 3LUGA 1FEZA 4TWRA 1DINA 3HK2A 4BFSA 2O2YA 4RXUA 3GG9A 3S40A 4C7JA 4PAGA 2RK3A 4C0QC 2FKAA 3IURA 4DIFA 1DGQA 4YP9A 2ZKIA 4KR0A 2WM3A 4FFRA 2QLFA 3K7EA 3ABOB 2ZOSA 5JXHA 1ZD1A 3QYJA 5AUPB 1GTZA 2VPPA 4DB4A 3VH4A 4Z8YA 4JP8A 1AMNA 1P4JA 2X76A 3DUFA 4NAHA 1SBZA 1W7AA 5D3ZA 1RYZA 4BUZA 4EG0A 1LSOA 3FNBA 4Z54A 1ZIDA 1J9GA 1LFDB 4Y9TA 5JTTA 1O5IA 2EZ9A 1WCV1 1Z7GA 2YYSA 4WNIA 5A4KA 1E3WA 3ZWNA 3Q8XB 3OQIB 5BR1A 4QC2A 4PLPA 2QRLA 3G89A 1ZQ1A 2C2GA 4D9IA 4N01A 3QLVA 2GYVA 4JS0A 2B0JA 1V26A 3KETA 5AKHA 1TADA 5FEMA 1GIAA 2VHZA 3K3PA 2WBLC 3KZKA 1D2NA 4PGMA 1I4TD 5CJJA 1H6AA 3B1JA 3UHPA 2VA8A 4YJFB 1KSJA 3JQBC 2JIZA 3TW0A 1LPMA 4OMFG 5LR6A 2XOKA 3FCUB 1SCQA 5TDHA 3NRJA 3AVPA 4Q6WA 4MYHA 2IV2X 1PFUA 1Z5GA 3QVGB 3TIGA 3VZQA 3CW8X 4JHXA 5HMLA 4JI3B 1Z6AA 1T0HB 1I1QB 1JEOA 1XF1A 4LGVA 1Y8QB 4L78A 3RTCA 3TUZC 4OGWA 2J45A 1F9AA 2PWYA 1L3IA 3QFSA 4HSEA 3KQMA 4AWBA 2ODEA 3KTOA 3KLPX 4KSYA 2C4TA 2IPNA 2JFGA 5FXMA 3DZCA 2FWJA 3BGWA 1U4NA 4XM0A 4B3DA 4TZ0A 2AOUB 1KI7A 1C9EA 2Q1SA 1C0KA 4L74A 3DAGA 1THGA 1N5JA 1J0DA 2B4KA 4BMYA 2W2XA 5E2BA 1KO8A 1OD6A 5C7LO 1WY5A 5CPBA 1CF2O 1W5FA 3WLEA 4AJKA 1SOVA 2KS6A 3DT8A 2AL7A 3NZEA 4QECA 1F12A 5HIJA 4DVJA 1YHNA 4CR6A 2V7QD 4ISBA 4MKIA 4M1WA 3JZDA 4EPWA 3A58B 3U48A 1PJ2A 5CA0A 3RAPR 1CFZA 2HIHA 5A6SA 2ZT8A 1LRKA 4B6FA 4JJAA 1E7SA 1KNQA 1WCIA 4URHA 1JLKA 3E70C 5G4LA 3WIBA 5C7YA 1KYQA 5FO0A 5GJVC 2J4DA 4LYHA 4RK6A 4WV3A 5JWRA 1CUEA 3OZBA 1DBQA 1AQ6A 5ALPA 4IOKA 5A2QA 3LX4A 3G9XA 4RVCA 4EECA 4D26A 1E2DA 1I51A 2DPMA 2HMAA 5CA1A 2V1XA 1D4FA 3ZY2A 3IUNA 3U4MA 1RAIA 3W05A 3C43A 1TMYA 3RFCA 5CFRA 1SUFA 2A0UA 2FUNB 2H08A 3HCDA 3RJ9A 3JQ6A 1KIAA 2C4NA 2YMMA 2FP4B 3ZS9A 4NP6A 1KQPA 5LQRA 2F1OA 3KX2A 1ZI9A 4PC2A 5ALOA 4IEFB 3FR7A 1QH8B 3K1JA 5IUKC 2J9FB 5KYUA 1AMUA 1JBQA 1A5AB 5LBIA 5DHUA 1JEYA 5EP2A 4ZOBA 3Q6MA 2EJCA 4OQDA 3TX6A 1XD2B 4LY0A 1V45E 1ZD8A 1P45A 2PKXA 5BW4A 1Q0ZA 5IARA 3PV0A 2FZVA 3HB7A 3K0AB 5BQ5A 4QRIA 4E6PA 5C35A 2NW6A 2DR2A 4MIYA 2V6GA 5JUWA 4YRKA 2XVMA 4IO0A 1KO4A 3E9YA 3BWCA 3R8CA 2XWQA 3LI2A 1ORDA 3CZ9A 1NE2A 4HS9A 2P4UA 3I9JA 4L0DA 3RVDA 2FPUA 3OQPA 4IGEA 1XEXB 2VH5R 3ILVA 4MXDA 1NDUA 1LI4A 1NATA 2XXAB 1DQYA 1VJTA 1DP4A 4ENQA 1PJLA 1RVV1 3NG1A 4NQZA 3PRJA 3RC3A 3UJ7A 4RTMA 3UG7A 4J1SA 5TC4A 4FM9A 1WIWA 1NZJA 1T43A 1UM9A 5EPEA 4I5FA 4BDSA 2QX9A 1SXJE 2GF0A 3EFHA 4WEOA 4DG8A 2BM9A 4E30A 4LJSA 2NV6A 4TWJA 3C8ZA 1C4KA 4I50B 1THTA 1EI9A 1P0CA 3DQPA 3LQQA 2O8NA 1JAYA 1WZNA 4PZAA 1M1YA 4URFA 1HE8B 5GGXA 5FI5A 3GUYA 3EVDA 3LOUA 1Z36A 3ZZUA 2QBYA 4UTNA 1T4DA 1V5IA 2RAUA 5AK4A 4GI2A 4ER6A 4TXLA 3DYVA 1QQ5A 3JRWA 2RBEA 4MITA 5CNIA 4QTYA 2FPPB 3IBYA 5EERA 4Q3LA 1QCCA 2CCKA 2ZIEA 3WLOA 1GU0A 2X6TA 2BM8A 2FB9A 3PNQA 5K4AA 1L5LA 2IY7A 3NV7A 3TL6A 2D54A 2WLSA 1U1DA 1RHKA 3DQZA 3EBOA 1CJBA 2BGNA 3EAQA 3GRYA 1TFRA 2O05A 3B1VA 3DXFA 1TAGA 1P5RA 4KXQA 1GKIA 3T54A 4B09A 4O4IF 16PKA 4DQXA 3NJRA 2QX4A 3AU9A 2VZ0A 3W4IA 2O1EA 3I5UA 1IN5A 1HC7A 2GBFA 5G0TA 2X2FA 1H2XA 3CFYA 1GCOA 4TVOA 3HHEA 3KJXA 2QJTA 5F5NA 1E4EA 2Q4BA 3N6RA 4GE3A 3T3MB 3PPVA 1CS0A 4CQMB 4RYLA 2JFPA 2V1UA 4RZHA 3KZOA 2GAJA 4V1CB 3DBIA 4ZIRB 4TVKA 5DBHX 1DQPA 4WSOA 2FPPA 1SVSA 3A06A 4KX3A 4L22A 4DR1B 5EIXA 1HDXA 1LGYA 2R66A 1P8JA 5EJIA 5DX1A 1AQLA 4RL4A 3MRTA 5JD4A 5GIPE 4R71A 3Q7TA 4CL3A 3GUHA 1JV2B 2ONZA 4M2LA 1AF7A 2VATA 4MSUA 5FL7A 4XQEA 1IB6A 2JVKA 3AF1A 3Q1KA 2AN3A 1RRGA 3PXAA 5HFJA 5AVTA 4UXIA 3WI7A 1ZH8A 2AZMA 2OV6A 2AYZA 3ELDA 4M6WB 2OCXA 2YWBA 3LK7A 1YGYA 2E5WA 1QP4A 2Z3ZA 4YJFA 4BEVA 1P5ZB 2O5VA 3KO8A 4RACA 2GKGA 4FSDA 3HKEB 3L8HA 3OEHA 1TD1A 2CJPA 2X58A 4NG4A 2D7DA 5AJHA 4MVJF 2W93A 2F2TA 4GGOA 2PV0A 2YJ6A 4I0WB 2NZ2A 3UJAA 5IULC 2Z04A 3G13A 4Q3KA 2F7SA 4HYEA 1SGWA 1YQGA 4CIWA 4PQEA 4W5QA 1SBHA 1ECFA 1KAQA 1UBLS 2Q6LA 2V58A 2YIJA 3T7CA 2O5CA 2ODNA 1U98A 1V6CA 3O84A 5A03A 1M10A 1PFVA 2PKQP 2RHMA 5DSXA 2V96A 5DCWA 3WNCA 4LRYA 4E70A 1XTJA 1NV9A 3QY9A 4AIIA 5J5AA 2VRCA 4N3BA 4OM8A 1LK0A 3O47A 5JO0A 1FPQA 3EDMA 4WY5A 5DNVA 1G4UR 2VQ3A 4JMPA 3TQQA 4N3CA 1KFKB 4L5BA 3FM9A 1YS7A 5C52B 2GDJA 1O57A 4IMIB 4BB9A 1E6KA 1T5IA 1E6WA 1YJBA 4TMFA 5H02A 3RU9A 4G4JA 3AFGA 3TMAA 4AX4A 2P9FA 5AHWA 2R8OA 5J2UA 1RMTA 4RABA 2JCVA 1B26A 4HATA 1T8TA 2P5TB 4I6GA 2C9OA 4JB8A 2UVDA 1U99A 1ULUA 2OYSA 4DLTA 3WL3A 4QU5A 2H4YA 3NIGB 2R7KA 4ER7A 1ZBDA 2R6HA 1J8QA 1GV0A 1P4HA 2Y67A 3I04A 4NYMQ 1U0LA 3LP6A 1H4VB 3RQIA 2QN9A 2EKLA 3PPWA 5CG2A 3EC7A 4NJEB 1T4MA 4N03A 4CODB 1NTRA 1LC3A 2B0CA 2IYTA 2QD2A 3OTWA 2JCBA 4ZICA 2ISCA 2Y9PB 2DJ5A 3ZDQA 3GBPA 3H5IA 3B9RA 4H7HA 4E08A 1T2EA 2VRBA 1DI0A 4RLHA 5BR7A 4J03A 4NULA 4QJIA 2AEEA 1YMQA 5L6MB 1LWNA 1NN0A 2FR0A 3VOBA 3WL8A 2GESA 1SD5A 4S2EA 2VPQA 1U80A 5G4KB 2V8BA 5IZ4A 4YC7A 1XQ9A 1Y1KE 3P94A 2D3TA 1W36D 2C5EA 3WYNA 2EX0A 1JZSA 4JL5A 4C0JA 1HSZA 2NT3A 3ZGOA 3ICQB 4C3UA 3IGFA 4F0JA 1K98A 4CF6A 3OEWA 1IPEA 1G63A 4GPD1 2J7PA 1HM5A 4GQAA 5KCZA 4UDXX 1YI0A 2HA4A 5F2KA 3DLPX 3IP9A 1NF8A 1S1MA 3O74A 5E9JA 1K3UB 3IPYA 5D8DA 5IJ9B 1N36B 4M76B 3GZTB 3IVGA 4WIAA 2OCKA 3UAGA 1NLUA 3M2PA 1VYTA 2CNKA 1W35A 1U3WA 3C1UA 1R0WA 5FFNA 3TRHA 4B6GA 4JI8B 2OMEA 4NBNA 2ODWA 3VNBA 4F3CA 5JAUA 5L7WA 1C14A 5BSWA 1P1FA 3A1FA 1JL3A 1ZISA 3OPYA 4L9RA 3GLFA 4UBOA 2GRAA 3P71T 3DO8A 2GKSA 1B76A 4UBMA 1EFRD 2DWCA 2FN4A 3ROGA 2PGAA 2J87A 2XCUA 1PZNA 4LYJA 4NPCA 1SBQA 1DKLA 4OOFA 1L5QA 3UMCA 5CCBA 1LLCA 4L4SA 4CW7A 1GFWA 1F0NA 2AYYA 4MHTA 2AOXA 4NXMB 2P9ZA 1OAOC 3PXDA 4LDNA 4F4HA 3K9QO 1BKDR 2QX7A 4HB3A 2FWAA 4KBGA 4CFSA 1MLDA 4YJKA 4BNJA 3BZBA 4NMWA 3ERCA 1H0RA 2R0QC 5DHFA 2GASA 2PGJA 4PANA 4BMSA 1G9TA 4XGKA 1QK3A 1VXOA 2Y1EA 2Q9AA 3HZHA 5ALJA 2XUOA 3B12A 4HB4A 5DMHA 4ZVMA 5K4GA 2GBPA 3D0RA 1ZMRA 4E1BA 4S1WA 3CUTA 3WWEA 2NSLA 1SXJD 5BW6B 4ZKDA 5E7JA 5AVXA 4YMTA 3P9ZA 2QYTA 1G41A 4QUEA 4YROA 4M0EA 4QODA 1Z2CA 3VNRA 2JGEA 4NHOA 2QTZA 3NU1A 5T3YA 3RVBA 2BGKA 5ES3A 1IYZA 4C7XA 4DUYB 2PUGA 3PLRA 3HFRA 1RR6A 1PO7A 4CM5A 2AJBA 1EXWA 3I3OA 4GSYA 3F6BX 4NENA 4DUGD 2GX6A 3CSDA 3NVKI 2VEDA 3O73A 1SCAA 3AH8A 3IA2A 4UHDA 4Y2HA 3CZ5A 2H85A 3IEKA 4Q9DA 1QQ7A 1TLLA 4JELA 1WPXA 1ZN7A 1T1EA 2RK6A 4UARA 2Z6AA 3GRAA 3BX1A 3I61A 5LZ2A 3BJZA 5I8PA 3PI7A 1XQWA 4I4NA 1MJGA 2VNAA 4G0YA 2RHRA 2V59A 2P2LA 3QWBA 2BT4A 1YKSA 2IX9A 3IHTA 4D6XA 1Z6ZA 2P11A 1W6UA 4RY9A 4WZBB 4BOYA 4ZI7A 1EVLA 3TLZA 3K31A 3CCCA 2EG5A 3WYCA 3K4HA 4KFRA 1M2JA 1Z0AA 2Q3JA 4WXPA 3Q7IA 3RHSA 4Q4HA 3RTEA 4F8EA 4D74A 5B1IA 5DYIA 3U9TA 3TIIA 1A1VA 2JFQA 4RY8A 4YDRA 1B23P 5EP3A 5DNDA 1R16A 3DM9B 2Q5IA 1RLJA 1QH9A 2BEKA 2WMDA 4FE7A 4MYCA 3TD2A 3UPTA 4WZ6A 4HWGA 2C9YA 3DE3X 5E3HA 1PVOA 4CYMA 3TBFA 2QSUA 3OUUA 2ACVA 2VP9A 3TJRA 1HLFA 2FDXA 3F2IA 4JAVC 3UMVA 5CFPA 3UBTA 2QJOA 4HYYA 4NPAA 5AM0A 1AUVA 2HXGA 1E9BA 2CHEA 3BQNB 3BA6A 3HRHA 3SIWA 3E8SA 7MHTA 2AMLA 3OZTA 4RCZA 2YY7A 4IUYA 4LWZA 3R3UA 3VUFA 3MK31 3DWEX 5EIOA 2JI4A 3LT1A 2AN9A 3EVBA 3OX3A 3QWIA 1RQ2A 5DLQC 1N0HA 5LWQA 4F2HA 4IJUA 1T1JA 2ZSKA 1VLJA 3HP1A 3S8MA 1K66A 4XIGS 3H1GA 4TV8F 1UQRA 3GAZA 4OD0A 1TZBA 3HYLA 4L72A 2F8LA 2LCFA 3UMRA 3RYCB 4WLUA 1C7RA 1ISMA 1D0VA 1H05A 1YZVA 1E3WB 2H5IA 1D09A 4H4CA 2V7UA 4MS4B 2KLHA 5JIBA 1K7YA 4GLBA 3ABZA 4HX5A 3MERA 4B8YA 1UEXC 2QY9A 4C1BA 1E66A 1F5SA 4PAMA 4EW6A 2OHVA 1SOAA 4CGYA 2ZP1A 4ENRA 5BYBA 4Z6KA 1PS0A 5HCNA 2WKQA 1NQWA 1I8TA 4H3HB 4QU9A 5FIUA 3MTGA 3L5KA 4FOLA 4FQ5A 4FHCA 4N7BA 4UMFA 3EQ9A 3V7YA 3C3DA 4JI0B 2AI2A 2WVJA 1KY4A 3SQXA 1HKHA 4QOGA 5DI9A 4NICA 3EGXB 4DM7A 4RVOA 2IIPA 3ROTA 4PPQA 4OFZA 3THXB 3CTMA 2Q4OA 4U02A 4Q4AB 4AG5A 1U3GA 3K30A 1E1CA 2TRSB 1TTQB 4XUDA 2ODBA 3PWSA 2C0QA 2HO4A 5E38A 2B2NA 2HEGA 4MLZA 2ZSIA 3L6DA 4G89A 2QD4A 3F1LA 1IY8A 2P91A 4BNXA 2QI9F 3ENZA 3A4IA 5AD1A 4COOA 4OOEA 4G24A 5L7YA 4ONEA 4YFYA 5KX5A 3H2IA 3WX0A 3VV3A 1AGRA 1Z34A 4GHWA 4F91B 1E0KA 1H6CA 1VKRA 2Z08A 2ZJ1A 2IEIA 1WBBA 3OQVA 4D56A 2E5FA 1Q5PA 1YNSA 1U8EA 2Z5VA 3C7CB 5D84A 4MW9A 1ZRSA 4OI1A 3Q3JB 5T7BA 5FPYA 3WDMA 3FTQA 1GT91 4ZCPA 4H16A 3ZJ4A 1J8FA 4GNRA 1GPMA 1MC4A 4ZMSA 2Q3HA 2FZEA 2J5RA 2H0QA 1V7ZA 4D9JA 2Z3VA 1XVAA 3OCVA 5TT0A 3W8NA 1FUYB 3GHYA 2B8EA 3NAGA 2PZFA 4ZV7A 4KPGA 2ZRKA 1GU1A 2HUNA 3LQ2A 4UCFA 3SYTA 4DA7A 2BR3A 2V5UA 5KVVA 1HE3A 3KBOA 4KSCA 3TB6A 4DN6A 1QYDA 3X43A 1QX4A 1ZESA 3K94A 3NIBA 5EI5A 4N4AA 2J6BA 1CIJA 3PIDA 5F78A 3FPGA 5BWLA 4RKEA 1ZITA 2D4AA 5I7RA 4V3CA 4MIOA 4BV8A 5JT1A 4DYDA 5TX7A 3F9CA 4QAQA 2EL7A 2ZIWB 3UJPA 3T06B 3A6FA 3ITKA 3P0EA 2QF7A 2G9VA 4WGGA 2YHIA 4FX2A 5DM4A 4YUXA 1V1MB 4UTZA 4C0WA 2O8CA 1DELA 5KHLB 4DMMA 3FPHA 1SCUA 2G09A 4MPTA 1PFWA 3NBAA 3U44A 3JR7A 4WKCA 3T9BA 1JQDA 2VI5A 4ZQBA 4II3A 3WYGA 4AQ7A 3QXCA 1PYOA 4FMCF 3SHVA 1A50B 1PN3A 4PU0A 3HUUA 1FPMA 4YAUA 2AOUA 2PLRA 4O4LF 3V8EA 5DI3A 1U63A 4S1TA 2DBYA 1J9ZA 1C3OA 4GR9A 4ESOA 3QMPA 4YUVA 2JHPA 2QMYA 3MTQA 1YS2X 5KSPA 4FILA 4R8MA 5IK2D 4OHZA 4MB2A 1ZRMA 1K86A 4R81A 2VKTA 3OF5A 1G1MA 1O96B 4UREA 2XCRB 4ZVQA 2QZ9A 5B58T 1PL6A 2WPNA 1XNHA 3I9MA 4ESVA 1E7MA 2WSSD 5FJIA 2FE4A 4CG3A 1Q74A 3R7LA 2Y8EA 2V3CC 3R3WA 2FK7A 5CMLA 5I9MA 3TIXB 1N2GA 1FC0A 1ZGBA 4C0XA 1VKJA 2WIBA 2WTMA 3PEVA 3JR3A 2B4RO 2P6OA 3WLFA 1KVUA 4NATA 1NV8A 3P96A 4OBBA 2P78A 3ENKA 1NVXQ 2C0CA 2CCJA 5CP8A 4BVJA 4LC9A 4PRLA 3AOEC 2VHWA 4C6HA 5AUNB 4HWRA 4B48A 4OXIA 2Y1CA 3I52A 2JAUA 2GGSA 3F3MA 1GAEO 4QQKA 1DFHA 1BX1A 1HYGA 3D4BA 3HB9A 3GL9A 2VK8A 3P19A 2C4HA 3KCQA 4H7KA 2WU3A 1LQ2A 4P53A 3HGTA 5FPQA 4DSNA 3FZYA 3GJ7A 1SD2A 2MOKA 1XXHB 2WSYB 3ESBA 4KGZA 3GXOA 3VHQA 2JJ2D 4YAGA 4FGSA 2CLLB 4EI9A 5KNCD 3JYPA 1Q1EA 1OXUA 4B3HA 1W88A 1UK6A 3T6KA 1ENYA 1SZJG 2GJKA 4HNVA 2CVPA 5HVNA 1YR9A 3QE3A 4FCTA 2PUCA 1H23A 3FYUC 3REGA 2VJYA 3L18A 4LECA 4UCXA 5TE9A 1Y6FA 1U28A 2VR1A 1F9EA 3R76A 3S2EA 1C7QA 3NANA 4OJNA 2AC2A 2C4KA 1GUYA 3NAQA 13PKA 5F7OA 5J4YA 1NI4B 3NBKA 3AJ8A 1W2HA 5KNDH 1L5HB 2QRUA 5FWDA 2ZBDA 4C2TA 5DVZA 1EHIA 4JR1A 2VQDA 2WKPA 1NJSA 1RLOA 2G5PA 1FRZA 1ZH6A 3PXUA 1NM5A 3HWWA 3VPSA 4OGKA 2WPDA 3HCFA 1WXQA 2D13A 5ALTA 4EYOA 3BWBA 5K45A 2CLOB 3II6X 3IRVA 1N2OA 2D1RA 2V3VA 5JS2A 4TV9B 4ETIA 1VLHA 1N0VC 5I7FA 2UXDB 2ZJBA 3WG9A 5KOJB 3B6JA 2H48A 1HYBA 3HSYA 3QXXA 3LWBA 4FMPA 5EKDA 4P81A 3SXUA 4V38A 2H1SA 5FD8A 1ZJ4A 2ERYA 1W94A 4JJIA 3NWJA 5FOWA 4M8KA 4XUEA 5LP6C 3OZGA 5ADHA 4LC1A 5IK2A 4AS1A 4RJJA 4KYIB 4M3NA 3BXHA 4A8TA 1VL0A 5FOQA 4TT3A 4C88A 1QAMA 5DLPA 2NUPB 3DV2A 3WLNA 4YJ2A 4X0EA 4J1QA 5JADA 3H13A 1U4SA 1U5BB 3UA4A 1QQAA 4W5RA 3ZYCA 5LZ5A 1VC2A 4JGBA 1GG9A 1UXJA 2CMFA 4UCQA 3V3KA 5JYBA 4J0JA 2Z9DA 3GZ4A 1VLLA 3R0IA 3F8WA 2DPGA 4BBPA 4CIXA 4WKOA 4IHKA 4MVJM 2JW5A 4EUSA 4L5YA 1TW2A 2QN1A 2W8BA 1BW9A 3BB1A 3H5LA 4LXYA 2DLCX 4LZNA 1T15A 3RYHA 5LA6B 4A2WA 4Z0TA 4HQOA 4QPZA 1OLUB 4AUMA 3EGEA 3I58A 1FNSA 1LBIA 4MMZB 3SI7A 1USKA 3LUBA 1UKZA 2C5SA 2P9GA 1CEEA 2NXEA 1IOVA 3REFA 5DHRA 3LT4A 2HCTA 1I1NA 1QKJA 4Z4IA 1M8PA 3MTIA 3G02A 3COVA 5G41A 2C2MA 3IBTA 4G0MA 3P2JA 2CVOA 3W6OA 3OLWA 4D9CA 1T2DA 1BS9A 1LVGA 1MO3A 3P9RA 1O6GA 1JIKA 1JHXA 2NYUA 3JQ9A 4NIMA 1E2PA 4BXOB 3LU1A 1X1RA 1DOAA 3CSSA 2JD1A 2P62A 4IHQA 3RVQA 1FX0B 2GBIA 1NQ5A 2HJWA 5IW8A 4A8PA 5BWNA 1L7DA 1OF1A 3I32A 4I1OA 1G64A 4REQA 3W6ZA 1NBMA 3N7TA 1KRWA 3O26A 3TXAA 4OB7A 3E6AA 2ZSUA 4GEGA 1Y3CE 3IT0A 4NK5A 3GFSA 2NUBA 3ST7A 3VPBA 4Q7JB 1B16A 3DVRX 3E4DA 3N7UA 3UT0A 1HQYE 3BIJA 5K99A 1YZGA 4RK1A 4M9XA 1CVLA 3ZH9B 1JI3A 2C54A 4WZAE 5CFLA 3BGIA 3UJ9A 1FF9A 1DKUA 4WI1A 1C7FA 4DARA 1KYXA 1UBFA 4JJ7A 3ZY6A 1FXWF 4LQDA 1QG6A 1AZTA 4XJXA 4E07A 1V1RA 2BSAA 3H2JA 4UULA 3AHDA 1OH5A 5JALA 1WPQA 2EVWX 2GM9A 3THXA 3D0QA 2H4JA 1ABFA 1XYYA 4LMBA 2HOQA 4NNPA 1F2UA 1WKCA 1KMHB 1RJEA 3B53X 3DNPA 2PMFA 2JFZA 2PY6A 4BNMA 4AJ2A 3SEQA 1JYEA 4BQFA 4GPEA 4FFBB 4YCJA 4HFRA 1G6OA 4OQEA 2B20A 1PLKA 2CDAA 2MMCA 1CR6A 3P9PA 5AW0A 5AXAA 3RUCA 3A2NA 3L5OA 1N5RA 1WNTA 4R0NA 2P8SA 3JASA 4JUFA 4NI5A 4DMKA 5AOCA 2XVXA 4UAVA 2ZWPA 4IUCS 3NUQA 2H11A 1J00A 1P7VA 2QEQA 2QP4A 2X23A 3EAGA 1FP2A 1I4DD 1BCRA 3E15A 2XADA 3JARB 4FHFA 5DBEX 3RO7A 5I5EA 3JQFA 1M34B 1YULA 2FRDC 3L1VA 4P3OA 4QJ4A 2PK3A 1DAFA 3DB2A 4KZKA 4DA8A 3U19A 3AILA 2GZRA 5HM6A 2ZIGA 1WHSB 3QE0A 5KTTA 2IHBA 3AF2A 4TTRA 4JYPA 4LOIA 1IY0A 2B37A 3TLBA 4MQEB 5C0OE 2OD2A 1JT2A 5JSZB 1FSPA 4KXFB 3DCYA 5G40A 2Q1XA 5B30A 3LLMA 4ZYXA 4UMDA 3K2QA 1RRKA 3ROKA 1MUUA 3LQRA 2DXIA 1GPJA 1W0KD 2JAOA 2OOKA 3ZJYA 3H5AA 2O2XA 2HSDA 5TY0A 3PD1A 4HEQA 3RBXA 4EH1A 3BB4A 1VJ1A 1RYNA 2HBQA 1OAOA 2JA1A 4OHWA 5TB5A 2J59A 4DHWA 3VR0A 2Z1MA 1BE1A 1OYOA 1SELA 2PEZA 4MRAA 1WZCA 4XPIA 3W8EA 3WKEA 2C96A 3ROFA 2OAP1 2JJQA 2VJNA 3G0HA 1TL7C 1A3CA 4XB6B 3O4RA 1G7SA 1U5AA 1ZUWA 2R6DA 3W3AH 1ZUNA 4R16A 4IQFA 1P2UA 1TAQA 3AF5A 2X0IA 1DEXA 2CBXA 4B6OA 1GO2A 2NM0A 1U2TA 2OGZA 2W98A 4GX2A 4HDMA 3ZDYB 3TMKA 4BMOB 4IIVA 4DG5A 1CX9B 3MMPA 3FVRA 1ZJ5A 4R2IA 1L4EA 2EW2A 2B8NA 1ODFA 4MUFA 5NLLA 4B2PA 2ZXEA 3K20A 1MAHA 3B9QA 2QMUA 2CL7X 3AZOA 1KR2A 4EHJA 1K8ZB 2QQ0A 2X2EA 1XA4A 3F6YA 3OE1A 4MS1B 3QUCA 1YKFA 3VMMA 3ZNPA 3RC1A 4CTOA 4URXR 1D1SA 3JD4A 3OQJA 4WKPA 5CVEA 4MHOA 6LDHA 2EEZA 1N2EA 4X8LA 3TFOA 3TOVA 4MVJH 1H85A 2Q7OE 2FE1A 5KEIA 4R5MA 4CHTA 2CJWA 3W5IA 1RLTA 4XTCS 5KB3A 1ZH0A 2Q1UA 1RJFA 3RYHB 1G8FA 3PC3A 3SS8A 1U02A 4B7CA 3AT1A 3DLIA 4YRZA 4K86A 3FPEA 1P77A 3DMGA 4PGAA 1LU9A 3GJ0A 1YQ9A 3P0IA 3TQOA 3JRXA 4D4HA 1LPSA 2CFSA 2LRHA 3ER6A 3GLHA 1FFHA 4L3WA 3ZE0B 5CFOA 1I5OA 1D9XA 2G06A 3HGMA 3B1ZA 4R7GA 1L5HA 4EJ2A 1V5GA 1YDFA 2BEUA 5ES4B 1TZMA 1U1IA 3F7MA 4WXMA 3MMZA 2IH5A 2IXTA 5HS6A 5JJCA 2NUPA 3G49A 4PX2A 2ZYUX 4YJ2B 5DGIA 3IDSA 4NCAA 1A7JA 2Q9UA 2YZKA 1P18A 3DDZX 3SP1A 3O9ZA 1UL1X 1UZAA 1UJ4A 1RPZA 4EMSA 4B33A 4V02A 1C1YA 5LD2B 3ZD7A 1YFZA 4BHTA 4G0VA 4X1YA 5EKXA 4PSUA 5C5EA 1F2TA 2QTAA 3WMGA 2CNWA 1T9HA 2W0MA 1RP7A 3BL6A 3ZIAD 2W2VA 2D3WA 4EGQA 1JFTA 1VE7A 1NF2A 5I7UA 1G2QA 1O0SA 2BCEA 4W7IA 4UFPA 4Q1BA 1FMCA 1M2WA 4CHGA 2AWNA 3CA8A 2W11A 5EVCA 5K5EA 3EZYA 5TGDA 1A72A 1DIHA 1LSJA 2GZMA 2PV7A 1UMDA 2WAMA 4HT3B 5A06A 5JDIA 4JQYA 5JAPA 1X7WA 2ONJA 1KQOA 5EZYF 1N77A 3EF0A 1GT6A 2NP6A 3T5DA 2XMZA 2C2XA 2J85A 3LLCA 4Q02A 4YX9A 4MLDA 3NGXA 3TJMA 2VPYA 4JYCA 1Z6GA 1Y7LA 3VSCA 5HQ3B 3AHFA 1UBNA 2WTEA 1CY0A 5IP5A 3HO1A 1FYEA 2VZ9A 4Q4LA 1TOAA 3TNJA 1AG9A 5EHXA 3REQB 5K0JA 3I6IA 3MFYA 3KPWA 2RGBA 2PGOA 1ZVKA 5EKUA 2Y66A 4J4BA 1FX0A 2GPWA 3ENWA 4NNOA 1HDYA 4BNHA 1Q7BA 2FW8A 3DF7A 3GEHA 2WU1A 5JZMA 3GI1A 2TS1A 1LZKA 4AMUA 3F9RA 1LBQA 3C6BA 5KNBA 2ZBQA 3BGOS 1TLFA 4FB4A 4CEHB 1TT7A 1KS2A 3QJ5A 1D2CA 4M0LA 1SKQA 1BAPA 1W4RA 4ZT4A 3AF6A 1R27A 2QTNA 1E9EA 4TGLA 5FNVF 4RV9A 3O95A 5TPZA 3BG5A 4AK9A 3Q8KA 3FYSA 4BLOA 1XZEA 3MINA 5K3OA 1Y3IA 4XAQA 3W8DA 5JJIA 5JMPA 2LGJA 5T5QA 4EPTA 3I01M 1FUUA 1X2EA 2L0XA 1U7UA 3OFVA 1GARA 5ESRA 3OX4A 4H6VA 5EVJA 4DIKA 4A8JA 1U31A 2JZCA 3RSQA 5DYNA 3KTFA 1X1BA 4JEIA 3DYBA 5DLYA 2OFFA 4AT1A 4ATNA 1JEAA 4A3SA 3ACDA 3CH5A 3JQ9C 4E3ZA 4MI6A 2EOAA 2VNIA 3KNZA 3JD3A 4KIGA 1XRRA 2F3QA 3QHAA 4IVQA 4BO5A 4G56A 5G0VA 4AC9A 1J49A 1JA9A 2CHUA 3EW9A 2AOWA 5EXSA 4RHYA 3T1QA 3C41J 5EJ6A 2A9JA 3PUYA 4LHWA 1G21E 1P9OA 1FU7A 1RRPA 2QAJA 4W63A 5FV4A 4FKZA 5K6AC 2XUDA 3M1AA 2WAOA 5DEIA 5CIWA 3ZGYA 2RC5A 5DN9A 4FKBA 3EGIA 5L7TA 2OKGA 1ISGA 4BE7B 1W2GA 3V4FA 3U60B 1TF7A 2VP4A 1PJCA 2RB4A 4F4UA 2Q3LA 5TQVA 1DAHA 4OK6A 1S01A 1H69A 1YZKA 2A78A 4HRYA 4D8YA 2WEKA 1GNRA 2HDWA 5EWJB 3QNMA 3NHUA 1WE2A 1N5OX 1U7OA 2JFHA 3M7IA 1N2CA 4RETA 5KYYA 5JR3A 2RD2A 4ZZ0A 1Z75A 1A5SB 5EJ7A 3R77A 5F1OA 5HOEA 2H9AA 4FDMA 3PZRA 1U3CA 3WQBA 3EG5A 1IWOA 4PLGA 3HM9A 3NAMA 5AJYA 4FSHA 5HRUA 1JVBA 2VXBA 5EXDA 1QGYA 2ZUDA 1XP8A 3KQVA 3BK7A 3TTTA 3W6UA 1Y5LA 5K51A 4XWAA 1JXOA 1FFWA 4QATA 4JB3A 3H9JA 5IM4F 3G0BA 2DKFA 2G83A 2CB0A 3CB2A 3GFRA 3F2VA 5AM3A 4J0IA 4TTIA 2QRVA 2O8FB 4EZBA 1WMEA 4F96A 1AV6A 2WAAA 2NV2B 3K1YA 4R84A 1HEIA 3QYAA 5TARA 4YPOA 5IKXA 3TLEA 3U3JA 3W2FA 4DDTA 4LGYA 3OZVA 2ECFA 3L7LA 3O0DA 4BWFB 3OT1B 4Q48A 3NBMA 2H4WA 3RYIB 3UWKA 2GAAA 4PN3A 4H4DA 4OJYA 4Q24A 2ZYDA 2IZ6A 4F3KA 2D6FA 5HS4A 3Q7EA 5DWVA 4K3UA 4YCLA 5A02A 4G5GA 4MEBA 3HNOA 1HE5A 1RD4A 3ZWOA 2GTIA 5FUVA 3SDSA 3FDFA 5I7SA 1N34B 3FA2A 3DLAA 4HV4A 4EF4A 1W85B 2GN4A 1Y1RA 4FR5A 3OZFA 3LP5A 4RH0A 4BC1A 3LF2A 2XWSA 2NUTA 2QLTA 1WMSA 3KU4A 2FFQA 1TJ3A 3TDNA 2CXRA 1M2KA 2JIRA 1W5EA 3K6JA 3JPYA 3C3AA 3PFGA 4QPDA 3G2HA 4YGYA 4AKTA 4Z4FA 4YCMA 2ECKA 4HAIA 3DP7A 1E5DA 1XEWX 1FP4B 1XQVA 3D4IA 3MWFA 2HADA 3KB8A 3NHBA 1JAIA 4KR7A 4LOLA 1IG3A 3L05A 1D9ZA 3WSWA 3VC1A 1CJTC 1QUEA 2WIAA 1JDVA 3MB8A 2A0FA 3QKUA 1LW7A 4MQLA 4IJKA 3C1OA 1V96A 2H31A 1P0PA 5DI3B 3HB5X 3KYCB 4QEKA 3GRUA 4KSBA 4AX8A 3BBPA 3HCEA 4FS8A 1G6KA 4XEUA 2EJTA 3BH0A 1A8IA 1W96A 1HETA 3FRJA 1NURA 3PDUA 4Z86A 4FNGA 2CNDA 4OBXA 2XLBA 3L7BA 3NVMB 3TAUA 3LTNC 4E4RA 5UKDA 1ZH2A 3AKYA 1VIAA 1WMFA 3CT4A 1RZ3A 4CEIB 1V3QE 5GVSA 5FBHA 1S3FA 2DBZA 2WWFA 2Q0QA 3A2LA 4TV9A 4WZBA 4ZI7B 1FOEB 4OQ4A 3D64A 2LCIA 4F5WA 4B3GA 3WMRA 3WL4A 5FNZA 2OUIA 3G79A 4K2AA 4KVZA 5G1OA 3LBFA 4EP1A 4F2PA 5FPKA 2WD9A 3MRXA 4ZOAA 3UIEA 3OO0A 3VOTA 3B60A 3VTFA 3QLUC 4M0KA 5F1YA 2IHNA 2VCHA 3ER8A 1EFRA 2O48X 4RQBA 4DR5B 1NMYA 4XKJA 4PZLA 3AW8A 5ICFA 3FFAA 1R66A 2OOSA 4WCDA 5LZ7A 2GJ9A 4R1UA 4RLSA 1PK7A 4QYIB 3RNLA 1CIPA 3JQBA 5HG0A 1H3NA 3LUHA 3MPOA 3IOCA 3WWZA 2COUA 3QFTA 2F3RA 3PNPA 4OLJA 3L4BC 3C7DB 4RA9B 3BWMA 2PU7A 3K0EA 4Z9XA 4OGFA 1QO0D 2ZU6A 1O2DA 3HTXA 4MA4A 4FXPA 1QU3A 4BFLA 3EXEB 1EK2A 3TMYA 3DD5A 3BSWA 3QENA 5K8IA 1VCIA 4LFBB 2HLNA 1F48A 1XROA 3C8DA 4XRRA 3AR7A 3DGFC 2F43A 1S2LA 1Q3HA 1E79D 1X77A 4KGXA 4L9WA 4AROA 2Q5HA 2R85A 5TF4A 3CNLA 2OB1A 5FBVB 3KOOA 1A04A 4L8YA 3WJAA 1QYWA 4C2UA 5D5QA 2WWWA 3A9WA 5KNLA 4N8DA 2GZSA 2ZAOA 2HW8A 4ENSA 5AW8A 4P84A 1QKKA 1Q7GA 3N8NA 4QBHA 3TVYA 2VZ8A 1P72A 5JNTA 3ANXA 2X8LA 5CGQB 1UXKA 3ITEA 1ENOA 1UJBA 2W6JD 2Y9MB 3HQ4O 3JQ7A 3TOSA 3HB1A 3R3VA 1YVUA 3K9NA 3NV9A 2DHCA 1PGOA 3MC1A 1C3XA 3F74A 3HDTA 4KQIA 1K6IA 3IRUA 1SHKA 3MTEA 5LQMA 3KJEA 1H6BA 3VJRA 2Q3CA 3WO0A 3RIMA 1IHPA 4XIFA 1Y5NA 2VG8A 4YRFA 1JQEA 3MS4A 1NPDA 4K7JA 4LYYA 1SC6A 2OHOA 4KE6A 1EM8A 3RTAA 1Q1GA 2H2IA 3M3PA 1CC1S 1LPOA 4Z1MD 4HH3C 4C5AA 3MYYA 4D96A 1T2NA 3IAXA 3T9FA 1W0JA 3HCBA 1DTWB 1ZCJA 3EUEA 3IAAA 4NONA 4CM3A 4DCSA 4F92B 4YRTA 4GGMX 4PRYA 2ZS9A 4QUBA 2ZSHA 5FV7A 4UE2A 5GZ1A 3ZE6A 5IU6A 4A03A 2WIDA 4A0HA 4IHJB 3ZCUA 3WMWA 1M7BA 2PH5A 3R5KA 4WVLA 4NYIQ 2AF3C 2CEKA 1MZVA 2PWPA 1X1DA 1ODJA 2HSZA 3G2LA 3ZWYA 1H2RS 1P2FA 1TTHA 2WIGA 4AJ1A 4DQ0A 5JXJA 2Q5OA 3LW7A 4XI9A 1SPBS 5LNK6 1XNJA 2R6JA 3F4BA 4EPRA 1EXVA 4F5ZA 3L7OA 3PJFA 5IVDA 1DHRA 1NN5A 3P2IA 2FDCA 1DARA 2O7VA 4G0UA 4AY2A 1RMQA 1S3SA 1YQXA 2I6FA 5TEVA 1MQ8B 4M54A 2F3TA 1N6KA 3MB5A 3DOCA 3O3CA 4P4SB 5AMXA 3ECSA 3EAFA 1RXIA 4KXUA 4R6XA 3SFZA 4CKEB 3ESRA 3W5DA 1XCMA 4HKTA 5A5GA 2VDMB 4PQRA 1CG6A 1T1IA 1F0YA 1JMKC 3DBRA 1P29A 3RKRA 2EQAA 4MAAA 4CVNA 1MABA 3H7AA 2C94A 3PG5A 2QRGA 2QB5A 3SE7A 1HLPA 1EG7A 3W34A 5JAOA 2XMQA 1XZLA 6YASA 1DEKA 4YUZA 3ZCPA 2D7JA 3B6EA 1QC5B 4RFVA 3ZLTA 4KK4A 1I7SB 1O89A 2JVIA 3RGGA 1YR7A 3GBSA 4OXXA 2YZGA 4PNEA 1DFGA 1JAHA 3CKYA 1EWKA 5A4AA 1ITZA 1L4NA 1EFVA 1PNRA 4BY9E 3UC5A 1B6GA 2EFDB 1O6FA 1H0SA 2CLEB 3HDGA 3OMXA 4QG3A 2SNIE 4R7TA 5T8KA 3V4SA 3BD9A 5EN4A 2ZSJA 1RWXA 5DCUA 3HBNA 4GH5A 3AFMA 2BY4A 3INGA 3R44A 2JGFA 4RVHA 5CVTA 5JYEA 3TUJC 1VECA 2P79A 3QX9A 4E51A 1VBNA 1VE5A 3CR3C 4CBVA 3EZ9A 5HKKD 1EK5A 3RTDA 1PR5A 1L7OA 1CYDA 3COPA 3GZNB 1DZIA 2LKCA 3G2NA 4FHZA 4WRRA 3UUEA 4B5LA 5HZMA 2CWDA 3FE2A 1A77A 3AI2A 3DPSA 3JARA 3TDKA 4AVYA 2UUCB 1IY2A 2BRUA 1IXRC 1U7XA 1R4ZA 5HKKA 5HQTA 3OIVA 3SD7A 5JAHA 4LF5B 1UOOA 2ANCA 3GDHA 1I4LD 3MTBA 1NT2A 3BQ9A 1FP7A 4EHKA 4F5DA 1ZBQA 2G25A 4NCIA 1KQ3A 5CT5A 4BS9A 7MDHA 2BGMA 2Y2VA 3QYPA 4JY7A 4LG1A 3ZVLA 3N2GA 2GEKA 5A4JA 3O1HB 2HDOA 5K3FB 2WICA 3UF0A 2P5UA 3CHYA 1T10A 4K6OA 1JR2A 1DCTA 4CIAA 1VHLA 2WF7A 1ZXXA 3PP8A 4PYNA 4EKDA 4DLSA 2EX1A 1E4EB 4LI0A 4HDNB 1WQ1R 4KODA 1C0LA 4XQCA 1RXVA 4FWBA 5K0BA 1E94E 1L4LA 1CTQA 2ECOA 2OB2A 1CY4A 1ZMTA 5JH7B 2XNHA 4YMIA 1NY6A 1XA0A 3AY3A 4LYEA 3F49S 3FKJA 4W82A 3UCFA 4X1KA 1QH1B 2VAMA 4BVBA 1EX1A 1T3HA 3HKBA 3FBTA 3QFFA 2X0DA 5LYJF 5IJ0A 4KXNA 3RFVA 1RVDA 5KWVA 5KQPA 2JFNA 5GIOE 1QRUA 4CMEC 1MB0A 3AF3A 3B85A 1NRWA 2X0RA 4LVNA 3WGTA 1UPUA 2X15A 3D6VA 3K32A 4Y2JA 3KHUA 1C50A 1KI8A 3DE0X 1V8OA 1CB0A 2GM4A 1W34A 1AS2A 2HMWA 3FUCA 4TS3A 1ZDMA 2KE5A 1H1TA 4TXMA 5DASA 1Q3KA 2DRIA 5GWXA 4C5BA 3X1XA 1Z6PA 2DTEA 2FJPA 4B46A 3HWX1 3MJTA 2VP3A 4ETNA 2BTQA 2O7RA 2X7JA 1E5VA 3N70A 1SXQA 2P7HA 3FMVA 4GZLA 1IXYA 2PZ8A 3ZHXA 2HBZA 5E8RA 2BH2A 2AMVA 1JA0A 2GVZC 3VR4H 5F2NA 4DT1B 2H6EA 1K3FA 2QNRA 3O90A 1PRYA 3TZEA 2Y0DA 3W5JA 2XA2A 3JQ8B 3LV8A 4X3PA 1C3VA 2ROQA 4C6TB 4OTZA 5JQGF 4TSFD 1V47A 2E37A 4OIMA 1EAMA 1X0VA 3BH7A 3G23A 1M6YA 4ID9A 5IUNC 1KFEB 4L9SA 4Q5IA 1E3SA 1OBVA 1EEHA 2W8BB 3S68A 1ONNA 2O1WA 3FYUA 2DQ4A 2ZJ7A 1K8YB 3R74A 4ZJZA 3EPHA 2P7IA 2Q21A 1HQDA 3LOQA 2ZTLA 1BC5A 3EH1A 5J63A 4FUTA 3O91A 1WBJB 4U9UA 3UJCA 3LUAA 2HF8A 2H4ZA 4DRXA 2Y0CA 3WGOA 2V7TA 1PR6A 3WRXC 3TFQA 1CDOA 2P67A 3INNA 2I8AA 2JCGA 3CEMA 3VO8A 5GTDA 3NQ41 3KE9A 3MWJA 4ESHA 1CHNA 4XA8A 1NR5A 2FG7C 4O3MA 1FA9A 1Z68A 2CVZA 5F51A 5P8WA 1KDTA 5LZ4A 2DU8A 4FZ3A 4M9UA 5C8YA 1RKUA 2VN8A 1OAKA 3EIEA 4MJLA 3HEMA 2VDLB 2OLEA 4LYDA 2V9ZA 1T5DX 2J4CA 5T6BA 4HS4A 3K9BA 2YWXA 2II6A 4KWCA 4HN9A 4IVNA 2JATA 3WV5A 5BNTA 5BYAA 3RWOA 4RDCA 4ENVA 1R5NA 1FW6A 2VLBA 3DVLA 2W43A 3EYWA 4P36A 1G3QA 1QGDA 3C24A 4YECA 4ND3A 1A9TA 5C3UA 1YS6A 5GM1A 2J46A 2Q3EA 4V0QA 1APBA 5K01A 1OT3A 4YI3A 1ZCFA 4NU6A 4ZYUA 3A0RB 2WT8A 4GWKA 2BMEA 5DT9A 3EK2A 4UXJA 3PC4A 4KAJA 2DM6A 3GJTA 2ISQA 2R96A 1XZJA 1UBHS 1EQ2A 1W73A 1JYSA 2ZT5A 3QU5A 4GMHA 4XUCA 4QLBA 3FHTA 5FWYB 3SQLA 2RGGA 2RHGB 3VU9B 2VWQA 3ZZMA 1X1SA 3QLEA 1AURA 3PUHA 3PTAA 3BB3A 3L1HA 4HQ6A 1GLGA 1MOPA 2NZ8A 2M1ZA 3H99A 4ROSA 4CEHA 4DAEA 4DR2B 1PGNA 3HCOA 1G19A 4AUNA 4N5HX 3B3AA 2PS9A 1I10A 1TU4A 3LC7O 4LNHA 1YS9A 3A3KA 3GHHA 5KJFA 4OX9Y 2HHLA 2PRKA 2WY2D 1ODTC 1O8CA 1Q1NA 3MMSA 5SZKB 4ARAA 4EJSC 3QEBZ 2ZDHA 2F1RA 4EVRA 4I99A 3R6TA 2ZJFA 4NMHA 3R0JA 1VIDA 5EXTA 4LF4B 3EWSA 3IP1A 1SXGA 1SC3A 4JJEA 3STUA 5JPDA 3PQFA 2XA1A 1RWQA 3N3BC 2C92A 1JB1A 1HR0B 3SHOA 1IZZA 1VJRA 2GLXA 4JSTA 3T1HB 4HWSA 5FFFA 2WSIA 3I04M 1E9DA 1KOFA 1V9CA 4C21A 1OMOA 3NETA 2IOFK 4TUYF 4MVJI 4V2UA 3VI4B 3ZWKA 5AVUA 2C84A 4FWIB 3BFVA 1AB5A 1BD3A 2GJSA 3WBBA 3EZ6A 2OEPA 4FR2A 2OC4A 3M5PA 5E9QA 3IFSA 5C5DA 4KPYA 1K5GA 3LLSA 3RM3A 4I7EA 1KFCB 1SY7A 4QG7A 1GAWA 3UB3A 2XZDA 3T7RA 4E5VA 3K0FB 3AI1A 1BZYA 1E1DA 2P2YA 1U0SY 1VRCA 4DJTA 1QANA 4OUKX 4M21A 2XNJA 3MIZA 4G26A 2JLQA 3F6PA 3VISA 1W9HA 3W8RA 4NESA 5GM2A 1O9HA 2B5OA 1Y5RA 1W30A 2AQKA 2O6LA 3IR7A 2YV2A 3RBVA 3M5CA 4AMVA 3ZY4A 1GRQA 1WRBA 1XAHA 2OQ2A 3I5MA 1PR4A 4OV6B 3BHMA 1P8AA 2H1CA 3B7GA 4HDAA 1OXBB 3MELA 3RT9A 2RHJA 3D3KA 4WY8A 4UVDA 1Z5ZA 1A82A 2BDEA 2GAOA 4WTOA 5I7VA 3U17A 2I7VA 1MPXA 1X7ZB 2PU5A 3GGJA 3QIAA 4ER3A 2I1LA 3T3PB 1OTHA 3QI2A 4X6YA 2Y6VA 1PD0A 2PG3A 3QX8A 4JQOA 4D9MA 1G21A 2ZIUB 1M5RA 4C89A 4O25A 3MWDB 1XJ0A 2MYPA 3BAFA 3O93A 4GFDA 4UEJA 5D3MA 3GD7A 4N54A 2A9VA 3K0AA 1FQOA 4JNKA 1A88A 4QXQA 4KREA 2ZUCA 3F6SA 3KSAC 1GA1A 3KT0A 5DBGA 1E8DA 2SICE 3HR7A 1RRFA 1EHYA 3ZLBA 3FFBA 1XELA 1ZSYA 3QV2A 3QTLA 3SOPA 1VXRA 3ELYA 1RWWA 3VJLA 2P5YA 4LY9A 1RFGE 2VIIA 2OHJA 3C45A 3K1AB 2XOXA 1DXQA 3EDQA 2Q07A 4MVJD 5ENDA 3RIYA 4ZKEA 4NC9A 4LVUA 5KTSA 2H1VA 4Q34A 1W76A 4UXHA 2JBWA 2X0JA 1AZSC 2VXYA 2ZWIA 3DDWA 3B1KA 4FYYA 4JB2A 1V35A 4LZLA 4RHUA 4ZO7A 1NFFA 4TTVA 3WLTA 3NDPA 1HNWB 3GJZA 4IWYA 4BFUA 2CEAA 4F4FA 5DYYA 2DT5A 4KC0A 1QZTA 2PZJA 4GT1A 5LOVB 2PUHA 2SECE 4FNOA 3EOBI 4H7FA 2EP8A 2MMGA 1B15A 2PUWA 2QD1A 2VDOB 4M86A 1QGED 1E6MA 1K6JA 2XHZA 4G1VA 4MQ5A 2B92A 4WDRA 5CX1B 1PJTA 4ZP1A 5EUCA 3EVGA 4MW5A 5FTMA 5J2TB 3PJGA 1E7YA 2I87A 2OR3A 1V95A 3DV0A 4DKXA 1Q0UA 1SKYB 2AKAB 2X4GA 5KC9A 2QQ5A 2FN8A 3NYWA 3K0CA 2C4MA 2D1QA 3NT4A 2ONYA 1TECE 3VR2A 1QQ6A 1SU4A 1EVQA 3L77A 2QNIA 4KQXA 4XVUA 4D80A 4P2BA 2VWGA 3UENA 5AESA 4X8MA 2BFWA 3CZCA 4JLDA 3W9SA 4EMUA 3BJMA 2NNWB 2ZAYA 1M34A 4RH3A 1U8FO 1P2DA 4BRWA 3QEOA 2EFGA 1ID8A 3DFIA 3F4KA 5BQFA 3R9XA 3EHEA 1C81A 5MN6A 2NT4A 1TM5E 1FNMA 4PLYA 3T1TA 3FNRA 1DX6A 3IIEA 5J2TF 1N57A 1X80A 4JITA 5J2UF 3UHJA 1G7TA 1H4TA 2O2GA 4QREA 4C4AA 3KKEA 1U3VA 4K1XA 1DJPA 1YVDA 2C9MA 2J5BA 3GEIA 4URVR 5JSUA 5K6RA 4AKEA 2AXEA 3DXYA 3ZD9A 1D4AA 1H93A 4LK2A 3VVLA 2PKQO 4C3ZA 4DLLA 3EA5A 3MEQA 2VBIA 4S0XA 4K3VA 1OBFO 4AZWA 3DZGA 2OZLB 1TA9A 4Z0HO 1DBWA 3K16A 2EFJA 2IK8A 1GZ6A 3HU1A 3E1GA 4S1VA 2VPXA 3HXPA 3S44A 3LE8A 1S6YA 4CF5A 4JVLA 3IV7A 4PZCA 1PG2A 4CM1A 1ZWLA 4LFCB 3QLVC 3L4BA 4ZHQA 5AM2A 5ALVA 5B6JA 1NYQA 2Q3BA 3MCTA 3RQSA 1EUZA 3R5JA 1I1HA 1EE9A 2GEFA 3IMFA 5JEEA 4PHCA 1ETUA 2WDPA 2HU5A 2H17A 3JZIA 1PT6A 2J0UA 2PPVA 5D87A 1KI1A 3RSGA 4IFEA 1WBDA 1GPAA 4MR7B 4EB3A 4EMBA 5DB4A 5BN4B 4EAQA 2C88A 4BECA 5AW4A 3DE2X 1SKUA 1XZIA 2CVHA 2VOEA 3KKPA 4G1MB 4H0NA 5CVJA 3OWXA 4RD2A 1NBOA 1O03A 4D6YA 2IOYA 4UU0A 1AU9A 2K7FA 3PI6A 3BD8A 4Z8XA 5A5VA 4AJ4A 1MF7A 2PO5A 3CE6A 1B1AA 4FYMA 4DV6B 2A5JA 1T26A 4JC4A 3TVDA 4M8LA 1UJ6A 1SM4A 1N5DA 4ARBA 1NR7A 3RS8A 3LSYA 1O08A 2YXEA 3GJ5A 3HNPA 3VKHA 3PA6A 4MRMB 3GU3A 3Q9NA 3I4CA 5LB2A 4ZODA 5IABA 1B8UA 3VO1A 1N3LA 4G5XA 3HVKA 2BMVA 1WA5A 2A3NA 2NYAA 3D3NA 4J4HA 2OYCA 2OCBA 4JUIA 3UFBA 2HJ9A 2WUFA 3FVQA 4GSLA 4F9TA 4PX9A 1P1CA 4ZJUA 5HA5A 4R4JA 4E2YA 1DWPA 1GAJA 4JCCA 1Q0LA 4A4DA 4OP2A 4EW3A 4PBRA 3A9CA 1P1KA 4PIVA 3HBAA 4OQZA 5DNEA 2Q41A 3Q5DA 5T4BA 3RODA 3WLQA 1OPXA 2A67A 3OO1A 2ZUTA 3ZWPA 4HUQB 5EE3A 1AH2A 5DTJA 3CJQA 5MN5A 1R0XA 3IELA 4ND7A 2GTHA 2YJZA 4ZOQI 3RSCA 4CKEA 2PRIA 4Q4JB 4X63A 3U1VA 2VPTA 3Q0TA 3WGHA 2IS6A 3UH0A 2AW3A 3PC8A 4MWGA 2ZE7A 2FSFA 4GMGA 5CBPB 2PYIA 5DBOA 4NQRA 5GPBA 3ZOZA 2D5CA 1PWEA 1GTJ1 4OL9A 4KXYA 1EAYA 3OZUA 5BQXA 4J0KA 3KVYA 3FY4A 4Q4JA 1XR3A 4TTSA 4QBTA 5BSEA 4UQPA 4DR6B 2FHSA 1KHTA 1NNI1 1X0XA 5JEDA 1P91A 1WQ4A 2ERCA 3E9MA 3I34X 1A2OA 4RO0A 1GUAA 3N74A 1Z06A 1TEVA 2VHUA 3CB4A 1L5WA 1XYVA 2B8JA 3RLFA 1XZMA 1NG9A 3SC3A 1SXJB 3IMCA 4IIJA 1KQFA 4O29A 5THQA 2Q2WA 1OLXA 1YACA 2HSGA 4JHLA 1VYHA 2Y27A 3WA6A 4O2AF 4KNVA 4YRAA 1JDPA 5EE9A 3CNHA 5JRJA 2RGAA 5F77A 1N5LA 2X77A 5HOQA 3TNFA 4BMCA 2C58A 2WYIA 3TTXA 3STHA 4BEJA 2V7GA 2R44A 1F17A 4ZT3A 5KQRA 3OQMA 2B4AA 5G1PA 1GYQA 2NZWA 3ET4A 4BYMA 2ECPA 5HGXA 1EA7A 4P0PB 5I9TA 5LB4A 4U5XA 2NWQA 3ZWBA 5KDOA 1MV5A 2FZWA 1USIA 3MLBA 3NC0C 3PD7A 2A9PA 1U8AA 2PS1A 3FLBA 1H8EA 3IJRA 5GP1A 4D9NA 1C41A 1Q19A 1W2WB 2WR8A 3PDIB 1UBEA 2O8DA 2FNAA 4MV7A 1EQUA 2XB4A 4DUGA 3GLTA 5FBQB 3U3OA 3I62A 4QSHA 4MZXA 3SSAA 3TB4A 4DJAA 5L6LB 1Z22A 2F3UA 4A15A 3HA2A 4QPNA 4BRUA 1GL3A 3VR6D 4ENWA 1JFFB 1HTTA 2DG2A 4R9SA 4Z4QA 2FR1A 3F73A 3DLBA 2JFYA 8MHTA 5G3ZA 1SQ0A 5JZSA 3UOGA 1FFXB 3E58A 4M0FA 4UNIA 2FMFA 4ZD6A 1YFLA 1VL1A 3DBOB 5KQSA 4CDGA 3IAM1 1LJ8A 1WSWA 4FIZA 4BV9A 2GI4A 3PT9A 2X5KO 4C4ZA 2F3PA 3ZV4A 4MKHA 4YBZA 3KV3O 3HXQA 4X7MA 4MR9A 1EUDA 4FYIA 4UEQA 3BSYA 3W2GA 1XRQA 1WXHA 3QXHA 3V1TC 5K0TA 1JDZA 3L06A 1O94A 1ZSNA 1OUMA 2PGDA 2TMGA 3W06A 1TO2E 1FW8A 3H75A 4HP8A 4LOJA 4TTPA 5AI9A 4YQYA 2O0KA 2GAFA 2J6IA 4IUBS 4BVGA 3DDSA 1SWWA 3EFBA 4U7WA 3OC0A 4MV5A 5BN4A 2B69A 2ZT7A 2BEVA 2ASEA 3HKCA 1RI3A 3SGLA 3WYDA 4C7BA 3I5YA 1M0WA 121PA 4KQ6A 4HDRB 1YUBA 3QYFA 4N3AA 4XGQA 3SYMA 4CR7A 3IEIA 4D2IA 2EXXA 1F06A 3LVRE 2UZ0A 4B2IA 1OZFA 1QV7A 2KBFA 3PHJA 3AUYA 5EIBC 2BZ1A 2Y1XA 4BGIA 1LDBA 2Q1WA 5BURA 4G2TA 1MDBA 4L16A 4ZHQB 3E7WA 3JVIA 4YR7A 2HTFA 4IPTA 2JGDB 1KAGA 5FPHA 3FUVA 1KGDA 3A3OA 4M1ZA 2D1YA 4NEHB 5AOAA 1Y1QA 1GGEA 1DEAA 1X7XB 2IYPA 4N5LA 4NARA 5BYKA 1RLUA 4JENA 3EPPA 3EF1A 4EB6A 2H59A 4TL6A 2A7QA 2G1JA 5IPFA 1R0RE 3ZW9A 4PC3A 4NSNA 2DFTA 3AC0A 3LNTA 4B35A 4JC5A 2HF9A 3K71B 3T7IA 3NC4A 4NFYA 3G2IA 3JWEA 5ELLA 2X6QA 1U2RA 2EKBA 3A27A 5K8VA 4JJ8A 5K0LA 4NE2A 2ZBRA 4CUZA 1CETA 6GPBA 1KZ4A 2Z30A 2REXB 3M4XA 4EPXA 2ACKA 3FFXA 3P97A 2A92A 4QD3A 3N28A 2Y71A 1FJ2A 5KVAA 2XGOA 3KEMA 3V2HA 1AS3A 1DAMA 2NADA 4QHSA 2C5LA 2O7NA 1RWVA 1GGHA 3BIOA 1IHYA 2CUNA 2D2EA 3B70A 3JWPA 1AUOA 4TKLA 1QPBA 1XZHA 3M6AA 2XQVA 3Q2OA 2NXCA 3ADOA 5H4HA 1E9AA 1DAPA 1QZUA 2KX7A 5DCYA 3QX7A 4JJGA 5BOVA 1FVHA 3C5VA 3CRZA 4K87A 3PXGA 4YV0A 2CV1A 2KHZA 4O4IB 3LTEA 3GJ6A 1CDZA 1Y6JA 1L7AA 3A9SA 1J5PA 4BKRA 1A9ZA 4QDKA 5JCJA 1XDWA 1ZLYA 4OKSA 4BO4A 3LQFA 1I2DA 2A9FA 1CQPA 3H5OA 1RWNA 2XUQA 4GM1A 4EQ6B 2AG1A 1VJDA 4FCCA 1USGA 2WYVA 2OP1A 5CT9A 2FEMA 2OO3A 4GMDA 4Y7CA 5HBRA 3L7AA 2IHTA 1JNYA 5L3QA 5A0VA 1HT1E 1IONA 1K8QA 2XT9A 2B94A 4X9XA 3RGWS 3FTCA 3M8KA 5IKMA 3KTAA 4GZ3A 1KJNA 4CN9A 3QVOA 1UM8A 1WZIA 2BZGA 3O7WA 4GLLA 4W99A 3X1ZA 2FPKA 3FNEA 3IQIX 5ELMA 3LHFA 4Q15A 4B44A 4E09A 1TUEA 1Q15A 3NCHA 3RHFA 2A5LA 1GFZA 2AE1A 5EQDA 4ZAXA 3V8BA 4BYGA 1CSEE 4OXNA 4BTEA 4YQZA 4AY3A 4CCYA 4L4RA 4IKEA 3RS4A 4DZTA 1G0NA 1AZWA 1FYVA 2PCJA 3RRZA 3QHQA 4EI7A 2DERA 1SIOA 2RBKA 2XUIA 1QHNA 2XDAA 3TSOA 3D2BA 4FJ0A 3H2SA 1XPJA 3H6HA 1GCGA 2FSVC 4MW7A 1XJWA 3G59A 4XYEA 5ETJA 4DA0A 1AJEA 1H2EA 3T0FA 5BR4A 1QG2A 4ZVLA 1QK5A 1TC1A 1CLEA 3PPYA 2IX3A 3PFNA 2X0EA 1KAOA 5A7FA 4RNCA 3MRVA 4NABA 4IIJB 4NJOA 4N39A 1M74A 1AO3A 3ETGA 1RAEA 2W6IA 1GL9B 4DPLA 4EG5A 4GI3A 3W9BA 2ZVQX 5EUBA 1OZHA 2D0IA 5C34B 2IZ0A 2ENUA 3AY6A 1KTVA 3BF7A 2I7DA 4GC5A 5CTAA 3ZUGA 2EDCA 3ZTTA 4F2DA 3PUIA 8OHMA 3TECE 1PWHA 1PQYA 3AV3A 3EDRA 3EDCA 4BJ6A 4U6QA 2QYHA 1MIHA 1LNZA 4I14A 5JY1A 1BFUA 3PGVA 2WDZA 2PX8A 5K05A 3V7NA 1Y6ZA 3GCWA 4Q00A 1NIJA <