2QL7A

Crystal structure of caspase-7 with inhibitor ac-iepd-cho
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ql7A00
5IAEA 3D6FA 2C2ZA 4D3ZA 2QLJA 2QL9A 4JR2A 3H11B 4QU5A 5IBPA 2QLFA 3PD0A 4LSZA 4QU0A 2HBRA 3R7BA 2FUNB 4I1PA 2XYGA 2H48A 3V3KA 3DEJA 1I4OA 1QTNA 5IBRA 3QNWA 5JFTA 2CNOA 5I9BA 2H5JA 4NOKA 4ZVUA 4QTXA 5IAJA 4PRZA 3R5KA 4FEAA 1F9EA 4PRYA 2DKOA 1CP3A 2HBQA 2H54A 2QL7A 2CNNA 4QUBA 1NMQA 4FDLA 1SC4A 4ZVPA 3UOAB 4QUIA 2CDRA 3D6MA 3KJFA 1RWOA 2CNKA 4EJFA 3V6MA 1QX3A 1M72A 4QUJA 4DCPA 2C2MA 4JR0A 4PS0A 1BMQA 1NMEA 5IARA 4FXOA 3RJMA 1RHMA 1RWNA 1RHUA 4QULA 2J32A 3SIPA 2XZDA 3V4LA 5LU9A 2HBYA 4NOLA 1SC3A 2Y1LA 3NKFA 2XYHA 2K7ZA 1RWWA 4ZVOA 2C1EA 2FP3A 3V55A 2H65A 4NBKA 1SC1A 4QU8A 3NS7A 4NOMA 3SIRA 4EHNA 3DEIA 4EHLA 1RWVA 1K88A 2WDPA 3H13A 3R7NA 4ZVSA 3GJTA 3NR2A 1NW9B 3R6GA 3V4OA 5IAGA 4NBLA 2J30A 1PYOA 3GJRA 1RHQA 1RWPA 2QLBA 4HQ0A 4JJEA 5IAKA 4EHFA 5I9TA 4N6GA 2H5IA 3KJNA 5H0IA 4QTYA 3PD1A 4DCOA 5LUBA 3K7EA 4M9RA 4JQYA 1IBCA 1I3OA 2H4YA 3V6LA 3ITNA 1ICEA 4N7JA 2CJXA 1RHKA 1RE1A 2HBZA 3IBFA 4IYRA 4PS1A 1NMSA 3E4CA 4N6OA 5LU8A 3S70A 4N7MA 2XZTA 3R5JA 3OD5A 3R6LA 1SHLA 3UO8B 4JR1A 5IANA 1CVRA 1RWXA 4ZVRA 4JJ7A 5LUAA 3DEKA 4AW9A 4DCJA 3P4UA 3H11A 5IC6A 3KJQA 3EDQA 4EHHA 3P45A 4QU9A 2H4WA 3H1PA 2QL5A 3BIJA 2CNLA 2NN3C 1I51A 2FQQA 1KMCA 1GFWA 2J33A 4JB8A 2Y0BA 1SHJA 1RHJA 2P2CA 1RWKA 3PCXA 4FGUA 4QUGA 3H0EA 1PAUA 1I4EB 2J31A 4QUDA 3GJSA 5IABA 4JJ8A 5K20A 4QUHA 2C2OA 4N6NA 4ZVQA 5IBCA 4NOJA 4HQRA 4NBNA 3IBCA 2XYPA 1JXQA 3DEHA 4EHAA 3R7SA 3GJQA 1F1JA 1GQFA 4EHKA 3D6HA 4AWAA 1K86A 5IASA 4N5DA 5IC4A 1QDUA 3S8EA 1RWMA 4D3XA 3EDRA 4I1RA 4QUAA 2AR9A 4EHDA 4AWBA 4D3YA 4IEFB 1RHRA 4QUEA 2CJYA 4ZVTA 2H51A 4JQZA 2C2KA 4HVAA
chains in the Genus database with same CATH superfamily
3S2GA 1FPMA 2VXBA 3BMOA 1JHAA 5C0OE 3E9EA 2BI4A 4M0DA 4U9HS 3K71B 3A1NA 4HF7A 2XITA 5L7TA 2BSQA 4Q4HB 5D87A 5IKEA 4IJVA 4YMIA 3DTVA 1PTKA 2ZR7A 3FDZB 3CS3A 1JR3E 5KYUA 2PWAA 3WIVA 2EGHA 4MRMA 3HYNA 1BKSB 5CD9A 4H4DA 2FU5C 1Z6QA 3PICA 2HLDD 2IW3A 3G89A 1GCAA 1SBQA 3X1XA 4C0QC 1CQPA 4UNIA 5F7ZA 4IQ8A 1J8MF 3OP1A 1G4HA 1LZLA 5H59A 5DM4A 4DBLE 2CCGA 3BGDA 2IDKA 4MVJI 2PDAA 4QUIA 3KJFA 3UG7A 3T9CA 3BH7A 4M0MA 1P75A 1OXBB 1W96A 4HDSB 1P4AA 1CS0A 2AT1A 5G0SA 3V1LA 4DILA 3CWCA 6LDHA 1R9MA 2WYUA 1KGDA 2DPLA 3M33A 1YQTA 5DLQC 3V4LA 1C9KA 2FE4A 1ONBA 4LE1A 5TGZA 3TRDA 1IEWA 4I50A 1F0YA 2EZUA 3T5DA 3ZE2B 5BW5A 2RGDA 4LUCA 3ZVMA 2CN1A 1NTRA 2OENG 3H2JA 3OPYA 4S35A 5KNCH 3I9V6 1YS7A 4ZEXA 5JXWA 2WHEA 5K0LA 1GM5A 3HU3A 1B4DA 3AVOA 4RABA 3DEIA 3L7LA 1M2WA 4GEKA 5IP5A 2B8NA 3BWBA 2O2EA 1QVAA 2WT9A 4KMSA 1QWSA 2G07A 1KF0A 3I30X 1KKMA 5JARA 3CVYA 4LISA 5EFZA 2EDAA 2I6TA 5TJHA 1EG2A 4A73A 4EL5A 3O8RA 3FTNA 1STOA 2EWWA 1KYTA 3WHIA 3AJAA 2BGUA 3VH4A 3FAKA 3UUEA 4DCOA 4G81A 1OX5A 4D82A 1QZUA 3V6LA 2WG2A 2IZOA 4CM5A 5LB4A 4ENPA 1AE1A 3S0JA 1K8XB 1COWA 3AGPA 3U7EB 1MB2A 2I1QA 1QGED 3LZCA 5CVUA 5AQ1A 5D1NA 3JVDA 3R5JA 3HYTA 5EAIA 2HTEA 4CJXA 3H17A 2NVUB 3JD1A 2O52A 4UFNA 1LLQA 1PR0A 4EB0A 2BTEA 2ODEA 3L0IB 3RRJA 5IHXA 1YBVA 2Q49A 1E7WA 2A92A 4QU9A 1X7GA 4B43A 1MGPA 2PX2A 1O6ZA 1HDOA 3PXBA 4C03A 2VPIA 1T5OA 3LQQA 3P26A 1C7FA 5SYMA 2R2GA 3B1JA 3NUGA 3F9RA 3HA5A 3DYBA 4DTCA 1S9DA 3LCMA 3VSDA 5DWQA 4ZDJA 1QCCA 5CT9A 4ZEMA 2PKYX 2OWDA 2XYPA 3PQ2A 1DPGA 1I4DD 3E9ZA 1VLMA 3JALB 3OOEA 1W1IA 1RPNA 4L76A 3MA0A 3OOSA 2QE6A 2F62A 4NMWA 2FMHA 2FSFA 4EI9A 2WIAA 3KQVA 4FMBB 3EDYA 4WX2B 3FBTA 4QTUB 4YRNA 5KNDD 1QGUA 1DEHA 4MUXA 1CY7A 2R5NA 1T6YA 2Q3BA 4DIOA 4ZKDA 5F33A 3W0LB 2O8DA 3L1IA 3RJTA 3KQSA 1K4KA 2QX6A 1O9HA 4UMEA 3WL6A 5HRUA 3GH3A 3KPVA 3LIIA 3ESAA 3FCYA 5FUVA 2NU9B 5K4AA 1U2SA 1U7OA 2F3PA 3CA8A 1A8SA 1PG5A 1N4AA 2XZLA 4LBWA 4ZV7A 1MX1A 2C20A 1IG3A 1QHXA 2P4QA 3EMVA 1IONA 1GCOA 1H2HA 3A04A 4YDRA 2FUG6 2JKZA 4DGQA 3Q4GA 4XQGA 1XCLA 4QARA 2PWYA 4MUIA 3FVTA 1B73A 4IMPA 1PT6A 4L15A 2ZPUA 2EGGA 3GLKA 3ZNOA 4RJTA 1SVSA 2VNIA 3IIKA 2VQ6A 3QXXA 5KREA 1B43A 3VR2A 5KEIA 2NYVA 4UTZA 4E1AA 1ZONA 2IEIA 1PZNA 1IYZA 3KVVA 4GICA 4OB7A 3WYAA 5K0SA 1T1IA 1ECGA 1OC2A 2FXVA 2ISCA 3K1ZA 3ORFA 1PX0A 1B8VA 4K0RA 3UXMA 3L5KA 4I81A 4KI7A 2RBKA 4I6EA 5AVJA 8ADHA 1A97A 1LNSA 1EFKA 2VJLA 1DT5A 1Q2XA 5AKLA 1HYHA 2XSZD 1YDHA 5JIBA 2B20A 5B3KA 2Z6AA 2K4MA 4PBTA 3K70B 3BB3A 3RYFA 3II6X 3PGJA 2E7ZA 1P1JA 3ITEA 3LG2A 4J7CA 4U0KA 1JEAA 1KU0A 2X2FA 1Y4SA 1TEZA 3RK0A 1FY2A 4TMTA 4IX9A 2DYKA 3ROQA 5LQCA 4G0NA 4XPIA 3RARA 3SU8A 2JZCA 4PYNA 5B1HA 2DVMA 3PVZA 4QBIA 5DIZA 3T7JA 4EGAA 5A04A 1NX6A 4QU8A 3B13B 3E3OA 3ET5A 4BLOA 4DMUB 1WZEA 1TF5A 3RC9A 3T1VA 3TLXA 1L4LA 1K7FB 4E2FA 3DEAA 4D74A 2VQEB 4NZPA 1W94A 2I7XA 3QKRB 4NZYA 1E5TA 1LTHR 3KU1A 4XA8A 1XPUA 2QRGA 4RHUA 1P2GA 1UJNA 4K9DA 2MSDB 3SSOA 1XJWA 3AY7A 4JWTA 1Z5ZA 2FMKA 3Q0IA 4XTCS 3U3DA 4YWHA 3NC4A 5KYTA 1O9BA 4HATA 3T7IA 1I5EA 1UMBA 4Z3KA 3ZLJA 4JU9A 5K2MA 3BREA 5LB2A 3M3DA 1V45E 5FWYB 3D3NA 1H8HD 3ESQA 3QLUC 4ISBA 4MW7A 1E0AA 3THXA 3BGIA 3BF8A 4YMHA 3PQCA 2J7PD 4C04A 1FLNA 2XAUA 2K5UA 2X0FA 4CF7A 3ZZTA 3NHZA 2W43A 3K32A 4D9MA 2R97A 1YUNA 3LDFA 1KAOA 2O2YA 4DXHA 1NNEA 1TKCA 4JMLA 4FDTA 3SK0A 3WRYA 3IHKA 2A1UA 4NS4A 4BBZA 3C5EA 3K31A 2RGWA 1L5GB 2JFHA 3GLGA 5FX2A 2P2CA 1FNDA 2PAFA 4YJGA 1GZVA 2E4AA 1E20A 4DOMA 5ES3A 2CHVA 4KXYA 5AW7A 3HCEA 1N57A 3HDHA 4D4HA 3SIXA 1RKXA 2PANA 3N76A 3STVA 3WK4A 1C3EA 1R8QA 1FTGA 1SZDA 4FLEA 4RK5A 4D9EA 2BE7A 4F1JA 2ERCA 3NANA 5FHQA 2WWGA 4IOMA 3K70C 3IMKA 4JJ6A 3EQ6A 3GJQA 3ABIA 1DO0A 1NVFA 3KLMX 3LP8A 3GN1A 3O94A 4IYJA 4KPUA 3PQ6A 3FBGA 4TXHA 3RFCA 4C07A 5ILOA 3LUFA 3HYRA 3FH0A 5CB6A 5BNTA 1RQGA 2ZTUA 3OMXA 1GT91 2Z2XA 3IB3A 2D00A 3NGXA 3RLIA 1ISFA 2J87A 3O8QB 3H84A 1X92A 3BUSA 1VMKA 3DMFA 4MCAA 4NCHA 4QOEA 4DLAA 2XUFA 1XN1A 3TBHA 2ODNA 1V48A 3B3AA 2ZRHA 5CG2A 3CJRA 4QU5A 4QDOA 1RAIA 5CCXA 3A37A 1VE9A 2P9TA 3BL6A 1X7WB 2H1FA 3QPDA 2SKDA 1CEYA 1DIHA 3WQBA 4Q01A 4OX9B 1IXSB 1PFWA 3CUSA 1VI2A 1X2EA 2UUOA 2O0MA 1C0EA 3KTOA 4NOKA 5AHOA 4JBWA 5F2NA 3HGQA 5G3ZA 2C82A 2CNNA 4UM9D 4KREA 3LLSA 5D51S 2PJDA 5DLDA 4MPTA 3HH8A 4K28A 1LFDB 4PBRA 4KGZA 2D0OB 4N49A 3RGWS 1TO1E 2GM9A 2CBGA 3LGSA 2J6HA 2VATA 5IEJA 1XA0A 4DCPA 1CYDA 4O0MA 2GJ9A 4EKYA 1BMQA 3K9FC 2OG1A 3NPAA 2VP4A 2IC5A 5H4GA 2VRCA 2C0CA 1Y98A 2Z09A 4C5BA 1BCSB 4F06A 3T38A 3VHQA 1J97A 4CDGA 4KACA 1QKIA 2CLHB 5H7XA 2HUNA 3DONA 3JQFC 3NWPA 4QE3A 3SY8A 2NXJA 1XQYA 3IURA 3RAEC 2YWHA 1X42A 2Q0QA 2C5HA 3QXCA 1DINA 2ZJ6A 4K9LA 2YR0A 4TVBA 3EIFA 4P0QB 4PWZA 2AN5A 1ODCA 2B37A 2CLLB 2FVXA 1UJBA 2XUQA 2V0GA 4F8EA 3IAUA 3O8OB 4Q3EA 5ESXA 5HZGA 2A4KA 2VJDA 3WE7A 1M8FA 3STYA 5T3UA 2V8BA 3RS9A 9LDTA 1SXJA 1GTSA 1K5PA 2XTZA 2QMYA 3DKKA 3B2EA 3L0ZA 4D79A 1IUNA 1NRWA 2HFJA 4G4SP 1JAYA 1P6XA 1N0VC 3C3BA 3K0AA 3MF4A 1GZ7A 1E6WA 3R9KA 1RHKA 2Q5EA 4N6OA 1I2MA 1SUIA 1N2EA 1UK9A 1I3CA 4DRXB 3OX1A 4GI1A 4PW0A 1NZJA 1Q0PA 1Z0SA 5G1PA 4CL3A 1DAMA 2XMCA 3GFGA 2J7KA 2PGAA 3WI7A 2X41A 3GNQA 4RV9A 1JQEA 4WZAA 5CFZA 1K66A 3I39X 3V1MA 2E37A 2QE7D 3DDHA 4BMZA 5TEWA 1VBNA 4QO8A 2HRCA 1LB1B 1PNTA 3WAKA 3L8YA 1J4AA 1I51A 1MZPA 1AQ6A 3E9MA 4L74A 5A5DA 1A82A 1D6SA 1I2AA 3BFKA 4BP1A 1K92A 3UGQA 1ZW1A 9ATCA 1E1RA 4WZBA 2PX6A 4V1CA 1L7PA 2ZWVA 1TF2A 3QVGA 5A4FS 2RGRA 4RNCA 1TUIA 3I6BA 3LSTA 1V5EA 3NORA 3O2JA 2HLPA 4XPZA 3RHZA 1Q0RA 1F7UA 2WF7A 5G4KB 5K2OA 3GGJA 4NNPA 5J2TB 5IW8A 1R5NA 3O8CA 4A2QA 4N5DA 1U0HC 3BB4A 1ZVJA 2XGJA 2VAPA 4MARA 1X7YA 2P7IA 4XYMA 3PIDA 4B75A 1HE1C 3WWZA 3TLZA 3ZOZA 2GOYA 1YOBA 1E2EA 1LF0A 3FDIA 3M5CA 2NU8B 1OGIA 2C2WA 2OQVA 2DMRA 4MUGA 4REQB 3FZNA 3WLMA 2CSUA 2YNMA 2FVYA 1C3XA 3IV6A 2B8EA 5E6SB 3WLNA 1UM9B 4GKAA 1KDYA 4EOGA 5FO1A 1SVMA 4TMZA 3HXMA 2NVWA 3UJHA 3ZJTA 4MGZR 1S4MA 5DT2A 4QLBA 5CIYA 1KSFX 4NCKA 1TQ6A 3AXSA 1O0CA 3MCZA 2ZSIA 2OCIA 4PSUA 3ZGYA 1ZJZA 1YZUA 2FFBA 3GG2A 1CVLA 1FUKA 3H3FA 4O29A 2AN3A 1IOVA 4B35A 1LX7A 4AAYA 3PCRB 3WC4A 4B32A 2X4DA 3BA6A 3DEYX 2EG5A 3S99A 4C08A 5IX8A 4CF4A 3ZLBA 1ANKA 5MGNA 1U2TA 1XRNA 4YLEA 4FOOA 1H8HA 2GRJA 4F3NA 1XKQA 5L9AA 4M7WA 1L4HA 4MS1A 2P62A 4ASUA 1D5CA 3W5VA 2O2DA 5ICGA 1UPCA 4BMCA 2E82A 1GZUA 1UBRS 3CLRC 1Q3KA 3O3OB 3KXPA 2OP0A 1Z6XA 5C7OO 2ZS8A 1D2NA 2CWWA 4GMHA 1M1YA 3RIMA 3QU4A 2GF2A 5B58C 3QY9A 4RSMA 2D54A 3PUZA 4RS4A 1AXGA 2PRKA 2JIZA 5FNVF 2VDUE 3ZCQA 2YHUA 2C2HA 4DY4A 1Q7EA 3GEEA 2M6SA 3DOEA 3H8SA 2PLFA 3AT1A 1NQWA 3NEJA 5K51A 1FJHA 1YZNA 1JE1A 5HUQA 1ELOA 1ICIA 9LDBA 3A1FA 4UNPA 4C22A 4BU1A 4AKIA 4YP1A 2KJQA 3U13A 3IX7A 2RHHA 3N8NA 1UPXA 2W9XA 1QSGA 2AEMA 2Y0DA 3GT4A 3N6XA 3T5CA 5KWJA 4CUZA 2PCLA 4CR7A 2XMQA 1FFHA 4PYLA 4YAEA 3EWSA 2GKGA 3WNBA 2Q5FA 1QXSA 2A9OA 3FWHA 3GCZA 1KMHA 4QBHA 5F5NA 4RAOA 4EMSA 2WWFA 1HYEA 4DHWA 3RS4A 1UDRA 2G1UA 1VSQA 1GP2A 2C9MA 4JCOA 4ZI3A 2NUPA 2YVLA 3G0IA 4G5YA 2C8JA 3CEAA 3D7NA 2ODPA 1U3VA 1SQ0A 4HXGA 1VECA 2PRZA 2AOWA 2FAXA 2R9VA 2I22A 2BM0A 2G0AA 2QR3A 2YY6A 3GLUA 3M0EA 3AEUB 3NYIA 4PHHA 3T8YA 4D5GA 4N5LA 1W5FA 1P1KA 1XZFA 2ZW9A 3LP5A 4RTRA 4B7CA 4KXXA 3GPCA 3K05A 4A23A 5EHZA 3ENKA 3H9JA 2JAUA 5EE1A 5FO0A 3RU3A 3X1ZA 5CH3A 4QT4A 5EA2A 1EP2B 3F6RA 3GT7A 3OM0A 2AKAB 1O89A 4LDZA 4BJ6A 4FWIB 3OUTA 4BKRA 3PX3A 5KTMA 3GELA 2Q7OE 1GQFA 1QE5A 1ZSVA 3ME5A 3TLAA 1P62B 5DNCA 4PTYA 4DUZB 1IHOA 1N5IA 2DBQA 1QMPA 1LSSA 2XIQA 4HDRA 4AJ2A 4D6PA 2QRVA 1NUQA 3CKLA 1UL1X 3B3GA 1JQ3A 4ZAYA 4JWKA 1V8ZA 2WB4A 3EBOA 4R5HA 3RUDA 3AEZA 1TJYA 3L77A 3OBIA 5A6SA 1OI2A 1PK7A 2XNCA 3SXPA 4DB2A 4OFBA 3KOOA 3QEKA 2X9VA 1ZWLA 1JU4A 3ZW9A 2XCIA 2WA1A 3IILA 1NR1A 4TN5A 1PNRA 4Q7EA 5DNWA 5IJXA 1T35A 2YHIB 3C4VA 2HYDA 4FB5A 2FFAA 1YJAA 4O25A 1LDGA 5B3LA 2IXBA 4LHEA 1JLMA 1MQ8B 2D4AA 3P2KA 4KQEA 1NXWA 1F2TA 4N7RA 4UBIA 3H4VA 2QBYA 1R5OA 1CY2A 2CHGA 3BXGA 4JODA 4B5KA 5DRYA 4ZCRA 5FAKA 1JQLB 2H54A 2WILA 2VFAA 4XSGA 3ETEA 1FS5A 1U0RA 2FDXA 4LNAA 2ZRGA 1QF7A 3BJIC 1L5WA 5LC1A 2EFEB 5IM5A 1X1CA 1SPXA 2QM7A 3TM4A 3COSA 3PUXA 5A06A 1ZS9A 3E03A 3C6YA 1FC0A 5TS2A 4MCJA 4DR5B 3FRIA 1NYLA 1XVIA 2HA2A 4BEVA 4WVLA 1E1LA 2HJSA 2OFWA 3E18A 4AWXA 3ZBUA 1WDTA 3AI2A 3M4ZA 3IRUA 3VAZA 1U2QA 1PZFA 1XZJA 1IMOA 4XSVA 1KYVA 1MVOA 2GEDA 3F98A 2C1EA 5FQOA 3GT0A 1FA9A 2J3HA 4HFJA 1E2IA 2PXAA 2IWRA 2CNBA 3RVOA 2Y05A 3R3XA 2ZJ8A 3TGWA 3QF4A 2NU7B 1VGRA 4HZIA 121PA 2X1HA 3L8CA 2X86A 3Q3JB 4HR7A 1U8YA 2WPNA 3UUFA 4UVHA 5FWNA 4BFLA 1U0JA 1ORDA 2WBLC 1KZHA 3UHPA 4OI2A 3UT5B 1GA1A 2BWJA 2WQZA 3OHMA 3SF8B 3BT7A 2AYYA 3CWQA 4OU4A 4BGUA 2PKEA 1BHJA 3DAPA 3MWFA 5EXDA 1C1DA 2R1TB 3CVOA 1KMQA 4IGKA 4HAIA 3VU0A 3ZXIA 1N6HA 2EWMA 5CA1A 2R751 2VJMB 5KOJA 1T2VA 2CXSA 1YCDA 2WTAA 3P0HA 4ESHA 1TMGE 1FNCA 1A7UA 2P1RA 4BRZA 1VE6A 2VNAA 3O3CA 5HUHA 1Z2OX 4O63O 2BEVB 2D8AA 4CQNA 1O97C 1A4IA 4NULA 4QYTA 1FX0A 3E35A 1IATA 4MYDA 1DAEA 1B2LA 2XZPA 3WNDA 1UFQA 3ZKWB 1E8NA 2W2KB 3DMTA 5F9HA 1DTSA 2EJBA 3EZYA 3ZWOA 1GFWA 3F2VA 1I9CA 4BNWA 1WWKA 3ZY2A 5EKUA 5CA0A 3LWBA 1A2QA 1DRUA 3ILXA 2GO1A 2BI8A 3SQWA 5D6NA 3E9NA 3L0PA 4Q1BA 5DVZA 3USZA 3QWHA 5DTRA 4XLZA 4EYSA 4YTEA 1VL1A 3WP0A 4Z51A 5JS1A 3BRWD 1MC5A 5KWSA 2ZSDA 3EEYA 1Z0JA 4PINA 1EFPB 1Y8QB 3WB0A 2NLOA 1JFLA 1YA4A 3LCVB 4KH1A 4TMWA 3RC1A 1TVKB 1V2HE 1UJCA 1L7EA 3BDAA 3INGA 4URYR 2I91A 2PSSA 1UZNA 2QZPA 3LUHA 4RU1A 3S2EA 4ITVA 4DBZA 4QUKA 3GL9A 3LT2A 2VHXA 4AF6A 3IKMB 5K05A 3HM2A 2MIIA 2JASA 3SG0A 5TMBA 2EEPA 3KL2A 2P3SA 2WJ4A 4FOSA 4P08A 3U3JA 1OA1A 1FVFA 5FWAA 4Z9YA 1SKQA 2NX2A 1X19A 3N9IA 4ZU1X 3W05A 4GYWA 4O4HF 3PPXA 2J0QA 3OEEA 2JJMA 1TB4A 2AGVA 4YP7A 3NRJA 2JFXA 3Q10A 4K7JA 2C00A 3PC2A 5AI9A 2XB6A 3OTOB 3BHNA 4GPZA 1UJ2A 4JIMA 4EWLA 1JEQB 1K8QA 5TX7A 1UFOA 3V2UA 2C92A 4FS3A 1U9IC 2H5JA 1D0IA 3DV0B 3VFDA 3MTEA 4LXIA 3TB6A 3UMGA 4ATNA 3OZ7A 4HAUA 2E9SA 4QXPA 3EVBA 3TNYA 4URXR 2GBLA 2QL7A 2IZ0A 1HNNA 1T36B 2DQYA 3E7XA 4BIMA 1CFJA 4JL6A 2XDYA 1KETA 1YRHA 4GOKA 1JJVA 1HNWB 5JUWA 3GMSA 1ZBDA 4X91A 5HOQA 1T4BA 1XEAA 3C45A 5TT1A 1B3BA 1KJWA 4WQMA 1II8B 2ZSEA 2VSQA 1XPOA 2Q7XA 1IDN1 1VPLA 4ND8A 2FKNA 1XELA 3KYDA 4NOLA 5JALA 4RPLA 3THRA 5DBGA 5K01A 5AOCA 3KZMA 2W2PA 2OBBA 1SIOA 3PJDA 1M7HA 2JLVA 3CNBA 2C9ZA 4RK4A 5J40A 4MIKA 2QSJA 1G291 1W1WA 1YBMA 1R6UA 3C6XA 4RDCA 2OV3A 7REQA 4CIWA 3ZZUA 2QY6A 4ARIA 3CJQA 6ADHA 1M1YE 2PX5A 4IIHA 1B0UA 1OI4A 3WRXC 1YVDA 1ODKA 3CUEF 4CTMA 1KEPA 4IV0A 4P5PA 2AE2A 4RVGA 3K30A 3PBKA 2Q7DA 3H0KA 4ID9A 4K6FA 4PNPA 2CJWB 4MUNA 4NK4A 5LUBA 5FUYA 4YRBA 3RC8A 1YR8A 2IU4A 4TYPA 1TK2A 5AICA 5L3SB 3FZGA 1JGTA 3RBVA 1N0UA 1T8WA 1H0KA 1LPOA 2O8CB 3L4KA 2ZR0A 4EDHA 2ILVA 1P4HA 3L7MA 3OQVA 4KMRA 4YRDA 3RVBA 1YB2A 4B0OA 2FN3A 1ULAA 1HV8A 1TMKA 1ZVKA 2FFJA 4E5SA 4FMCB 4GLFA 5C5EA 3SMVA 1WCYA 4RVOA 4UE6A 2O4UX 5BR7A 4CV2A 3F6PA 3DMGA 4QG7A 1OYYA 2P9EA 3HYSA 2GZSA 3OJ0A 3QIAA 2CNDA 3QVWA 4LDPA 4R2WA 2ZWIA 1PJRA 4RY2A 4NJMB 2XT6A 4GRAA 3EULA 3FFXA 1JJIA 3HPQA 3I52A 4UXJA 3HLYA 5KVVA 2A33A 4CMCA 4MQ4A 4D41A 3GUHA 2G09A 1OFGA 2C8VA 4I50B 2VHUA 1JLSA 5K4GA 3C3DA 4D9IA 2PS0A 5I9LA 3OD1A 2FSSA 1XLWA 3DWFA 4OKIA 1D6MA 1MOZA 4KQ1A 4L9SA 3BKXA 2JH3A 3JQ7A 1PJ2A 3C14C 3QXJA 2OV1A 3N53A 3MUFA 2HPVA 2FX3A 8GPBA 3QOFA 5EIFA 2NG1A 4I1RA 4D0GA 3K20A 4JBGA 1BHQ1 4JBIA 3QPWA 5J4YA 5KCZA 4I6GA 1FZTA 1QYXA 4ZXFA 2ZJOA 1C7RA 2UUPA 2HSWA 3CUVA 2QORA 4P93A 3PWZA 4IOJA 4E07A 2HLNA 1W8IA 1XIVA 2WZBA 1NF3A 3TZCA 1KR5A 1Z82A 3CNQS 3LDGA 1IRIA 4J0QA 3A3YA 4NATA 2HXSA 4QPJC 4NYIR 3Q8MA 3PA6A 2UYQA 2FZ4A 3ZHCA 2FN4A 4D56A 3O4HA 1NJ1A 2B1RA 2OZLA 5C5CA 1CY6A 3PLRA 1FTYA 1NHWA 1J2TA 3UUWA 721PA 4BQSA 4X85A 4ZEWA 3CVXA 4Q19A 3Q1KA 1SOMA 2P9QA 2M6LA 2IYZA 1B1CA 4IDGA 1KZ9A 2AIRA 3DZ8A 4K3VA 4AX8A 4C0KA 5HS6A 3SJCA 4AO8A 3Q2OA 5JQGA 3FFWA 5EJ9A 1SCAA 3QTTA 5LQUA 3G49A 3IUBA 2MYTA 4S0XA 4PHTA 2O7SA 1DJQA 1H2EA 4KXWA 3NM6B 3MD0A 1IN4A 3QF7A 5EIHA 5JECA 2F3UA 4JLNA 5P8WA 4KP7A 4I1OA 2WHPA 1BE8A 1ID1A 4EMTA 2HCJB 3MZ0A 3WLJA 4MQEB 2Z04A 4B3BA 3IQWA 1RRPA 3FSRA 1XROA 4LDJA 5EPEA 2ZE8A 3KYBA 3L43A 2QE7A 3MN1A 2NTNA 5EI5A 2EBUA 3BWEA 1SM4A 4GM1A 1NDHA 4FTWA 5D3ZA 1JJBA 3SF0A 4V1CI 4XFKA 1BVUA 2R65A 1WSBA 3GWZA 4MWZA 1GV1A 3SHTA 3U7FB 4F6RA 2OHOA 4Y6SA 2D5LA 1FVOA 2H2FA 3ICPA 4HNAB 4KZPA 2M6KA 1R37A 4U9IS 1X1DA 2OB1A 2ZBDA 3TW8A 4HAZA 5LU9A 3PC6A 3D7KA 2RB5A 1NPTO 1VPTA 1E2KA 3EIEA 2JK0A 5IUKC 3PD1A 5E1DA 2B4YA 2WHXA 4IHAA 4MPPA 4YRSA 2XLCA 3CF6R 1T9GR 3WHPA 3RAGA 4JBXA 4O02B 3I9KA 1JR2A 3K4HA 4Q00A 4QICA 2A4MA 5KU1A 2BRUA 1FJ2A 4NAUA 3BJMA 3H4MA 4PG4A 3NHJA 3I4CA 2CUZA 2FR1A 1YXMA 2SCUA 1JMVA 3E3NA 2Q50A 4INZA 5BV0A 4F93B 1EDOA 3FHLA 4MA5A 1KOJA 1ODJA 1YZLA 2SHKA 3AHFA 1EGQA 1EJBA 3IJRA 3PUHA 1V7PC 2QLTA 4KFSA 4ZI2A 4DIMA 4EHHA 3PGMA 3CISA 4UPEA 3CH7A 4V1CB 2VH2A 3BIJA 4FHGA 5TVGA 1UODA 1JBKA 4UQPA 1C8KA 4J0DA 4P7KA 4L85A 4RGBA 2ZREA 4HWTA 4FZVA 1I94B 3QVKA 3WJ7A 1TM7E 2PA0A 3Q6IA 4II7A 1M7GA 3R0XA 4Z1OA 1PW7A 1PUIA 4ZI7B 3F49S 2Y0PA 4KQ6A 5ITZA 1TZBA 1R5JA 1JHMA 3K9LA 1C8VB 3HB9A 2HJRA 2GI4A 3BCSA 2A3RA 3HBFA 3DMTC 4L5JA 1J2RA 1M75A 2HFKA 5H02A 4KPFC 1KSGA 4E5DA 2GAFA 3AEKA 1DARA 5B36A 2F43A 4YLYA 3GLGE 2CF5A 3D59A 4RSRA 4A6EA 4EHDA 1P0QA 3HHEA 3G2MA 3H6KA 5L3RA 1N2IA 1XXLA 2HF7A 4J0GA 4QUEA 2CJYA 2W7TA 1WPXA 1RACA 2PVPA 1K6IA 3KVOA 3LQFA 4H6XA 1NBME 3QQ5A 1ISMA 1EQUA 1OAAA 1XDBA 1Z4MA 2OORC 2Q1WA 3FPEA 4OMFG 4AT1A 4EW6A 3L0YA 3QX9A 5LMCA 1EK5A 1KRWA 1AXEA 1ZUWA 2E6KA 4X65B 1HC7A 2CBZA 1DG3A 2EKZA 4MR9B 4OQLA 2NUTB 3PNMA 2FRDA 5LOVB 3P52A 5F5LA 1GTMA 4MV8A 4QXQA 4MRRA 1S2OA 2G28A 4RWZA 4C0LA 1I0IA 4IQGA 4X3CA 5EHNA 2AG5A 4L5BA 2ONCA 4FNGA 4DPKA 3TI9A 4EG8A 1BTOA 1LPNA 3GIWA 3F9CA 1A04A 3IT2A 2XBMA 3VJLA 2QTGA 5C8XA 1I3KA 1Z4PX 2Z8YM 4E14A 4HJXA 1T26A 2HA4A 2IXGA 3CEMA 4XD7D 4A26A 1Z5GA 1X9GA 4MCIA 4B0PA 4LHZA 2VPQA 4S1NA 1FW6A 2GTIA 1Q14A 4G2NA 5GJBA 2NXEA 1ORIA 3R7FA 5C1OA 1J09A 2QX9A 1HG0A 3GUZA 2NW6A 2V7QA 4QODA 4ENTA 4LE0A 3J7TA 3QKIA 4N0QA 2NO6A 2HF9A 4UHKA 4BVLA 2WT4A 2XCUA 3DE4X 2IL1A 4C4ZA 4HNVA 3KKMA 4QPDA 3NKVA 5A2QA 2XT9A 4DV6B 2W6PA 2F67A 4C6RA 2J3DA 1P18A 1QHIA 3PNBA 4FCWA 3H13A 5IKOA 4C3ZA 2FR0A 2VBIA 3Q3HA 2IK8A 1R16A 4NR0A 3RSZA 4TUYA 1WUHS 3IVGA 3TZQA 3BMCA 1WUIS 5FEUA 2ZTMA 3EK2A 4F4UA 3FLBA 4XYEA 5F1PA 5KNCA 3ELDA 4QA9A 1J1IA 2AFRA 4QBFA 4I5GA 1X9IA 3FPGA 4FWBA 1FU7A 3UJ6A 4EI8A 3OTGA 2CL6X 2FSVC 3ULKA 5EJ5A 3D5EA 2ZB2A 3HJGA 1AGYA 1JDSA 1NVXQ 3MCWA 2GJSA 2H4XA 2ZJ4A 3IQZA 2XMBA 3P9PA 3LC2O 3EQ7A 4QGHA 5JJCA 2H18A 3OOYA 3EHEA 2NUPB 4BNDB 2VYVA 4LI0A 3PVSA 1KFBB 4U5QA 1AK9A 5E1BA 4IILA 2ZT7A 4N5MA 1KPHA 1U5BA 2C7GA 1QHNA 3P45A 3L6CA 5L6LB 1TCUA 1YQUA 1WRBA 1E6CA 1QRTA 2HXYA 3MWJA 1XZQA 5G53C 5FWXA 5DWVA 4UM8B 1F5NA 1G8YA 3R9IA 2KBFA 1RKBA 4MP8A 4EUNA 1OMOA 2IP2A 3EH1A 2ZYIA 4FR2A 3DQPA 4FW8A 1SOWA 4P4GA 3AJRA 3VTAA 4B1FA 2AK2A 4E3WA 3R6TA 3T1OA 2YBEA 1HK7A 1MB9A 3AEQB 3IBCA 4J6EA 2IH2A 1G42A 4CCAA 2DRIA 4L9AA 2BUBA 4X8MA 1WNTA 1DFIA 4AUEA 1VYTA 4QD3A 3OQBA 4Q03A 3ST7A 3SXUB 3TJZA 3WYBA 4DJ5X 5KC8A 2YOHA 1NQUA 2AOTB 2UZ1A 3PVCA 2ATIA 4EEKA 1KRXA 5HIAA 2ZJZA 4JBYA 3ROZA 4DANA 5IKXA 1DTWB 2HHHB 4KJZA 4RCVA 3RHTA 2R62A 3VKUA 3TUIC 3UJ8A 4EBFA 2REBA 3WDMA 2ZVPX 3R40A 3BTUA 3WP1B 1G9SA 2VRWA 3I53A 2FLVA 2GN0A 1DG1G 2B30A 4FQ8A 4QL3A 5CXXA 3RYIB 2VSXA 1P72A 1W59A 1GNTA 1AKMA 2VPXA 2WYOA 5FTNA 2VO1A 2EX0A 2QX7A 3HDQA 3D8SA 4S2EA 1E1YA 2VRCD 2I2FA 4JUFA 1E77A 4A8TA 2M1XA 1M8KA 1NY5A 3U17A 4MGYR 3K1AB 2NYAA 1QQ7A 2B1QA 3TIGA 1ZM4A 4PLZA 1ULUA 1P0IA 4PRKA 2ZTHA 2OPBA 2V55B 4KWIA 3BMNA 4XXHA 3H99A 1WZ2A 4KN9S 3CX4A 4WXRA 1SKAA 1V5GA 3DB1A 4DSTA 1A8UA 3IALA 1CJMA 4DNQA 4G5SA 2PUWA 1TQ4A 5SY4A 3DR5A 1F6WA 3VHXB 3VKFA 2WD7B 4PZPA 4RZQA 2YWDA 3V4VB 2GH1A 5HHTA 3KKLA 4MV5A 1G8KA 1RZ3A 5CDTA 3RNOA 3FVRA 2P5SA 2ZJFA 4UEKA 2DPYA 4GT1A 4BFYA 5A4MS 3AHHA 1VIMA 1JQBA 1XF1A 4BMXA 4CUKA 2X9NA 5DBHX 4NDZA 3UAVA 2RGUA 4BMYA 3G2PA 4P7JA 2YBDA 3D64A 1XYVA 2IOYA 1YUBA 4LDAA 1I2BA 5A5VA 2WZDA 3U26A 2JLYA 1I32A 3PFHA 3D3WA 3C8HA 1VSUA 1T2EA 3PQ4A 3V55A 1J20A 3OICA 4KTVE 4M9XA 2HSDA 2VL7A 2OFXA 3O4GA 4MW4A 3VKHA 1GYQA 3HNPA 3K2IA 3NBYC 5ILQA 3RJ5A 3SEZA 3UGKA 1WAMA 2G5CA 3A11A 4J7AA 4GL2A 4GI5A 5AHKA 5ICMA 3VKWA 4P98A 1ULHA 2Z4TA 4D0RA 3C24A 5HIKA 3MUNA 1G3IA 4Y7DA 3W5DA 1TYCA 1E3MA 1NULA 4Z0TA 1OAOC 1U6KA 2X77A 1PU2A 2R6R1 2WFLB 1JHDA 3A1CA 1OOEA 3KR2A 1R15A 3FOCA 4JEUA 5IWAB 3TRJA 1Q57A 4D3ZA 1XZLA 3R3UA 1KO4A 1DAOA 1XD8A 5CMLA 3RYTC 5I7EA 4PLPA 4BKQA 3BAFA 2WJGA 1TUBA 5C8DA 3E2PA 2V9ZA 4O2AF 4TMVA 2RHCA 4B9EA 4E2YA 3IQGX 1J0AA 1N5OX 2HQ1A 2ZTLA 3T5TA 3UO8B 3MG9A 1O4WA 4KI0A 5KYVA 3ELBA 3K9WA 3MTGA 4N18A 1LEHA 3AVYA 5J4KA 2FWBA 2FPIA 4NBTA 2YVAA 3I58A 3IP8A 3SS9X 1AO3A 2XTNA 1CUGA 3RLFA 1T10A 2Q28A 4BRWA 4ZYVA 4RE5A 3GT3A 4V2UA 1R00A 1WCIB 2AOUB 3HP1A 1JAIA 4HRXA 4NYMR 4R69A 4YS6A 3MRSA 1U1IA 1U2GA 3BGSA 1KE1A 1U9CA 5LD2C 3OWOA 4K86A 1YNOA 1YB4A 1TE2A 1EXDA 3HI6A 2A86A 4KVGA 4Z7NB 5KJ1A 4RGVA 3I8XA 3SFVA 3OPYB 4BEBA 1NIPA 2XRFA 1G38A 5CDGA 3U1TA 4JJGA 4OXIA 2CHQA 3AGQA 3NG1A 3OETA 4A91A 2IQ5A 3DXFA 2EJCA 1MLDA 4IPTA 4B82A 4P7BA 2RK3A 3VOSA 1MC8A 1YJQA 2WTEA 3PUJA 1ACLA 1NV9A 2Y67A 4WOCA 3DFKA 3FMOB 4YQYA 5I7AA 4BFSA 3W5IA 3GAMA 1AM4D 1XYGA 2V6IA 2EBHX 1QZZA 2IYVA 2QX8A 3F78A 3ODPA 2WTBA 3WXMA 3OJLA 5E9WA 3K5HA 3KZVA 4XB6B 3ANNA 1QGUB 5CJJA 4AROA 2P9BA 1Z4JA 5JRJA 3D6FA 1GXSA 2GB4A 3OIFA 5EIXA 1Y89A 4R8LA 2EIHA 1PT8A 2NZJA 4JR2A 6ABPA 2PVSA 2N3ZA 4YP5A 1P17A 4UMFA 3T52A 3AFOA 1OAOA 3AJ9A 1YJ5A 1AC5A 2A9KA 1OV6A 2FPGB 3AI3A 3BC1A 4U39A 4ZI5A 1QB8A 4MQ6A 1YBHA 2QTZA 5E4YA 1E4VA 1EEXB 4RHYA 5GMOA 3FX2A 1CZHA 4XIYA 3F2IA 3QBTA 5FPHA 5LQMA 2VPYA 521PA 2G1PA 1TLTA 1W5BA 1LW7A 1BO6A 2OR3A 1KI2A 3O95A 3QK7A 4F1KA 4XARA 4FNOA 1RRGA 5BNIA 4I4TA 1W4BA 4JVMA 2FMIA 1N1MA 3W9BA 1XNJA 2KX7A 4YJ2F 1U04A 2QTFA 3LLMA 5E9JA 2XYRA 3T1NA 1GEGA 2W98A 2IGBA 2HTFA 2DT5A 2IBMA 1N2OA 1KERA 3NT5A 3FUWA 4M46A 4MV1A 1URPA 4B84A 2ZI5A 4R84A 3GFRA 2XQKA 1PKEA 3HI4A 3WB9A 4G5FA 3ESZA 5EP1A 4BQEA 3SJUA 2OV2A 1ZHOA 5AKKA 1WOMA 1CDDA 2CY0A 2VA8A 5EUCA 1IBSA 3TQQA 3ZEIA 1Z5UA 4FDUA 2FWNA 2PZJA 4YV0A 4O1MA 5KTYA 1M83A 2LIPA 2QRVB 3DEZA 3UHFA 3ICQB 2WMOB 2LD4A 3G1WA 3L07A 4WJKB 1TW2A 4ER6A 5JI2E 2W8ZA 1K88A 4CMKA 4Q05A 2A84A 5LA6A 4I9NA 4YALA 1YNSA 4D45A 4I9FA 4TKLA 3LZ6A 3JATA 1S3GA 4ZT4A 4M7OA 5HFJA 5BPFA 2BFBB 4KQ2A 5KJ6A 5HS4A 1S5PA 3TBKA 3L4EA 5ENVA 2VKQA 4J94A 2ZB3A 5TC4A 2BFAA 2R7LA 1UP6A 1DQRA 1KOLA 4KN6A 3ZDAA 3OJWA 1J9GA 1TGVA 3WB1A 3MYRA 5KJCA 1E63A 2XVXA 4L4SA 4LZJA 3PXAA 3L7YA 4G24A 5LQAA 4DFDA 1HTWA 1WF6A 2EW1A 2O5VA 1BHSA 1UM9A 1VKRA 1OYVA 3A2LA 3N2EA 4U7TB 1LV8A 1ML4A 4ZCPA 3TB4A 4RMIA 4G65A 1DCFA 1B8PA 1NZDA 1OY1A 1IBMB 1XMQB 5JSYA 1KS9A 2Q6KA 3PK0A 4HX2A 3UHOA 5BMOA 1G5IA 3UBTA 2C2BA 3U4QA 1XO1A 4YMSA 1F8GA 1TGYA 2JKYA 3UA3A 4Y6GB 3WGTA 1L2TA 1YU9A 3ZQ6A 4LJ5A 3KQOA 5FPSA 2BBOA 3E15A 5CURA 1OXSC 1PJLA 3PQ5A 2Z4RA 3KKOA 1JFFA 1V71A 3CLHA 3DR3A 5DTIA 3HK2A 1BEUB 1I2ZA 4G0OA 1XMOB 1CR0A 1NXOA 4C0HA 4FEYA 1SZJG 1QNLA 3I5XA 4U8HA 3R44A 1UEXC 1CETA 1E69A 1JHOA 5BN1A 3ANXA 5HR5A 1ZCBA 2OO5C 4QUAA 4RVSA 2C61A 4OV6B 4YMWA 3EA4A 1XQ1A 4ILKA 2AQHA 2PKXA 3I61A 1RHRA 2XRZA 3IEVA 1X1RA 1NXQA 3QWFA 1DTEA 3BXHA 2HAEA 4WDQA 1HDRA 1RXEA 2Q5IA 4GXRA 4KFRA 1YRAA 3MJDA 2GBGA 4IGIA 5FOVA 2QT9A 2GZ1A 1PV2A 1FQOA 1P0MA 2L42A 4L5AA 3WSVA 3VX4A 1A7KA 3PPYA 3DO5A 3AJDA 3G8BA 1VB3A 5CVDA 4Y7CA 3RH0A 5C3UA 3CXUA 3KWJA 1C9NA 4B6FA 4V24A 3T9FA 1FX0B 5ED4A 2P9JA 3WL5A 4IXMA 3W3AD 1LVUA 4AXXA 3FPBA 4QEZA 3QWAA 4DG5A 1QIFA 5JNVA 3U44B 3ZCVA 4B6SA 3PNLA 4RTNA 3C43A 1CP2A 1OLUB 1ZXXA 3CZPA 1YHYA 3JTEA 3DE1X 4PLWA 1R9NA 2QOEA 4RPKA 4Y6LA 3L1UA 1E3EA 5TQ0A 5K0NA 5ADVA 1PWXA 3I01M 1A2BA 5BUZA 4JR0A 3B9BA 2O2XA 5FLXA 1H9CA 3T3HA 1OJ7A 3WFJA 2V6JA 4G5XA 4FE7A 1CJVC 1I7LA 2O8NA 1SC6A 3FLAA 4CKBA 1VYHA 4M8IA 3TZKA 2AH5A 1TFUA 3DD1A 3WNVA 3EMKA 3D43A 5ITSA 2FY8A 4N48A 1XXHA 3FE2A 1IZ0A 4D4JA 4J16A 4LGYA 1PWEA 1PJCA 4BB0A 4ZJZA 5BR8B 3LA8A 1RBMA 4LYEA 5DOZA 1CQZA 5F9FA 3RV4A 5K0TA 4ZHQF 1U8XX 3C3XA 3V8VA 3SDZA 4B40A 1T6XA 1I33A 1TZ2A 3TLGB 4LWOA 4WJLA 3HGMA 3OF2A 1CY8A 4CIYA 3GEHA 3HCNA 5CBKA 3ZR4B 5KHLB 6YASA 3ILYA 5SY9A 3T7RA 2PWPA 1UJ4A 1TNDA 2W6IA 3OFSA 4HRAA 5CBPA 1S2GA 2QXUA 5KOIA 2VTVA 3PJGA 4HQ6A 3ZIAD 4AL4A 4BNNA 2EXXA 3A2NA 4F56A 2FPRA 2VP3A 2OORA 3CCCA 2P5YA 5LYJB 1ZRSA 5I9MA 3INYA 1TPZA 1A88A 3OD5A 2CNWD 2B8JA 1YHZA 3U3ZA 1B00A 2WM8A 1RPTA 3PFFA 4JN6B 1WVIA 4XIFA 1D2EA 2Y6VA 3WDSA 4PX9A 5JXGA 1UUFA 3QU5A 3WJ1A 1U3TA 4LX0A 2YCBA 3AV3A 3Q7PA 1GD1O 1OFUX 3IVXA 5DX0A 3U7RA 1BCRA 3AERA 3EVDA 3P2JA 1SJ9A 1FZQA 2XX3A 3KKNA 3OF5A 1VL0A 4NE2A 2HWWA 2DPXA 2ES4A 1ULSA 2I3AA 2J09A 1LQ2A 2W22A 3UA4A 1QQAA 2D2XA 3C5WP 1EAYA 2IEYA 3GJSA 4MITA 1SWWA 4IVQA 4KVAA 3H97A 1JAXA 3PI6A 4H0FA 4Y1RA 3TTXA 3GHHA 3B6JA 4WXYB 2MOKA 5I7OA 1U6IA 4KXNA 2RHTA 3LBNA 4MHSA 2COEA 4D2IA 3VNQA 4BV8A 4Y9RA 4M0UA 2Q8QA 4PXAA 2XH8A 1NVDA 4BVHA 1EYZA 3LOPA 2YV5A 4MDEA 2WUFA 1WPQA 3HBAA 4CKZA 1ESMA 3CLSD 1XJ0A 3W6PA 5H16A 1FTQA 1TC1A 2NSDA 1M5RA 4UC0A 3AKEA 1XZHA 4H7HA 2J67A 1TZCA 4JQZA 4CT0A 2BRUC 5BO5A 3EC7A 1QIKA 3UWSA 2FZEA 2NUTA 2I3DA 2W58A 4ESVA 2GBLC 1XN4A 2HDOA 1F0NA 1ONNA 3FTPA 2J8ZA 4AKGA 3ENNA 2YZNA 4QGSA 2BEUB 2A35A 4XIJA 5FNZA 4BS9A 5K99A 2C7PA 3H2HA 1CXZA 2HBRA 1EDBA 3FPCA 1HZJA 1JWAB 2UAGA 4PAQA 2QI9C 2NVBA 2WY2D 3LBIA 5KSOA 4AIIA 2PH3A 4CKEB 3W1VA 5FBHA 4DJEC 2IIPA 3ZVKA 2DUWA 3KSMA 3RBAA 2GILA 4GE0A 4P32A 2BGRA 3GVCA 2HJHA 1DIAA 3KEQA 3FWYA 3OZEA 4PFSA 2I4RA 4XTRA 5HBGA 2V54A 3UN1A 5BV1A 3DBHB 5CDSA 5KVSA 4RK6A 5BQ5A 1JA9A 4BWVA 1RMYA 1GGMA 4MVJE 5DI9A 3H4IA 4WZBB 3AUYA 3G9TA 4W1SA 2P2GA 3CT6A 3I1YA 3TX6A 1T15A 2I2XB 5BQFA 2WU4A 1N3IA 2IOQA 1GU0A 3QP9A 2HBYA 1P6UA 2OC9A 3GLHA 2MMCA 4XW2A 1GNLA 5EG5A 3NKFA 4IIJA 4YFVA 1FEZA 1NONA 1KS2A 3AOEC 5GOTA 2Y1EA 3B7WA 4Y6RA 5HRAA 3SX0A 4ACAA 5ECYA 1E94E 1U63A 1AUOA 3QKTA 4J0KA 4WKOA 5BN4B 1Z15A 1EP1B 1PWHA 2OD9A 4NMLA 4S1OA 1YE8A 3DB2A 3OJFA 3WMWA 3GPBA 1XV5A 8AT1A 1QOQB 5JYDA 4F2HA 1J8QA 4FMPA 2HWKA 1K3FA 2QYHA 4P22A 1GPJA 3ZV4A 1AKTA 1MO3A 1IWPB 2D5BA 3OOWA 5K0BA 1KAHA 4GFDA 4WBSA 4X3PA 4H3HB 3U6BA 1WP9A 2ST1A 4KO3S 1G8MA 4LEIA 3ODGA 2D7JA 3RK4A 2IY7A 1Y8ZA 2REQB 2IU3A 4AYXA 3FCSB 4AY3A 3A32A 4TWRA 2FPKA 1XHFA 1L7MA 4ZU3A 1PGPA 2VTKA 3CVWA 3E2MA 4LNUA 3TLYA 5E95A 2NQTA 4FUTA 5CPBA 2HU5A 5KI6A 2QKYA 3UMRA 1HT1E 5LUAA 4Z4FA 4Z9BA 5EJ4A 1F6DA 5HIMA 1TXGA 2MSEB 4E12A 3CZCA 5FR2A 5JDIC 1NLFA 1QG2A 1N2CE 2O8EA 1X7WA 4LJ8A 4YCSA 1BROA 4BX8A 2PMKA 3VZCA 2C9CA 2FSPA 3OQPA 2GS9A 3R0ZA 2WICA 4Z49A 2FPPA 5H9WA 1QRAA 4MOWA 2GZDA 1UBKS 4FFRA 1AF4A 5M29A 1GCUA 1MVNA 2RGNA 1AZLA 2R3SA 1AURA 1X2BA 3N70A 4GSKA 3OTIA 1KIAA 3X1MA 5KOHA 3K6RA 3WWEA 2PZGA 2O9JA 5DMHA 4A5SA 3B38A 4L6IA 3CH4B 3F8SA 5LIPA 3WMRA 1YBAA 4BDSA 5TGDA 2RJNA 5ITZB 1KAMA 2GCGA 1DC7A 4GXQA 1NT2A 4KLCA 3VBCA 1XWFA 1QVZA 5HW0A 1C50A 4GUAA 2HI0A 3K5IA 3L7IA 2NO9A 1OV4A 4H4EA 4OXNA 1RLMA 5C9ZA 2P75A 1FLVA 4GRDA 4BNYA 3AFHA 3EX7C 3IOMA 1Q0HA 5HVNA 4BVJA 2NZVG 2IYNA 5IAAA 4TZKA 3LNTA 1CEQA 1D1QA 2Z5FA 1JPJA 4WOKA 3AP1A 3LY8A 5U9CA 1C0KA 1H2WA 1ODIA 3IESA 4DMFA 3M4YA 3ZCTA 5JZMA 4RHTA 3IDSA 1QR6A 4NTZA 4G2TA 4IUCS 3L6EA 3DBLA 4XCQA 5CM2Z 1UBGA 4I14A 5IT9A 4IJWA 1LQTA 3MS4A 3Q41A 4W8HA 4KXMA 5CJ2A 4DLWA 4IH9A 4DWJA 1XWIA 1V7CA 4HO1X 2F1IA 1YCHA 2AK3A 4PRYA 4TWAA 5H70A 2J3KA 2XXAB 4JXZA 3EE6A 4K5QA 4MHOA 5KX5B 3IPXA 3K9QO 4JEMA 2Q0HA 2COKA 3KSUA 4KPUB 2C9DA 2VTEA 2XE4A 2OMKA 3PGXA 3MUOA 4FE3A 3ZIAA 2DFLA 3NTUA 3QI2A 1U2DA 1XVTA 1L6RA 4JIGA 3WGZA 2ZRFA 5LPNA 1H1LB 2W11A 1EWYA 1FP7A 1BD4A 4H3SA 5FPTA 3SR0A 2G80A 2R44A 1KJ9A 3HKCA 2H8GA 3OBBA 4O3FA 1O94C 2IP1A 4JK3A 5FFNA 3DAHA 2AJ8A 2QX4A 4R1UA 4HUJA 5KNLA 3V80A 1AF7A 1HDEA 4NPCA 2I2BA 1LJUA 1TKAA 1O87A 3QMPA 3EUFA 4NQZA 2GM3A 1S2NA 2VJKA 4OPMA 3A06A 1YQEA 4ZZ0A 5AW4A 5G1NA 3AF2A 3BDIA 5K6TA 3EASA 3G7NA 4MRNA 4ARBA 4C2BA 4J49A 3WFZA 3IDZA 3NHMA 1CC1S 3A6DA 3V8QA 3VPFA 3GJ6A 3PE4A 2ZJ0A 2C5LA 5KKAA 4B7AA 4IUBS 1PHPA 3EISA 5HCNA 3X3HA 5AVYA 4I6JA 4NRDA 2IEBA 3SXJA 1EUCB 2EJUA 1Z25A 2ZQ5A 1GG9A 2E0IA 3TCXB 4DQDA 4KODA 1WTCA 2BKUA 2ONYA 3BSYA 4P5DA 5B2FA 2GNAA 5ER6A 3HACA 1HDZA 2IZ7A 2UZ0A 1KYZA 1SOVA 3TD6A 1EJ0A 2F8SA 4LCJA 1QFYA 2FOIA 3AQ4A 4X24A 3WWDA 1TLLA 2XQFA 2Q5HA 2H4JA 1B8OA 5BSVA 2FPSA 1IMJA 2G70A 3QPUA 4PFJA 3TEFA 1WEKA 2I7CA 3H83A 3ZTYA 3M9XA 2O8EB 3DT8A 2QUJA 4HDNB 2FK7A 3MT8A 4KQHA 4Q9AA 4CKWB 3IDOA 2YWBA 1NVVQ 3CM0A 4QNRA 4F12A 1MAVA 4O2BA 4QUDA 4RD6A 2C96A 3ZI0A 1ZOOA 4QJ3A 1GL6A 4OAQA 1IWOA 5CGQB 2PUHA 3PNSA 1WXQA 2C8KA 4FFWA 4A16A 7MDHA 2NXNA 1SVWA 2DY1A 5IT5A 4RNDB 3DHVA 4UASA 2JLWA 1YVUA 1EFDN 3LY9A 3VNAA 4HWRA 1M34B 4UAGA 1KQOA 2Q9BA 1Y37A 1XAJA 3DFMA 4DSOA 1JHVA 3JQ9A 5SZHB 1QLWA 2QSZA 5F1YA 4J4HA 4MB6A 4TRJA 5CGZA 4P3PA 3ZEAA 4LDNA 3BWXA 5H81A 1PR6A 2C9BA 4BAGA 2FWMX 2WEKA 4E88A 4K6GA 2BI7A 2J85A 2JFPA 3PQDA 4PZCA 3TLMA 4DRXA 2B4KA 1H93A 2Q4TA 2CVFA 2VJNA 4HVAA 3R0IA 3LUCA 4KNVA 4RM2A 2QLJA 4PXSA 4U6SA 1IQUA 2ADFA 2YXEA 4E5VA 2QLFA 3GD5A 3AONB 2EKBA 3RRNA 4RHCA 4BFCA 2IYWA 4FZJA 1JIIA 4AJ9A 3EGIA 1TADA 4RL4A 4UTPA 1P77A 2ZJ5A 1E1QD 3E9YA 5TXGA 6CHYA 5JNUA 1PNQA 2Y1GA 1E3TA 5FA5A 4AF8A 5J4HA 1XC7A 3O8BA 2H17A 3DWIA 2P4EA 4D0NA 5LNK6 1FF9A 4J0IA 3VPHA 1RQNA 1Y1RA 3IKLA 3OU2A 4LY0A 2WTNA 4UBJA 3RRYA 1AMUA 1ZL0A 1L5KA 1IZYA 1GWNA 1OJLA 3DMNA 3DOUA 4ICIA 1HLFA 4DNFA 4UZFA 1PZXA 4EECA 4RDIA 1DS6A 2W0MA 5BWNA 2YOFA 2JGIA 4M1MA 3EF3A 1NC3A 3SC6A 2HA6A 3C39A 2FXIA 1R74A 4MVCA 4X6YA 1Z4NA 3O73A 3IR7A 1WQ3A 4KOAA 1L3BA 4LMBA 4OMCA 4KR9A 4H60A 4JD5A 5IEBA 1WHTA 4PZAA 4PIMA 2ZCUA 3CPHA 5B4TA 3AFGA 1Z6PA 3GGPA 3FOZA 1IZZA 3ZJ4A 3OC0A 3KYDB 4C0BA 3WNQA 2LGJA 3QY0A 2YUIA 3F7OA 1U2GC 4DIEA 4ZI7A 1RPJA 5IRCD 2XKJE 4HB2A 2BGLA 3AF4A 3VKGA 4G1UC 1P9OA 3GCWA 3OIGA 3BRQA 1OZ0A 3ASZA 1X1EA 5ALHA 3ASUA 3HCCA 2R87A 4BGDA 3KYIB 4YWJA 2I67A 3NOOA 4CG2A 1N8KA 1VTKA 4WJZA 3Q9SA 3LJKA 5E2AA 3M70A 4DLTA 3FUCA 4OQZA 3LDAA 4GVPA 5DYWA 3T9EA 3ILVA 3JX9A 4CIDA 3IUSA 2B1JA 2X8BA 1MUUA 3UHJA 4IFTA 4C43A 3WWYA 2ZWAA 3FYSA 1YDEA 1TCVA 3HXQA 2WIBA 3CUKA 5T8KA 1BZYA 1SCUB 1GUFA 1ZNQO 2VUIB 3HDYA 3HE3A 1A77A 4HDOB 2OK8A 1GITA 1T5IA 3OURA 4BLVA 3H7IA 2WT8A 1DEOA 3AF6A 1G8HA 1S7GA 2GPYA 5BUQA 3H0EA 4ZP1A 2ZSUA 3ZHYA 4ZVQA 4R2IA 1JX6A 2HT6A 1A9XB 1F38A 4F8JA 3V7YA 3YASA 1VE1A 2BH9A 3AESA 3A7EA 3L1KA 4O0LA 3H6HA 1U1GA 1UIRA 3T95A 1HZZC 1QGAA 2YN2A 1XVLA 3H04A 3PRHA 5AI8A 4BUCA 4EPTA 1TM3E 5LP6A 1OLSA 1G1MA 2XTAA 3GF4A 3MWLA 4LOJA 4WKNA 3OZIA 1N2JA 4CDRA 2BHTA 1GRNA 1WDWB 3EEQA 5E0OA 4D3SA 4JKYA 1SCQA 4RD0A 1Q11A 2PMEA 2IRWA 3WICA 4AJHA 1P0PA 1W88B 4F86A 2QM8A 3LECA 3EVAA 3FYDA 1WXFA 5HF6A 4RHEA 1J2JA 1PBNA 1F2DA 3Q0EA 1JG6A 5JFOA 1YTLA 3OC6A 1W87A 1HTTA 2ASVA 2G9ZA 1NJSA 4TKMA 5IMSA 1EGHA 1ZGGA 1ZJWA 4BY9E 1QH0A 3R3JA 4K1XA 2ADOA 3ETHA 1R88A 2OVBA 3BK7A 1NU8A 5EESA 2VJOA 3GJXC 1EE2A 4FGJA 3IAHA 3I0ZA 4OGKA 2ZETA 1QIEA 2PUTA 5EIWA 1WXDA 1V5WA 4F4DA 1NOKA 3OTWA 4PQRA 4YRCA 2X4GA 2Q6LA 3UBMA 1OX4B 2OWEA 4BXOB 1XTQA 2NSJA 2WWWA 4IDNA 3TR6A 1JLHA 4M53A 1Z0KA 2CE7A 3SE7A 1E0DA 3FMVA 4YJHA 4H7KA 2E6UX 4FE4A 4ND7A 1Q7BA 1BVYF 2KE5A 5FI5A 4EY7A 5HPYB 1VMEA 1JDPA 2GASA 3TX2A 4JB2A 5AK3A 2PGLA 4O4IB 3LOQA 3R9XA 3I0NA 3KXLA 2QMOA 3OA0A 3DL4A 2HNBA 4YI5A 1EQ2A 2FDCA 2VK2A 1R27A 4RZSA 4UATA 4HLNA 2R79A 3WGUA 2I3GA 4FDMA 4QWWA 5KTOA 2HO5A 2WKQA 1ZJJA 3GEIA 3Q1LA 1B6GA 4M8KA 4BNIA 2BP7A 4EIWA 4DA6A 4UKDA 4O1HA 1R5BA 4HLUC 4L3WA 3VDQA 5BSFA 3LTEA 1GL3A 4FM9A 3HJCA 3MC1A 4DLRA 2EFHB 3FYUB 3O8DA 1JECA 4MRSA 2CXQA 1JU3A 4HRVA 1P7WA 5CD1A 2CEKA 4OP3A 1CUWA 4PLYA 1RWQA 2NZ8A 2P27A 1AV6A 3VVLA 1ST2A 4XCXA 4DYDA 1V39A 3RIGA 5FBQB 1SHUX 4Z0HO 2YN0A 4G5GA 5IPFA 1DU4A 5IVKA 3VI3B 2QBYB 2GBCA 3O75A 5H3HA 1K98A 1J7JA 2B0CA 2LKDA 3K7EA 3T6KA 3RRZA 4RL6A 3BJRA 3BMOB 4FB4A 2D5AA 1UDXA 3I12A 4UMVA 2YJ3A 2CJXA 4Q3NA 1W6RA 4IXWA 4Q0MA 4Y30A 3AOGA 3WV4A 1ESZA 4CXMA 4RETA 1QZTA 1ZN7A 2DSTA 2ZULA 3QVXA 2BGNA 3AXTA 3G02A 3JASB 4KQFA 3K9HA 4ROTA 4RPIA 3VZRA 4ZQFA 1SKBA 4AW9A 4BJHB 2WLSA 4DAEA 3SEFA 3KC2A 3TS1A 4KE8A 2W2KA 4IDHA 3IDFA 4N4AA 2JG3A 1AGXA 1L4EA 2RHWA 2PFKA 1QWOA 3B51X 5C3MA 5TDHA 5MFZA 1F1BA 5DGCA 1FJGB 4YRZA 2BKAA 2ID8A 1PVOA 5HYVA 5JZ9A 4IDCA 2PNJA 2DFTA 2ZSFA 4J16C 4MZDA 4L57A 1GGJA 2EFYA 4LJSA 3ER6A 4TV8F 4GOLD 3GAZA 3EEFA 1IZ9A 3FNGA 3UT5A 1CTQA 1NMXA 4HWKA 2PZMA 2YYSA 4AWAA 5HUJA 2DECA 3TJRA 1JT9A 4B2YA 2QTCA 1AVTA 3ONNA 3FPLA 4AVYA 2B2NA 1SU8A 3FHJA 4JI3B 2YWRA 3MJTA 5CA1B 3EPLA 3U1VA 1XZIA 1X13A 2HSJA 3GGSA 3MT0A 4IIGA 3GUUA 4L0CA 5AYVA 2CSXA 4F3RA 3H4TA 1DWUA 1O95A 4JGGA 4EX7A 2JEOA 3KR1A 5B1IA 5TF0A 4PO9A 2CMDA 3ZGVA 4FC7A 2YV1A 2NACA 4BYGA 4F96A 3DVAA 4QIHA 8MHTA 1TZJA 4MS4B 1Y5LA 2Q6VA 4CU2A 4IX1A 2PG3A 2JLAA 3PRKE 4DC9A 4LF6B 3IL2A 4B3MB 4TVSA 4B31A 2G5GX 4UHDA 2DBRA 2VP9A 1BJTA 1A8QA 1TLFA 3DNPA 4ZQGA 2ZZNA 4LTMA 3AW8A 4C0SA 4L28A 1RR6A 3SDBA 1E6EA 2WD7A 4WVFA 1OWPA 3LPCA 4R1TA 3G8YA 3NIWA 4YJHB 4LRQA 5GOZA 5H80A 5HIJA 3WX0A 4KWTA 1PJQA 4ZDIA 1JE0A 1KJQA 3V1TC 3UPTA 5EEHA 3PKZA 4PAWA 3QSGA 4WKPA 3WZLA 4BNKA 1XZAA 4MGEA 2XUKA 2IYUA 3V4RA 5IM4F 5SZJA 4GKBA 3R8FA 2QVXX 4OM8A 2IEAA 2W2LD 3PUKA 2Q5LA 1B0PA 5A02A 3C98A 1TT5B 3CRRA 3SSMA 1PFKA 4HMOA 3HP4A 4JOQA 4AJJA 1D4ZA 1WCIA 1I0ZA 2HQSA 4DR6B 4FMDB 3GFQA 3PPWA 3N1UA 3LUJA 1U28A 4YRPA 3EGEA 3REQB 4N54A 5JC8A 2R6ZA 3KJZA 3N75A 4DMGA 1T24A 1YZVA 1G2PA 1Z6ZA 1ZD5A 2V8OA 2E5FA 4BN5A 5IJAA 1PK8A 1OLOA 3N2KA 3R6GA 1JLLA 3VH1A 4JXXA 2IPAB 4AULA 1Z62A 2WRZA 5AJZA 3ZYZA 1G6Q1 4RK0A 4TV8A 4JAVC 4BZWA 4ES6A 3R75A 2OZEA 1TUBB 3GW8A 3USES 4L8LA 3GRYA 1AX9A 1V8PA 4MPDA 1JTFA 3F90A 3GJ8A 3UW3A 4ZYUA 1U98A 4OHBA 5C2JB 1KY5A 2JGNA 3JWPA 1FFDA 5H68A 4E94A 2IXDA 5HX7A 1CQWA 4FQ7A 4V0QA 3JCZA 2WTMA 4HH1A 4GKJB 4GZ3A 2WM2A 1TYZA 3B36A 4HUQA 2VDQB 4QXAA 1UAYA 3DZCA 1VBFA 3A3NA 3RSLA 1ZPDA 2XDAA 3P71T 1H05A 3PQEA 1C80A 2D8MA 4AO6A 4OU5A 2EZ8A 1IY2A 1ZGCA 4HXEB 4D9CA 5IFLA 4IAOA 3ZHRA 4ZGGA 1IL0A 4PE5B 5EQJB 1JG7A 4BO8A 4OB8A 5JQWA 4BDTA 3FPKA 2DPGA 4JS0A 4QYSA 4EB6A 4B3JA 1IFXA 2O7VA 3I5UA 2OXTA 3HCRA 1NIJA 4JVOA 3PEVA 2VJYA 5M34A 2GKSA 4I8IA 3FKQA 5HQTA 1O03A 2BGMA 1TD9A 4NYMQ 2R1UA 4RZ3A 5M5BA 4KRFA 2CXHA 1XXHB 2NUBA 4IHQA 5DTEA 4I55B 5DV9A 4BASA 1F1JA 4A1FA 3KHSA 4ZQBA 1DIGA 1K4MA 2C5EA 1YZYA 1LDMA 1WKBA 1ZNXA 5GVRA 1X7YB 3TRHA 3REOA 1U2DC 2W2OA 1JAZA 1Q92A 2RI0A 5HF9A 2JBAB 2XUDA 3N86A 1A4RA 1GSIA 1TQ2A 2HDNB 1TKBA 5A4AA 2WU8A 3L41A 4YONB 2C4TA 3HY4A 3S5JA 3GRVA 4NG4A 4JBHA 4EH1A 2YOGA 2QI9F 1E8DA 3RSOA 2VHYA 5ALUA 1H4VB 1DIBA 3RYHA 3JYQA 2B5WA 5T6MA 3H86A 3RYIA 2TYSB 5I9SA 3DE6X 2BFFA 2R85A 1H94A 2IYXA 1OWMA 3NHYA 4NU5A 3CC8A 2IYPA 2WWIA 3DMPA 2FMTA 1Q1AA 3HU1A 4DA4A 1PFVA 4LMRA 1OI3A 2CLOB 2ZVQX 1NU6A 4MKZA 2IHTA 4DY6A 3E7WA 1E9RA 1FNMA 2WIKA 5LXTB 3B3QA 4OLAA 1WBDA 2AI3A 1OT5A 4FFLA 4M9SA 3BMNB 4ZQEA 1U4SA 4YV2A 3H2BA 2FETA 3UGJA 1WDLA 2Y6UA 2OLJA 5C52B 3LQ4A 1Q0QA 1RAHA 1TC2A 1FFWA 1GPLA 4J2HA 2GN2A 1KYWA 2VP5A 1YR3A 2FZCA 3ORRA 4TKVA 2Y1LA 3TQRA 3BIXA 3AX6A 4PANA 1GGNA 3R8CA 2HMTA 2LCIA 3TLJA 5DU2A 1LY1A 1QQTA 1VLHA 1XRQA 1JB9A 3F97A 4RPHA 2FWJA 1LRKA 3F7NA 4CM8A 2H11A 4I1SA 1BX3A 1MKYA 1ISIA 2VQFB 1Z5VA 4JL5A 3GJTA 1GILA 4XWKA 1AD2A 1B6SA 2FOXA 1MIOB 3FSGA 3MXTA 3MLAA 4FBGA 3R8XA 2B82A 3ROTA 1RJDA 4M21A 2BMVA 2I5PO 2BSAA 3FOFC 2MSKA 3D3KA 4PAOA 1E2NA 3WLFA 5HWSA 2XD4A 1PLKA 1GPYA 1U5AA 1ZD2P 3WQQA 3KWFA 1L8QA 1R0RE 1Q6YA 3G5TA 2H5LA 2ECFA 3F5MA 4EHBA 1HEUA 4CEJB 4URHA 5AKYA 3KG2A 3E3LA 1L7RA 2WYIA 4PX2A 3GPIA 2OZKA 4EY4A 4NCJA 4IIFA 1EESA 1WXHA 4YXFA 3KT0A 2R7KA 5IK2D 3CBQA 3NIGB 1WY7A 2GAAA 1PVVA 1PUJA 3UKOA 2L82A 1Z0FA 5FDFA 2YMQA 4Z8XA 4CG0A 2UKDA 4IWYA 2NN3C 3GA0A 2OYRA 2PUVA 1ULTA 3QKSA 3VO2A 1SGWA 1SHJA 2X5JO 1UP4A 3HJAA 1S3FA 1V4VA 2GXUA 2VUSA 3QIVA 3Q5DA 4HWSA 4AMGA 3TH5A 7GPBA 3I2HA 4GLLA 2QLLA 2X8LA 3QG5A 4HK4A 1P4RA 4HKTA 3O6VA 2HCBA 3P9NA 2R1ZA 4B7UA 1N7HA 2VJBA 4MDHA 1KVRA 5BN4A 1FXWA 1L4NA 2LKCA 4EL0A 1G8FA 3C1TA 3PGVA 3PR1A 5IASA 5E4JA 2C94A 2YH2A 1RDFA 3PNKA 3VR6H 3FFTA 3EDRA 3EXEA 4K9KA 1VZ2A 1X9HA 2PTHA 3DHWC 4G1CA 1Z7WA 5CYPA 3ZHXA 3NTXA 1MFZA 3QU7A 1CY0A 3ZI7A 4YASA 2MYPA 1GL7A 1MR3F 2H9YA 4MINA 2P41A 1UBUS 2AL7A 2DBVO 2QN1A 2REQA 2ZUBA 4AN1A 1XDSA 4K6HA 3DJFA 1T2FA 2DXIA 2QL9A 4W5RA 1DRKA 1QR2A 2B8TA 2JGAA 2VJCA 3MVEA 4DVJA 5C7YA 1I7DA 1PLLA 1H5QA 1ZO8A 2GDZA 1Z9BA 2IT1A 4N5NA 4PYKA 4TKUA 4ZHQB 2ANCA 2H29A 2RGEA 4NJEA 1HWYA 2C57A 3PDWA 3Q3IA 2BZSA 3NO4A 4J03A 4F9TA 5B4UA 3LUPA 2PBRA 4IWXA 4ZOAA 1DKOA 1Q44A 4B74A 4KRYA 2C3OA 4E3ZA 2FPGA 1MRSA 3RTAA 4ZZIA 4ALJA 3H1BA 4AZ0A 2JCVA 4LSWA 1NVMB 1ZNYA 3DBLB 3TTTA 5EJ8A 1H65A 3SEQA 3TSCA 2C84A 2DFPA 3N2NA 4WBXC 5K3FA 4C0AC 2XZOA 2FPPB 5H82A 4AQYB 1FTWA 4IM7A 4CV1A 2JFUA 5M7EA 1WB9A 2FRXA 5FNVB 3W1EA 3NBKA 4F2PA 1SKYB 5EJFA 3ONFA 3UANA 2IHKA 2P65A 3AVPA 5LXTF 2UYOA 2WAXA 3SZMA 1QH9A 1Z3CA 2C9YA 1SNYA 1TAQA 3F67A 4R1LA 5B55A 2OAP1 3M8KA 3RS2A 3TN7A 4C87A 2EP5A 2AXNA 2BYTA 4V2IA 1HG1A 4TVKA 3G7UA 3ZE6A 3OIVA 2Z3VA 4KQXA 2ZFUA 1RIFA 4WCDA 3UWPA 1U0LA 3AL3A 5C1IA 4BNFA 3ED5A 5YASA 3ZXUB 4DCNA 1OH7A 3DAGA 4F97A 2GF9A 2JCGA 1VLZA 2WJZB 3I9V1 2RG7A 4X00A 5CFNA 2QL6A 1CNMA 3KAPA 2CGEA 3TLCA 3I45A 4PLVA 3ZCXA 2VHTA 2WVAA 2VDNB 5ICEA 3O47A 3DZGA 2C2GA 3HRIA 2HEGA 4YJDA 3BWYA 4E5UA 2HXGA 1S01A 2QRHA 5CEFA 1YR7A 4GNRA 1UBTS 1W25A 5HKOA 4L51A 2L18A 1Z0ZA 2FEOA 3HLKA 2FHSA 4KQKA 4RHXA 5BT9A 3NDPA 3DJYA 2ZXFA 4IL5A 1V5IA 5DCLA 4DEVA 2PL9A 1GUBA 3DZFA 3IV7A 4WLUA 4A82A 1KDTA 4DCJA 5EGNA 1G5PA 2PXHA 1D09A 2XMRA 3T1YB 2L2QA 3A6KA 2C7OA 1N77A 2JFBA 4RH1A 1P2BA 1E64A 2X15A 1RHJA 1KOGA 2JRCA 1RWKA 3JAKB 4TSFA 3QJYA 3ZHSA 4JI4B 3ICEA 3I6ZA 2X4LA 4MAFA 1WVMA 4MGKR 5DW0A 1XP5A 4FP9A 3E81A 1KJJA 4QVKA 3JZDA 3H5NA 4FK8A 4H35A 4G41A 3SYRA 1KL7A 3C16C 1FIUA 4UHFA 1UXIA 3OQIA 4FN4A 3WGHA 3OSZA 5F4BA 3OIUA 2WIFA 4NFHA 4BJ1A 5JW6A 1SUPA 4LRUA 3SZLA 2BONA 1NP3A 1NQTA 2JI7A 3UGTA 3WQHA 3GYGA 4RQAA 2XHZA 1KEZA 2DWCA 1DAHA 2UXCB 1SVLA 5AOVA 2VA9A 4CLRA 1PX2A 3QRWA 4M9UA 1DXOA 1MRNA 3M6MD 2GO7A 2PMCA 4PPGA 1S8OA 3CLKA 3MEQA 2OAEA 1J39A 3Q15C 3TRIA 2DKNA 4A2PA 5DGIA 5FTLA 4HDKA 3DE7X 1P1IA 3W5AA 2CV0A 1ENZA 5KYWA 2OKCA 1XAGA 3THSA 2VSNA 5L4SA 4B6PA 4YMUA 2QP9X 5HKAA 5E6RB 1TTTA 2V98A 3OO0A 3QEMA 4TN1A 4C6TB 5A3QA 3L93A 1VKNA 2ZI9A 2QTRA 1IJBA 3IKVA 3ANYB 2FRDC 2G0TA 3DBHA 4DV4B 1PJAA 1N3YA 2HRZA 2AZXA 2O8BA 5ALXA 4QPPA 4BZZA 4A0RA 4XQCA 3FOEC 1SBCA 3E9DA 4N0PA 2Q1YA 3D4LA 3SNHA 4ZN6A 4OHYA 4RAQA 1WETA 1IY1A 1KEWA 1XUOA 3FOWA 4PSCA 5LMZA 2CJPA 1DGQA 4EF5A 3PRJA 3O84A 2GM4A 3ANMA 5AUPB 1Y3HA 3LWNA 4P82A 1QYIA 2FF7A 1GNPA 1W2HA 4L4YA 3M1IA 5DBEX 1GYPA 2QIPA 3LY7A 3ONDA 2XA9A 3H9GA 2ZSKA 1DZIA 3CV3A 1UBOS 3CNHA 3JQ9C 2FPOA 5EYPA 3WYFA 5CFLA 5HKKA 1DTWA 2WJYA 1P3JA 2AB0A 2GYYA 2ZIUB 4EKDA 2AW5A 1XEWX 2J3LA 1F8FA 1NXVA 4DG8A 2RGYA 2PV7A 4ZYZA 2HB6A 4RKRA 3I34X 3ZJVA 1YRYE 2QD2A 2ZZMA 1US8B 1QP8A 2IEGA 1A9YA 2O7RA 4DNOA 2FZGA 4D9FA 4R3WA 2UYHA 3BEOA 4FD2A 3RYCB 1IEQA 5EE0A 4BLSA 5KYGA 2GXSA 4FZ5A 1IXKA 1C9EA 4KGDA 3ETNA 2P8SA 4MWEA 2QTWB 1GA6A 3EQ8A 5ALOA 1XU7A 4LC1A 1JR3A 3LC7O 2JIRA 1L7OA 3PQ8A 3U5TA 5L3SA 2XEXA 2ONZA 2P0YA 4IXDA 5KU7A 1YZGA 2X13A 1LU9A 4NE9A 4ONEA 1GZ4A 2R7NA 1AUXA 3NASA 4JGIA 3TAXA 3ZHQA 1NG1A 2WWRA 2Q45A 2JFNA 3C4QA 4OG2A 4KN8A 4RPJA 3S70A 1IDOA 1UWCA 3WLLA 1UPFA 1A5SB 2G82A 3IE0A 3KX2A 3O4RA 2VXYA 4O1IA 1GKKA 2F3RA 2X0NA 3NHLA 1V3TA 4HMPA 3VR6A 4IDDA 2AUMA 1HRKA 2CDAA 3U19A 5K3DA 3PYMA 3THWA 5LYJA 4COOA 3QA9A 3EXFA 3NT4A 2F1KA 2ICAA 3K4QA 5D2CA 3RTDA 1K27A 2R6GA 3HVUA 2QV0A 4YT4A 3F3SA 1GTL1 2Y9MB 4GX5A 3D3JA 4NHEA 2QUAA 5HA5A 1P4JA 1ZVMA 1BCRB 1M1ZA 1X94A 2VAXA 3ET4A 3HZHA 4JQSA 4QEKA 4ZOBA 5D1HA 5EXSA 2GNPA 2AMFA 3L4BA 3T5PA 1IULA 1V11A 3ECSA 1QF9A 5TF4A 4DAOA 3Q0TA 1C9MA 3ORHA 2CKMA 3S28A 2GZAA 2QAJA 3K73O 3MGKA 1V35A 4ODIA 1FSZA 4PYOA 4UDNA 2ZIXB 1G41A 5IC4A 1QGYA 5AH0A 1JSLA 3SLGA 2HJ9A 3EZNA 2GZ3A 4AWBA 3LC0A 2W42A 3VGJA 3EQ2A 4BB9A 4ETIA 2ZI7A 3R0JA 4RA9A 4X20A 3WKAA 4ZQCB 1OLXB 1KQFA 1LRLA 1UKZA 3LS2A 5I48A 2Z58A 3LQ1A 2JI4A 1PVDA 2C2ZA 4INOA 2HY7A 4EARA 3FJ1A 1PFUA 4GRIA 1CUFA 1K7CA 1JG4A 3MMSA 4GOMD 1DKMA 5CT5A 5DE3A 3EDMA 4JFRA 1C7JA 4ZAXA 2LP4Y 1KZ1A 2UZ4A 1SUAA 2EW8A 1O6FA 1V43A 2FDRA 5BN5B 1KJ8A 2NP6A 4P83A 5E2BA 1JA1A 3K1TA 1OZHA 1BQ4A 3B1XA 5CM9C 2A58A 4NG5A 3K0FB 3GC6A 1YB5A 1YKFA 2QJTA 4G86A 1NR7A 1RRFA 5DGTA 2H2WA 3ZY5A 3BORA 1W0KD 3L05A 3V8MA 4LC9A 3T4PA 5FADA 3T06B 2E4WA 1RXYA 1PT9A 1Q95A 4B76A 4HC4A 3OZSA 3IAAA 4QYMA 4GYYA 3GG9A 4R51A 5CYOA 3U37A 5EPUA 4D9BA 5JCZA 3GGDA 1CUEA 3OZCA 2H59A 1ORRA 2YFKA 1V7QA 3MTBA 1PJSA 2QRZA 1OBHA 4QBTA 4ER7A 3NV7A 3J81k 4LZPA 4PC6A 3TG2A 4A92A 5B7PA 1UEIA 4AY5A 1RM0A 4YPOA 3H5AA 4KH0A 5JSZB 1BGVA 5IXSA 1NF9A 1L5OA 1PW5A 1RBYA 5JNSA 1L5SA 2R66A 3CW8X 2RGNC 3DGEC 3HUDA 4JB3A 1JPUA 4D8WA 2HLDA 2OZLB 1IB6A 2HREA 1OXTA 3BBLA 3ESRA 5IVPA 1JFFB 2NO1A 2YW2A 3W8FA 3SDSA 1X3LA 1YL7A 1RHQA 1N2CB 3GJRA 5A2GA 5EP4A 2GXQA 4Q7QA 3UKJA 4RLSA 4BLWA 1XA3A 2QRJA 1U8UA 1WG8A 2YJGA 3ZH2A 1P6QA 1Q6ZA 3ZG6A 3NYWA 2Q62A 1ZI9A 5FBKA 4KC0A 3NPMA 4GG1A 3VGPA 3S2SA 3OWHA 1GVHA 4QPCA 1EFRA 4M1SA 5J59A 3LW8A 4E4TA 1TA9A 5JNTA 1XCPA 1FYXA 1EFAA 2H7CA 1UQTA 2JFZA 3PYLA 4B6RA 4DMMA 2JK1A 5JAUA 3B7PA 1ESNA 3R0VA 2OXRA 4B83A 4YFYA 1AKNA 3N5CA 1JKMA 5J4LA 2Z43A 1U2EA 3O7WA 1Y48E 1NVUQ 4UMDA 4GPIB 3WR5A 3K72B 3VHXA 1C1XB 1Y80A 5IABA 3HB0A 1L1EA 1N9GA 1W44A 5AM0A 5FPQA 1Y81A 1BOOA 3DZKA 2BMDA 2CUTA 3KOZA 1MEOA 4N7BA 2OXEA 3CEJA 2FEWB 2GYWA 1XLTC 3NEAA 3DZBA 1WCXA 4TMFA 2PKQP 3DF7A 3JXEA 1N33B 4LJKA 3TUZC 1R18A 2XNKA 2I33A 3CX8A 1ZMOA 4UD2A 1YRQA 4ZT6A 5JBIA 3OY2A 3OUUA 1EA5A 1FP4B 3ASYA 2BGIA 4G5RA 3ED1A 3ER8A 3F0TA 2FMFA 1CUHA 1VJGA 4KAJA 4XUDA 1I3MA 2PA3A 1L8LA 2YJ6A 3PC7A 1JA0A 1BE1A 3LKDA 3W3AH 3EXIA 3ZLUA 1E3LA 4DRZA 1G55A 5CDYA 5DPMA 2DHCA 4ZCQA 1SD1A 3WWPA 1FSFA 1NTOA 3KZKA 4INJA 4O8ZA 4MVJF 3WAGA 1OPRA 2AVNA 5BP7A 2ZKLA 4YIHA 5JSFA 4L8WB 5KYWB 4I1YA 1KP2A 1GZ6A 1G8SA 2Y1FA 1TJ3A 1Y8CA 2AJCA 2IYQA 2XVZA 3ENWA 4H59A 4NJOA 3TBFA 2N1BA 4DR2B 3G88A 3JASA 3L4JA 1CD5A 2ETVA 1D2MA 4H0CA 3PP8A 1XCOA 3TPZA 1FLAA 4QLOA 4TV9B 5MN6A 1FFEA 3RAJA 3K0FA 3T3MB 1X80A 4HH4A 4BYMA 1FSSA 1Y7TA 4Z0NA 1FL9A 4DIDA 2IKSA 1DQYA 1LX6A 1C3VA 7YASA 4G0WA 3I32A 4KVZA 4C6SA 2QVGA 1U4OA 3N0VA 3URMA 3CW2A 3EG9B 1PWZA 3K8ZA 2WJ6A 1JEJA 3KHUA 1CWUA 2FW8A 2FR8A 3MHPA 1Z06A 1DNPA 3RRXA 5T64A 4RH0A 1RWOA 3LUGA 1E9VA 3D8BA 3QBVA 2ZM5A 4BTLA 2AOUA 4EGQA 3FR7A 1JDVA 2BJWA 3MT7A 3IB6A 1RWNA 1MABA 1AHNA 1CQJA 4Z9XA 1DAGA 4Q82A 5EYPB 3UV7A 3ZDYB 1CF4A 1MJNA 3U3OA 1E61A 5AMXA 4Y1GA 3FCXA 3DAFA 2W71A 3DLHA 5ES4B 3NNSA 2TMGA 3RUPA 5HXAA 2DH6A 2G67A 3HUEA 4MV9A 3D0RA 2WK1A 2J46A 1CQXA 2XWQA 3G2LA 4J1QA 4PG7A 2KSQA 1J2UA 3FW1A 1ZD3A 4P0TA 1A1SA 1NQAO 1VMDA 1CZNA 1SC1A 2XUOA 2NZUG 3G5UA 1P8JA 1YQXA 4LJ7A 4RELA 3VH2A 2BBWA 3BMXA 3C85A 4PQEA 4JLDA 4RVDA 4BO4A 1XMXA 1FU8A 1TM4E 2NPOA 5CLFA 2NYRA 4P4SB 3FKSD 3QX7A 5DIFA <