2QL7A

Crystal structure of caspase-7 with inhibitor ac-iepd-cho
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ql7A00
2QLBA 1RWOA 3DEIA 3DEHA 5IAJA 4ZVRA 2H65A 3IBCA 1KMCA 3GJRA 4HQ0A 3QNWA 2XYPA 4JR0A 5IBRA 4IEFB 1NMQA 3GJTA 1ICEA 4QUEA 4QULA 4EJFA 4QU9A 3UO8B 1BMQA 4NOJA 1K86A 2QL9A 4JR2A 4QU8A 1RWXA 1SC4A 4QU0A 5I9BA 4PRZA 4QUIA 4N7JA 3D6HA 3R5KA 4QUJA 5K20A 4JQZA 5LU8A 1RHQA 3GJSA 1NMSA 1RHMA 5LUBA 2QL7A 4JJ7A 3R6GA 4QUDA 3EDQA 3IBFA 3H13A 3R6LA 4I1RA 5IAGA 1NMEA 2C2OA 4FXOA 1K88A 3P4UA 2CJYA 4N7MA 1M72A 1RWPA 2Y0BA 3DEKA 5IBPA 1IBCA 2H5IA 4NOMA 3NKFA 2CJXA 4PS0A 4ZVTA 2C2MA 2CNOA 2J30A 3NR2A 3OD5A 4EHLA 4EHDA 2CNKA 2CNNA 5IBCA 3RJMA 2J32A 1RWWA 4JQYA 2QLFA 4DCOA 4ZVQA 5LU9A 1SC3A 1RHJA 3EDRA 4QUAA 4JB8A 2DKOA 5IANA 3H1PA 4AWAA 1RWKA 3D6MA 5JFTA 4ZVOA 4I1PA 2NN3C 3P45A 2FUNB 1NW9B 2XYGA 3E4CA 2H4WA 3V55A 2Y1LA 4QU5A 1PYOA 2HBZA 4PS1A 2HBQA 4EHFA 2H51A 1QTNA 1F1JA 2H48A 3DEJA 2H54A 3D6FA 2XZTA 3KJQA 3S8EA 4N6NA 3BIJA 5IC4A 1QX3A 1I4EB 2WDPA 1RE1A 4IYRA 4JJ8A 4NBLA 1F9EA 2CDRA 4NBKA 2K7ZA 3KJNA 3R7SA 4EHKA 3PCXA 3SIPA 1PAUA 4NBNA 5IASA 2AR9A 1GFWA 1SHJA 2CNLA 1RWVA 1RWNA 4HQRA 3R7NA 1JXQA 4FEAA 3V4LA 4EHAA 3NS7A 4D3YA 2QLJA 4HVAA 3V4OA 4JJEA 3ITNA 2HBRA 4LSZA 2H4YA 3PD1A 1CP3A 4N6OA 4EHHA 2QL5A 1RHUA 4ZVUA 2J33A 4AW9A 2FP3A 2HBYA 3V6MA 1CVRA 4ZVPA 3S70A 2C1EA 4N6GA 1I51A 3H11B 2FQQA 4QUGA 4NOKA 3H11A 1RHKA 4NOLA 5I9TA 3KJFA 5IARA 1RHRA 4PRYA 4QTYA 5IAKA 4QUHA 3GJQA 3V6LA 4QTXA 4D3ZA 2XYHA 2C2ZA 4DCPA 3H0EA 1SC1A 3PD0A 1QDUA 1RWMA 4D3XA 3SIRA 2P2CA 1GQFA 1SHLA 2J31A 4M9RA 3K7EA 4N5DA 3UOAB 1I3OA 1I4OA 2XZDA 4QUBA 4FDLA 3R7BA 4DCJA 5IABA 4AWBA 3R5JA 4FGUA 5IC6A 4ZVSA 4EHNA 2C2KA 5IAEA 5LUAA 5H0IA 2H5JA 4JR1A 3V3KA
chains in the Genus database with same CATH superfamily
1KY2A 3H05A 1TW2A 3GT7A 1IRIA 1H1DA 2OZPA 3EVNA 1HLPA 4IQFA 4S1VA 5DX1A 3AKZA 4KXFB 2Z56A 3BIFA 1Q92A 1TKAA 4BMSA 3S7TA 3ZEAA 1QGYA 3H65A 4P7JA 3FSGA 1XZJA 3UH1A 4EY6A 1FX0B 2O59A 4R9RA 4JVOA 4OXKA 4BJ6A 1YUBA 2I62A 4LJ4A 4Z4CA 2PEYA 4BRUA 4MWOA 1MJGM 3RVMA 4A7PA 2WAXA 1JH8A 1FYVA 4YAKA 1OMOA 4R81A 3EDQA 4RVDA 2ZJFA 3WISA 3KOXA 2BFMA 5SY6A 4LXQA 5JXWA 3SI7A 3VJRA 3FRHA 3V8EA 1SMKA 1DTEA 3OJWA 5DHAA 3ZS9A 4C07A 4CNQA 3QVGA 1WX1A 4NCBA 1GCIA 2WJ3A 3ZHSA 1LNQA 4NPCA 1DC5A 1JXOA 3PZBA 5K3AA 1GAXA 3SFTA 1YZFA 2BFAA 1XJCA 4FN4A 2FDXA 4KLNA 1S2NA 1WXXA 4HRVA 4R31A 2PLWA 4KPGA 5DBIA 4R6XA 3ECAA 5CK4A 1RABA 2CNWD 3GZTB 1K66A 1ZAYA 3I39X 2A4KA 2I67A 3FYHA 2GFIA 5DI9A 6NULA 4RK1A 4FW9A 1DIGA 2JAPA 3L7IA 1QGZA 1O0CA 1YRBA 3WQQA 4BNVA 1SOUA 3JV7A 3JATA 1F51E 2KPOA 3LP6A 3RC9A 4ARUA 3MBOA 4CKEB 3N1UA 5CPBA 3TZKA 3ZHQA 1K5HA 3ZE1B 4OUDB 5AJUA 2IY9A 3N8GA 5E7QA 1JYEA 4LYEA 1M1YB 2GHTA 3VO2A 4RTMA 3OCYA 4IWXA 4JUFA 5TEWA 5IMBA 4UM8B 1DBSA 1ZNQO 4IFIA 1MDFA 2LIVA 2R8XA 2VT6A 2JHAA 1LK7A 3ZGLA 4XR9A 1OKKD 4FOSA 4JEHA 4QOGA 4PZEA 1L5WA 5LYYA 3RIXA 3VZBA 3K1ZA 4C4SA 3LX4A 4YAGA 1AKVA 3CUKA 5I7OA 1D1PA 1Z0KA 4EBBA 1AGNA 5GM1A 3QNUA 5IT0A 1L3BA 4H3HB 4PLFA 4FGZA 1U7HA 1AM4D 5F9MA 4LVNA 1I30A 3DA8A 1CT9A 1UOQA 3IT3A 1WUHS 4Y9RA 1DLJA 1C0IA 3AEYA 2NV6A 1G5PA 3C39A 1U1GA 3FDZB 3BDIA 3L01A 4KE9A 4BWYA 4P33A 3ZD6A 5A05A 4LJLA 1J0XO 5TQVA 5CG1A 3DLBA 4R98A 5DFAA 2QJOA 1RLTA 1KZ9A 2GD0A 4BGUA 1JILA 4J3NA 3NYIA 3IFSA 4GQBA 3LZCA 4MMXB 4RL6A 3IQFA 1KYQA 4MYUA 2O2XA 4ZQHA 2ZSEA 3ADDA 1PV2A 2XYHA 4B74A 4YLGA 1YIAA 1JLLA 2W58A 4KMRA 3RG2A 3HDGA 1J49A 2Y1GA 3QPWA 4MWBA 4WWHA 2R44A 2W0MA 5J2UA 1E59A 1GPH1 3KKNA 1SXHA 3HU5A 4NNJA 4RSRA 4DIUA 3MLEA 4MP6A 3WWEA 2BFBB 2ODTX 1SA0B 4OU5A 3LOPA 2C5AA 4G26A 1FDWA 4ZQIA 5C31A 4BS9A 1Z73A 3AXSA 1JZTA 4GOOD 3WL6A 4BNWA 4DDTA 3WO1A 4G86A 3MJSA 2I7DA 2FGKA 2WBLC 2GPBA 4M8IA 1TJ5A 3FZYA 1AKUA 4QYXA 2RGDA 3KQHA 3DMHA 1ZJWA 2IU6A 3AF1A 2W4QA 3O74A 2O8EB 2O3SA 1RCUA 4DQLA 2B5OA 1BZYA 4X85A 5K0TA 4HKTA 1MX5A 3WNDA 1UKVY 3G5MA 4MUIA 1MA0A 2CLSA 1U8UA 2ZRCA 5ALHA 4ER3A 5B7NA 4KXLA 5F1PA 2JIOA 4ZQBA 1BVYF 1P73A 2C8JA 3EUAA 4BXOA 2DRIA 4QDOA 3BXEA 1HL3A 1ND6A 1T8RA 1Q74A 1LC3A 1RI1A 4X6UA 1CFJA 4JJ7A 4ARIA 1KPGA 1M8GA 2N3ZA 5CM8B 1NJFA 4PWZA 2GFQA 2VHUA 4BFXA 4F5YA 5A1JA 4A8PA 2AMYA 4N5MA 5K6AC 1DC7A 1ZS9A 4ZGBA 5DX0A 1E0DA 1N75A 1RWPA 1TIKA 1LSUA 4ZU1X 4C04A 1TA0A 2Q4EA 3N5CA 3NKFA 1KIAA 4LX0A 4DV2B 2CHGA 4MIEA 2XQIA 1LLUA 3UENA 1ZXBA 3VU3A 1ZISA 3M82A 1CUAA 2WWGA 1Q11A 3DMYA 4FS8A 2YFYA 4ZYTA 3EEYA 3PUXA 4UCXA 5C8YF 5I45A 5HEKA 3DLHA 1XXHB 3AU9A 2JNWA 2EOAA 2NZVG 3LL4A 4Y2UA 4COOA 4DUYB 4DWJA 4KV9A 5SZIA 4EUFA 4KPYA 2EV9A 4LXUA 2WSLA 5FHRA 4JL8A 3NM4A 4LGMA 2WAYA 1JIKA 1TCAA 3KSMA 3TD2A 5IKPA 5CLLA 4ALIA 4DJDC 2F3TA 2ZTUA 4AK9A 2IEZA 1BWPA 3FTDA 5HJ7A 2FYTA 1WCIA 3GEBA 4IS3A 4W6ZA 3UJNA 2JLSA 4X94A 1X38A 1JQLB 1R0KA 1CUEA 4FBLA 5F3RA 5UKDA 4N0DA 1OXKB 3OP4A 1EXWA 3BIWA 4WZAB 1K3UB 4G25A 1TKBA 2VJKA 2P9GA 3WX0A 3QW4B 3E8MA 3FLMA 3REQA 3CRMA 1T5DX 4M6WB 4TT8A 3HR8A 1IHYA 2GEKA 2OAEA 2H9YA 3DM9B 2I91A 4U00A 2IHKA 3D6NB 3PXCX 4D8TA 3HCWA 1QVWA 1QGOA 3VOBA 4TTAA 3EGXA 3C3BA 4DQUA 4YT8A 5JVDB 5A06A 3HEAA 5LP6B 2QLTA 2K87A 1ZMBA 2VDRB 1C3XA 4E7OA 3VH4A 4FI3C 4CMHA 2JIMA 1FP4A 2BMWA 2AQKA 2HT6A 1AY0A 3UK1A 1R2QA 3I73A 4YJGA 1FFDA 1XMPA 4U7TB 3ZLJA 2VSFA 1XP5A 2ABWA 4QTXA 5JAIA 2YRXA 4A4DA 5EJAA 2HFKA 2FZCA 1EJ2A 2H5EA 3BPSA 4LX8A 1SKYB 1KQPA 1C9KA 3NGMA 2O7QA 3Q72A 4GECA 3ZY3A 1D4ZA 3WLEA 4B31A 1QQAA 1V4BA 1PHRA 2NTEA 3HZZA 2VT2A 3G5LA 2Q9BA 2CDCA 2J67A 1B3BA 5JATA 1MVOA 2PRIA 2YJ3A 3KLMX 1O97C 5KAPA 1MX1A 1TIBA 5JNUA 3RTGA 3WHPA 1NW6A 4E21A 4JI4B 1WUYA 2UYQA 1NOKA 3MSXA 2P4QA 3VYRB 3BMQA 4E5YA 1IN7A 4KGDA 2WMOB 3L1VA 3OQBA 1KJYA 2ORWA 2ZBQA 4M0CA 3EXEB 1Z0JA 4HDSB 3KEFA 5ALOA 3MCAA 2Z8YM 2B1GA 4Q1AA 3H7AA 1QIHA 2E89A 2TMDA 4S1OA 3VVMA 4AN4A 2QYOA 4AP6A 4S0XA 3ZS8A 4EMTA 5JAQA 4GPEA 2D0OB 1TMOA 2FFJA 4LHXA 2GEDA 2OAGA 2REBA 3GLHB 2PXXA 4MW0A 2BR3A 3KWJA 3O2JA 1SVLA 2QG4A 3MWEB 4U3JB 5BR1A 1Q14A 2QSJA 2FPLA 1OPRA 5KTMA 3IPLA 1IYZA 1L7QA 2XGSA 2Z57A 3DO6A 3M2PA 5IKEA 5ITVA 2BFEB 2V96A 2G9VA 1E1QA 2Z95A 4WK6A 1A9ZA 1QAQA 2JHGA 1C2TA 3DOIA 4U2GA 2C7OA 3PQ7A 2ZUTA 4LGYA 1DKNA 3KOZA 3V4SA 3GJ7A 3RHTA 3ENWA 4MR8A 2YXDA 1Z4PX 1HDYA 5E0KB 2PXAA 2G76A 3MYRA 5A5VA 4F3TA 4EHDA 2Y93A 2ZBVA 1JT2A 2ZU0C 2FPRA 4NHOA 4PO3X 2Z4RA 4ZVMA 3STXA 3GLIA 3EQ6A 4HVLA 4Q4AA 4DCOA 4CTMA 1DBPA 1UOOA 5KSYA 4BO7A 3WKCA 1ZX1A 4UTPA 1SH7A 1ML4A 3AHJA 4MV8A 4MQ6A 5E1BA 3FPSA 3PGVA 4PFSA 5B5SA 3I9OA 3RF6A 1VLMA 2P2YA 4AJLA 5ED0A 3OPYA 4ZVVA 4MHTA 1UZNA 1U1FA 4KQGA 5JSHA 3H8JA 1BX3A 4HNTA 1KRXA 1PWZA 5BRAA 3IAFA 4V0SA 1GAJA 2O3RA 4GI7A 3ACDA 2VCHA 4NLLA 1H42A 1EUDB 1UFOA 1PYGA 4DANA 4EA9A 1QX3A 3BXHA 1L7DA 1VLQA 2J9YB 4XUCA 3WB1A 3M7IA 4EF5A 1BGXT 4X24A 2QLLA 4GSKA 2H2WA 1MG0A 1BCRA 1V7QA 2XF2A 1OLOA 2JJQA 1A7AA 4BLRA 4DR7B 1E7WA 1RWVA 4M22A 3WRVA 2FXVA 2V58A 2JAWA 3DONA 1SPBS 3L43A 1VPDA 4PYLA 2W42A 4TUYA 1M34B 4EPVA 1LPNA 3NT4A 3PS9A 2OD7A 3QHQA 2MMCA 1UPBA 1PRYA 2L19A 2ID4A 3HSKA 1WW3A 2QRMA 2Q4OA 1KSFX 3IOCA 3IT0A 4D6PA 2C42A 3HSSA 1C0EA 3TH5A 1GGFA 4OAPA 1ZESA 2A88A 5KJEA 3FHTA 1CNFA 2MHCA 2HSJA 4EGCB 1IEVA 1ZU5A 2V7GA 3KUXA 5I47A 4ZPXA 1E5DA 1YJAA 5ECYA 2HHAA 4R40A 1GPBA 2C4WA 2EDAA 4REQB 1MO4A 2NSYA 4ISBA 1YJQA 3DNPA 3FNQA 2QTGA 2V54A 2PL1A 1EWRA 5I4KA 5JS8A 2BE7A 1E3SA 1NI4A 3P8ZA 5TLSA 2O8FB 3QBTA 5H4HA 3KQKA 5HZKA 2CZCA 4G5OA 2E85A 4FDLA 4R41A 5EAIA 1W4ZA 5AR1A 4IJ5A 3ND5A 2SBTA 2EBFX 1AKRA 3QUTA 1ZDMA 3K30A 5DHUA 3VTZA 3ZWWA 4BMCA 4QVIA 4BX2A 3EXFB 2VQ3A 4C88A 2CY0A 4DDVA 1EP3B 1Y4ZA 3VZQA 3UAZA 4MV5A 3M49A 1B14A 1MIOA 4OGWA 3R24A 2EQAA 4R1PA 4B7ZA 2ZYUX 5HF6A 3EGDB 3H1GA 1JT9A 4UZSA 4MS3B 4U02A 1N2ZA 4Q9KA 5J5AA 3T3EA 4JLOA 3QF4B 2R2AA 4ILKA 2ZJ4A 2WTBA 3DMFA 2BUCA 3E4DA 4KQWA 3UO8B 3PRHA 1XYVA 1WW2A 2VTEA 3DP9A 4IZIA 1U2TA 3FSGD 3FTQA 1SC4A 2VUIB 4LA4A 5BQ3A 1E1KA 3GLGB 4JJKA 1XR3A 1ZSYA 3J81k 3W4KA 4YMLA 3SP1A 3GJXC 2QUZA 2FV8A 5EQDA 4D97A 3QVSA 4X92A 3BEOA 3KK0A 3OH8A 3DKRA 4Q7QA 3ILHA 2ZTLA 1NNI1 1CR4A 1DAOA 4RACA 4E2WA 5T6BA 2VT3A 1NSFA 5CNJA 4HNSA 3QVVA 2EJTA 3UOGA 1KDYA 3X1KA 1XT6A 1VHQA 2BEVB 2HO5A 2VP0A 2PVPA 3DPSA 3H5IA 3D3KA 3T5MA 4JN6B 3TR0A 4B4DA 3A36A 1U9JA 1WDMA 3D7LA 3SMQA 5CVEA 3ZWOA 2H1CA 4HTAA 2KQUA 5EUQB 1NJ1A 3S2YA 4HQNA 2ZREA 2A9JA 3DG9A 5HR5A 2LUOA 1U3GA 5MFPA 3S2EA 2GLUA 2B0CA 4L4RA 3SHTA 4DUGD 3CEMA 1HETA 1OROA 4S1TA 3A58B 4Y6LA 4BLWA 2QTAA 1WD7A 3CNLA 2YINC 1C9DB 3GO4A 4KQKA 4D1YA 1WB5A 3N7UA 3LXXA 5K51A 3DE4X 4GZ3A 2DTXA 4B3FX 2MSWA 1I7LA 1DZIA 5CLHA 3RRYA 3ZE6A 3EISA 3UK7A 4U9IS 4DYHA 4BV2A 2V7EA 4RYLA 3AP2A 5EZ6B 4O2RA 1G64A 3M3DA 3U6KA 1HTWA 3HLYA 3BIJA 3NC1C 1I4EB 1CKEA 2JJYA 3ZCQA 3ULKA 2K7ZA 2NV2B 1GUDA 3PQCA 2ZCVA 4QTTB 5LA6B 4IG4A 3IKMB 1GTL1 3B78A 4IR7A 3S27A 5KPDA 1D2AA 3NDRA 3EDCA 1N8SA 1U98A 4HHEA 4E6EA 3Q8WA 2Q07A 2Q1WA 4LVOA 4DSZA 2CMDA 4OY3A 3UPUA 4WERA 1NY6A 4RAOA 4KEAA 1GPAA 1TC1A 4BPRA 2IHYA 4OBEA 3BCRA 3SDBA 4EIWA 3PP8A 3VR6A 1N1DA 4F5EA 1J00A 2OHGA 2ZUWA 4HZUB 5A9RA 3QIAA 1B1CA 1SUEA 1LXCA 2EWVA 4CEJB 4W5NA 3U40A 3AHGA 4OX9Y 1RHKA 1KVSA 1YFLA 2WZQA 1CVIA 2X7JA 1HL7A 5ALPA 3TLZA 3N76A 4QTYA 5JZOA 5AKEA 5K8LA 4NHEA 1DINA 1MJNA 5G1PA 1ML3A 1PR1A 2OORA 4U8GA 1JH9A 3NHKA 3U13A 3VPBA 3R8FA 4RD6A 3W6NA 4OKSA 3F6EX 1Y7PA 3AM4A 1XG5A 1DBVO 1BE8A 2B1RA 3ROKA 2HDOA 4CKWA 2RHLA 5I4IA 5CVJA 2ZQ5A 3EH1A 4NXNB 2OV6A 2QVYX 3JZIA 4AG6A 2RIRA 3UATA 3D4PA 1DCKA 4B33A 4WLFA 3RS5A 2RAPA 1L1QA 3S2SA 3M6VA 3ORHA 5TQ0B 2HPVA 4RS4A 1B0AA 1NGSA 4F8YA 5B3JC 3T1YB 3FOEC 2QYSA 2FPWA 4IHJA 4BAZA 2FLWA 3K92A 1ZIOA 1ZRHA 3DZCA 4FYHA 4NMMA 4M8LA 2XCOA 3PQDA 4TL6A 3FA2A 4I1YA 5DPMA 2F43B 5LBTA 4FKMA 4HB4A 2VPXA 3HABA 5AKZA 1SD1A 2VAVA 3EPPA 2JGNA 5LQRA 3R40A 4CG0A 1CJUC 2IEYA 5C3UA 1Q1BA 2EFCB 3DBRA 5A6SB 1WNTA 4H3VA 5CG2A 3LWNA 4WIAA 3KL2A 2DQZA 3IUMA 1Z5WA 5DIFA 1W7AA 4RXMA 1H2HA 2AG8A 4EG3A 2ZIZA 2VXOA 4EY7A 2EQ5A 3C15C 3DZFA 2Q9AA 4GGOA 4E22A 3AKCA 3UBTA 1ND5A 3M4NA 3KAJA 4BNTA 3ZE7A 4POOA 4N7MA 1M72A 2PNFA 1T36A 3RGWS 2UV8A 1BWQA 1W34A 3D31A 1NVFA 2C20A 5B64A 4IIJA 4AJEA 1LZKA 3GG9A 2BBSA 3ICWA 4B6SA 1P6QA 2IELA 1QK3A 5I9NA 3G9XA 3AHIA 5HQJA 1HFWA 3PPYA 4KK3A 1N2CB 1B6TA 1YACA 3A6ZA 3G9UA 1BQEA 2P30A 2C7QA 2OPHA 2OHFA 3RABA 5ALVA 4X1IB 1TZKA 2PMKA 4A73A 5TX7A 1L1RA 3KYDA 1D5WA 3MPOA 5B4TA 3SNKA 3VMFA 4BJ3A 3EGWA 2QU8A 1DEOA 1G21A 4HMQA 4JMLA 3LUCA 3E3MA 1BHJA 1CDEA 4F85A 4XWOA 1EE2A 1RKUA 3LM8A 3AUTA 5B58T 4PF1A 4CM9D 3STTA 4Q3OA 3OESA 3HVRA 2ECQA 3BBLA 2YWHA 3W7VA 2YXEA 2ANCA 1SXJD 2QMHA 1AXGA 3LCRA 1WLYA 2H57A 3AP1A 4IV5A 4RX1A 4XI9A 5LIRA 3DZDA 1H3NA 4IGKA 2PZMA 1DKQA 1VPEA 5IM5A 4EG5A 2HD4A 3EXG2 2GXUA 4E1BA 1A7KA 4R0MA 3AIIA 3N07A 1KY5A 2AR9A 1G9XA 2PSDA 2DGDA 1FSFA 1HT2E 4MO9A 4N3NA 1RP1A 1ZG3A 4QODA 1JR2A 4NV1A 5CTAA 2FEOA 5F1OA 5BVHB 4CODB 2NX2A 4WFQA 3RBAA 4M0EA 1FOEB 1M2EA 2XGMA 2YVQA 4FP9A 3R6DA 3V6MA 4P0QB 1GV1A 2IYVA 2PQ6A 1W75A 4LKOA 2C57A 1MABB 3FPLA 3HBFA 2P41A 2EP8A 1Y3HA 3KVYA 3QG5A 3QYFA 3DF7A 4ES6A 2QHXA 2JBWA 4P22A 4Q7MB 4V0QA 1TD1A 3CQ9A 3M34A 4QQFA 3C8DA 2NU7B 1Q0TA 4N47A 5JO0A 4B9EA 4D9KA 1OIXA 4MH0R 2Q46A 5L53A 2EJWA 1WP4A 3I76A 4Y2QA 4IPTA 1X6VA 5HIIA 4B0PA 5JHHB 3A0UA 1PR3A 3KT3A 1JA9A 5K0SA 1WSWA 2PS0A 1K3TA 4V0MA 1C9NA 1VE7A 2WJPA 2NVWA 2EC5A 3HVHA 3MT0A 3JS5A 3K2IA 4L02A 5KQMA 1X7XA 3DZBA 1LI7A 2CXPA 3OE7A 5KWIA 4ZN6A 4B2PA 2HDHA 4LECA 1YMQA 5F7OA 2GYYA 2ZIXA 4R7TA 5IBRA 3Q8LA 3U19A 4LHVA 5DXAA 3MWFA 2H18A 1CK4A 4IEFB 1EGQA 3KPVA 3PHLA 1RIIA 3KD2A 1WBDA 4PEVA 3HLKA 1HLGA 3WLNA 2O8DA 4U8HA 4PYKA 1THTA 1U3UA 3BIOA 4PLTA 5DLEA 3DV9A 4K6MA 2J09A 2R6AA 4RPCA 2G28A 3R5KA 2IXAA 5IG2A 1F0KA 2P5SA 4Z9BA 1MEEA 1Y9ZA 5HF8A 4JBXA 1JBQA 1JKMA 2XUGA 2J6CA 4X0EA 3VKFA 1ZM9A 1QNLA 3RKUA 5FWYB 1YQDA 5JSFA 1M7HA 1AGXA 2OGUA 4H4CA 3VUEA 4LXYA 4GQIA 3VPSA 4AY3A 4US2R 3AETA 2NYVA 2IBTA 1N2BA 1F2TA 1E98A 1NR1A 5CW1A 5D3QA 1QGDA 4QXMA 2ZTSA 3ZOKA 1ZZGA 1KKUA 3KG2A 4NZ9A 5AJVB 5ADWA 4NENA 1IIRA 4MDHA 3U3RA 4GZ5A 4Q37A 3K8ZA 4EUHA 4TQUS 3V42A 2POQX 3N9IA 5F7JA 1SC3A 4ZHQB 1W93A 4XVRA 2REQB 3QWFA 4UAVA 4F2GA 1E94E 3MGKA 2WFLA 3O7MA 1ODIA 1XNQB 2VJNA 3N0VA 4PAQA 1I1HA 3QPAA 3WNZA 5CFRA 2BUBA 1TIPA 5LD2B 4YP6A 2BKVA 2BCJQ 1R5BA 5IHPA 5CHEA 2QJWA 4H7HA 2EZ9A 3JQRA 1MQSA 3RLFA 1M9NA 1P91A 2DPGA 3BD8A 4MVCA 3TJRA 3GLTA 4X7PA 4Y2TA 3ZW9A 1RQLA 3D02A 4M7OA 2XRMA 4IKEA 1P5HA 5AOVA 1IHXA 2NSDA 5I7UA 3CNHA 3FHLA 5IZ4A 3OZEA 1JR3D 4JLAA 3TIIA 4A3SA 4JUIA 4JKYA 3L79A 5JPIA 1X3LA 1ORRA 4BV8A 3ZJ5A 1Y9JA 2BC9A 4OLJA 3PU6A 3VHLB 2DWPA 4OREX 2X8BA 1L4NA 1T5BA 3DWIA 2QD5A 3G89A 3IAHA 3KB8A 3M6IA 4BFWA 4KIFA 4LSZA 1DE0A 3EZGA 1MX9A 4L15A 4RTOA 4KKXB 4UHJA 5C37A 4A0RA 3RSHA 2IP2A 3K0BA 1FSSA 3Q1LA 3QYAA 4ZMSA 4HF7A 3TRIA 4CU2A 1B4DA 3H75A 3MWLA 5JCZA 2FMIA 4XB1A 3W7AA 1XMQB 1CHNA 1EM8A 4P7GA 3EARA 4KGVA 1TMYA 4WZBB 4IUBS 3SJZA 1E99A 1ZH8A 2O5VA 2R8BA 4G0PA 4N65A 2ZI3A 5HBRA 5TF0A 2NW6A 1CRWG 4DG5A 3B6MA 1QGUB 3MFQA 4O5OA 1XQ6A 3KOUA 4CFYA 4B6FA 5COBA 2HPHA 2CXOA 4F4UA 4R5MA 2YIMA 3INGA 3LY9A 5KTNA 5G53C 2M2IA 1LTQA 1OIVA 3GGGA 1NNSA 5DRTA 3G7NA 1NNLA 3HZOA 2J9GA 1XWFA 1NLMA 3HJTA 3KPWA 1YL6A 4HMOA 1GTG1 4YRQA 2VJMB 1OU0A 4I9HA 5CEFA 2IEBA 1RJEA 1TQ6A 3P9IA 3OEHD 3SYLA 1IE3A 3L6BA 3EZ6A 3KC2A 4ZCTA 3COPA 3RNLA 5TT0A 3S81A 1TZMA 3FDIA 3HCDA 5EWLB 4CM4A 2PWAA 2PLRA 4Y2PA 3WTBA 4AO6A 1SQFA 1Z4OA 2J07A 3GJTA 3HVUA 4ZHQF 2V4UA 3P9ZA 3Q1KA 4ZO7A 5ALYA 2Q3FA 3K8YA 3VBEA 3W2HA 1UAGA 2PH3A 4E5PA 5KNDD 1OR8A 2CFTA 4QUJA 4IIUA 1HV8A 2QN1A 4FKBA 1G60A 3F6SA 1E62A 4BJ5A 4YI3A 3RS9A 1UJ4A 3NIFB 1X0XA 4R8KA 2FLVA 3EOAI 3N2ZB 3MERA 1HDGO 3AHDA 3EASA 1AKYA 2ACVA 4FFDA 2C82A 2JZOA 3BRWA 1GZ3A 2CJXA 3KV1A 4FR5A 1Z74A 5H70A 3IMEA 2J30A 4LBWA 2NU8B 4ZCRA 1U2RA 3FFBA 5HUJA 3EXEA 4L4UA 3UGKA 3K53A 5BN4B 3I9MA 4M3NA 4MIOA 4PIMA 3QKSB 4RD4A 3FPBA 4YUVA 4HDCA 3I04A 1YB4A 3A9RA 3W2FA 2WU8A 2YFQA 3CPEA 1QP8A 4YO8A 1IPFA 1I13A 3U49A 3CW8X 3OJCA 1PQPA 3H6GA 3O31A 3FYDA 2B8WA 1OXTA 1BE6A 1B41A 2ZZMA 4P2BA 2OMEA 3AONB 1HT3A 2IYOA 3VPFA 3LLUA 1AQIA 2PGJA 2PZLA 3T4EA 4B79A 1FFYA 3H2GA 4GQAA 3FNGA 3PLAE 3CZCA 5HILA 1YU6A 2AYYA 4JJIA 4KDEA 4LJKA 4F2PA 3O9VA 4IDAA 2V6GA 2ZANA 4LJ7A 3RRFA 1NQTA 1K8YB 3MS4A 1OX6A 3R44A 3G49A 3KKPA 1KP9A 2UVPA 2ZB3A 2V5VA 2NP7A 1ZI9A 2DPMA 5DV9A 2CXNA 5DW0A 4HYQA 1PK9A 1W85B 4L5BA 2X42A 2AC7A 1ACLA 3I3SR 3DVLA 5LKAA 4AJPA 1I0ZA 1ZUIA 1SUAA 2D1FA 3OUZA 4FUTA 1AIPA 4Z2AA 1CV2A 1JNXX 3DMPA 1JQKA 2NU8A 4TQAA 2BFFB 2ZJ3A 3M1AA 4EY5A 5ERGB 4F84A 3L3BA 1AUVA 5AK5A 2C1EA 4Q9HA 1I51A 2LRHA 1LF0A 3OQHA 2AOUA 2AA3A 4L27A 1PW5A 4OHPA 4R2LA 4Y30A 3HM9A 2IXGA 4YQFA 3U56A 3G59A 4YLYA 4CXMA 1KQFA 4HX5A 4OGFA 1XCMA 3IMFA 1RDFA 1ZCFA 2AZTA 1KOFA 5JNRA 4LQ4A 2WYHA 3LBYA 4HLUC 4HFMA 1L5LA 3PUVA 3A4IA 3I8SA 5FFNA 3VI4B 4Z99A 5JWRA 4X8MA 3IALA 2EKZA 3VTAA 1BXRA 4YT5A 1GWNA 3D5QA 4FM9A 1I4OA 5DHSA 1Q7GA 1QKJA 3K16A 3O38A 3NVKI 3U3DA 5A02A 4V39A 1K6EA 1SCDA 4ND7A 1OFTA 1XA4A 2XUAA 1SWWA 5ALWA 4GX5A 3KDPA 5IAJA 4Q5IA 4M0UA 2DQYA 2WC1A 2FJUA 2YASA 5HJEA 2WF9A 2XUPA 1M74A 2GRUA 1ADFA 2QTRA 3KTDA 4HQ0A 2D1RA 2AJBA 4HT3B 5I7FA 3JWEA 5T6MA 5BR7A 4QXQA 1SU8A 5JNVA 4AB1A 1LPMA 1H8HA 5HDQA 1FMLA 3OKFA 4NOJA 3WC4A 4AF6A 1TW3A 2AZXA 2P2LA 3T3DA 1WNFA 1FNSA 2VQEB 3E9DA 1XLTA 3FLAA 1LEHA 2PT5A 1ZCBA 2QLNA 1Y89A 4Z3OA 3RTBA 3BTOA 3LX8A 5HE8A 1FP2A 1FNCA 2AN4A 4I50B 2CK3A 2DE0X 3DVAA 5GIOE 4W5WA 2G5PA 2QDKA 2R00A 3C1UA 4O3FA 1O9BA 1NF2A 2JIPA 4TMVA 3TJZA 3K9FC 1W36C 2FX2A 1E3IA 4KQIA 1J0EA 3NFRA 1USVA 5TY0A 1QGED 1XA3A 3V8MA 4TZ6A 2MOKA 5IKOA 4PRKA 2SKDA 3S5UA 3AR9A 2BJHA 1GLVA 4NCHA 2GEJA 4U2CA 5DM60 1QU3A 1FZTA 1ZJZA 2I9PA 4Y2GA 4L4ZA 3OKCA 1OA1A 4HQFA 3LC7O 2BEJA 1SQSA 2D74A 4WNYA 1Y8RB 2I3ZA 1KI7A 2HZ7A 3H1PA 1TA9A 3VU8A 4BNGA 4DOMA 4FDVA 1T6ZA 1T6YA 2VH5R 2GFHA 3C3CA 5DLPA 3W2TA 1VKNA 1SOVA 2DXIA 3MWGA 1NW9B 4CLXA 3D2LA 3H6HA 4L6IA 4IOLA 1G0OA 3CLRC 3ZV4A 3SC4A 4UJ5A 2HBZA 3LOUA 4E15A 1J2TA 5HF9A 2XCIA 4Z1MA 3UV3A 4F71A 1CB7A 3B3AA 2VF7A 1RRMA 3MAGA 3RCBA 5I4BA 4D43A 5L45A 4GPD1 3U0BA 2UDPA 3HUUA 4MRPA 1HTTA 1D9XA 1YQXA 2PDAA 5KHLB 2JGDB 1E58A 2Q1TA 3HE3A 1L2TA 1YC5A 2ZTHA 3VHRA 3FY4A 3ICVA 1Y0BA 2Q5IA 2WG0A 3KZKA 2XF8A 2GQ0A 3R0JA 4C87A 4RSGA 5IX8A 2HMSA 1LQTA 1WUTA 2AD1A 3GLHA 3F1KA 4L95C 4MJ3A 1Z4IA 5DE3A 2A33A 2QTBA 4OM8A 1XZHA 2CHQA 4BQEA 4JLKA 5AJTA 2DOKA 5KYTA 4BFLA 1RI4A 3KJHA 1G42A 4I4TA 3I1IA 4NTZA 1CVRA 1L6RA 4IJKA 5BW4A 3TLAA 2XNJA 2OOSA 3PNVA 4LCBA 1JDJA 4C30A 5JE8A 1RXWA 3DOEA 4QUGA 1ISRA 2ZAIA 4U2EA 5K99A 3QYPA 2IHBA 4FEYA 4D82A 5C7IO 5EXEA 3LVRE 2Y0DA 3GYGA 1RHRA 1ICIA 1OLXB 2QTZA 1T10A 2SICE 3A1SA 3GLQA 4LTMA 3V1NA 2BHTA 3GEPA 4NI5A 4OUKX 4C0BA 1GGNA 1CJKC 1H0RA 4Y98A 3VO1A 1QRUA 2VXCA 4MI1A 1WR8A 3UMYA 5IAOA 3HO1A 3E82A 5FPHA 4JUDX 2DQSA 2AHRA 2JFXA 1PTKA 3T94A 1SHLA 5IJAA 3RQIA 3HN7A 3JWJA 3UOAB 5F35A 1JIIA 2F9MA 2VXYA 2WM2A 2XZDA 4BGVA 3E3OA 5IABA 1XDBA 1IJEA 3EDMA 3EGDA 1VE9A 3AVYA 3CW9A 3UHJA 5IAEA 3T1HB 1Z36A 4OHXA 1RKXA 3BD6A 3K6KA 4AMZA 4K9LA 2Q5HA 2VTKA 4YJHA 3UHFA 4MRRA 2I4OA 4TZ0A 1WKBA 1JALA 2W71A 1QH1B 2WZBA 1G4UR 1ULAA 3GJRA 1EQAA 4BNXA 1T1RA 3OAAA 4NJMB 3THWA 3GBVA 3L6RA 3LV8A 2QAGB 4NAHA 2XPCA 5D01A 3O4HA 1PQUA 4HLQB 1V43A 2HHHB 1GUAA 1YDGA 1K86A 3FAZA 4EVQA 4ZOQI 2J9FA 3FGZA 4KTTE 1Y5RA 3UYKA 5BVGB 2HJHA 3IP3A 4DDMA 5K0EA 4X3CA 3SLKA 2AG5A 2YZNA 3O94A 3WDMA 4BKQA 1T2EA 3ONNA 4M9XA 5AHRA 1E2IA 1U2ZA 1X8JA 1GTZA 4LV5B 2RBEA 1W0KD 2QU7A 2ZI6A 2YYSA 3NHWA 4G1EB 2VRCA 3RYIA 1O96B 1V1MB 1A9XA 1T8YA 5A0TA 1RPJA 3OQIA 5J4LA 2FSUA 2BFOA 1RZUA 1FUKA 4PXSA 2Z43A 1NR7A 2VQSA 3BL5A 2GEFA 1P0IA 2HUNA 2FSIA 2MSEB 3PJDA 2YWRA 1YIDA 2ZE5A 3TEJA 1JDTA 1KIMA 2ZJ8A 3FHJA 5HIKA 1V6CA 2XXAA 3KQYA 2IYTA 1L8OA 3IDAA 4G0VA 4D02A 3EF0A 1M6YA 4MQEB 2C77A 2PD6A 4DA7A 1X9GA 5EKXA 1GKKA 1VLHA 3FFTA 3HDQA 5KYXB 2C2BA 3FI0A 1HG1A 2XB9A 1L9KA 1H1LA 3N6VA 3V55A 1MJGA 1DBQA 3R0ZA 4WBNA 1ODJA 3H87A 3PNBA 3R4CA 4UBKA 1ONOA 3B1FA 3BN3A 3MSCA 3IRVA 4AQDA 2YC4C 2SKCA 1A71A 3TAHA 4NC9A 3GT3A 2JGRA 3PDIA 2W6QA 1SXJE 3MD0A 5BRJA 2QLMA 4GO1A 3SXPA 4F2WA 3SBOA 2DU8A 2LDXA 1E5VA 1JQAA 2A5LA 1IZ8A 2H7XA 2YZMA 3MG9A 3DEYX 1OX5A 4LYGA 5HGJA 1DFHA 1R5JA 3JQAA 4OBWA 1XFAA 5CA1A 3U09A 2XMGA 2WK1A 4IH4A 3IUEA 2CCGA 3KDAA 3F9RA 4ADSG 1OSNA 4BO1A 8ABPA 1W6RA 1GARA 4IAOA 3G2HA 1VKHA 3EPLA 3U7FB 5KYUA 2IPOA 2BBTA 5KUTA 3INRA 1I3CA 2AVNA 3ZNNA 3L4BC 3FXAA 4V1CI 1XEXA 2YOHA 3U16A 2GD2A 3IBGA 1FRQA 2XMPA 4NCKA 1ABFA 1XDGA 2WD7B 4H7IA 4RMGA 4Y18A 4JENA 1BIFA 4IYJA 3IUJA 4YDRA 2AZMA 3ELUA 2ZE7A 3GH1A 1SCUB 1O3YA 3WNVA 3E53A 2BI4A 1AQUA 1PK7A 2Z2KA 4MJ7A 5DLYA 1WSAA 1YI1A 3BH6A 4OMDA 3ROEA 2OLEA 4RGVA 1OBHA 5LYJA 1XYGA 4H59A 4BKRA 3C85A 1XL1A 3BK2A 3ROGA 3GDHA 1P44A 1ZM4A 2C9YA 3H5RA 1U28C 2FPMA 4FXPA 3WQRA 5KWJA 3BK7A 421PA 1IM5A 1KTVA 3Q5EA 4IM7A 2ZB7A 3KT8A 1Q21A 3PNOA 1NASA 1VRCA 2D5AA 3I6IA 2IH4A 1BJRE 1Y8CA 1XTTA 2XJ4A 4Q6BA 4RZQA 2VPPA 4MJXA 4W9RA 3B60A 2I80A 1C1YA 2YHAA 5DLDA 1QYIA 1G5TA 1H94A 1KAOA 2R8ZA 1R74A 1Z9BA 2YXNA 1XRSB 3LQYA 3D6JA 3S2ZA 5D85A 2UZIR 5G4LA 4G0MA 5CEEA 3LCUA 4JZYA 4BQQA 4IIHA 1R6VA 1QS0A 4WOBA 4X1YB 2DCUA 4G4SP 2JJMA 1XTJA 1ZCZA 1A8UA 1HE2A 1UANA 3K9HA 2XUJA 2AF3C 3THSA 1L8XA 3TCNA 1IOVA 2R6FA 4LCEA 2F8SA 4O6VA 1P3JA 3DCNA 1OGYA 3ZWCA 3IUYA 1I10A 5KNLA 7AT1A 4DQKA 5C0OE 3HNOA 1ZH2A 4S2UA 1ADGA 1R0WA 1PWXA 1OYVA 2QMQA 2YW9A 2XYVA 5ES4B 5LCXA 2J3DA 3V8PA 5LQJA 1KOGA 4OQLA 2KYRA 2I54A 1SB8A 3TCXB 4CLHA 2PUEA 5CM2Z 3PGMA 3GQBB 5DJ5A 3NGLA 2GZHA 3O1IC 3PFNA 4E5DA 4NEHB 3ZGXA 3SVZA 4N7RA 1A8SA 1ZFNA 1X2BA 1NXVA 2GUWA 5LZ5A 4RJKA 2HCFA 3ESBA 3EXHB 4XFJA 1USIA 1ZJ4A 3PDUA 2XCQA 1E8MA 1FUEA 3JQFA 3HFGA 4CWAA 2DUMA 2EFEB 1WB4A 1LA2A 2AFIA 2W37A 3LSYA 4MUMA 2CSXA 5BR8B 4OL9A 1EEHA 2CVOA 1QTNA 1EG7A 1FVFA 1T13A 3LIIA 4K03A 5CP8A 3JARB 1FW6A 4ZI5A 2FZ4A 1QV7A 1KPIA 1T4MA 1OXBB 1X7ZA 3PX3A 4PX5A 2YHIA 2AKYA 1V5IA 2HH9A 3AF4A 2YZGA 2LWIA 2BEWB 3LU1A 3R3HA 4HYYA 4ZXFA 4DT1A 4Q16A 3OHPA 1AT1A 1IOWA 2PH7A 4FTWA 4J4HA 1YZNA 3KCQA 1T9AA 4J07A 2W2KA 4G01B 1LK0A 3MWKA 3TAUA 1AX9A 1B6SA 3G2NA 1J5XA 1D5CA 1S3FA 4MKXA 4CKXA 2VAXA 4GBGA 4N8EA 3UXMA 4B71A 2LPMA 2CHUA 3DYIA 3L9XA 4U4AA 2CL0X 2WOJA 3AOEC 4C76A 4NULA 4JFRA 4DSTA 4U6NA 4QGFA 1GZVA 4OM7A 4YMVA 4UTZA 3CNBA 4DMKA 5LQNA 3FZNA 3VC1A 2QY9A 2XR1A 4DUPA 3VSDA 1KO1A 4PGFA 3E58A 1MEJA 5TQ2A 5LL6P 1HE5A 3U2QA 4YLEA 1YZUA 1PZFA 4AC9A 5LN1A 3EQ8A 4RK5A 3VYVA 1X14A 3WNQA 4EG4A 5HZGA 2GZ3A 5DXFA 3RRNA 2GYVA 4ZTBA 3Q8MA 1Y6ZA 3PF8A 1JSXA 5EMMA 3UUEA 1AMOA 4L57A 3OTOB 1WCV1 2O48X 2IE0A 4M9QA 5FD8A 5K0NA 4V1CB 1VB3A 2BEWA 4BMXA 5DM4A 2O8EA 1VL6A 1R8QA 1A2BA 2MR5A 1QWSA 1VHTA 3K2BA 4MW6A 1JSZA 4BNDB 4O4IB 3I32A 4N5IX 4GAEA 5LWQA 3KWFA 4D46A 5DEOA 2VP2A 2XDYA 3FTPA 2VP6A 2YJ5A 5BSWA 1NM5A 1OBOA 1ZGAA 2V59A 2NWQA 2QTTA 4ZOAA 2WSYB 4ZRMA 4GVPA 1XQ1A 1ZNYA 2E1PA 4O4IF 2WNIA 1OGIA 3EVAA 3EXAA 3LGAA 5AWFC 2R86A 3B52X 1RHQA 1KMHA 2GZRA 3BMXA 5JRZA 4CI9A 1J9EA 2PS9A 3SEZA 1IBKB 5FFFA 1ZIDA 4BAGA 4XVHA 1KQ3A 2ZBDA 1ANKA 4MV9A 1XCOA 4F97A 1DU4A 4R3WA 3JQGA 4FT4A 3M9LA 4EB3A 3H2ZA 4NENB 3RV3A 2YHUA 1IB6A 1NVGA 1NBOA 1VJ0A 2R5NA 2VNJA 3QU4A 3ILXA 3FBGA 2CJWB 2ZYWX 4AECA 5I9SA 1DAFA 3TPZA 4CQJA 3F7TA 3LDHA 3LKZA 4WK0B 3G6WA 2X0DA 3FLEA 5F7XA 5FEMA 5BY2A 5IFLA 1AQ6A 1XLTC 4N5HX 5JMPA 1L8LA 2YX1A 1BVHA 4GP9A 1KI6A 4LF7B 1PJRA 4QUAA 1DRUA 5IANA 4AURA 2R6CA 3Q7QA 4Q4JA 3DOHA 2ORYA 1SBZA 5HTKA 4US1R 2VSXA 1RQGA 5KJ6A 3GLIB 3TYXA 4G8BA 2G6BA 4DRYA 5EJ6A 4JI0B 3ZHRA 4LDJA 4J7AA 4TS3A 3RD5A 3WTCA 2H1FA 1RRKA 4FZJA 4C2TA 5EIFA 1GL6A 5DCWA 3SBEA 2HPAA 3WGUA 1I94B 1WMSA 3ANTA 4EO7A 4YRMA 1SPXA 5CA0F 1FVOA 3RTEA 1W36B 1CJVC 2VP4A 2ZIXB 4QDTA 1YDEA 4RZXA 1GPYA 2XOXA 2Z1MA 1LBHA 2QW0X 3IPCA 3NI2A 4FNGA 5KB3A 4E14A 2JANA 1ULHA 1MZPA 1V8PA 3T7DA 2PUFA 4AI6A 4MUJA 3CR3C 4ALMA 2HGSA 2YQ5A 4G1BA 4NAVA 1SULA 1XVUA 1TT5B 1HSOA 4NZNA 4HWTA 3RS7A 4TMXA 6REQB 3B9PA 4CMAA 3IPXA 4M9ZA 2VL7A 2H4YA 2JCBA 3IIIA 4ZCIA 3TLBA 4BEJA 3V3TA 3TINA 1T5HX 4BRZA 1DTSA 2HQRA 2GZ2A 3BSSA 3FUWA 5G0UA 1QM5A 3PDJA 3WMFA 4H4EA 2YNMD 4P80A 2HO4A 3AEXA 3D3WA 3AHCA 4GMFA 4W5QA 3M9WA 3EC2A 1SUIA 1GZUA 1JSLA 1VMAA 3NW9A 2ZB8A 4GICA 4HY3A 5I9TA 5F9FA 2KE5A 4EKDA 4XYMA 2FPGA 3VGJA 4X00A 1WHSB 4GYKA 1T2CA 1XQXA 4YT2A 1ODTC 1ZGGA 2ZRDA 3Q7TA 1D03A 1NYRA 1XKXA 4J1TA 3A9SA 2EEZA 1X7WA 3CTMA 1YMUA 3CT6A 3RAGA 3U17A 3NEAA 1J25A 5KYYB 2YUIA 5D87A 1CRQA 1VKJA 1HE8B 4LF5B 2GMWA 4L9RA 4K9OA 1N5MA 4UFOA 3TNLA 1NFQA 1YA6A 4ND8B 3ZJVA 4NJEA 3ZK7A 1U7TA 5MGBA 1NBHA 3MK31 2NAPA 3X2SA 2H5JA 4Q18A 2F7SA 3U7GA 1RI3A 3CZRA 3G8BA 2ZR9A 2O0KA 1UZLA 3AERA 4GR4A 1XZAA 4UXJA 4UUAA 3OAAD 4KQ9A 5K5EA 5TR9A 4PG7A 3IMCA 5DYWA 8AT1A 1J20A 2O2SA 5TARA 5IVKA 5G4KA 2JFZA 4JGBA 3IA7A 1YDHA 2P78A 3L1HA 3KU1A 4Q9AA 3WYCA 3RWBA 3JQEA 3E8SA 4PLGA 1CUHA 1BO6A 3N8NA 4QECA 3TCKA 5KTOA 5JAUA 1Z26A 3IHTA 4BX0A 1Z56C 1MB9A 1NYTA 5AM1A 1QHHA 4DNOA 4F1KA 2X5XA 3IEIA 4MKGA 2R7NA 4RGYA 1L4LA 1ZD3A 1G1AA 3HBLA 2CL7X 5K3OA 1PW7A 1A04A 1E2MA 1HLDA 2QE7D 3ORRA 1R6AA 2BGGA 1NM5C 1TT7A 2HNKA 2Y0BA 1XU4A 4C1BA 4KR6A 3W0LB 4JI7B 5JVDA 4YMTA 1UF9A 1NTOA 4R8LA 1K4KA 4WINA 2PZAA 2E9SA 1VB5A 1HF3A 1Z37A 3KQOA 3O2NA 3OA2A 2H8KA 5EXTA 1XVIA 4TLAA 1E4VA 1GXSA 1PSWA 2PRKA 3O95A 4N49A 4BMOB 2EX0A 3D7NA 3C6ZA 1CERA 4RHCA 4AROA 1B15A 2H1SA 1XPOA 4C0SA 3OCVA 4Q3LA 4G5YA 1G7TA 3GUUA 3L7NA 1P1HA 4LE1A 1CEQA 2I6SA 4QDZA 1VPVA 2C96A 1WBBA 2HYDA 1YD7A 2ZUCA 3CCCA 4R1OA 4CDRA 1IH8A 5FL7A 1G8AA 4FHGA 1F1JA 1AQLA 1NBEA 2D2FA 2LCIA 2RHJA 2E2WA 4CM4B 3T0IA 1SCKA 4Z8XA 5HCNA 3FR8A 5AW1A 3DEFA 3IMGA 2WE8A 2FH5B 4WLNA 4E6PA 6LDHA 2NVUB 2WI8A 3O8OA 5CGQB 1QZTA 2NZXA 2FAXA 1MTZA 3KJGA 5CYFA 3JZFA 5AK0A 1ECGA 4CFZA 4FYXA 2XTJA 2X6RA 4MI3A 1E4EA 1C50A 4NBTA 4MJLA 4MICA 1N1GA 4G65A 2JGIA 4YRKA 2JIBA 1RMYA 2A1UB 4PZ0A 1CJTC 3W1EA 4X62B 2B35A 2AC4A 2E1RA 4K26A 2BGNA 4I3HA 4CMKA 4INZA 1AV7A 3AOGA 4FC7A 4Q24A 4NOLA 4WXEA 4CUKA 3INYA 4QXOA 4GSYA 4UC0A 2XI4A 3C70A 4YJKA 3UCEA 3IKJA 3KKEA 3LX6A 4INPA 5JISA 2XKAA 4P93A 4TYQA 4DLUA 3IJ5A 3DV2A 3TSZA 2OGWA 2XZPA 2FTKE 2DT5A 3QX7A 3NUZA 4BCBA 1ADJA 1CQWA 1N34B 4KYUA 3IUNA 4BC1A 1TPYA 4HLDA 3EVCA 7GPBA 5KNCD 4XIYA 5B1YA 1V8DA 3ZWAA 1FTGA 1B8VA 3ENZA 1BXKA 3SVTA 3AB8A 3AUFA 1R66A 1USKA 3FBTA 4OK6A 2JH9A 3D8SA 4FFRA 5G1OA 3LA8A 2W00A 3NVAA 4G0YA 2ZBPA 4UEKA 4F91B 2FW1A 3OIWA 5CTJA 3USCS 5LKRA 6PFKA 5IYZF 4NU0A 1AU9A 1EINA 4JU9A 1FUIA 4PICA 4PQFA 3WL5A 4KFSA 1LPPA 1ZP6A 4LQCA 2FG6C 1LDEA 2I4RA 4GC9A 2DUNA 3U60B 3PXBA 3AKDA 1K08A 3UAGA 3W3AA 4ERNA 2HJSA 1JUDA 4KUEA 1UZUA 4D80A 5DM70 3HNPA 3F8TA 3QXGA 4PAOA 1UEIA 1X77A 2QGZA 13PKA 3SQLA 2J3KA 2WOOA 1GSOA 3NJRA 3GVXA 5LUBA 2Y05A 3SEAA 4DLSA 3JQ7B 4HS4A 2CXQA 4EQZA 3KAQA 4CCYA 4LF8B 1J2RA 1QC5A 5LXTF 3P2YA 2JIDA 3OZSA 4LWZA 3TJMA 3ZV5A 1CQPA 1GRRA 1SCIA 2XDWA 4G41A 3CZ5A 1DBWA 1NRJB 3GWGA 1MENA 5ENZA 4BO3A 5JVDF 3RWMB 2OM2A 4PPGA 2PGOA 3ZWXA 5FOQA 3V2UA 4ARZA 2PQMA 1IVSA 3B2QA 2XW6A 3VJKA 5ANRB 1TXGA 2B4AA 2AS0A 3NBFA 3NRBA 3GPIA 3O9ZA 4NBRA 1IHOA 5E0OA 4YAIA 1JHPA 3BFPA 4PQYA 4LZZA 5TQ2B 1KDVA 1FY2A 5BSUA 2CC2A 2UZ1A 3A0RB 1JR3E 1V1RB 1SXQA 3QQ5A 1XMIA 5EPUA 1O0SA 2O7VA 3KELA 1HE3A 1GNSA 3F3MA 1IL0A 4NZPA 4ND8A 1JAIA 4Q02A 3SBXA 4AT1A 3VNSA 5AVOA 1K8ZB 5J59A 4CRWB 5I48A 2H3HA 2D8AA 1ULUA 4DKXA 4YI5A 2QUIA 3QHAA 5B55A 1KBQA 3EJWA 1GA6A 4N3CA 4TLBA 3T5TA 1INLA 1ZKMA 2Q5FA 1VA5A 4E03A 3H4VA 1PFVA 3BOSA 3OZCA 2OILA 2WFMA 4EPYA 4H31A 1CVLA 1MIOB 2AJCA 3OO1A 3ZU5A 1J8MF 4HEJA 3WVNA 5AVKA 4QYMA 3RGGA 2IZ5A 1GDDA 1W2GA 1TAUA 1GFWA 3D9QX 3E1KA 4Y2JA 4A2CA 5A03A 5HM6A 3V4LA 1I4LD 5C32A 2FF5A 5FWNA 2Y77A 1EVQA 4DUGA 1E3DA 1RHUA 1UIMA 4TMTA 2WB4A 3VPHA 4REOA 5JSZA 4UQOA 2E5WA 2XB6A 3OVMA 1SZCA 1GQRA 4JELA 4J0DA 1N5LA 4N6GA 5IBQA 3T3IA 4D45A 1T24A 1BJTA 4FNAA 4IQGA 3NGXA 2ODQA 1HTBA 4HGRA 4X93A 2OY0A 4DMFA 1LW7A 3MTJA 3SZOA 4A8JA 5FAKA 4EHIA 5FNVF 1A9TA 1IPEA 1CIPA 3TVYA 1U1IA 1FF9A 4BFCA 4BKPA 1UBCA 1PCXA 2H7YA 1GTSA 2XHZA 1NHGA 3H0EA 2RH5A 3SZMA 2A9RA 3TQQA 1O03A 2GM5A 4RO0A 3B9RA 2X22A 3I58A 4RORA 5DHTA 3M83A 4F9FA 3BFVA 4DBZA 1G9TA 1YFKA 5LXTB 3S99A 1F2UB 2JLBA 4CLEA 3GZNA 1W5TA 1L8AA 3QKTA 1WW8A 3VX3A 4BJ1A 4V38A 4G0ZA 2UZ3A 3SR3A 4AYWA 3ZIAD 4XYLA 1SVUA 2HREA 2GD6A 1FUUA 3MTAA 3D2BA 1NN3A 1KI1A 4MK4A 2W0SA 4BFTA 4IX9A 2E4YA 4URUR 2QLBA 2E55A 2XWBF 1XDDA 3WR5A 1T2NA 2AQIA 4FHFA 2I87A 2AFIE 4HDNA 4QNRA 3FNIA 1N6OA 2W2QA 3HSYA 3ZU4A 4OLBA 4IGAA 4JBGA 3HYCA 1FUYB 4MWDA 3PTAA 3QVOA 3O4IA 4NL4H 4KQEA 1AJEA 2BR4A 2H0QA 4P38A 5CDFA 4XFKA 3CRVA 4PPNA 4E4YA 4QG3A 4DQ0A 1OOEA 2ZT5A 3DE1X 4I50F 4LHSA 5CFOA 1OI3A 4OCZA 4JXJA 4I9FA 2GZ1A 3FUUA 4QM7A 2RH9B 3DV0B 5HM8A 2JGEA 2CZQA 3OLVA 3NPAA 2PMEA 2I4IA 3A6EA 1RYYA 3PHHA 4V3CA 3H1BA 3H5TA 4U39A 1AZSC 3CA8A 1NUHA 1VE6A 2Q2WA 4XGQA 3RF7A 3V9PA 3ZTYA 2ZI4A 1EUQA 2WA2A 4PC2A 3DQQA 3FJOA 1H4TA 3MELA 3ZCUA 3U6BA 3E15A 2XDAA 2C0CA 2W6JA 1OXVA 2NQ2C 2CLDX 3S3TA 1U5CA 3I62A 2OENG 1NVVQ 1AZLA 5EINA 3HUFA 1ZN7A 4I9UA 4L9WA 4OFZA 3WLHA 2IZ6A 1RYEA 2BBWA 2DWUA 1D6NA 1ZW6A 2G82A 3Q40A 2H1IA 5CJPA 4PLHA 2B83A 4M8NE 2JGDA 5LOVF 1ETUA 2CNBA 4NSNA 4EAQA 4ZHSA 1FFWA 2XMDA 2FF7A 4CG3A 1I36A 1DIHA 1U4OA 2PAAA 4FOPA 3SJ7A 4I2NA 1DWQA 1M8KA 3A3YA 4L3WA 4CHTA 4P4SA 2BR5A 3BJEA 3BXPA 2WE7A 1M2HA 1JR3A 2F43A 4JXZA 1FDTA 4C5AA 1M0EA 4G36A 3N0TA 2GBLC 2HGZA 2PKXA 4HH3C 4QE3A 4BVFA 1FXSA 1XF1A 2ATVA 2PGXA 2QAGC 5LBIA 1Z4KA 1FVXA 4IX1A 4XYGA 1QSGA 2OCIA 2X5OA 1DI0A 4OXXA 3SHVA 1W35A 3ESDA 1U99A 2FZLA 1XLVA 2JLRA 4Y1GA 5TQ0A 3U4DA 4ND5A 2VUTA 1JSCA 4QD3A 2GNOA 4O4LA 3QMMA 3G82C 3GGJA 1G38A 4RY9A 4UU0A 1R9JA 1ADBA 1OAOC 3BMOA 3I30X 2OBBA 5DW3A 5F5NA 1TJ4A 2VHJA 3GMTA 5LFAA 4MEBA 1GRVA 3OLZA 5F5XA 1DV1A 3KSRA 1ECLA 3CCBA 3ZC3A 4ZGGA 1T8SA 4O2AB 3VJLA 3Q0TA 2D62A 4HUTA 4NCJA 2WU4A 1YVEI 1X7DA 2R4QA 2F62A 5DM1A 4C7JA 2BV3A 3PUJA 1TZ2A 3GA7A 4LN1A 2YV2A 2FLKA 3HA2A 2RGYA 4IWYA 4HH0A 1DEXA 5B4VA 4GDFA 4QHTA 2PS3A 1Y4AE 3K6SB 1D1QA 2QTLA 3P94A 1QAOA 2DCMA 4DIFA 3PPIA 1UOEA 2WSSA 4GM1A 4OP3A 1LPBB 1Q0LA 1R6UA 2UUPA 3I8OA 2ZAYA 4N0PA 4NYIQ 821PA 5C51B 2G1JA 3BXGA 5EIBD 2CJWA 3SIRA 4URXR 4LMBA 2RH4A 5LU9A 1L5VA 3CZAA 4I4CA 3IVMA 4HAVA 1F6BA 4N01A 3DMDA 2VYVD 3GB9A 4LC1A 5DXJA 5AUQA 3TGWA 2ACEA 1YZTA 4AJKA 1FMFA 3K1TA 2Q3BA 1CZRA 4B3BA 1X7XB 3CRQA 2XMQA 2O4CA 3WRYA 2IUEA 1MAHA 3P19A 3OIYA 4G67A 1UZAA 4D9BA 3LJKA 5BSGA 4F6RA 1X1BA 4PSAA 2AXNA 3B3GA 4Z54A 2BHRA 5JXIA 3WYBA 4Q00A 4AY4A 3PFWO 2VPWA 2ZITA 2ZWMA 3BRQA 4Y2HA 5EHQA 1FXUA 1ODCA 4P0TA 3OEHA 5DMXA 3EY9A 3VR3A 1E61A 4MPTA 5LDHA 2CBXA 3IR7A 4HXFB 1DAKA 4KXNA 2I3DA 2RHGB 2ZULA 3A3PA 3DTTA 3AKEA 3FJ1A 2VPZA 2C3OA 3O93A 4OX9B 3I5YA 1JVSA 2PUBA 3B53X 3KR9A 1JTVA 3JAKA 4K9DA 4W1SA 2BI8A 2FW7A 4P3PA 3U7QA 3GLFA 4D96A 1T9GR 2JH3A 3FKQA 2ZRJA 3R3XA 1GZDA 1E2DA 1BAPA 1RBZA 2HRBA 5B2FA 4ZC1A 2RHMA 4CIYA 1SZJG 5KOJB 2HK9A 2HWUA 1YRHA 1QG2A 1RJDA 3HDTA 2HF8A 2OP1A 3G2QA 1DUVG 1XEFA 1W85A 2O0JA 1RWWA 4MIKA 4WA7A 1R9GA 3S0JA 2Y9PB 3ZNQA 4R8RA 5ADVA 5CNKA 3DZIA 3THYA 1RTTA 3TZLA 2FPSA 4DQDA 2GNPA 3B5EA 3JQBA 3I61A 1JEEA 3DWFA 4K05A 4FNOA 2WUWE 3C43A 5H3HA 2W6CX 4KQHA 4OFXA 4HVCA 1O95D 3AW8A 3AR5A 3GRPA 2WF7A 1P60A 1HM5A 3GJ8A 3IXQA 1BGWA 2ZSBA 3PYLA 3PRYA 1KK3A 3I8XA 2GPNA 4UNRA 4I4TB 4J43A 3ZZ0A 2WHXA 1NQXA 4RPHA 4ZREA 1AKEA 4CIBA 3LZDA 3L04A 5DGCA 3K1YA 1W9HA 4PLYA 4RAQA 5AKIA 1CF2O 1MV8A 1J09A 2LDBA 1F14A 1HUQA 2X4LA 3W3ZB 3V8VA 1QPGA 3KJIA 2WUEA 3N7AA 3G8CA 5BWMA 5JSQA 1R0SA 5CAEB 1SHJA 1RVDA 4IFTA 2PKRA 3CMMA 4XZ3A 4YRIA 1PNOA 2CFCA 1MQAA 1FDSA 4JJEA 4WKCA 1JLSA 1CSEE 2E18A 5GM2A 4NZYA 3TIXB 3NM6B 3O8QB 4CE6A 4ECEA 3WAGA 1PEDA 1JLMA 3UMMA 2ATCA 1UXGA 2JA2A 3GRKA 4EBFA 2FPXA 4EJ0A 1MFZA 1ZN8A 2QTWB 1RXCA 3DPIA 3ZYZA 1I2CA 3N05A 3OQJA 4WOJA 3W8DA 2Y1FA 3ESYA 3KS9A 2Q3EA 4A0QA 4X64B 5B7GA 5HK9A 5LZ4A 3BORA 2RKBA 3HU3A 3L7BA 2REXB 1P8AA 4RLHA 2X1VA 4LJYA 1XF9A 2GYWA 4FDTA 1SWVA 2BGJA 1BGVA 2EW8A 2XLBA 3H19A 1VPLA 3OTQA 4M98A 3UHAA 1Y42X 2QIPA 4KO3S 1OTXA 1NOIA 3O3MB 2OZEA 2ALJA 2B7LA 3HKBB 1GNTA 1KEEB 2I1LA 1AK1A 2P3OA 4J76A 1NBMD 2HRZA 2P2CA 4M87A 4UDXX 1XKQA 4A6DA 4KZPA 1JHDA 3MS7A 1UZMA 4O4JA 5KWSA 5HTOA 2JATA 4LK3A 4J91A 1EGHA 4R9SA 1Q7RA 2ZAMA 3FKSA 3OT1B 3WKDA 3ZGYA 3KYCB 4GBMA 2WFAA 1GILA 5GADl 1I6MA 5T41A 2WV7A 3U44B 4DCMA 2G08A 2Q3LA 4ESHA 1Q1AA 1QFSA 3FTNA 4KKVA 1KEWA 5C7OO 1U3WA 1J1UA 3W9SA 4PCAA 4HEA6 2Q6VA 2ZYVX 4TRNA 3HXMA 1J1IA 2IZZA 3O8BA 4WT7A 2HSDA 1DXQA 2X8LA 2SCUA 1P5JA 5BYKA 3L40A 2J0SA 1CXZA 1AH2A 1GCAA 1V96A 5M04A 1AKMA 1LJ8A 4EFNA 3EW7A 2ZRBA 1I7NA 4HC4A 2POCA 3W7BA 2VRCD 2C5EA 1RZ3A 3PFGA 1JIVA 1L4UA 3G13A 2IJGX 1C4OA 3D4NA 4GXQA 1FFBA 3JWGA 1MC1A 5KHAA 5IVDA 4BN4A 4DNXA 2WVJA 3DWEX 2WJ6A 1KR2A 4BXOB 3UJ6A 1JIQA 4L4SA 4ZOLF 3NEJA 1IBCA 3OX3A 3TUZC 4OQ4A 1QPZA 2CN1A 1Z6TA 1TE2A 4E2YA 3KEGA 5SZJA 5U1PA 3RREA 3EOZA 3JTEA 3MILA 5JAZA 4YGXB 3ZVLA 1A9XB 4NNPA 3STUA 3UGTA 4ENVA 1OGJA 1WB9A 2H2AA 4TT3A 2DH6A 4B75A 3R9KA 1BCSA 4F3CA 2YV1A 1M33A 1JSRA 1W4RA 1F8UA 2NAFA 3TQRA 1J0AA 2B4TO 1VSBA 3EGEA 1T1GA 4WA8A 2DLNA 3K94A 4CT5A 4EHJA 3IULA 4RY0A 1E6CA 1J4AA 3JQ9C 2QXUA 4UE2A 3X1DA 2V3CC 2VJCA 1PSZA 2XNDA 3H97A 4BZPA 2JGLA 1NQWA 3K6JA 1ZHHA 2NP6A 2O1XA 1H5QA 1P1CA 1P0PA 2MTBA 1P6UA 1PUXA 4G1UC 3MA0A 1QQTA 1Z5NA 3RRXA 3N87A 3TW0A 3VXKA 1P9OA 1RLIA 3DMGA 3KPJA 4B0OA 2Q8NA 3RROA 4DMLA 4H6XA 2ECPA 4AS2A 1CLUA 3PNQA 3NV9A 1AKNA 1QF6A 2Y66A 1V8OA 2OO7A 3CBQA 3GPDG 4KR9A 4EI2A 1DEKA 1H6AA 3ORSA 4CHGA 3M0EA 3QUSA 1C4WA 1DP4A 4PBTA 2JFVA 4BNNA 3AJAA 2JI7A 2ONYA 4GS5A 3PLNA 2CV0A 4ZOLA 4JLJA 4K6CA 1P0FA 3Q7RA 3TXXA 5AI6A 5BW8A 4LYFA 1CUFA 4Q9IA 5KQSA 2V3WA 3LDGA 4LXTA 1HORA 2B2NA 3HB1A 5TMEA 2H2GA 2FWJA 3NHBA 4TQGA 3TSYA 1K8XB 3H2HA 4G2TA 2PH5A 1TLFA 2BHSA 2AOTB 2CBGA 4UREA 4F4HA 2ZQYA 3A31A 3WKAA 3ZHCA 4RTPA 1CR2A 1I2DA 4WN9B 3VFDA 3E2PA 1BRMA 4QUHA 3KU4A 1OE0A 4KXXA 4YROA 2QN7A 2DUWA 1UPFA 4TKUB 2Z83A 3AIOA 5KNBH 3OEED 3GGPA 5JNLA 5K8TA 4F9EA 1VSVA 3HVJA 3QTLA 4NFSA 5FI3A 5TF4A 4PG4A 1X86B 3OZXA 1CZUA 1XEAA 4H08A 5H81A 2C9OA 3LT5A 5DH9A 1NQAO 5EP1A 4BNIA 1GA1A 1M0SA 4Q0MA 3RSFA 1B0UA 3A3KA 2ZYHA 3DEAA 4A0FA 4G07A 3ZKWB 1IBMB 1G6Q1 1NWCA 3R2JA 4A5OA 3RUHA 5LA6A 2Q27A 4OHMA 3T9FA 1TEZA 4NJOA 1FFXB 1T34A 1NUUA 2AZ4A 1ADCA 1GM5A 1CDDA 3T9BA 4XJXA 4PY2A 2PN1A 3AT1A 3EMKA 1V5WA 4ZEOA 4CL2A 2MYUA 3RM3A 1CRPA 3H84A 4PWYA 3TX6A 3VOSA 4JYMA 4DLRA 2M1XA 2O57A 5FBKA 1NRXA 3DT6A 4II3A 1PDVA 4HEA1 1C5KA 2QZPA 3IBYA 2PJUA 5BQPA 1JDNA 1S8AA 4WVLA 1Z8HA 2JCSA 3WDSA 2C78A 3L4BA 2XRFA 4RMNA 2FQ1A 5IW8A 1WMAA 2YWGA 1NRWA 3EVBA 3N6XA 4GR9A 4IIJB 2BELA 1RPTA 3CINA 3MTQA 3RU3A 3X1JA 4NH0A 1N9KA 3W3AD 3WLFA 2GCPA 1IDN1 2I34A 3N8HA 3UFXB 1T6BY 2G1PA 1PGQA 1THMA 3B1JA 4G0WA 2Q49A 2GPYA 3AGPA 4KDRA 2JLUA 1CHDA 3AG6A 2Y68A 5IXJA 1LNZA 4TTVA 2YFKA 4LOKA 5ECWA 5DYYA 5K3FB 4Q19A 3QY0A 1NT2A 1BEZA 4M36A 5JRJA 1N0HA 5EFZA 1KGSA 4OQDA 5FBZA 4BWGA 4PNEA 2DKOA 4I9NA 4EEZA 4BP9A 3ICOA 4QEKA 5KYUB 3L8EA 3P9XA 3T7AA 5DNYB 1C7EA 3JYNA 5C1PA 1WUIS 1YJXA 1RRGA 3B20A 3RSLA 2ZRAA 3P45A 1GQQA 4BJHB 1JV2B 1KVUA 1UBSB 1NZFA 2E0IA 3AV0B 4ZODA 4C5BA 3KYCA 2P3SA 3C0KA 1W44A 3FVWA 1N1EA 3G1UA 3GRRA 3GVPA 3IXLA 4B76A 2FDCA 4GXNA 4MUXA 4P5DA 1FJ2A 4EEKA 3EYWA 4DEVA 4YV1A 3KTAA 3GP3A 1M2NA 2FEPA 4CM9A 5ICMA 1PNRA 2CFSA 2CFIA 2B99A 4EFKA 2AWNA 2INGX 4OHFA 5HGXA 5JUWA 1HKUA 1BSVA 1H85A 3ETEA 3GZ4A 3CVUA 3IO3A 2HDNB 3KOMA 2AKAB 3RHZA 3ZCVA 4BEWA 4OJKA 3FCYA 4DCNA 5BPHA 4CM3A 4DWVA 3AQ4A 4Z0TA 3T1NA 4BB9A 4IFBA 1EA7A 1P7VA 4R9NA 2QR3A 1JB1A 3REGA 3EIQA 4P3NA 2QV7A 4TQ9A 1RC1A 4FFMA 2Z08A 2Y1EA 3UXEA 3K0FB 5J4VA 1VQ1A 1QNFA 2Q3CA 2ONZA 2TMYA 4KREA 3GLFE 1BXGA 1MP0A 4N6OA 3HXKA 3ISVA 4HX2A 4S24A 5BSVA 1N6PA 4GHWA 5ECDA 1OH6A 3Q88A 1TD9A 3FF4A 5G2OA 3B1ZA 1DJQA 1E1RD 2WU3A 3A6GA 5HW0A 3MRSA 5TGDA 4HUQA 1EWVA 4RD1A 1X92A 1OILA 3AO0B 4OB8A 3RO7A 4K8RB 5LJLA 4C5CA 3ZXIA 3L6UA 3AYXB 4I5GA 3SLGA 3UMBA 4UBOA 3ES9A 3MLBA 3QE0A 7YASA 3TEMA 5T7BA 4IJQA 3L4SO 2GA8A 2NU6B 3K5IA 1RAGA 1KJZA 3JVEA 4PTZA 2CGEA 4TKMA 3FOFC 3W77A 4IIDA 2JH8A 3C3KA 4KWIA 1EIZA 1WZCA 2YY6A 2JKZA 4WMLA 4XGKA 4YRRA 2UZ4A 3JR3A 4MDFA 4RHUA 2H92A 3WJ2A 3MYYA 5AW9A 5U4QA 3Q12A 4HCJA 1PG5A 4RKFA 4TTSA 2AOXA 3JQPA 4KR2A 4MKIA 3VKWA 3TZCA 3LQRA 3HXTA 3ETCA 1C7RA 1E7SA 3QPVA 1NC3A 4CW7A 1IAQA 1OF1A 2G8NA 1AMNA 4MINA 5LBUA 3U1VA 3ONDA 3BTVA 2C03A 1Z0DA 4DILA 4QUEA 2NSLA 3K0CC 4CGZA 3O47A 1Z39A 1Z4JA 1K4MA 4F4IA 1XK6A 3L6EA 3A2MA 3LPMA 3MJFA 4KG7A 1CDOA 4LC9A 5TRTA 1SXJC 3ZE2B 4F8EA 1RJFA 3QI2A 4NABA 4GPBA 3H0CA 4AF8A 3Q5DA 1TM5E 5COAA 4I46A 5T67A 4ND3A 3SX2A 4F12A 2DYKA 1GADO 1V41E 1ZR2A 2BT4A 3KX2A 3TKLA 2C94A 2CMHA 3G5UA 1GL7A 1J8FA 1NZJA 1HYEA 3OEYA 3F4KA 4R05A 1VI6A 4IUDS 5ICCA 4JLUA 4CEHA 2PV0A 3O1JC 5AQEA 1TVEA 2G4VA 1I1NA 5GOTA 4S1WA 2WMYA 3TKYA 3RT9A 4BLSA 2J4DA 4EYQA 1DQPA 4K0KB 4KODA 2Q5LA 3TNJA 2UZ1B 4G97A 8ADHA 3PQ4A 2P4HX 2B78A 3GMDA 2J7PA 2NVBA 3ITDA 3WFIA 5JQWA 3FOBA 1GNVA 4NMXB 2ZWAA 1EZ4A 4JEIA 1ZQ1A 1CBUA 1XP8A 1QZUA 3V4VB 4C29A 3ZZNA 4PXAA 5C4IA 1KERA 5BQXA 4UTNA 2V1UA 3C5CA 2PXHA 4OA8A 4J3JA 2RB5A 1QHXA 5A4IS 3GA0A 5A9SB 1KMIY 2OV4A 2UYOA 4CTKA 2IS6A 2VJMA 3EUWA 3X44A 3RSSA 1PG0A 1WXEA 4F7DA 1P4RA 4J1NA 2E4XA 3AR3A 3O3CA 3VR1A 1TQ2A 2OT3B 1XEWY 5P21A 3C6MA 4BZQA 1QORA 2V5AA 3UWSA 2EIHA 1Y1LA 4D8VA 1BG6A 2AJLI 1QFJA 1K92A 3PXUA 1JMYA 1WMFA 4KN5A 3EUFA 4WV3A 4Z3DA 4EG8A 4IQ8A 4K28A 3DW3X 4QJ5A 2VDWB 1LDBA 3JQBC 3R7DA 3E7PA 3TFWA 4DSNA 4Q01A 3FTEA 1S7GA 3DBLB 4L5IA 3OZFA 3LK7A 4Q7JB 4DPLA 1MQ9A 4NCAA 2J9XB 1W1IA 2OPBA 4DEXA 5D00A 1MC5A 5ICGA 3QPDA 3UMFA 1UBKS 1SUSA 2GWRA 4J2TA 4LE2A 3O1HB 4RENA 5ESRA 3R8XA 3MJEA 1XZMA 4CCYB 3RRJA 4XDGA 4MVJG 3GELA 1Q77A 1YULA 1SCQA 5EPOA 3RUIA 2HSGA 4KPFC 3GRVA 4HO1X 2B21A 1XCPA 3A9WA 2BF4A 3B2NA 4I1IA 1V8FA 2W6NA 4OK5A 4E5SA 5FO1A 1JDBC 4X1IA 4X95A 4IIXA 3GJZA 3NKLA 2DFVA 3PFCA 5ERXA 3ZXSA 1G0NA 2A9FA 2MYTA 4RF4A 1PFKA 3WLKX 1S2LA 3FW1A 1QP0A 2PFGA 1VBMA 4J03A 1U90A 4WGFA 3HA7A 2JFWA 2CFRA 4YQZA 2QL6A 1N9ZA 1TDJA 1GQOA 2C1XA 2MIIA 2C8VA 2WHPB 4FWIB 2VQ6A 4R6WA 5EI5A 5DN6D 1BX0A 1M8JA 2J5RA 1NI3A 3MWYW 2IPLA 3DXYA 1VYTA 1UM8A 4NCIA 4RELA 1UJ2A 2FMFA 5FR1A 5LOVB 1LZLA 2HC9A 1RAHA 3I92A 3QE4A 4MQBA 3BJZA 4LWPA 4AZWA 3A4LA 3AU8A 2HCJB 3K2EA 3L0DA 9GPBA 5CIQA 1ZMTA 3H9EO 1FPQA 2NUPA 1JXAA 2D2VA 2LCFA 2ZS8A 1T1IA 5JROA 4DR5B 2BKUA 2FHSA 3CHYA 4MVJP 4QU9A 4XQ9A 5BPFA 2C9MA 2FU5C 3M3PA 3W5BA 5SY9A 4JWTA 3PC8C 5SYMA 3KQPA 1L4YA 3EE6A 4EGSA 1QKKA 4R1TA 4DCVA 2IYNA 2JIQA 3DXXA 4I1UA 4Q4LA 4B6OA 4EL5A 1LY1A 1NMSA 2X3FA 4LPSA 2WD8A 2JGMA 4RHYA 3P2IA 2CLLB 5KMGB 2BZGA 1HNZB 1T9ZA 3AF6A 5IZCA 3GU3A 3B12A 3O4GA 4Q66C 2WNSA 5C81A 2O2HA 3TR6A 2ONKA 2FB9A 2FVYA 3SF0A 2ZRHA 1M34A 4P3YA 1D0VA 1N8TA 4CDMA 2DH5A 1ISHA 1IBRA 3RJMA 1UKAA 1M6VB 2QM3A 3ITEA 1F17A 3DUFA 3MFYA 4FJ2A 4H3KB 4IEIA 4NYMR 4RH3A 4DSOA 2QQ5A 3UWKA 1RJWA 3UF0A 1DQRA 4BWFB 1M2WA 3OPMA 5IS2A 3BSYA 5FL7D 3CN7A 5EE9A 5FPKA 3ZI0A 3K9GA 3OM1A 4QZVA 2AB0A 4CEJA 4UM9B 1YH3A 4Q48A 3B6ZA 4ZYLA 2DJIA 4IH9A 2Z1NA 3CH5A 1WQ4A 1K7FB 2HNAA 2YHSA 4HBGA 1SVWA 5EP4A 2E6KA 1P45A 1SD5A 3CZ4A 4DMHA 5EOVA 3NHPA 4G8JA 5JEEA 2ZRLA 3S8EA 1HYHA 1OVGA 1GDTA 2GX6A 2D3TA 2XIQA 3BQ9A 3CZPA 1DWUA 2B3TA 2OCXA 1QS0B 5NULA 1P2DA 4XFDA 3BWYA 4KXUA 3MPUA 4K9QA 2BAGA 1G19A 3NT5A 4N54A 1Y6JA 1T0BA 2COEA 3K1AB 1C30B 1PSDA 4OD0A 1X7HA 3UFBA 1D8AA 3D43A 4BB0A 3E3AA 5C53B 1HMYA 1FRFS 1MB2A 1PL7A 3TNYA 1YNSA 4IIBA 4L08A 5CB4F 1YWGO 3HKDB 5EYPB 2X8AA 1QJCA 3E9YA 5JFGA 3ONWA 3UEOA 2RGGA 4M1KA 4YWJA 3OIGA 1G3QA 3IUPA 3UB3A 5M29A 1V6SA 2GN1A 3T8YA 3Q3VA 4HAXA 1R8JA 5J4HA 2Q4RA 5CCXA 4LOIA 1UWLA 1DRJA 2AH5A 4KLRA 5A4DA 3D2AA 5LMUB 2PMCA 1QE0A 2GK7A 1M6EX 2GN8A 3VPCA 1PR2A 1ZA1A 2YXLA 5K4GA 1V2HE 1CF4A 3CE9A 5K0LA 1R1DA 2FSVA 3V1KA 1JLRA 1IN8A 5EXPA 1Q20A 5FPSA 2X9NA 4N03A 4XRGA 3FOWA 1EFPB 1D6MA 1ZVKA 2Z2XA 2WIKA 3SK0A 3K15A 2H59A 4OPMA 3MUEA 1W73A 5TC4A 2HK6A 4Z51A 3Q87B 5T8KC 4Z4EA 4XA8A 4U0JA 4WOPA 1QP4A 2V6IA 1TFUA 3P32A 3IBCA 1KMCA 4ZOEA 2UXCB 4QDJA 1YQGA 3GCWA 3Q41A 1UXHA 1CRLA 1ZD8A 2I5PO 1ICEA 4JT4A 2PSEA 4UATA 4C6RA 4KFRA 1N5KA 5GJCA 4RWEA 3GRFA 4WY5A 4GVXA 3DKKA 1EAYA 1EFCA 4H0NA 4H6VA 2KJQA 4M0MA 2P9FA 3MTIA 3ORFA 4C89A 5KYVA 4DGSA 2FP4A 1F8YA 1GZ6A 3RUCA 5KDOA 1ISFA 1T9DA 2PD3A 1CY2A 3MWDA 1R4NA 1WTCA 2O3TA 2V6BA 3L7JA 3G9QA 4WCVA 1GAQA 2AQHA 1RXEA 3SOZA 1JJBA 1GT91 2LCQA 1B74A 2HADA 5A4AA 2FFHA 1LBIA 3JQ7A 3G0BA 1PD1A 3LL7A 4CL3A 1VFPA 4D9EA 2V7UA 3W6PA 3CLRD 3P0FA 1Y5LA 5EIOA 4CM6A 3LUKA 1U2DC 2F3UA 2W6IA 3A1VA 4AKEA 1R27A 3NH6A 2DHRA 4WASA 2VPYA 2DC1A 3GJ6A 1MH1A 4LY0A 1ZOLA 4UPVA 2E48A 2BGWA 1JEOA 2QJFA 3F3KA 1E8DA 3E5NA 1KI3A 3F6PA 4U2FA 4PQGA 4B32A 1ZGJA 3BH0A 4IUCS 4JB8A 4X45A 5G40A 1EWYA 1V39A 3OE7D 1YHZA 1FYFA 4OO3A 1P1RA 4O2LA 2EIXA 3KZOA 4S2EA 3SS7X 5C1OA 2WYVA 1J8QA 1EFKA 2BGRA 4R2IA 4R84A 1QFXA 3LLMA 9ABPA 4B6JA 1CIJA 2OQIA 2XYGA 1NIPA 2ZWIA 3A7EA 3B70A 3DVRX 1DIRA 3P2MA 5HFNA 2XDQA 3KHKA 2FPPA 1E6LA 5H4GA 1RAIA 2CHEA 4P34A 4UULA 3UKJA 3WNCA 5FCDA 1EXNA 2WVHA 4I55F 3JPWA 5DKFA 4KOEC 1D4FA 3RHSA 1XU7A 4KHPB 2VUHB 4N0QA 4W4TA 5ALTA 3EGOA 5A3QA 4PQEA 3RSQA 3VSAA 1XVTA 3UK2A 4EA8A 3PYXA 4DR3B 3Q8KA 5I9LA 4A26A 3GGOA 1XALA 1E9VA 3AY0A 4LDNA 4AZTA 2B4RO 5DGHA 4OHVA 2IYRA 4D6XA 1MO6A 4XDZA 1WSBA 2R60A 3IAS6 2ZT7A 4CLOA 4YALA 1FQKA 5FPYA 4AJ1A 3SR0A 1DIOB 4H35A 3REOA 3IV7A 4NK5A 2BJVA 2GA9A 2GLXA 3GFBA 2O2JA 4ZGWA 5IJ9A 5K6AA 1L1EA 1Y81A 2HV9A 2XSZA 3EAGA 4OB6A 5K7SA 1BDBA 1N7GA 3D8BA 3GBPA 3DS8A 1LDYA 3FSJX 4PAMA 1Z5GA 4RW0A 5LZ9A 3V34A 4ECAA 1W0KA 2D4HA 1M2JA 1P31A 1QHNA 2AEFA 3D7SA 2CMKA 5JCJA 4ENWA 1VE5A 3BMCA 1XHEA 5CLIA 1IMOA 3JATB 2E37A 2FETA 3JZMA 3QLVA 4MSUA 3VX4A 1IN1A 3Q6NA 3M6AA 1L5HA 3LE8A 3IA2A 7MDHA 1M8FA 1NBAA 3DFZA 3Q9UA 3T1OA 2AC2A 1HZJA 3H9GA 4US0R 4MCAA 1NZDA 2OK7A 3I09A 5CLFA 1GUBA 4XJSA 3BG5A 2J31A 3HJAA 4LXXA 4TL8A 4AUEA 1VKRA 2QBYB 4D42A 4Y9SA 1CIVA 2WWYA 2AZDA 4D9FA 2BSQA 5AW4A 3RYCA 4K0RA 3GD7A 4BNYA 3DLIA 2FZGA 1WWKA 1MORA 5FOTA 2O1SA 2GWHA 4MYSA 4BNFA 3KR0A 1R8YA 4DIEA 3MOIA 4P35A 3ROFA 4XOIA 1X80A 4E31A 1ZUD1 4MRMA 5TPZD 3EULA 5BVGA 4N12A 1NV8A 5DIZA 4ZJYA 5B1SA 1XZ8A 4GKJB 4BUJA 2ZR8A 2NTYC 2NLOA 3NDBB 2O5CA 1N5RA 3B6IA 1WABA 2IOFK 2OBXA 3TSOA 4HDSA 3RANA 4AL4A 4BUCA 4M2LA 3PDHA 2EJCA 5TGZA 5HHTA 5BXYA 2PLNA 1DBIA 2HX1A 1QONA 3NJ8A 4UD6A 1FK8A 1M0TA 2X23A 3ABQB 1DC4A 5E6SA 1ZEMA 5H7XA 3KSDO 4CIWA 1X1TA 1SBYA 4TSFA 1ZBQA 2D0PB 4YPOA 3CB2A 2FZVA 2B4YA 4X63A 3TTTA 8OHMA 1OJLA 4FILA 4X6YA 3MQFA 1UMKA 4UDYX 4PIVA 5NLLA 3G2MA 1MB0A 2EJBA 1U9IA 1UC9A 2R6R1 3QOWA 3QPUA 4J8PA 1YOBA 2UVQA 5IEBA 1NE2A 1T8PA 2WU0A 2YCLA 2D7JA 1UMCB 4HUQB 4MVYA 5HQ3A 1U8XX 2NXCA 5JY1A 4XSGA 3V1LA 1YVPA 2YV4A 5JSZB 1RRPA 4AS1A 1WLSA 3EW9A 4ZKDA 4RGBA 1Z12A 2GCGA 1PNQA 1Y9DA 4FHDA 4FOLA 5JFTA 4KCGA 2GHRA 2ZTVA 1EUYA 4U2BA 5CB0A 4DM3A 4K1XA 4R1NA 4L3VA 1WAMA <