2QL7A

Crystal structure of caspase-7 with inhibitor ac-iepd-cho
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ql7A00
4FDLA 1K86A 1CVRA 2C2ZA 4PRZA 5IC4A 2H4WA 2QL7A 4QUBA 4FGUA 2C2MA 2QLBA 5IAKA 4AW9A 3BIJA 4FEAA 4AWBA 1GFWA 2J30A 2Y1LA 4QUHA 2C2OA 2HBZA 1RHUA 2P2CA 3EDQA 1RWMA 3KJFA 3QNWA 4NOJA 5LU9A 3IBCA 4NOKA 3EDRA 4QU9A 4JQYA 3PCXA 1RHQA 4ZVQA 1BMQA 2C1EA 3D6FA 1M72A 3V55A 4N6OA 2H54A 4D3XA 3D6MA 4PS0A 4QULA 2CDRA 1F9EA 3SIRA 4QTYA 1QX3A 4QU0A 2J32A 4ZVSA 1RWOA 1RWNA 3R7NA 3H13A 5IBPA 3R6LA 4I1PA 1RHRA 2XYPA 4QU5A 4NOLA 1I51A 1SC3A 1PAUA 1I4OA 1RWKA 2H5IA 3H11A 4JR0A 5LUAA 4JJEA 4EHNA 2HBQA 2XZTA 3V4LA 2H65A 1NMEA 5IBRA 5I9BA 4N6GA 4JJ8A 3GJRA 5IARA 3IBFA 1RWWA 3NR2A 4LSZA 3DEJA 2K7ZA 1K88A 4HQRA 4ZVTA 2Y0BA 3R7BA 5IABA 1RWVA 4ZVUA 3RJMA 2CNNA 1RE1A 4PRYA 1SHLA 4NBKA 4D3ZA 3DEHA 1KMCA 3P4UA 5IAJA 5LUBA 1F1JA 4N6NA 4D3YA 2XYHA 4EJFA 4QUIA 4JB8A 4NOMA 3V3KA 3KJQA 4I1RA 2FP3A 1NMSA 2H5JA 2AR9A 1RHKA 4EHAA 1GQFA 2CNOA 3K7EA 3H0EA 3R6GA 5IAGA 4HVAA 4EHFA 2WDPA 4JR2A 4AWAA 3GJQA 2J31A 4N7MA 1QDUA 2H48A 3NKFA 5I9TA 4EHDA 3SIPA 3S8EA 4NBNA 1RHMA 2NN3C 5IC6A 2HBYA 1SC4A 2XZDA 3H11B 4IEFB 4JJ7A 4JQZA 4PS1A 4EHKA 4JR1A 4NBLA 5LU8A 3V4OA 1RWPA 4ZVOA 3V6MA 4EHHA 2C2KA 4HQ0A 2QL9A 3R5KA 4EHLA 5IBCA 4DCOA 4N7JA 2CNLA 3ITNA 1IBCA 2QLFA 4QU8A 5H0IA 2CJXA 3DEKA 2H51A 4QUDA 4QTXA 1ICEA 1JXQA 3H1PA 4FXOA 3S70A 1NW9B 1PYOA 3D6HA 4QUJA 3NS7A 5IASA 2FUNB 3V6LA 2CJYA 4QUEA 4DCJA 2CNKA 2J33A 1RHJA 2DKOA 1CP3A 5IANA 2QLJA 2HBRA 3R7SA 2XYGA 3GJSA 4ZVRA 4ZVPA 3UO8B 4DCPA 1SHJA 3R5JA 3KJNA 4N5DA 1QTNA 2QL5A 4M9RA 1RWXA 3GJTA 1SC1A 3P45A 3PD0A 4IYRA 1NMQA 2H4YA 3DEIA 3UOAB 5K20A 1I4EB 5IAEA 3E4CA 2FQQA 1I3OA 3PD1A 4QUAA 5JFTA 3OD5A 4QUGA
chains in the Genus database with same CATH superfamily
2JVJA 4D9MA 1JHYA 5ALTA 3HXKA 3H05A 4QA9A 3FDZA 2ZRGA 3EVFA 4KBGA 2MWMA 4E5UA 1L4HA 2DPYA 3L4BA 2YN2A 1X74A 3GLFB 4MDEA 1Z13A 3DVAB 4M86A 3RT1A 2CBXA 4O4IA 4DUGA 5L9AA 3AXTA 3RAEC 4GC5A 1RQPA 1Y7HA 4R9UC 4ZVMA 2PZAA 1N8KA 3DE1X 2JPDA 2YXEA 3I73A 3M49A 1WPQA 2CCJA 2JATA 1RHUA 1CF9A 2XXJA 3CM0A 3N6XA 3NIFB 2EFYA 3F7MA 3Q1KA 4GOLD 2OHOA 3O4GA 3DTVB 5DTEA 3WNDA 4E6PA 1W0CA 1F5SA 1KI6A 2GHRA 1OROA 1R6AA 1DRWA 2MSNA 4KACA 4XRGA 3FDFA 2GILA 4Q16A 3IEMA 1FVOA 5E8RA 1P2SA 3EXHB 1DU4A 2Y1XA 4QPCA 5IUKC 5CT4A 3KLMX 3P5BA 5CLLA 2AG6A 2ILTA 1SB9A 2XIQA 4RKRA 3U4HA 2D0IA 3I8XA 2IBMA 2CLDX 3DYBA 1SQ6A 1U2QA 5FCDA 1KRXA 5COBA 1Q2XA 4H7JA 5BN4B 3EZ6A 1QF9A 3FRIA 3ZHOA 1UBRS 3FLEA 1NXQA 4PZZA 1SC3A 3RUPA 4IJQA 2QZJA 4XIGS 2AFHB 3GFQA 4ZCRA 1JJ7A 5LQUA 3JARB 3NYIA 2P91A 2D7DA 1J24A 2BCGY 4QWWA 5FR2A 2R1VB 2ZQYA 1M2OB 3QE2A 2OAEA 1JR3D 4FYKA 4BTEA 4MA0A 4CR7A 4MR9B 1M7HA 4BO6A 1BG6A 1FU4A 3E8XA 3K5HA 4PGFA 5I4KA 3TD9A 5EP4A 1E18A 1A5BB 2N9UA 4X90A 5K3CA 4WZAB 1E6KA 5BNZA 4M1TA 3CR3C 3ISTA 5E2AA 2MTBA 3WISA 4BKQA 1E5TA 3HO6A 3B1FA 4C20A 1E64A 1SVOA 2BHNA 4CV3A 5KTYA 2BBSA 3L49A 5LMZA 4L1KA 1C81A 5FHQA 5AVKA 4FU0A 1T36A 4U0KA 2ZE5A 4B6OA 2QTVB 3ZQUA 1JIKA 2D5LA 4OMCA 2DMRA 2RI1A 2HSZA 4QLOA 2QAGC 1JFTA 5ITVA 4HMQA 4PWZA 1EFRA 3LY7A 3L79A 4J29A 4WNAA 4AUKA 2EW8A 3EG5A 2LWIA 3UCFA 2ERCA 2NWQA 1JG2A 5IZ4A 3EA0A 1RZRD 2AJBA 2Z8XA 3KVRA 1D2GA 5AI4A 1GAQA 3R5SA 2IZ7A 3AONB 3CPSA 4FBLA 3PFHA 1QGED 5ER9A 3PPVA 3TEJA 5EJIA 1FP6A 2BLNA 3SK0A 1YRHA 5KKAA 2C2GA 2E2WA 4QYIB 2CXUA 1YK1A 3BE4A 3ZY3A 1PYOA 5A5GA 3EPHA 2F00A 4BQIA 3SAJA 1ATZA 1NZJA 2ZIWB 3T54A 3WNVA 2O6HA 4PLHA 3LUFA 4ZU3A 1DQRA 5HS6A 3ZQ6A 3CW9A 1KI2A 2OZLA 2C58A 3KE9A 3KP1A 4POOA 5FWXB 2NU8A 3MSCA 3GP8A 1WHTA 1QRDA 5CFMA 2BL4A 3HN2A 4QEKA 4M9SA 4GI7A 4Q9IA 3DUFA 4L3VA 3RSZA 3HVIA 3RS0A 1JVNA 3N74A 1N3LA 2IF2A 1WSWA 2HIMA 2WU3A 1ND5A 3UTCA 3ZEAA 2NXJA 4JX9A 1NLZA 1JWAB 3DT8A 1W2HA 3DV9A 3H87A 2ZBFA 1UBEA 3BEDA 3NRCA 3BQMB 1E8NA 1LA2A 1TUGA 3KHTA 2VXYA 3PFGA 2E4UA 4GMXA 5BUCA 1QRTA 3BKWA 3KPUA 3QEMA 5A4MS 1T1EA 5T5QA 2QSYA 3Q5EA 1ULSA 1F60A 4RK6A 3G8DA 1NYQA 1PJ4A 1G5HA 1TNDA 2VYND 3AM4A 4IO1A 1P6XA 3IV7A 4TM8A 2C54A 2AKEA 1YOBA 3C1AA 4O3FA 4R1SA 1V4VA 3BFKA 3QXJA 1SCDA 2AUNA 2VT7A 1KFKB 2ZCVA 3BK7A 3P9ZA 4MDYA 1OWMA 4FEAA 4EF6A 1GFWA 5IFLA 5BSRA 4OHXA 3SQNA 4W1RA 3W2HA 4BRZA 4F3YA 2ZJFA 1K27A 3FRJA 2WWVD 1XDWA 3TD6A 5IJ9B 3PWZA 1QG0A 2OXTA 5FYQA 1P60A 4FEGA 4EBFA 1KZYC 4WDRA 2VP5A 4WLEA 1P19A 1TCUA 3KKLA 3EFOB 4XCVA 4UJ5A 3NTUA 4RFSB 1E1RD 4FWTA 4AY5A 1F9EA 3IJ5A 2UXBB 2QY9A 3DWIA 1HEYA 4KPEC 3DBHB 2YJGA 5DNUA 4LE2A 3CCFA 1CZKA 5KIAA 1OGYA 5IHXA 2PD3A 3UIEA 4LRYA 4RK4A 1AN0A 3DMYA 5JRZA 3D0RA 2VTBB 3WYNA 1W4BA 3KOMA 2J6CA 3TEMA 3WWEA 3DE5X 3W04A 5HBGA 1TECE 2ORED 1AMNA 1W7AA 2RHBA 4ZRNA 3DAHA 3AFGA 4A23A 3JZIA 2DXIA 3M5PA 2G17A 4UCFA 5DEOA 4DSTA 1FMTA 4LMAA 2RGUA 3PWSA 4J6EA 4OHCA 4PSAA 4DV4B 1PJCA 1SULA 1ZOSA 4PLPA 4X91A 5AKEA 1U7PA 5CA0B 1PHPA 1BHQ1 1Y8RA 1A27A 3O4VA 1QOPB 2GGSA 2ZI6A 2IYNA 1KJZA 3DBRA 4UVIA 4BRSA 4GYWA 1T6BY 1NW7A 2ZWPA 5EHXA 4BY9E 3UV3A 4KIUA 1BE8A 1K3TA 3MTJA 3NHPA 2VUSA 2A86A 2HU5A 2PZGA 3PI7A 5DN6A 5KAMA 3STUA 4KR6A 3NHSA 4A10A 1UL1X 2JLCA 1FDUA 3KB6A 2JL1A 4FILA 4MLZA 5T67A 5FH9A 1YO6A 2DWPA 4KMSA 2WF8A 2IXAA 1DP4A 3FOCA 4HS4A 2ZT8A 4PONA 2EFHB 1JVBA 1PR6A 2F6RA 2RGWA 4IEFB 2R6R1 4LBWA 4J76A 3GRAA 5CR9A 4JT2A 1AGNA 1TQ6A 3VJMA 1IK4A 3LV8A 3HABA 4ZODA 2N1MA 3OQOA 1G4AE 1LLUA 2WW8A 4OGKA 4WEOA 1YDHA 1HDRA 2BHTA 3OCYA 4XIFA 2JI7A 4F91B 2OBLA 2OCYC 5TR9A 3D7SA 4JJ4A 1RXWA 3EQ6A 9LDTA 5B64A 3HLYA 5ICSA 4E11A 1HRDA 1ZO8A 3AXSA 5ENVA 2PZ8A 2H1FA 2VJYA 2CDNA 2O7VA 4IFBA 5KDOA 1KL7A 3WL7A 1KXZA 5KKCA 1LD3A 1VM6A 3PNVA 1ZH4A 2PUEA 1MVNA 3MF4A 4TPKA 4JLPA 1EWVA 2Z0MA 1N1DA 4HN4B 3WICA 4AP9A 2XBMA 5KREA 1NAHA 3BMNA 1BTOA 2XQKA 2F9FA 3TPFA 3OMWA 4EFKA 1Z2CA 1L8LA 4YJGB 2XNDD 4LXTA 3ANSA 1XCJA 2A33A 3K0CC 2GN9A 4GPBA 2CUKA 2VK4A 4MRVA 1UJ4A 5F5XA 4EP1A 3I62A 5M34A 1DJMA 3I58A 1OX4B 1N1EA 3E4CA 1CF2O 3TMAA 4JXXA 3THYA 2AMJA 3WJ2A 3F6YA 4V38A 2PDAA 3BIXA 4YGYA 5JSZA 3JALB 2PUCA 5LLTA 4ZQIA 4BNFA 3V46A 1XEWX 4E5KA 1U8TA 5KQMA 1UM8A 3WYEA 4FGWA 4OUKX 1XELA 5L51A 3KV1A 1PO7A 4RADA 2WA1A 4M7PA 3DLIA 3LWZA 1OKKA 4BX3A 5FBWB 4IFTA 4Z4HA 4JJKA 1YS6A 1V3TA 1V41E 2Z3WA 4HZUA 4BV2A 4F6RB 3KSAC 1QP0A 3RUCA 4CV1A 3CB2A 1E2EA 5EXPA 1GL6A 1N0UA 2HPAA 4O4HB 3C5CA 3GT3A 4RVDA 5EP2A 3S1SA 4D56A 1VIMA 1BMQA 1ZJWA 1N2CA 2P69A 1H9AA 4PWYA 4UTVA 4B81A 1UAYA 3CINA 1QWOA 3Q2OA 1L4EA 1NN1A 5IZCA 1FC0A 1PEDA 2DSTA 2QX8A 3D3JA 3HO8A 3W0LB 1RXSA 3LT4A 3UCXA 4ZFNA 4GPD1 2P9BA 2OL4A 4JA0A 4LQ4A 1XV5A 1FMFA 5B1EA 5DCUA 1OLSB 1FUKA 1X2EA 3QFFA 1RFGE 1UKAA 2GBIA 2H1RA 4S1NA 5A4IS 2J07A 4BNYA 4FFMA 4CM1A 2F64A 2JIPA 2Z6VA 3IJEB 3ZGNA 4EUKA 1PV2A 1QS0A 2HK7A 1FLDA 2J41A 3LUAA 5FI1B 3LHFA 3AYXB 4JELA 1J8MF 2ECPA 2PVCA 1TMGE 3OIGA 1X7YB 3UPDA 4DXDA 2QVGA 3NIDB 2C0QA 4D3YA 3U1TA 4R0MA 4M7OA 2ATEA 1N1MA 1VE3A 3MNFA 5TMDA 4QUIA 2Z3VA 4HNGA 2Z09A 1EX7A 4CEJA 1E3JA 4IMJB 3HEAA 2E4ZA 5AW5A 3QA3E 3GPLA 4DV1B 1R9NA 5CNJA 3W5CA 2FWMX 1MXHA 1ZLXA 2WFZA 1E0AA 2VAWA 4BPRA 1SK9A 1FSZA 4MUIA 3PB3A 1PYDA 4HRXA 5HE8A 4MS1A 1PJ8A 4AWAA 3GEBA 5DBGA 4ZYVA 5MHTA 3S2IA 1CZUA 4RUKA 1C3XA 2ROQA 1RM3A 2VDKB 3D64A 4II3A 2WI8A 4PAWA 3NWPA 2Q4BA 4HS9A 1V6CA 3INGA 4CUKA 2J0QA 4BC1A 3TVYA 1ZN7A 2KJQA 1JIQA 1CHDA 1LBQA 1GSHA 5FPQA 1TAQA 4A0RA 4E31A 1X1DA 4KYTA 3SYLA 3V97A 1NJFA 4YCCA 2BR5A 3MINA 4I5DA 3ZV4A 4IRUB 4UVDA 4KQ1A 2CE7A 5F21A 1R0SA 2WTAA 4DCJA 1WLSA 1UT6A 3WAKA 1ZC3A 2GJ8A 3WQHA 3G6KA 4H7HA 3W4KA 4LHVA 4L8YA 3K1AB 3GLHE 4AUNA 2GF9A 1QG4A 5JAZA 4UFPA 1XDDA 2IITA 3RWMB 4EKGA 5C52B 1ZN9A 1ES9A 2WYIA 4MVJF 4BV8A 2H92A 3GA7A 1NVTA 2AJ8A 1KJ8A 1ZMTA 1P6UA 1E59A 2BBOA 2DKFA 1ENZA 2JLAA 3DOJA 3H2SA 5GJVC 1VHTA 5HTKA 3ZD9A 4TVKA 5IVPA 2ODWA 4OXYA 5IULC 3EG9A 4CMAA 5KINB 3G6WA 3L7KA 2OB2A 1MV5A 1ONBA 4NU0A 2VPTA 1R4NA 4XWGA 1B8VA 1S6YA 2QRGA 3JQFA 3VDXA 4E32A 3HCCA 3A31A 1M5UA 2OZEA 2WMDA 1YRYE 1SAYA 5A5EA 3CRZA 5LZ7A 4QFCA 4GSLA 5AR1A 5IEBA 4FNGA 5FTLA 4ZIRB 2GNPA 3D6AA 2ZBGA 3L04A 4LZNA 3LX6A 4MNTA 4ER3A 5J59A 3WNBA 1CEYA 5JSHA 4DLVA 2V6JA 4UARA 4WZZA 4JB3A 5F2NA 3FLMA 2YWDA 3H5IA 1Q7EA 2YJ6A 1L5LA 4JROA 2QRLA 5DX8A 4N6OA 2YVQA 4NBRA 1XG5A 1XAIA 2J4DA 1UBMS 4HXGA 5F52A 1D8TA 2QTAA 4CIWA 2AN9A 3M89A 2ARKA 2YYAA 4E1BA 1Y4AE 2RGNC 4K9DA 1TAGA 2ZCJA 2R7AA 3ENQA 3TOSA 1U8FO 4OATA 3WLHA 3NTLA 1PL7A 3I9OA 4GM0A 2O19A 2JH8A 1YACA 3AEKA 3K0BA 4R7ZA 3GEEA 3DZKA 3R7WB 4A0QA 4C03A 621PA 4R2IA 5KYYA 1J1UA 1R8XA 2PUBA 3A58B 4XJXA 1ZNYA 4CG1A 3CQ9A 4LRWA 5AW0A 1ISSA 1NMXA 2A94A 1XZGA 3D02A 1IN7A 3L8GA 1UFKA 1ZHFA 3WRYC 2QJFA 4U6QA 3EBOA 2WHXA 1WXDA 1LPAB 2PO7A 3Q3HA 1EG7A 3QP9A 1L5RA 1EX6A 3JQBC 2VSNA 4WKPA 4ZO8A 4GPAA 4C4SA 1C4XA 3KZMA 2DFNA 1XA3A 1GITA 2Q46A 4OXQA 1NG9A 4Q24A 2FFAA 1AHPA 3HKBB 1R3DA 1GGJA 1E6CA 3T94A 3SDZA 1U94A 3JQAD 4O6VA 4O8CA 4QREA 1M6VB 3RREA 2YWFA 1M2HA 1VKNA 3RBZA 1ZD3A 2JANA 3AEXA 3FCCA 5G0TA 4DBZA 1AZSC 2PXAA 4KAJA 1QB7A 2AQHA 3D7KA 1V95A 1GZHB 5KOYA 2FMHA 1E2IA 3GRCA 1VPDA 1PLLA 3K9GA 1BHJA 4Q4JB 2CL0X 2INGX 2WICA 4D4HA 1UADA 3T95A 5LYJB 2BEVA 1MX1A 1NBHA 3FROA 2GXQA 1UIMA 2V8OA 3GQBA 3PDIA 1KFEB 1NUAA 4OB7A 5H9VA 1RJDA 5AVVA 2M2IA 4TN1A 4P8RA 3L0YA 2JGLA 3K35A 4YMSA 4YCBA 2BFCA 4LOIA 4MV6A 4P54A 2Q7OE 2HBRA 4CU5A 2EQ5A 4B87A 4ZVRA 1NR1A 2X7XA 4DCPA 3IV6A 5D01A 1U0HC 3R5JA 1H2FA 4XPIB 3SJBA 3VI3B 3H1TA 4RD2A 1DFIA 3GJ5A 3HCOA 3LJKA 4IIXA 2OA0A 3WBKA 1CDDA 3AVVA 4KV9A 3IUQA 5JBIA 2HR1A 1RLIA 1YCDA 4BVLA 4ZOCA 5FOSA 3BTUA 1Y5NA 1I6WA 2QM8A 3FPFA 4JP5A 2W2KB 1M1YB 3ETCA 1T3HA 1KO1A 1Z8FA 4B79A 4DYHA 2AUTA 1S0UA 3AGQA 2J59A 2P79A 2VDWB 3BHMA 3M5DA 3QYFA 4NJOA 4DW8A 1US8A 4MWOA 4R9RA 3T06B 4C30A 3RS9A 2I03A 2QRVA 1U2GA 2VNKA 2WHRA 1QR6A 5AKYA 5JNVA 4JQSA 1PJRA 3WMGA 4CCSA 3AP1A 3GLGB 2IY9A 1R15A 3VC2A 1EFPB 1P5FA 2J7KA 1KXJA 2GKGA 2R96A 2DLNA 3QE0A 2OFOA 2RAPA 3KJFA 3HH8A 3L82B 4HDNA 4K46A 2H4FA 3DBVO 5TEVA 3WRXC 4BO4A 1TTTA 3UAYA 3ZX4A 1XZMA 1C7QA 1RYDA 1FNBA 4UDOA 1II0A 1LDGA 3BG5A 4JCOA 5DSXA 1WKCA 3C3DA 1A9PA 1P6QA 1T0JB 4ZHQF 5EJ9A 1OHHD 3JQ8B 4KN5A 3RS5A 3TPCA 1EDDA 1T8TA 2IU4A 2WD9A 3AC0A 3G2MA 3IAS1 4XSVA 4E51A 2IEDA 1GL3A 1Q77A 2LTAA 1HT1E 3HCWA 2HJWA 4FMDF 1SU8A 1Z28A 3UV7A 3DEZA 3N3BC 3G9QA 1QTQA 2ZBEA 2H9IA 4AKTA 1KS9A 1K63A 3FIUA 1MW9X 3NHBA 2AQ8A 4JN6B 3TR5A 4F0JA 1NOJA 1PWEA 1JX6A 3N3AC 3GBVA 2PRSA 3QA9A 1YA4A 4GBGA 4O4LF 4HX5A 5P21A 4N6GA 2WWHA 5L7TA 4PFKA 3ZI0A 3HK2A 2G9ZA 3CJQA 3GH1A 3L0OA 4XIYA 4X62B 4IG4A 5IABA 5A7HA 4UDYX 3PF9A 1T10A 1W2WB 4CM3A 2B0CA 5DBEX 5IDXA 2FG7C 2JFPA 821PA 2ZJ6A 1MH1A 1NJ6A 2FN4A 3O3CA 1ZAYA 3H2JA 3ODGA 2PQ6A 4KYIB 5ALKA 4EA7A 3U1BA 3ETHA 4AYTA 4FDUA 4J4BA 1SIOA 1UP7A 1Z2DA 4L0CA 3N2GB 1N9GB 2SECE 4HLUA 4AZWA 3ASUA 1PYGA 1RJ9A 3P4XA 2ZJBA 4LJSA 5CK4A 4AO8A 3PFKA 1WUYA 3MYYA 3O38A 3Q6MA 2D0PB 4RJ2A 5IAGA 1FLNA 3EF0A 3HR7A 2HLPA 3ZDEA 2V97A 5AI6A 2V3CC 1QB8A 2RGYA 3O75A 1MAVA 5EGNA 5FL3A 5HTOA 3W2TA 2R6JA 2OBYA 2ECFA 1MHPA 3CS3A 5JJLA 2RHHA 5K0EA 4BMNA 4LHSA 4QLBA 1VQ1A 4KRYA 3UMMA 2ZIFA 2R5FA 3S2EA 4AZ0B 5L53A 2AI3A 1OT5A 1NBOA 1S3IA 1UOOA 3MJRA 2FE1A 4GOND 1VA5A 4MQFA 4FZJA 3OP1A 2OHFA 1GQQA 4Q4CA 1FE8A 5KOJB 1IYZA 2IPAB 5BWBA 5BOVA 5GV8A 1NVEA 2OGZA 1G5FA 2PT6A 2UZ3A 4MV0A 1XTRA 1FB5A 2YN0A 1O89A 4V0KA 3REQB 2QM0A 3VNUA 1R12A 4CDNA 4ENWA 1ZIYA 3I92A 3ISVA 3QUCA 2ZSEA 4L3WA 5A3VA 1KQ3A 4DSUA 2J33A 1B41A 3PNPA 4M8SA 2BGRA 4P84A 5EXSA 2EOAA 1DIHA 1KC3A 2G9NA 2CMDA 1YMVA 2OQIA 5D3KA 3A1VA 3H19A 3W1VA 1DBRA 3A1FA 4DWJA 4IIJF 5IC5A 8ABPA 1SBYA 3ZXUB 2FW0A 1PK9A 5B7QA 3ED5A 3H6GA 4DM4A 3PD0A 3ZZMA 1PN3A 4JX8A 1YVUA 1T2UA 1BFDA 1OX5A 3BFVA 4RE5A 3R9WA 3TUIC 3AHDA 4JWTA 2X8JB 1ZBDA 5CCBA 1X15A 1QCCA 5LMCA 1C4KA 4LJ5A 5AJUA 3T3NA 4NJEA 5DZSA 3RFTA 3HJBA 4RGQA 4WZBB 4KX5A 3D3EA 3BUSA 1QVZA 1I2BA 5LR6A 3MEQA 4YRTA 2Q0XA 4ALMA 5B3JA 5LXTA 2XNSA 3IXQA 1D4AA 4GZMA 2QZZA 2VATA 4LWPA 4OQFA 4D9IA 2UYCA 1Z2NX 5K4HA 2NX2A 2JIDA 1RAIA 5C1IA 1Z62A 3C74A 4L2IB 4X64B 1XKQA 1J00A 1MORA 3C7CB 1KSHA 4QSMA 5KSWB 1SC6A 3K9FC 3L43A 4UTPA 4R3NA 4YMTA 1NW3A 2YHSA 4NNPA 3PV0A 1H2EA 2BPOA 3D6TB 3QTLA 4JNCA 5LA6B 3SC4A 3AEQB 3WP0A 2IDJA 4M9XA 4R1LA 4REQB 5HBRA 1EFLA 4P7FA 3VR6A 4WAUA 3WKAA 5KVSA 5DTMA 1FW8A 4UBKA 5KYNA 2QN3A 4B8WA 4RTSA 4JLWA 1UXJA 2PZBA 3X1JA 4DE5A 2L2QA 3DHEA 2VRCA 1KERA 2ZDHA 1CQPA 4H1WA 5ALGA 4RTKA 3OUZA 2D4HA 3T7IA 2FQYA 1GDHA 4Y2QA 1BDHA 4ZAYA 1SH7A 4MW0A 3MHPA 4PC2A 2VZEA 5IBRA 1UXOA 5AIAA 3D8BA 4UW9A 1CVLA 3CJTA 3SJAA 3R5FA 1OREA 3KLOA 4BBPA 1P5JA 1U3GA 3R6DA 4WGFA 2BONA 2ZYWX 3IR6A 5EE3A 5FAXA 3DNMA 3IYLW 4RS4A 4YRIA 3NALA 1OH6A 2Z6UA 1G19A 4IY1A 1JTVA 1RVV1 2C7GA 3B5JA 1O5TA 1E8MA 4L16A 1SOAA 1MJGA 4CYMA 2P9JA 2YY7A 3EJ6A 2CHGA 2BFPA 1NMSA 1G7TA 2PSJA 2UVPA 3KEOA 1QG2A 4P36A 2ZSFA 1VG8A 3D43A 3ANYB 3DJYA 3L84A 1CLUA 4OHFA 1Y6ZA 3PE3A 1Y89A 2B20A 2B83A 1VE5A 5G41A 3CLSC 1ZH2A 3OEWA 2OSBA 4G1MB 4PHTA 4BN4A 1E9EA 1TJPB 5CLFA 2G1PA 1Q22A 3AT1A 3NBZC 3AUXA 4J43A 4V2UA 3KKMA 3ADPA 4LZJA 2QRNA 4JV5B 4TLBA 1PSDA 4GDFA 2ZRAA 5DYGA 2IYPA 4MPTA 2JGKA 6REQA 4KN6A 3HFJA 1YHZA 3IKLA 1I2ZA 1SUWA 3WB0A 5K0BA 4C2UA 1WV1A 1TM3E 4IXNA 1FMCA 1M8JA 3RASA 1LTKA 1EE9A 3OHMA 2R00C 5GIOE 1ISMA 1JT9A 3UUWA 4DIBA 1H0KA 2RI0A 3PK0A 4G9GA 4NMWA 5D5PA 2X1HA 2XW6A 3OM1A 2DF8A 2VCYA 4Y8VA 2CWDA 1SUBA 3T4UA 4J2OA 3VISA 3C24A 2XYGA 2BSAA 4ZT3A 1G5QA 2XB6A 3KAPA 4EJSA 4PN7A 2PCLA 3U2QA 4CMGA 1QGUA 3TLEA 3WQRA 1S1CA 2I8CA 2I54A 4RHXA 3LOQA 1SMKA 3DW3X 4S24A 2AF4C 3IAHA 4I9FA 2OEPA 2DB3A 2IX3A 3IAAA 4BMVA 1CUZA 1DC3A 2V5VA 3MLAA 4G07A 5FTWA 1QHFA 2ZVJA 3PFBA 1RI1A 1D2MA 3O2SB 3QUSA 4Q7KA 1DBQA 2LP4Y 2ZK7A 5LZ9A 4F2WA 4D9FA 5LOVF 3EXIB 5JFTA 5DXFA 1L9KA 3CMCO 1KSJA 3EXEB 1U1DA 4N65A 3C3BA 3JQQA 4PLCA 2RHLA 2AXEA 4V0NA 2AXPA 4S3MA 1C3OA 2I22A 4AW9A 3AJ9A 3F9IA 4E70A 1TYDE 2WWFA 3CSSA 4B43A 2CL5A 4MRAA 5AVWA 2G40A 3HCBA 4DGSA 4RPLA 2OBBA 3A25A 1RT9A 5I9IA 3OMXA 2IYSA 5I8ZA 4MLCA 3ZHYA 2G1KA 4IHJB 1TUEA 2XUFA 3G0DA 4ZGBA 5HQ3A 1T9ZA 2NUPA 2V9PA 5JXJA 3P19A 1KH2A 1MJ5A 3C8ZA 1VSVA 1TQDA 2XA2A 1P1KA 4G97A 2ZEJA 4B85A 4DSOA 3ECSA 2RG7A 4ILKA 1R8SA 3AR6A 2G09A 3EBLA 3Q5GA 4KQXA 4NFSA 2FPRA 3FFAA 3MWEA 4YAUA 3B2NA 2EKPA 2CMFA 2OPHA 3T99A 5HZGA 2OFFA 1W0KA 2C7BA 2X0NA 1PNVA 3MN1A 1T8UA 1QZTA 5BVHA 5AKIA 3DNFA 4C76A 5JT1A 3E58A 3K70D 2GLTA 3JTEA 1H6CA 3P2IA 3N2ZB 2XZTA 4ZEXA 3IVRA 3W3ZB 5AMXA 1YB5A 1K88A 1NIPA 1ECGA 1YJCA 3MJFA 2JLQA 2PVSA 3ZHUA 1LCIA 5BMVA 4Q15A 3C45A 1UPBA 2CNNA 1VYTA 2F8LA 2RHCA 3OEHD 3R09A 4HYQA 3W90A 3HR8A 4EW3A 1G21B 1OQAA 4HY3A 4DV6B 4QRHA 3HV2A 2NUAB 1UC5B 1CIPA 3NI2A 2BN4A 4LMBA 4TKZA 3ZHVA 2GN6A 1WRBA 4CUZA 3BRQA 1KVTA 4QQ8A 2WWXA 2PKEA 1O5IA 1UPUA 4E33A 4M0MA 3E9NA 1VG1A 3VO1A 1KEKA 4HO1X 1Q12A 2PUWA 2WIFA 3D3NA 1M34B 4BEJA 2WRZA 3L7AA 1E5XA 1QE0A 3EXHC 1IOLA 4MJ3A 4MROA 4CMHA 1UK6A 3MTQA 3VZDA 2ASEA 3IKMB 3KBBA 4KBYA 4UVGA 5JNRA 4WOPA 4P92A 1TI7A 3L0CA 2QTTA 2XA1A 2QLFA 3OQBA 4LS3A 5GPBA 3U60B 4WOBA 3C1TA 3GUVA 3LDFA 3ICEA 2FJ0A 4B6GA 1CJSA 4MYDA 4IDPA 1N77A 2WNSA 3LSTA 4L0MA 3ETJA 3RVOA 5K99A 2I91A 1PTKA 2O7RA 2K4MA 4Y1FA 3DYVA 3PXEA 3WJAA 4ARSA 1L7MA 4LJ4A 2Z95A 3VNVA 1P81A 2Y67A 3KBOA 1YE8A 1HZZC 4YECA 4DPKA 2Q29A 2IHNA 4BATA 1PQYA 3WA7A 3F8TA 2C5HA 2PD6A 4MUXA 3GZNA 2I4OA 2VJBA 1EUZA 4BWYA 4OY3A 5H16A 1LDNA 5J2UB 3T1QA 2XUOA 3JSXA 5DGCA 1I3OA 2A88A 2AD5A 2IC5A 4IXMA 4BEWA 4YONB 3H83A 4RTMA 1ZGGA 4O63O 4R05A 1KMHA 1AQIA 2LCIA 1XXLA 2C29D 2EZ4A 1VI5A 3TK1A 3A3PA 3NPMA 1RRKA 4JL6A 1XDSA 4UU7A 4X61A 1CZHA 4M8KA 3UZUA 1JDVA 1PFQA 1Q0UA 2YRXA 1UBJS 5K45A 2VH2A 2UZ4A 1NJ8A 3PJGA 1GGFA 1SA0A 2QV7A 2W6JD 4FOTA 4OEHA 3A9SA 2QY6A 4PIVA 4OGLA 2CB9A 3E5RA 3QYAA 3RBAA 2LPMA 3TZCA 1R6BX 2CN1A 3VAYA 5KJ6A 3T5PA 1P9RA 2X2FA 2ZPTX 5EIFA 4M0UA 4OJKA 1P7WA 1KMIY 1RC1A 4XOIA 3O31A 3JQ9A 5HCIA 2F1KA 3WMWA 4FYVA 2NPFA 4MO2A 2FWJA 3ZVRA 3WLJA 3E8SA 5K0LA 3CBGA 3B1ZA 1EAMA 5C53B 1G8AA 4Q3DA 4WBXC 5J3JA 2CNBA 2YIMA 4LF5B 3DM9B 2YYYA 1OI4A 2ZBVA 3HXLA 3KQPA 2E49A 4E88A 5JPCA 3K0HA 1SVIA 2IHKA 1OFTA 2ZWMA 3MCTA 4D0LB 3FDZB 4DIUA 4DSNA 3KYBA 3A4IA 1J1IA 2Z04A 1SUIA 1TLLA 4ED9A 5AW2A 3L02A 1P1HA 3AERA 4KJXA 4R01A 4O4IB 1N6NA 2HB6A 2ZR9A 4WVFA 2AR7A 2V7PA 1Z34A 2V6MA 1AD2A 1DQNA 1WNTA 2HREA 3I83A 4GOOD 1S8OA 2YUTA 1C2YA 4N6NA 5CFQA 3ZHSA 3NONA 1B0PA 4RMGA 1KI6B 3A1TA 1BYUA 2GA8A 1G8HA 4AMBA 4ZOLF 1MJGM 4RTNA 4YCDA 1U1FA 1GQYA 1NJ2A 4Q01A 1P31A 1RD4A 4ZOBA 3I6ZA 1TTQB 3BKXA 5IW8A 3MCVA 3TRJA 2R84A 5JSKA 4ZI5A 3BJMA 4UM7A 3NH6A 4YRRA 4RV4A 2FSIA 1A9SA 1IN6A 2QTHA 1KMMA 4JBHA 3TIXB 1TUIA 5BWCA 1G59A 3A2NA 3DLHA 4GUAA 3FXAA 2IYQA 2IHTA 1DKMA 3AUUA 4Q66C 1EX9A 2CL7X 2JS7A 1RZVA 5HJEA 3QXCA 4OP1A 2OORC 5AI5A 1XHLA 2R6GA 1YT5A 4J0GA 1NBME 2YICA 4JT4A 2ZB4A 4E12A 1CS4C 2HFKA 4EOGA 5IJXA 1BN6A 2Y8EA 2YZNA 4AJPA 4EVQA 2SCUA 2B0JA 1MR3F 2W7TA 4JD5A 3PQFA 3IPXA 4HKTA 1Y9AA 1EDBA 4C4TA 3SX2A 1BGWA 2ZS9A 2GF2A 3JV7A 4ODIA 5ALHA 1O54A 3E4DA 1T5IA 2PEYA 2X23A 4YUAA 5KEIA 4D3DA 3ROQA 4IIGA 2XQFA 3QVGA 4FC6A 4MVYA 2KB0A 4YRBA 3TG8A 4Z0NA 3JWIA 4HNAA 3AVYA 2IKSA 4I36A 1KOGA 4K86A 5E1OA 1E77A 5HWSA 1XXHE 2ZGVA 3LBFA 5DHPA 1XVAA 5AVXA 3CR7A 1EINA 4PX5A 5EPOA 4UOEA 4D4GA 1T36B 4YAOA 1TIKA 3VNBA 3RCBA 4UE6A 3NBYC 1KDZA 4QXQA 2A9KA 1IONA 1P73A 4F5ZA 2OCXA 1P80A 5EERA 4BMSA 1T4CA 4NABA 4DR2B 2CEKA 4NH4A 3KB2A 5T6BA 2APJA 7ABPA 3ADOA 4WNAB 1V26A 2G6BA 1YR3A 4KQWA 4GDMA 2DWCA 1JDTA 1PK8A 2FA9A 2VDNB 4RJTA 3CH5A 3UK1A 4B80A 1SFRA 2X5KO 1KDOA 4JUIA 3H9GA 3IDAA 4DMFA 2C2YA 1FYVA 2XGMA 1OV6A 4P1ZA 2LNDA 2XT6A 5FR1A 4BUZA 3AFMA 5DYTA 4B3TB 4NR0A 5IVIA 3RTBA 4QASA 3Q10A 2C04A 3G0HA 5DISB 3TEFA 1RPJA 1ZA1A 2R44A 3LE8A 4BB6A 1G66A 2WUFA 3V8VA 1JKXA 2OZLB 5CW2A 4FCWA 4HEA1 4BU0A 2NU8B 4DUYB 4CG0A 3GROA 1BS9A 1B73A 1WHTB 2X4DA 2ZYUX 2MYUA 3EVZA 3DUFB 1HNWB 4RXUA 3LPAA 1MO6A 4Y2RA 3TSOA 1XR3A 3RC9A 3DZDA 3L8DA 1T8SA 4QTYA 1XNHA 2PQMA 5K8CA 3DAOA 4FE3A 3ROFA 2YC4C 5IXSA 4DUZB 4KO8A 3H13A 2BSQA 1UAGA 3U3MA 3QEMB 4WT7A 2DEUA 1M2EA 4G3XA 4WXYB 5DTQA 1WAMA 2EP5A 1BA2A 2H65A 3WX0A 3T3IA 5JARA 4G24A 2E4AA 1EPUA 2ZB2A 1OA0A 2JCXA 2ZB7A 5AJVB 4YP7A 3WFIA 3WWZA 3HCAA 3K5PA 4C29A 1Y9EA 3FPJA 1YVRA 2W98A 5CCEA 3X2FA 3VOTA 1JHQA 2C4HA 4R9NA 4Q7JB 3D2AA 1AKVA 1L7EA 5ENDA 3OX3A 1B42A 5JCOA 4E4TA 1PWYE 1M10A 4F1KA 3KWFA 4D3SA 3CKKA 2FWPA 4ZZ1A 1L5OA 1ZD9A 2F17A 3UH1A 2IODA 4FSHA 4U6SA 2GJSA 1PZEA 3EVDA 5BUZA 1IK6A 1HTWA 2JH9A 3ESBA 4UFNA 1RMTA 4EHFA 4XX0A 1Z88A 3QQ5A 1V3VA 3WC4A 2QX7A 1PQUA 4LOLA 2NQ2C 4PBTA 2M6RA 3DFZA 4DWOA 3COSA 2AFVA 2QK4A 2EF1A 4QBFA 1AUXA 4X9XA 5JAPA 4UBMA 5AVRA 4IXDA 3UJ7A 4ICIA 3RF7A 2B21A 1J0BA 1ISRA 4IIUA 5JYDA 1C7IA 1ZG3A 4KE6A 2PT5A 2ZRKA 5JWRA 2IBTA 3IVAA 5CFLA 4PYQA 3G0IA 2Z5VA 3DFMA 4TTTS 4FQ5A 4IJVA 5AKZA 5FBRB 3RSLA 1U1IA 3HYRA 3OOJA 2IYWA 2XDQA 3KKKA 4PXYA 3UHAA 4PPGA 1P3JA 1YKGA 1CRZA 2NO0A 4CKWA 4OBWA 1Y8RB 2GFIA 1G2IA 3DBRB 2Y92A 3G88A 3SZLA 1QORA 2EJTA 4ALJA 5B58C 4RXMA 2YJ4A 1DUVG 1GDDA 3UC5A 1S2LA 3STTA 5K5EA 2G4VA 2DTDA 3NU1A 4Q19A 1YR2A 3MT8A 4XYLA 5J63A 2PLWA 2JA2A 3WGGA 4TZKA 1CNMA 3DCNA 3EVGA 4R1OA 5B1IA 5U9CA 3ZVKA 2Y9PB 5FNVA 3AOGA 1Y7TA 1ZM2A 1UC4B 1Z4QA 1QH1A 4QDOA 1SVSA 1XRPA 4OGFA 5KSPA 1L5QA 3BCHA 4KQ6A 1E4OA 2ZSIA 4ASUA 2GWHA 4X7MA 2RG1A 3BBLA 4PRZA 1DXHA 3JD1A 5H9WA 1C9JA 1VL6A 3NBFA 2WG1A 2Q4OA 3NX4A 1G1AA 2R60A 3CX6A 1QVWA 2IOFA 3MUEA 4D6YA 3KXIA 1REQA 5C18A 2ZBDA 2QL6A 1HKHA 1KBOA 1M6HA 1MBZA 4G0MA 4C05A 3VKGA 3OZEA 1RKVA 2SKCA 2FP4A 4JI6B 2B1QA 1ULHA 1ZCJA 2JFXA 2QTZA 2X86A 4KK4A 3FDJA 2GFQA 4C2BA 4W1PA 3RF6A 2M32A 2M1ZA 1TEVA 3BMNB 4GW3A 4J0EA 5BNIA 1YFLA 4HFJA 3QEOA 4TWIA 3RM3A 4OGWA 4OO3A 3P27A 4H15A 3ISJA 3ITKA 1EZ4A 1QX3A 5D1HA 5AVQA 2BCEA 2IXDA 3P0EA 4ZCPA 3R7DA 4ILEA 1VE1A 4JFAA 4C87A 2GYUA 3OQIA 3THYB 1KYZA 1LH0A 3G2LA 1C3LA 3WHIA 3AVQA 5JSZB 4F4UA 1KO8A 4H1UA 1XWIA 4L8WB 3WB2A 3JRWA 4TZTA 5GOTA 1YH3A 1I3KA 1H4VB 2C3UA 2ZM5A 4NONA 5FOVA 3SEZA 2G36A 4PPYA 5BRJA 1X19A 4C0AC 1QRUA 3QEBZ 2HL6A 3DMPA 3FVTA 2PTHA 3NTVA 1E3DA 1GUFA 3KQYA 5AM0A 1YQWA 3PUKA 3HA7A 4JJAA 3VZBA 3PENA 1UKZA 4NQZA 4HZUB 4M88A 5H3HA 1GRVA 4Y6LA 3VPFA 1PJSA 2HHJA 3HV0A 1RW4A 5CIWA 1ZIDA 3KKPA 3AI2A 4IKOA 1MQ9A 4G01B 1JAIA 1SXJE 2W00A 4JBGA 1RBZA 1B8OA 1U2PA 4ES6A 221PA 1N2CB 3DBIA 4WMLA 4XGNA 4EHAA 2AEMA 3L77A 1XZLA 4MVJD 5LWQA 1DAMA 2I7CA 1Y6GA 2UUPA 3C70A 4GG1A 4JR2A 4R3UC 2BD0A 4DBVO 2A3NA 4K03A 1XSEA 4ALLA 5BSEA 1D9XA 1W1UA 5FUQA 3DOOA 4MCJA 2PLFA 2DLDA 2NTJA 2PZFA 1YE3A 1E1MA 4PZEA 4WW0A 3CZCA 2C61A 1KF0A 3B1KA 3OETA 4N12A 4AKIA 4I5IA 3TTUA 2ENWA 3BMXA 5M5BA 1PNRA 1LSJA 4BQQA 1Q0RA 3TKAA 1QYXA 3DPSA 3O3NB 1QS0B 4HNRA 5KTKA 3ITNA 5LLDA 4I55F 2WM3A 2ZIZA 3NBAA 1OJLA 4NCAA 1BU8A 3D31A 3GGPA 3AETA 4E4YA 4Z8YA 1GLGA 1XLUA 3FOWA 1H5QA 1MKYA 2ODQA 5GONF 1N8TA 4W6ZA 4CTJA 2ZTVA 1CR4A 2X4LA 2ACWA 2ORIA 4HEJA 3T0FA 4CEJB 3QX3A 2ZYTX 3K1TA 1P75A 2QYOA 1AU9A 4HDQB 4AT1A 1AKNA 1L6IA 4P33A 4UOQA 5A9TA 3KLPX 3WWDA 4YT4A 4KPYA 1AX9A 2BFEA 4Z3KA 2REQA 4ISCA 4Q03A 1KAEA 2F3SA 3BWDD 4FDTA 4MS1B 3UK6A 5CA1A 1BS1A 3AR5A 3LYLA 3EPLA 2JVIA 2GD1O 3ZXYA 4EKIA 2C97A 2ORYA 1AKUA 4IHAA 1QVAA 1YJXA 2VP3A 1RBYA 1L3CA 1QFSA 1NX9A 1M0EA 1KK0A 4R8MA 5DCYA 3ZD8A 2H00A 1RLTA 4DTIA 1PZHA 4M8NE 4BLWA 2FPLA 4OLJA 4DMLA 1DT5A 4I5FA 3OC6A 3SX0A 2QMQA 3GP3A 3N2NA 5I48A 4L8FA 2M98A 3IELA 5EJMA 1I36A 3HCPA 2W0MA 2C5FA 2DULA 2YC2C 3FI9A 3MINB 3O91A 4ZC1A 4BQRA 2TMYA 2QYSA 3KQWA 2O05A 3UWSA 4MWEA 2CWWA 2DCUA 1G41A 3F4BA 3KTAA 2ZB3A 4CF5A 3KAQA 1F38A 3HXTA 4FMCF 4IUBS 4DM7A 4DADA 4Y1RA 2OECA 4HL6A 4U9HS 1E4VA 3VPHA 4NEGA 2FDXA 1DIAA 3ACCA 2ZUVA 3MPOA 5AXAA 2X76A 1ZOLA 4CM4A 3AM1A 2ORVA 2MMCA 4D3XA 4INAA 4MMXB 2G25A 3EZNA 1WXEA 3AHHA 2FPOA 1TCVA 3L8FA 4HGNA 4EW6A 4NEQA 1HYQA 3THWA 4W5JA 3R9XA 3U5TA 3EG9B 3I5MA 3T9AA 4EW1A 2EVWX 1KP3A 3WBBA 2O20A 1R4NB 3QXXA 2HDNB 5AVOA 3QX9A 2IZOA 2PMDA 4NTZA 4YQEA 5BQOA 3QVWA 1H42A 2VF8A 2OUIA 4R69A 2PNFA 4RVFA 4HWKA 3SXJA 3ZQ4A 3PVCA 1E79D 2EWMA 4TXHA 2QM7A 1SD2A 2N42A 2OP1A 3NC1C 4OSPA 3MCAA 3PD7A 4YAKA 1LX7A 3LQFA 4GKJB 2E87A 2QTFA 5E7QA 3CLVA 1NSTA 4U7JA 4D8YA 1VKJA 1C3EA 1SVWA 2GR9A 4J91A 3TQHA 3VZSA 5GIPE 3O8RA 5KCMA 1FVHA 4J16C 4TRNA 5CT9A 2DY1A 4FNMA 2IS1A 1DAKA 1DARA 4HVAA 5HYVA 4RSGA 2HA5A 2JNWA 1KU6A 3UJ8A 3QY9A 1UFRA 3CLTD 2AWNA 1MJFA 1YZVA 2FKAA 4LFCB 3O8NA 3R44A 2JK1A 4TM7A 1PW5A 2IP2A 2PS0A 4WKGA 2PMCA 2C59A 2J9GA 3TZLA 2OC9A 1O8CA 2FZWA 3PA8A 1ZSVA 1D4FA 3RI3A 5A4JA 1B0UA 2ZXEA 5SICE 3B1XA 5KNBA 2KX7A 2FSSA 3QGMA 3OLQA 4XTCS 3X1ZA 3AEKB 4URUR 1L5HA 2PU7A 5KYYB 2ONJA 3DMNA 5P8WA 1BCRA 3KSUA 5G4KA 3D8SA 4MDFA 1EVLA 1ZGHA 4XLTA 5KMGB 2XUIA 2WR8A 4MPRA 1O03A 2I2AA 3B85A 2IFTA 1NF3A 1P3Y1 1NFRA 2O1EA 2PX2A 3IDOA 1EX1A 3OAAD 4KTTE 1Q1ZA 4M8IA 3B6JA 4RLHA 3GBSA 3GXOA 3WLMA 3RHSA 4P81A 1ZMOA 2X0EA 3A6KA 4ZOQI 2F55A 1USGA 1XZQA 4IVPA 2VP0A 4F8EA 1P1BA 3W1WA 4TTAA 1SXPA 2OGTA 4DRYA 4A4DA 2E6KA 1OOEA 4NBVA 2WD8A 3E6AA 1ZGAA 3BSSA 5ALEA 4CQLA 5SZJA 3E0QA 2IF0A 1MX9A 2V7EA 3CRVA 4HQ6A 4N49A 1C80A 5FEMA 3V2GA 5KQPA 2WOOA 1QIJA 2NUTA 4EQZA 4IG9A 1EFVA 3TAXA 4WK0B 4P80A 3B9BA 3OJXA 4NXNB 4OX9Y 1PGNA 1Y9ZA 2J7PA 1I4WA 1CUAA 1LK5A 2P9FA 2C2MA 2NAFA 4IDBA 5A4DA 2BEVB 4BZWA 1C3VA 3EEYA 1DAEA 3GQBB 1JS1X 3N8NA 3PDIB 4AUMA 1J8DA 3FYUA 2DPHA 2FX2A 5A6SA 4KXVA 3DOIA 5DCLA 2P7IA 2V3WA 2BFCB 3D7MA 2XMPA 4BNNA 3U26A 1R6VA 3IUBA 2JFNA 5JSYA 4QOIA 3IDSA 4V02A 2J6BA 4WJZA 1MNQA 4ZVQA 2ODEA 1WY7A 3GJXC 4FKMA 1ZM4A 2P9ZA 5TPWA 5AESA 2AQIA 1ORHA 2HGZA 2VUHB 4PC7A 5C4MA 5FQNA 1A2OA 3AFOA 1LW6E 1PS8A 4KVGA 5CNKA 2Q3BA 1VL1A 2Z83A 1MX5A 4A8JA 1V45E 2II6A 4FB4A 2FOLA 3AHCA 4EYKA 1XGKA 2O3JA 4FHDA 4GQIA 3U3DA 2W2MA 5B5SA 2JBHA 3WZLA 4BKRA 3U3KA 2OR3A 5DMXA 1US8B 4IO0A 2HHAA 3QV2A 4KXLA 3F1KA 2ADOA 4MUGA 1GGNA 3TQOA 1N33B 2GEFA 3E0XA 1GQ2A 1MA3A 2QRVB 3HUUA 1Y80A 3I2HA 3W05A 2VP2A 4ALKA 2K2WA 3D8HA 3PF8A 4D9JA 3DM5A 4YBRA 3K15A 4YQYA 2J0EA 3LQRA 4KMRA 2RHTA 1SVMA 5EE9A 2WT9A 4IRMA 4BVGA 5F78A 4W5NA 3D7LA 4OP2A 2QQ5A 3AW9A 4M6WA 3HDVA 4XYGA 5TS3A 1VOTA 3B3QA 4HDNB 4DEVA 1CETA 2X42A 3IRVA 4DR6B 2Q8QA 4DV0B 4LYHA 2OHXA 2R3SA 4DY4A 4X93A 4HEHA 3K32A 4A92A 4YIKA 1XNJA 2GZAA 2CNDA 3GN1A 4EJ0A 2C9MA 4TV8F 1U63A 3NYWA 3BRWA 5I51A 3N58A 1U0SY 2ODAA 2GTIA 3BGOS 5DHRA 3UG7A 5F7OA 3LIPA 1R6DA 2Z8ZA 1RQLA 3CTMA 5I9TA 3E9RA 4NRDA 4C7XA 4NI5A 5IC6A 4WKOA 1DTEA 2XEDA 2CV0A 1MMFB 4GS5A 4TKUA 3AL2A 3NYRA 4R2KA 3PRJA 3NIBA 4Y9RA 4ZVOA 5TMBA 4KAXA 3UJ9A 3KYIB 4Z5XA 5B6JA 2BFNA 2GBLA 5COQA 2QL9A 2ZJ0A 3ZS9A 3C6KA 1UJ2A 2YBDA 2ONKA 1YA8A 2O8BB 2JZNA 3EARA 1DEKA 1QU3A 3RKSA 4JDUA 3VNQA 5FUMA 2BZ1A 1YZFA 4IL5A 1MHTA 1UBLS 4B0OA 3PFIA 4ZI2A 1Z83A 1DKUA 1IMJA 1X1QA 5CP8A 3DHNA 2DM6A 4TLEA 2EDAA 3WLQA 3R3ZA 4CTNA 2IXFA 2J3IA 4ARCA 1LBEA 2OTCA 1QKJA 4J8PA 1UINA 3GGCA 4KDEA 3DFUA 3AI7A 3GRZA 2PRZA 1ELOA 1C30A 2ZJ1A 3DMRA 4WXRA 3RUAA 2AXQA 3CZMA 4RL4A 1FUIA 1HE8B 1Q7TA 4KSBA 1RJ9B 5KAPA 3TDMA 4AF7A 3B5EA 1ZYUA 4EB6B 3B7GA 2E48A 3GUUA 3WLTA 2YOHA 1JB9A 2TECE 4IDAA 4M9RA 1HMYA 3FBTA 1NMYA 2LE0A 5JEDA 5I9NA 3FVVA 1C9DB 2J3KA 2HLHA 3AHEA 2EJUA 4MULA 4MW7A 4D02A 1Z17A 5G1NA 2W8BA 1TF5A 2OG2A 3UMRA 3W2EA 3VXKA 1VMDA 1HQYE 2NZXA 3QMMA 4GP6A 1XT6A 5I3ZA 1H8HD 4Q9KA 1MB3A 4MQFB 4AZ3A 1ZWLA 3FFBA 2GZHA 3AR8A 3K9QO 4K6OA 4BDSA 3KQKA 4YDRA 3F6PA 3VUEA 4TT8A 2IYAA 3GA5A 4MGEA 4UTRA 1X13A 4OIFA 3ND7A 3LX4A 4GM4A 2PZMA 2FHSA 3SQWA 2GASA 3LQKA 1YGYA 5TQ2A 3LCUA 3NM6B 4AMVA 1XQXA 4LK2A 2OYRA 3ZJUA 4UMFA 4AZVA 4K8OA 2IS4A 4CKBA 2VK1A 4P34A 1Y1RA 3FAKA 3CX7A 1N5LA 3DOFA 5I7WA 5JAUA 1KAMA 3H8WA 1JT2A 1N9ZA 2FK7A 3DD1A 1I7NA 4KN8A 4QLAA 3O94A 3E2PA 4TROA 4CIYA 4LF4B 2R9VA 4ZCMA 3I2JA 4IX1A 3GNLA 5TEWA 2I1QA 4FYJA 3IKVA 4CM8A 2B8NA 1C50A 3LK7A 5TE9A 3VTKA 3IGFA 3PCTA 4NJEB 3RAPR 3H84A 3B8HA 1HXHA 2NTNA 4HATA 1GCGA 1H65A 1KKMA 2BJWA 2GKSA 4QGSA 6NULA 4ZYLA 1NT2A 3SHFA 1RQ2A 1USIA 3I2IA 3P9SA 5ELXA 4F2GA 4PO3X 5LXTB 3O0DA 1RRMA 1YVEI 4AJIA 3ADBA 1VJTA 4D81A 3T4PA 2JIZD 3CNNA 4G1BA 4RNCA 1SCBA 1SHUX 1LTQA 2FPUA 1J8QA 3PNBA 4HBGA 5CNMA 3SE7A 3TNLA 4B4DA 2KM1A 4F45A 2QTGA 5IK2A 4DZTA 1M2KA 3FE2A 4X8MA 2GBGA 4I4NA 4EKYA 1HDYA 4TYMA 4CF6A 3BDIA 4PTLA 2DERA 1FFBA 4QFBA 4EEKA 1P39A 2P5UA 1SKAA 3AVXA 1U8UA 2FMKA 3MLBA 2CFCA 5ALDA 3IKJA 4M0CA 5L7YA 4EI2A 3VR2D 1DS6A 2IUEA 1H4SA 4TWAA 1X9GA 2W83A 3BJRA 1F0KA 1OXTA 3C41J 3EPPA 3QFSA 4OU5A 3AVTA 5D3MB 4UKDA 4A7PA 5EN4A 2BR3A 2HU8A 3LXRA 1GSAA 2PJDA 4JLVA 1CUBA 1D6NA 4B6SA 2EG9A 1DBWA 2CNLA 4Q39A 4URVR 4D0SA 5JG7A 3IIMA 2PR7A 3T3DA 2IOFK 3ORYA 5IF9A 2NUBA 3SC6A 3ZWXA 4JGGA 1QH0A 3DKPA 3OUTA 1Y8QA 4BO0A 2P9EA 3S70A 4CNQA 2F8TA 2VP9A 2I29A 3WHKA 4KPFC 1NPDA 3CZAA 3VGJA 3S29A 1JSXA 2UVPB 3E7FA 1W36C 4R40A 3FJOA 5JW6A 2A14A 3HSKA 3PUYA 1PG5A 3HJHA 2GAJA 3KXKA 4MV3A 5JCXA 4HG2A 4NARA 5T3UA 2W58A 2Z1NA 5JAIA 1E6WA 5DV9A 4K2AA 5AW4A 3HB0A 3KOUA 2P6OA 3K5WA 3PLNA 5B4UA 5SYAA 5U4XA 1ADCA 4IILA 3RS2A 2X0FA 2DGDA 4X97A 5MF6A 4FMPA 4K9RA 4PQFA 5IXYA 3Q8WA 1QQ5A 1Y81A 6REQB 4BGDA 3N8DA 1ZCBA 3ES9A 2VTEA 2W4IA 3GEDA 3L7LA 3PHLA 1YQDA 1GPMA 2RB4A 3DNPA 4HH3C 4M1YA 4ZD6A 3BTSA 3EEFA 1VB3A 3OIWA 3OC0A 4FNAA 2JFVA 3FBWA 4B45A 3EW9A 3A9TA 3F2VA 4FFRA 4OQEA 5ARDA 3I37X 5ELMA 4OG2A 1JV2B 2JJ2D 3EDQA 5KWVA 1C8BA 1YS2X 1SVUA 3A6JA 3DTVD 3GG9A 5L6MB 1U90A 1AK1A 1JG7A 4WKNA 1KO7A 4EJSB 4HDKA 1HNNA 1NE7A 1QGUB 2H3HA 3KR1A 4YCAA 3HB9A 5TGZA 4LVCA 3VDRA 1ODTC 4K0RA 1FTGA 1KMNA 1MO2A 3JVUA 3FGNA 5A2QA 4HFRA 3N9IA 5FJJA 2JB9A 5A5FA 5HOEA 4XLLA 1UEJA 4KR9A 3DV0A 4JL5A 2H3EA 3GRRA 3FZNA 1F0PA 1ZITA 3PRKE 1CY6A 2RGCA 2I87A 5KX5F 4U1RA 1O9HA 4UASA 2WB4A 1EBBA 3EGOA 4XYEA 1XF1A 1FP7A 1P1JA 1QMGA 2PS9A 2X19A 2AXNA 5FTJA 4UTNA 3IQDB 2DT8A 1WIWA 2G9QA 4WSOA 5EHNA 2Y27A 1O6CA 3LW8A 1C3OB 3LWNA 4M1SA 2EAUA 3IPRA 1IBMB 2P27A 2ZU0C 1WBJB 3AUSA 2BI7A 1IHYA 5JCJA 1UXGA 3M3HA 3IUYA 4JLJA 1KQOA 4NPHA 2H1LA 1PVDA 3WA6A 2OXCA 3IE0A 2QV0A 5HQ3B 4L9RA 3EZYA 2LIPA 2J08A 2NUPB 1UXHA 5CTAA 3KQLA 1YVPA 1E1NA 1JI3A 4JGIA 4HAYA 1KHHA 1NVXQ 2FB9A 3RJ9A 4BFUA 3NVAA 3B7WA 1TK2A 1MAWA 1Z26A 3UK2A 3QUAA 5AM2A 3RLIA 4Z8XA 3MWEB 2VJAA 3ILSA 3PJEA 1Z0ZA 2AYZA 2VL7A 2H0QA 3A4VA 4LQLA 1JHZA 2BDEA 3SIPA 3V7NA 1RAHA 4NDZA 4RFVA 4UNQA 3STVA 4EY3A 4UZSA 1FXWF 1Y8CA 5DBHX 5B6PA 3HGMA 5FD8A 4MVJE 2ZI9A 2X6RA 3GGOA 4BX8A 5BMVB 2YXLA 9ATCA 1A98A 5K01A 4KLNA 3FUCA 1H2ZA 1XTQA 2YWJA 1WF6A 4Z4FA 1E8DA 2GO7A 1JTEA 8ATCA 3ODPA 4LTMA 3SFVA 3WB1A 2AOTA 3BD6A 2KQUA 3JY6A 3GH3A 1H66A 2EKBA 5FKJA 1C9KA 3BJEA 3ZJ4A 2EX1A 4C14A 4EO9A 5JLJA 3L1JA 5TV2A 2EL9A 4Y67A 3SQMA 4L9WA 3C16C 4CT4B 5K2OA 1CNFA 5IPFA 3W5UA 4RQUA 2XRMA 4KSCA 4BFTA 5SY9A 3NFRA 1HL7A 2ACKA 3AVPA 4YUYA 2PX5A 1P33A 2AK2A 2OESA 5DLYA 4D42A 4KE7A 3IMFA 5CYFA 1DXOA 3G0OA 2JLWA 1V5FA 4U2BA 1MC1A 2Z98A 3U6BA 3ZNOA 3V80A 2A5LA 4GGOA 1VHWA 3OO1A 2GXSA 1FXSA 2QRKA 3WYGA 4KG7A 4XM0A 1KFCB 2D1TA 4MIEA 5AK5A 2JGEA 3VVCA 2RE8A 3DXFA 3OFNA 4EX7A 2NVUA 5D7BA 1XAJA 1G5IA 1ONNA 4AF6A 3CUWA 4ANFA 2B1IA 3DOHA 2W8ZA 2AC4A 2YFQA 1U3FA 1XRLA 4E3ZA 3GMDA 2I34A 3HWWA 1PJAA 5GGYA 3NATA 2VQEB 3JYHA 3AL3A 2PMEA 3UENA 2JJQA 1JB1A 2IELA 4R0VA 3MT7A 1YDEA 4OHRA 1SN7A 2F1OA 3ZV7A 5BNWA 4G8JA 4DJEC 2I2WA 1EE2A 4FK8A 2I7TA 3PNOA 5KQRA 2DFLA 5JPIA 4N8DA 2I6GA 3GHHA 5IBQA 1TRHA 4EYOA 4XYBA 1E2UA 4L8LA 4AJNA 1DIOB 2RAVA 1NSYA 3Q8LA 2PSHA 3VMFA 3GZNB 4NYJQ 3JYQA 3GJ8A 3SFTA 4BB0A 5BY2A 2CV2A 2H06A 4CLEA 2XDYA 4IMIB 2DKNA 3KVOA 4XLZA 1KMHB 2O2SA 2WD7A 3HWRA 1FVFA 3H2HA 4IDNA 3TX6A 4RD1A 1IN4A 4A5OA 4CWAA 1EXDA 2CLOB 4KQGA 3SMVA 1SA0B 5CCXA 1V47A 5AKXA 1BHSA 2IE8A 3FOAA 3V8QA 2VHVA 2IVZA 3I9KA 2JAWA 2HHLA 1D2NA 4G8DA 2WNHA 1QV9A 5ECGC 4TMZA 2WG0A 2E85A 3AF0A 3ETEA 4OK5A 5KWSA 3SCZA 5D6NA 4NOMA 3I34X 5FYDA 3ZLJA 2ZITA 2Z3ZA 2VH1A 1R0CA 1O6ZA 2Y1WA 2FK8A 4RE6A 4DZZA 1AA9A 2X9QA 4RJKA 2QJOA 4YWJA 3RO7A 4HN2A 4YI5A 2QRUA 3P26A 3FW1A 4R5MA 1UR5A 3K9LA 3K0FA 2FWRA 3TJRA 5BWOA 3KJEA 4BAUA 1U81A 2PY6A 3I45A 3OM9A 4K6FA 5AK3A 1B2LA 1M8GA 2VRWA 3AJRA 4Q02A 5DRTA 1P2TA 3H3FA 5KNDH 2NU6A 3TWOA 4NXMB 3ACBA 4Q4HA 3A6FA 2XADA 4QJ4A 1H3EA 3AERB 4HC4A 4HB0A 2W6QA 3GVHA 2RAFA 3IIEA 1CSEE 1T29A 5EWLA 1KEEA 3B3JA 2OQ2A 3E70C 9ABPA 3DLBA 2IZ1A 4AICA 4WHMA 2WJVA 4RD0A 1LC0A 2R751 2XH8A 1YAJA 1O2DA 2QLMA 3EQZA 4L28A 5ALMA 5HRCA 4JHXA 4U8GA 5E4TA 1T5SA 3CEHA 3LWBA 4ZQEA 2PTGA 3GVPA 3M4YA 4ZYZA 4EJMA 4HB4A 1B15A 1OLUA 3BBPA 1R64A 1CV2A 3B51X 5DLDA 1T5TA 4DJJA 3PNLA 1SHJA 4FW8A 2NW6A 4N3BA 1VLZA 1IEXA 2JFBA 3PVZA 2Y76A 3EGEA 3UUFA 2V0CA 4M9QA 1HLFA 1L4BA 2VKQA 1A2BA 1GEEA 1ZUNA 3HJGA 4KGDA 5H5JA 4RF3A 2E4VA 3P5SA 2FQ1A 4X3PA 5DNAA 1P8JA 1YQXA 3VR0A 3ZUPA 4D9NA 3QBDA 4FWBA 4ERXA 3EAGA 5F98A 3A05A 3I9FA 2XKKA 5JH7F 1NVFA 2OAQ1 1XD8A 2GHTA 2BOVA 4EO4A 2BY4A 2WTBA 3FETA 1XROA 2HCTA 2SCUB 3OSZA 2EG5A 2V7TA 4TVBA 3UWDA 3GZ4A 2IU0A 1Q0ZA 1Q7BA 4YMHA 5IDWA 1N34B 4OAQA 3WLRA 3GP5A 4EGQA 4JOQA 4YCNA 1GR0A 2Y1DA 2MSCB 5ED4A 1Y3HA 3PC2A 3WZ2A 2XMGA 2P2CA 3ZDQA 1ZW6A 3QVGB 5AYVA 1GCAA 4BNTA 4NYJR 4LYYA 4LJKA 2QXTA 4HNAB 1O95A 4QU9A 3AYZB 3EUEA 1O1YA 1VMEA 2ABWA 4PZ0A 1XNRB 2R7NA 4IWYA 4RHEA 2GJ9A 1JG4A 2XECA 3GCDA 2AI2A 3QU5A 1D4ZA 1T4CB 3O3OB 4UUMA 3VR4A 1P7YA 2FEAA 1C0PA 5IJWA 4BMOB 4U02A 5K8IA 5G4LA 3CXRA 2YVKA 4K9PA 1SXHA 2C5AA 3UGQA 4HK4A 3KAJA 3AHGA 1JE0A 4HXYA 4B7CA 4FHGA 3FPEA 5E4FA 3KPVA 4ZRMA 4QOSA 5K0SA 4X6UA 2GF0A 2Y93A 1I13A 2X0RA 3TW6A 4Y0NA 3ZE7A 4G63A 1D03A 2B1GA 2PKWA 1A95A 4L0DA 3O95A 4V2IA 1L4GA 1OZHA 2V03A 1WETA 2XTJA 5AVZA 5INTA 2H2WA 3BOSA 4D5GA 1Q0PA 1Y3FE 4RORA 3C7KA 3K20A 3R3UA 3RAJA 3S5UA 1R50A 1BRMA 1XVVA 3DLPX 1WUIS 4G4JA 4GMDA 1TC1A 1A04A 4R81A 1AMOA 2HHCA 1FFYA 1F3LA 2VDRB 2ZW9A 2BMAA 3NWEA 1BKSB 4YJHA 3LLVA 3D0OA 3IOBA 3GFPA 4KFCA 2YCBA 5CX1A 4BKPA 4RY2A 4PEVA 1N3IA 2EZTA 4FLEA 3SN6A 1EK1A 4P0TA 5F7XA 1HF3A 4HAXA 5AOVA 4DMCA 4US2R 1X7ZA 3UB2A 3PXXA 4F4CA 1ZN8A 2ZRDA 4TSKA 1PFYA 4TQUS 2ZTMA 1MB4A 4U2FA 4XWYA 5LZ8A 1WMFA 2QP4A 5JHGB 1QZZA 1VCMA 2FCRA 3O03A 3OJEA 4GVXA 4ONEA 3QW2A 2H18A 1CUVA 3F7NA 2W6IA 4LXXA 3TOZA 4C3VA 2ZRFA 1F6BA 4RSRA 3L8HA 2QLTA 2W37A 1IB0A 2WU8A 4YRSA 1XNQB 4DAEA 1P7VA 1WZIA 1FTWA 3WYAA 3U3ZA 1X86B 1OXVA 5I7OA 4H6VA 2WHPA 1V8BA 3PHCA 5LLSA 4NNJA 1VYHA 1GUAA 3ZLVA 4GKKB 2JEOA 2P9QA 3WAJA 3RK1A 1MIHA 1AHNA 4KGXA 4XX0B 5FFMA 4DYDA 3QPVA 2RHRA 4RPCA 3BE5A 3DH0A 3Q7IA 4UTXA 1GARA 5K20A 4WOCA 2DHQA 3MRXA 5LZ4A 4E2XA 2W6PA 4F8JA 3TZEA 4X60A 3MD9A 2A35A 5IZCC 5DX0A 2DSNA 4X65B 3OLCX 4BLSA 3T3MB 2DYKA 1YDFA 2NXNA 4B7XA 2Q41A 3N2KA 4E15A 4ZCTA 3RGGA 1EQ2A 2XCLA 3L1VA 2CZCA 2I66A 4EMSA 1V9CA 2R8RA 2R1TA 5E1BA 3QSGA 1DLJA 5MGNA 5T57A 2Q8NA 2XDQB 4Y6SA 4UFOA 5THQA 4CKWB 5MFPA 5JZBA 3VPSA 2DBVO 1IB6A 2J30A 3U4IA 1AURA 4XWOA 1JAXA 5K8VA 5GZ1A 4GR9A 1K6IA 1CJCA 1HE5A 3CTPA 5H7XA 4W9MC 4W5RA 4I9GA 3BL5A 1CZNA 1RHQA 4TMVA 1P4AA 2GPTA 2WEKA 1ZN2A 2DBQA 1Y5RA 2VDMB 4IWNA 2J9FA 1A5SB 3EMVA 1VCNA 3PYXA 4DEXA 5FNVB 1JJFA 4E5NA 2FRDA 4IAOA 1QFMA 3SIRA 1DBIA 1T1SA 1Z0SA 2VS1A 2QJTA 3H5TA 4OQZA 4RQAA 1IXYA 1QH1B 3DGFC 1VHLA 3DE3X 4E0BA 3A8TA 1Q95A 3R6LA 1S9HA 3EMBA 4F5EA 3G89A 4EAAA 1W0JA 1KJWA 2WUDA 5EKTA 4HPXB 4S05A 2Q5JA 3N0TA 3UMFA 1M0WA 2CLMB 3O9VA 4N8EA 1Q74A 5C1DA 3E9ZA 3OCVA 5DNCA 1MFZA 1REQB 3UQYS 3A04A 3GCZA 2FP4B 1I1NA 4WXHA 4E1AA 4LI0A 2WJYA 4KITB 1UKVY 4EITA 2CVZA 1V8ZA 4IINA 3GEGA 2JZOA 3I6BA 2A3RA 3M0EA 1ZMBA 3M6LA 4GMKA 4IOMA 4K87A 2IIPA 3SI7A 5A71A 4HQKA 3L6EA 1ZVKA 2BJVA 4K8RB 5FBVB 3I9V6 2FJPA 3ZQKA 1FLVA 1JQ5A 1R88A 1H0HA 3M4XA 5FT9A 5E7MA 1P77A 2GJKA 3INTA 4MRMA 5DLQC 4ETIA 1OBCA 2NVWA 1J0EA 2AC2A 2EF0A 4HSEA 1KEWA 2YHUA 3F2IA 1NI4A 3JR3A 4NENA 3IEIA 2QNIA 3DTYA 3OQIB 2GHIA 1BE1A 4L4UA 1D7AA 3UTDA 1ORWA 5TY0A 4C7VA 4ENPA 1U7ZA 3H16A 3WL3A 1WW8A 4EFDA 5JY6A 3A6DA 3B13B 2VHWA 4HQ0A 4YVFA 5FUBA 1WD5A 2OXFA 4N48A 4DC0A 1E7RA 3IMGA 1KU0A 1CG6A 4P7BA 2HC9A 3HR4A 1C9EA 1Z6QA 2OWEA 5FI3A 5HIAA 1E7QA 3F6RA 1Z75A 3TQRA 5KHOC 2OSVA 1U6IA 3JQFC 3GXBA 3IUJA 2ZIAA 2XTZA 1JBEA 2C84A 4CQMA 2JKYA 2O5EA 3BH0A 1CJBA 3MTAA 4BBAA 5JNSA 1TZMA 1EFTA 1LZKA 3C5EA 2GI4A 4HUQA 3QLJA 1TKCA 4N41A 5EHZA 1CUJA 2QMEA 2W2QA 1WQ4A 1ZMRA 3B78A 5DTIA 1LNSA 5JANA 1W9HA 2YY6A 3JQ7A 3ORSA 2NYUA 1FJ2A 1H6DA 3OO0A 3HZZA 5EGSA 1AXRA 4QDTA 5DKFA 4D6XA 2VA8A 2YY5A 5K8LA 1V6AA 1HYBA 4A03A 4YRGA 4MP3A 5ISMA 2FSUA 2A5YB 3CRNA 3AW8A 3DLCA 1SHZA 3HDGA 3ABOB 2POCA 5FLKA 5BW5A 1BEEA 1IRXA 1N4DA 2ZYVX 3PBKA 2NACA 4INOA 4D4JA 2GZDA 1HV8A 1V8OA 4E30A 5KUTA 3H5AA 4JBIA 4X1OA 4O1IA 5DWDA 2ZTHA 4II7A 1ONOA 1OAKA 1SD5A 1GRNA 3AETB 3AFIA 4PGAA 4DAOA 3IERA 3VYTB 4J7CA 1T3SA 1YL5A 2I6SA 3OOYA 1R3UA 1E2MA 2FEPA 1LEHA 1RCFA 2BF4A 3HB5X 4M21A 4ZARA 2BGUA 4DQVA 1N32B 5FI5A 1NZFA 4LQCA 2PD4A 5JYEA 3QJ5A 1G8KA 3GD5A 4RHCA 3P8ZA 3HBFA 1PG0A 3DL4A 3PC6A 4MUFA 3C1OA 3TQTA 3GHYA 3RRMA 2A0YA 2BFEB 2PUVA 1Z82A 2REQB 3BXPA 2QN1A 2Z43A 1NDQA 4C5BA 4E2YA 3GA0A 3WG9A 1ZM9A 5EL0A 3O74A 3UWKA 5CA1B 2YFKA 4KV7A 2ZANA 4EI8A 4BVEA 1N5MA 2VBFA 2WHYA 3OUUA 4KYUA 4MPJA 2QT9A 1EK5A 3IPAA 2DHRA 3TRIA 4B2LA 1GPDG 1XYYA 4BFZA 1M7BA 4XJSA 5IH7A 5AVTA 5KQLA 2YVAA 1GKIA 1BJRE 1DQZA 1W2GA 3N87A 2ZUCA 2WSYB 4MVJP 3LCMA 3S2UA 1LI5A 2QUIA 1YB1A 2CBZA 2HU7A 3WTBA 2ZE6A 2HRRA 1JR3A 1KMQA 2P77A 4XDZA 4UZFA 2IV2X 2VHJA 1RYEA 5M7EA 3IBFA 5EE1A 2WSMA 1DELA 4Y1EA 1JEYA 4QXMA 3KQOA 4CCWA 4IF6A 5CT8A 2GJ4A 3FJYA 4G5YA 2R48A 2X7JA 4NLLA 4YASA 1V6SA 4YDSA 1RYBA 1T9HA 2IP4A 5DW0A 2CXOA 3MAGA 3KTAB 4OQMA 2GSWA 1CYEA 2FQXA 5A0FA 5ILGA 1NI3A 3TPZA 2BFOA 3CLHA 3FYTA 4Y1RB 4EVIA 1E5QA 5E3JA 2AFHE 3FG9A 5ALIA 2I4LA 2I6XA 2X3FA 4CNBA 4Z7OB 2ZROA 4RETA 4CM4B 3WXBA 5JWOA 4BKUA 4G81A 2FGJA 2HWKA 1Z15A 3UT5A 1AC5A 2YMMA 4Q3CA 2OV6A 3BIOA 5T4EA 2C5SA 1DADA 3THWB 4J2TA 1ZQ9A 2WYWA 4G1FA 3R9XB 5C5EA 1FFHA 1E62A 3I09A 4H3SA 3BS4A 5C0OE 4F6LA 3SQXA 5HNKA 2PX6A 3K9HA 1PS9A 3PPIA 3Q12A 4WZAE 2DT5A 3EULA 1HDXA 4LAFA 1U9IC 1J56A 1TUBA 2BELA 2GN8A 2O2DA 1UM9A 3PQ7A 1QHGA 1BSVA 2IY7A 4IDFA 1E2BA 2G9VA 3FSGA 4KBFA 1I5EA 4KAFA 4TYQA 3SKYA 4WN9A 1A9YA 5T4BA 3PC4A 2XOEA 2YH2A 2PUHA 2PU5A 4JT8A 4PFQA 1WB9A 3WGMA 4PBRA 4UBIA 3QLUA 4LY3A 4ZQGA 4LGYA 4RGBA 1VHDA 1WG8A 2BFWA 2G72A 3TYXA 3ILXA 1RLMA 3LNTA 2I7XA 4MITA 1U2GC 2FEWB 3T5CA 1CUCA 4OI4A 3J7AC 1BJKA 5KYGA 4BNMA 4MWBA 1JSRA 4QPJC 1AK2A 5T4FA 3K0KA 4ZI7F 3EWNA 3G5UA 4H17A 4J7UA 4X54A 3FCXA 1Q0QA 2ISSD 3IAXA 2WPDD 4A0FA 5BXYA 1EM6A 2ESRA 5BV2P 2QMYA 2ZJ2A 4HQNA 2ZWAA 1T2VA 2HA7A 1B8NA 1ZUHA 4BX9A 2FMUA 3D54D 1MTOA 3LUHA 4RLFA 1OA1A 2C4VA 4LRQA 1D2EA 2V4UA 3Q1LA 3EMKA 4Q4LA 1A71A 2H0RA 1PR1A 2VYNA 1VMKA 2X1MA 1AOXA 4PLTA 4WFIA 4R8SA 2E5LB 1H93A 2AMFA 5G3ZA 1MQSA 1EK6A 4IV0A 5E0OA 3E1SA 3ENWA 4I4TA 2D74A 2JW5A 1DBSA 2E18A 1L5HB 1ZD4A 1MIOA 3FWZA 2JHAA 4QUBA 4COKA 3QVUA 1BCRB 1G8FA 4KUHA 4JP2A 1LV8A 1EDZA 4PSKA 4FSDA 3VKWA 3W77A 3AI1A 1VYUA 2VXOA 3EUAA 2HUPA 4DA9A 2VDLB 4G41A 4MI3A 3GEHA 2VUUA 3FY4A 3PKZA 4HMOA 3RTEA 3UJ6A 1E1RA 1FDIA 2Z4RA 5JAMA 4BXOA 4W63A 5REQA 4MW2A 4J9VA 1VIYA 3UY4A 1JRLA 1M2GA 2XNKA 3AM3A 4IUYA 4DL9A 5GP1A 3HVRA 2GM9A 4QULA 5E7JA 3IQXA 1I7QB 4RKEA 3PJRA 1ML4A 3DJFA 4HLUC 1JHUA 2BKVA 3A11A 4CQLB 1WM1A 1G1MA 2LDBA 3MQ2A 1PJ2A 1NFQA 3GMSA 2MINA 1V8PA 2J3JA 2O3RA 2A30A 2I5PO 2FR8A 2NUTB 5L3ZA 1EFVB 4MW1A 4E5SA 1H6AA 2QSZA 3LCJA 3EVAA 1GA6A 3QFRA 5JXWA 1QVVA 1R6UA 1AKTA 2O14A 3NC0C 3GLIA 3KVYA 3PT5A 1DC8A 2X0IA 4LRTB 3K3PA 3CVXA 1JU9A 3SJCA 3FYUB 2QPAA 2PANA 2A1IA 3RYFA 5IAJA 4M83A 5A6SB 4TRRA 1CY7A 3QWAA 2RHGB 3GOQA 4HX9A 3ZWMA 4KO2S 5JNLA 2PMFA 4OP3A 3U1VA 3DWFA 2CXNA 3L18A 2IXGA 5KJCA 4MR8A 5WRFA 4ZXFA 2DFPA 5FTNA 2VNJA 5TPWB 4JSRA 1G5RA 1SKYB 1GXSA 5CPBA 1T5DX 5HMLA 4H9GA 2UYYA 1UBUS 3ZE2B 4NU5A 4URXR 1KEZA 4D0NA 4WK4B 3SLRA 2OV3A 4A8JB 2IEBA 3NAZA 4M9ZA 1ETUA 5ALFA 4YV0A 3S8EA 2CC2A 2YWXA 3LLUA 4DC9A 4PN3A 1EGHA 4DQDA 1MEOA 3TZBA 4RCVA 1FNCA 1POWA 1TZBA 1ZRNA 2HLDD 3F46A 4BLPA 2E37A 2C00A 5I7UA 2BIFA 4MK4A 3ANXA 4RDHA 2X22A 4BU1A 1JHAA 1ENYA 2HMWA 2O3UA 1AUVA 1GZ3A 4MKXA 1NLUA 4XJVA 3QE4A 4LVUA 1R4MA 1ZJZA 3JVIA 1C1XA 2PNJA 4M3NA 4PIMA 4YRLA 2PJZA 4RY8A 5JAQA 3VO9A 2H8KA 1JXQA 5BYBA 4M6WB 1O94D 1Z07A 4UEKA 3KHUA 3HJRA 3OKCA 1XRRA 1AB6A 2YNMD 4WE3A 1WMBA 4NYMQ 1QIIA 1IXRC 1DC5A 2W2PA 1JNXX 1AA6A 4PO1A 3CYFA 5HF8A 4R7GA 4QC2A 1KDRA 2XNDA 4ESOA 1JBKA 3M83A 3ZLUA 1NF2A 1ZKDA 3AUJB 2V8BA 1P7PA 1WQ1R 3KKNA 4OQ4A 3WGOA 4K1LA 3A06A 5AJTA 2MSWA 3AFHA 4HADA 3H2IA 4FLMA 2JJYA 4MGIR 4N5IX 3LGAA 3MJEA 5HZHA 1UDXA 3DTNA 3UOAB 2XMBA 4UAVA 2H1WA 4Q7EA 3RJTA 1E9VA 3U4DA 1VPVA 4TKUB 5F35A 1PT7A 5LB2A 2JGAA 1EVEA 2EX4A 3PT9A 1H2XA 2F1RA 3RSOA 3O8CA 2CF6A 3O3MB 3PR2B 4YALA 3BORA 2C2ZA 1AM4D 2EIHA 4B6PA 3P9QA 4DJFC 2FZGA 2VAPA 1WOYA 4D92A 2OT3B 1LK7A 5KNLA 3H9QA 3PITA 5L95A 1WKBA 2I62A 3HLTA 3W8NA 4KR7A 1G20A 3DPUA 4EMBA 4AWBA 2JFYA 2PL9A 1R0ZA 2REOA 3DFKA 2BF7A 4QUHA 1BRTA 1O97C 1KY2A 1E6UA 4QPPA 3RARA 4V0LA 1C30B 4CL2A 4ID9A 5AUOB 4MMZB 1XQVA 3ZXXA 4B3BA 3BIWA 4CTMA 2VXCA 1CDEA 2WT4A 3BB4A 2QP9X 3VV2A 3ZE1B 5LSAA 1SIWA 4ZDIA 1QMPA 2JI6A 1PZFA 4B6FA 5LP6A 5DB4A 3HCRA 3KT6A 1W29A 2JFQA 3K0AA 3WE7A 3E3MA 2W8BB 4TTPA 1K97A 3AKDA 2GNOA 4TS4A 4RHYA 2X9VA 4I14A 5C80A 5A5DA 2GN0A 2WKPA 1CU1A 3DMFA 1YBAA 3L41A 4AZ3B 3U7HB 2RI6A 4AWXA 5CGQB 2QXYA 3BFXA 2GZSA 1YZNA 4QDJA 2VBGA 3O21A 1Q0TA 2RHDA 2XD4A 8GPBA 2NO6A 1YQUA 1TXGA 1DBPA 4IH1A 4ZVLA 4GOMD 2WMOB 4MKHA 2QTBA 3Q6IA 4YUVA 1I6KA 2VK8A 3DWEX 1TA9A 1DHTA 2D3TA 3HYLA 5TQ2B 2XB4A 5K3OA 3GJYA 4LE0A 4OQYA 3RVSA 4CKBB 2XYHA 3ZXSA 3F6EX 5JROA 1Q1NA 3TD2A 4EARA 3FPGA 2XNJA 1S2OA 3LVFO 5JISA 3TMYA 2H4HA 4FZRA 1KVSA 2V0GA 3C5VA 4B3HA 4L72A 2ZBUA 1LPNA 2AD1A 4I2VA 1CRLA 5J5VA 2WF7A 5GVRA 4FE4A 4V03A 3ZGZA 1WVMA 2OK8A 4F4IA 2RH9B 4B4OA 4CM8B 2V4MA 4NAUA 3D6JA 4HGPA 4OVKA 4NPAA 4OLFA 3CRW1 4PNPA 1ZHHA 4HRYA 3RFXA 5F3WB 1SC4A 1PFGA 2ZR8A 4L5IA 4L02A 1I2CA 1F51E 1QDLB 1DAIA 2ZUUA 1WVIA 4NYMR 4M0DA 4ZT5A 3WNZA 4L6IA 4H16A 3ZTTA 2ZTSA 4DVJA 3O2JA 4I9HA 5EJGA 4WECA 3LPMA 4KFRA 2R8PA 3ZG6A 5HF9A 4P0QB 1YE5A 2P2NA 3NHUA 4TTRA 3WK7A 1DHRA 3LD9A 3HJAA 1VLJA 4OMDA 1FXUA 3DOUA 3EFEA 5EI5A 2P4EA 3N2LA 2HJVA 5HIJA 5TF0A 2MIIA 1JDUA 3HY6A 4KDRA 5ALYA 5AXCA 2FG6C 1IZZA 1EGAA 1OB5A 2J46A 1W25A 2X2PA 1T6ZA 3MTDA 4PHCA 3RYCA 2B3DA 2HA2A 4F3NA 2GJAA 2V7GA 3EYWA 5TPZD 4AJ4A 3MUFA 3UMJA 1AT1A 5HGXA 2R0QC 1K6XA 2NP7A 1VL5A 1TT7A 4TKLA 1BCSA 2QW1A 3B7PA 3W8FA 2HWYA 4PZ9A 4FDLA 1IY1A 2JFUA 1ZD2P 2NVBA 4KH1A 1S89A 5LBUA 4F3RA 2AKAB 1VGVA 1JWLA 1H94A 2NTVA 4L78A 1K68A 4GBMA 2WU0A 1H69A 3PE4A 4R8VA 2H63A 5LMUB 2ZB8A 3ULKA 1S01A 4WBNA 4TSFA 3BAFA 1Y8QB 1TA4A 1ZVMA 1T13A 1X0XA 3IV9A 1SKBA 4FTWA 4IFEA 1VPTA 4KE9A 4DG8A 3JZAA 1TE2A 4AY4A 3OD1A 2VJPA 1NW4A 4X1IA 4OTZA 5AW6A 3UKDA 3OX1A 1GTVA 3G2NA 4O2BF 4UMDA 3O9ZA 1ZX1A 5GZ6A 2QB5A 1G9XA 1RQGA 1J09A 4WEQA 4CKCA 1N36B 2F8SA 2ZZNA 5B4TA 2H54A 2C1XA 3NANA 4DN6A 5B37A 1U2RA 1SIUA 3V1KA 3BQNB 2B5OA 4PCLA 4C88A 1GHTA 4UM9B 3IXLA 1DDGA 5DW3A 1BAPA 4G4GA 3AY0A 5ECWA 4JZKA 3U7IA 2HH9A 1GG5A 3VYRB 3NQ41 3UR