2QL7B

Crystal structure of caspase-7 with inhibitor ac-iepd-cho
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 17
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2ql7B00
3GJRB 3R7BB 2XYPB 3GJQB 3IBCB 1GFWB 3R6GB 4ZVPB 2Y1LB 2CNOB 3EDQB 2CDRB 2H5IB 1RHRB 3NS7B 2H51B 3GJSB 1RE1B 4ZVSB 1F9EB 1RWPB 2H65B 2C2KB 2HBRB 2H5JB 2CJXB 4ZVOB 1BMQB 1RWXB 1PYOB 2HBQB 1RHQB 1I3OB 2QLJB 1SC4B 2CNNB 2C2ZB 1RWNB 3R5JB 3D6MB 3KJFB 4LSZB 2P2CB 2HBZB 3GJTB 5K20B 3R7SB 2C2MB 1ICEB 2H48B 2QL9B 3SIPB 1NMEB 2C1EB 2QLFB 3D6HB 1RHMB 2DKOB 3RJMB 1SC1B 2C2OB 1IBCB 2QLBB 4JB8B 2HBYB 2XZTB 4DCPB 1PAUB 2CNLB 3P45B 4DCJB 2H54B 3R7NB 4ZVRB 1I51B 4ZVQB 2FQQB 1RWOB 1RWVB 2H4WB 2XYHB 2XZDB 1RWWB 2XYGB 2QL5B 3QNWB 1QDUB 5IC4B 4DCOB 3P4UB 3IBFB 1SC3B 2CNKB 1RWKB 1RHKB 3KJNB 3R6LB 5IC6B 1RHJB 1RWMB 2CJYB 3KJQB 2H4YB 2QL7B 1QTNB 3EDRB 3D6FB 2Y0BB 4ZVUB 4ZVTB 1RHUB
chains in the Genus database with same CATH superfamily
4OIXA 2O3DA 3JTPA 2CUYA 1WG1A 4IH7A 3GYGA 2Y1IA 2OEJA 1YZ7A 2ASJA 3H59A 1HI1A 2YQ3A 4NEZA 2RMLA 2XCPA 3TQEA 1BC6A 3G86A 5KG6A 5KG1A 2HQ3A 4DV5F 3CC2S 2VQFF 4BHQA 2OI2A 5J2QB 5BR8F 2ERRA 5DS7A 2BJDA 3I6PA 5I4MA 1HHTP 4LF8J 2H9ZA 2J7KA 1XR5A 1T9WA 1H0HB 1DTTA 4DR7J 2YQ0A 3AT1B 1HW8A 4NA3A 4ZVGA 3TI0A 1UFLA 4LT6A 4M63A 3ULHA 3OL9A 3CJKB 5BYRA 1CJTB 3UFCX 1FWPA 1REVA 4DPOA 2DRDA 4IG0B 4F4KA 4F4AA 2HHTA 4JI3J 1T9YA 1B0TA 5D0EA 3RRGA 2G4BA 1DTQB 3G9CA 2K7KA 2J0WA 3WZ0A 2NREA 2PC6A 2MLYA 1ACMB 5ETRA 3FQLA 2BQRA 1YLXA 3BGLA 4X4QA 2YBVA 2NQPA 1VBKA 3NBPB 3M8ZA 2ZBQA 2OFHX 1KTVA 4OJ3A 1VFJA 2GV1A 1N5YA 2WRMA 4K4XA 3V2UC 1BHNA 3MD1A 2MZRA 3TA1A 1GT8A 4ZLNA 2E7WA 1K0VA 2JOQA 2IMOA 1Q8KA 3FSYA 1FERA 4K4ZA 2AX0A 1Y9OA 4LREA 4GKKJ 1N54B 3OFEA 3EGZA 1U24A 1GX6A 3VGTA 2HNYB 4OX9F 2EFPA 4DV7J 1XWLA 3UDCA 4M5JA 1Q95G 1XR6A 3OTDA 1LW2A 2AV5A 2GJIA 5ITHA 1G1XA 4AL5A 2IC3B 3ISZA 2H5EA 4CM0A 3VWSA 3Q2TC 3SCKE 2HLTA 1YBUA 2DNZA 4CLWA 4N8OA 3TUPA 4K2XA 2YKNB 3OUYB 1PJ6A 2FGOA 2MKYA 1RAIB 2CG8A 4DWIA 2E5GA 1LK7A 3EZUA 1LOUA 5BYQA 1URNA 3THVA 4B3OB 2K3KA 5E5NA 3Q8QB 1YK9A 4A8YA 3OPKA 3HFKA 1FKOB 2QA2A 3ITHA 4DZDA 3CPWR 2UUWA 4ZVRB 1B3TA 4RW7B 4WP3A 5A6PA 2AWZA 4RX6A 3J7YI 1B64A 1NUEA 4DL5A 1LNQA 5IC6B 1CEZA 4PXBA 2LA6A 4C9DA 1S99A 4OI6A 2OD4A 4PXDA 1EX8A 5K14B 2OO4A 4LFBJ 3UDVA 3M2RB 3QSIA 2OHDA 1JB0C 2XG8A 2Z2ZA 4DSEA 2QIFA 5DDPC 3SCLE 2L3MA 3T3FA 2EFVA 1NK9A 1TKDA 3HP6A 1SKUB 4IFYA 1EJ7L 4I67A 2K06A 2PT0A 5KT7A 3DXBA 1WEZA 3POTA 2F8EX 5JXSA 1L5UA 5F3TA 3R5BA 4GKJF 3VGVA 2MQ8A 4ZP9A 3KTQA 2BJ8A 3ZTPA 5HI7A 1EETB 5F0UA 1NK0A 1H98A 3Q2SC 2ZKTA 3DI6B 3K58A 2F65A 4F3QA 3PDNA 5C42B 2V2KA 4B9MA 1BXNA 3GYNA 1OSCA 2PGCA 5HATA 2RVJA 1JWWA 1PBAA 3T9ZA 3NMRA 4OYPA 5A8WA 5F9NA 4FZVA 4DU7A 1NH8A 1QTNB 2C3UA 4ZJLA 2BEFA 2R2RA 4I0WA 3DYAA 3OR2A 4LF4J 2FHKA 3QRQA 2EKNA 1RT7B 1GH8A 1HD0A 3TZXA 2XZWA 3TW0A 5EGYA 4P6QA 1TU0B 3TX0A 4YHHJ 3Q86A 3T1HJ 3ZC4A 1GMUA 3NOCA 4LIWA 5HVGA 5HVFA 4LRBA 3A8JA 3DRSB 4ENOA 4OYBA 2WB4A 3LF0A 4Y65A 1LW0A 2HS3A 3JSBA 2DNPA 1ZTWA 1R8AA 3R7SB 3P6YC 4H4MB 3GV7B 2JEGA 4WK3A 1S7HA 2BQ3A 1WHXA 3CCTA 2BE2A 1RTJB 1HMVB 2JZ5A 3KUEA 4UOHA 1TK5A 2EBEA 2V8VA 3I0RA 2QT7A 5ETSA 1NRKA 1FRLA 2JFKA 1DARA 3KLVA 4ZJQA 3HVRA 1RYRA 4ZKAA 3FGVA 2G2ZA 4YR2A 1FDDA 3IN5A 3AD8C 4RUBA 2XWYA 1UVJA 1TL7A 2XO7A 2VDHA 2XS2A 2XULA 1TKXA 3C3LA 4BC9A 1FXLA 2ZOGA 4C3LA 1F9EB 3R8YA 3MCMA 4E0DA 5IFMA 2CJKA 4DX8H 4LSLB 2E1CA 1R31A 2R7RA 2V2ZA 3SI8A 3V6HA 4IQMA 2ATLA 3AA8A 2AP6A 4GC6A 4DFPA 3NCQA 1DLOB 3G82A 4NMXA 4ZPCA 3DGPA 1JX4A 1JLEA 2U1AA 2V50A 1Z4UA 1IXKA 2XWXA 2KO1A 4OJGA 3BBCA 5CYMA 2M70A 4B3RJ 3K0JA 1T03A 3O3LA 2AX1A 2XMAA 1MROB 4KV8B 4JYAF 3I56S 2OH2A 1UP1A 5HJXA 4TU8A 4ECWA 2ZD1A 4EZ6A 2GIFA 3H4BA 2CPHA 4UY85 4QYRA 1NZAA 2XLKA 3MDFA 2AHOB 4DUYF 2V69A 3GJQB 3PY8A 1FRHA 4HACA 4HVZA 2CDRB 1D9FA 1XJWB 2L08A 2V9WA 3ZZRA 1KR4A 4RW4A 2KJWA 3Q8YA 2ACYA 2XM3A 5C24B 5HBMB 1IJFB 4I56A 5J2PB 2IM0A 2QLWA 1WHYA 4K5SA 3DRRA 4MH8A 4J9SA 1X4AA 3WC2A 1FX4A 2ADBA 2IYIA 4DV2F 4NLXA 4L6V3 4D3HA 2H48B 1HNVA 3T6BA 3OFFA 1FESA 1IBLJ 1KWMA 4URQU 1RU1A 2QYCA 2AF6A 3N4WA 4X4PA 3S01A 1NK8A 2P6TA 3TOQA 1M5OC 2Q66A 1WI8A 3KLEB 5K8OA 3LPEA 2B6AB 2VBYA 3TUZC 4DLGA 4CLTA 4NXNJ 1NPPA 3GFXA 3V4IA 2CQDA 3Q8RB 2C22A 3NGKA 1VJWA 1LWXA 2CWXA 3R6LB 2FGCA 2C42A 3H5XA 4Q8EA 1S5ZA 4DPXA 3PO4A 4DLEA 3IRXA 1SC6A 2W2MP 4DPTA 2HK2A 3R2DJ 1KN6A 3E01A 1WACA 4K4UA 2L41A 1J2VA 1KQKA 1AUDA 4LF7J 3QJJA 3TUJC 4DR1F 5KFHA 5D4OA 3T6JA 3C15A 2VV5A 3UE2A 3HM9A 4WZMA 3PM9A 4U7UD 1ZA2B 2LU2A 3OTBA 2HVDA 3CXCR 3OL7A 5KFZA 1QSYA 2NXJA 5C5JA 3EVOA 1IVZA 4EGLA 3TAMA 4DFMA 2KZMA 1X4FA 4DSLA 2E7VA 2L9WA 2D3OR 2HNZA 1P8GA 5IV4A 4A8SA 1CJVB 4OZ5A 4CLFA 3F44A 1X4EA 2QYGA 4NYOA 1LWEB 2KVQE 3MAAA 1NSQA 1OYDA 4DDFA 2LA4A 3EICA 2YWGA 1NSPA 4KPYA 1NAQA 1N32J 1K47A 3FBFA 5ETMA 2CQCA 5A8KB 2QFJA 2Z0GA 1B70B 4K59A 4B9TA 5F8GA 3AJ1A 4NEYA 2BACA 1UAWA 2XMVA 5DJBA 3RRKA 1H6KX 5KG7A 3IAS9 4B17A 4PG6A 2MQMA 2EWHA 5L1LA 4ELUA 2B9YA 1HPZA 1FKPA 5JMNA 3JSMA 4FF3A 4DFKA 3H5UA 3MM7B 1Q7YT 3QWUA 4ICLA 1Y5LB 3BQ2A 1RTDB 1UFWA 3FJ2A 4CNYA 1RAJA 4ZMMA 3MM9B 4HL9A 2GW8A 1Q53A 5LMUJ 3WX8A 1NPKA 1VBZA 2OPQB 2C28A 2IRUA 2AYGA 4IH6A 1TKTB 3L09A 3BH6B 2X1GA 3N6MA 5B0CA 3TJAA 2XEXA 1DBDA 4S0MA 3CCQS 4KGXB 1ZOTA 1WHVA 3A4TA 1NHVA 5AXKA 5SUHA 4FNHA 4HDHA 2W1BA 3GCXP 1RBAA 2KDOA 1HKAA 5A76A 1TUVA 2DNLA 1KD1T 4N77A 3NAHA 2PFFB 4UZCA 1AA1B 4DN0A 4K8RA 2LCWA 2F40A 1AW0A 1IJEB 1S59A 5C25A 1UW9A 4ZP8A 2ZH2A 1SCJB 3VVTA 1MN9A 1RAHB 1VC5A 2Z57B 2BMBA 2X1AA 3Q23A 2DHSA 3RW7A 1C1BA 4GRSA 1UA1A 1HHSA 3MFIA 4Y3CA 2P2CB 3QAEA 2BE7D 3PJXA 2VUGA 1WD6A 2CDQA 3E8OA 4G3IA 3K2YA 4ZPWR 5E3QA 3D7SB 1GNKA 1JLFA 2VJUA 2DTJA 5BYSA 4YDDB 3QT6A 1VHIA 5AJ3J 1IQZA 2JC0A 1IKYA 3HD2A 1R0BG 2PI5A 3OT9A 2GS8A 4C8ZA 2W25A 2BBEA 5IV3A 3KMSA 3PX4A 2E66A 3DC2A 5J1EB 3VAIA 2JX2A 4M5LA 2MLZA 5MLCV 3MAQA 3BB5A 4LFBF 2RRBA 2R8JA 2UVUA 1Q8LA 5HVHA 1MMDA 2YPYA 7FD1A 2BE9B 3QPIA 4DX6A 2CQHA 3EX7B 3R1HA 1RWXB 2DNRA 1H38A 4I68A 1S12A 2ACMA 3MM5B 4CT9A 1C0TA 4LF6J 3FKBA 1JLAB 1S6QB 3TEGA 3MMBB 4WFAQ 5DRKA 2HNDB 2W4CA 1IN0A 4O3OA 5L8RC 1F5AA 2ASDA 5SZTA 4Y00A 1BQMB 3GE9A 3MMCA 1S97A 5C2GA 4M5NA 4PG5A 3PR5B 1YWXA 1RT4A 1YGYA 3P45B 2DJWA 1HA1A 4HR2A 4U8YA 2F1FA 2BOAA 1OYEA 4BWMA 2PSZA 5HN0A 1KRPA 5I3PA 4LJMA 4A8QA 1SV5B 2QMXA 1N88A 3Q22A 1UWBB 3IG1A 1H2VZ 1U2RA 5GAHU 1S1UA 3Q89A 7AT1B 3JTNA 4FF1A 5F3ZA 2AJ4A 4NI2A 2JJ4D 1WELA 3GR0A 3IGNA 4JI1J 4BBYA 1U49A 4P10A 4EBDA 3QT8A 4IRDA 4PQUB 3G2XA 1R89A 1TL1B 3D6MB 3PIOQ 2V4JA 1XNRJ 2MY8A 1WKLA 2FVPA 1F5BA 3T5KA 1RT3B 1TQLA 3BGRB 3CSKA 5EHHA 5LSOA 2HFUA 3ZO7A 2KVIA 5DGAA 5ADZA 2VU5A 2NXNA 2EG2A 1NDPA 4KB7A 2WSFC 3KHHA 4Z7CA 3FRZA 3BPDA 1EARA 2KXHA 1N6QA 2VFRA 4CYUA 4OL8A 2K3IA 4UW2A 4NA2A 5EX3A 4PPZA 2RH3A 1JXLA 1N52B 2FIUA 4NLTA 3KJVB 2BJ3A 1MWZA 3R6GB 2YWEA 1WC5A 3UNGC 3VVUA 2ZJRQ 4F8RA 1IKVA 1YRXA 2MQQA 4CDIA 4A8MP 1U1KA 2V68A 1RBOB 4ZA1A 4LQ3A 3R5JB 4IR9A 4EO6A 1UL3A 3PYDA 4MIWA 2DH7A 3V6DA 3M05A 2YKMA 3LGMA 2MKSA 2JEJA 2NXEA 1OJ4A 1VIOA 3BR8A 1SH3A 1F3VA 4RR5A 2I6WA 3W2WB 3JSYA 2UXDF 1YJWS 1U8WA 2MGZB 1VBYA 3PTWA 4EZ9A 3SV3A 2NYIA 1FFWB 2GVDB 3UN5A 3IMQJ 1MW7A 4EYHB 2XYHB 2KTQA 2Q1LA 2G1HA 3C6TB 2I2YA 2XSFA 5T7LA 3T5LA 3RRHA 4R0JA 3DOKA 1U2CA 3AJ2A 3PJ9A 4DR6F 1AFJA 1LFPA 2AJ0A 1T3OA 2U2FA 2H51B 3OJUA 3N6NA 4BC7A 4JI4J 2BUNA 2EBGA 5DLGA 1FFSB 1Y00A 3DOMB 2H5JB 2W8KA 4ZVOB 3S7RA 2CJQA 1SL1A 4Q0BB 4XIUA 2EC2A 2RQCA 4DFJA 4J9PA 4P7VA 4NLGA 4RW8A 1V5IB 2XHWA 2VPXB 3DU6A 2FHOB 1EP4A 1FFGB 1QAYA 1HR0J 4JV1A 3M9OB 2DKOB 1RCOB 4WPAA 3IGVA 3RYLA 4ETZA 3MPWA 1AUSL 3J81j 2HK3A 3UPFA 2FVQA 2W9CB 1R0CB 5HL7Q 3QT5A 2R7VA 4J9VA 2WTFA 4U9RA 2MQNA 1U48A 4EUVA 3L7PA 1Y3JA 1YVFA 3M30A 3W5XA 3SQGA 2GHWA 2MQLA 1QVFR 4WFXA 1Y5IB 4PZVA 2UU9F 1RHUB 2QTWA 2ASYA 3AOBA 4R8UB 1B0PA 4JI7F 4K5RA 2OFGX 3W2VA 2UUBJ 4JI5J 3VCDA 1HNXF 3NRBA 4K0KF 3MEEB 1NJIT 2EI5A 2GMLA 2XMJA 4ED8A 2DRAA 3PW0A 1B7YB 4I64A 4N56A 1RGVA 4IQXA 3LP0A 1FEEA 4DZ6A 1V6HA 4QQBA 3NL0A 4C6AA 3P5BP 1UW4A 3A3PB 2Z30B 4IRCA 3ISNC 2VFUA 1HNZJ 1XNQF 2AEFA 2MXYA 2LQ5A 3UD5A 1NNDA 3DLEB 1PCAA 2QRRA 1YJRA 4JV0A 2YNGB 1TL3A 2GAGC 2GJFA 2ZOFA 2RIJA 3HHNB 4KFBA 4NLUA 2NSBA 3M9NB 2LQ9A 4ZVQB 5ETQA 3MEGB 4EFAC 3I32A 4WYLA 3BJYA 2GAHC 3RUBL 3D3BJ 2LDYA 4C3MA 2W4PA 5L9XA 3BS9A 1JJ2R 2CNOB 1U0HB 1LV5A 3V6KA 1NK6A 3JYTA 4TYAA 1WJ9A 4RBVA 7FDRA 3TARA 1RQ0A 5JJBA 2G0CA 3M8QB 4OYWA 4OZ0A 4A8WA 3M4XA 4ZHRA 1N8RT 4ALZA 1KP6A 1RHQB 1TKZB 3SEOA 1NLKL 4EWTA 1S1TB 1VQMS 2ZHAA 1RXOB 1IM4A 1RLCL 1CJUB 1PG5B 5D4NA 5ETPA 3HXMA 4KJIA 2C2OB 1Y7PA 1RI7A 4X2BA 2HBYB 5JUMA 3LP1A 4UQTA 4A8XA 4TY8A 1KONA 1SJFA 2VFSA 3MMAA 4QIVA 3KK3A 2H1YA 5D3GB 2GQ2A 4LUBA 1HQUB 2KB2A 1FTCA 3DDIA 3MTKA 4USVA 3OR1B 4DR5F 3IBFB 3OXFA 3MUVP 1ZH5A 2A10A 1R0AB 2CJYB 4QYZJ 1SL2A 3JSRA 5G0RB 1CJKA 1UVMA 4CO4A 3PRVA 2HIQA 4KIAA 2DGVA 2CPEA 1F0XA 4A47A 3N79A 3HPOA 1SJQA 1NU4A 3JB9k 4QWAA 4DSIA 3HX9A 1R8CA 1FDBA 2OGUA 2XMWA 2HGLA 4QJVA 4DL6A 2QLJB 1E6VB 5M2UA 4ED3A 5IWAF 5DG8A 2BABA 5I42A 2QSWA 2P8IA 4F4ZA 5D77A 4PWDA 3J81U 3DLKB 1HFEL 4O44B 2CQGA 4ZPBA 1R3NA 2Q6BA 3MR7A 3PZPA 1IR2A 3JAMU 2R2TA 2FJVA 2AD9A 2CYYA 2YX7A 1Q5VA 1ZZNA 3T5HA 3M1VB 4I2QA 5L1KA 2AYBA 3F41A 1C4AA 4J9UE 1QSSA 3FDSA 2AW0A 3UW1A 2ZBRA 1SKSA 1G3OA 4ECVA 1VQ4S 3SSRA 5A2QU 3SSSA 4DV3F 2Z2LA 4LF5J 3T1AA 2FY1A 2PN6A 2EXUA 4HYKA 3QGHA 4OYXA 5KFFA 4USIA 1SUQA 4CTAA 5GAGU 4NRUA 1X5OA 1FXRA 4R25A 2F4VF 3TYTA 2HHVA 1RTHA 2BW2A 3IXQA 3EVMA 1KLNA 3EWGA 2K2PA 3DRPB 3H2LA 2F4FA 2A1BA 2JFDA 1YJ9S 4FP9A 2V8DA 1G2EA 2R7QA 5E2QA 3CNQP 4CI0B 4BWJA 4Y2KA 1QUVA 3O5TB 1X4DA 1NBEB 2NCKL 3CJTA 1FI4A 3TA2A 1JNRB 2WBMA 4B3MJ 1KHWA 3DOLB 4NCAA 4HT5A 2ZJQQ 2C2EA 1U2FA 1FKAF 5GMKa 3GCWP 2G2OA 3OTOF 3HVAA 4FYYB 1HNIA 2KZZA 4ZOSA 1MWQA 4ZVTB 3PKMA 4RPFA 2HAIA 4ER8A 3MR6A 3CD0A 3QZ7A 3OXLA 2WONA 4F26A 3O8WA 5KG5A 4WF9Q 4DL0C 1DTTB 4PWWA 2BJ7A 2JLEA 4DSKA 3KHRA 1TZ0A 2I38A 3L95X 3CWJA 3V6JA 4WU2A 3GV8B 3HD1A 1JLCB 1REVB 2ZZMA 4ZK7M 3KDNA 2BOPA 4DPUA 4TN2A 2JEIA 2UXBF 3MURP 1NCLA 1RJJA 5E3RA 4UQGA 1Q5YA 4X4NA 3ET6B 1S1WB 1VQ8S 1FO1A 1YI2S 2KT3A 4DCPB 2HHPA 3UQSA 4OQJA 3AOAA 3MF5A 3JQJA 2FYXA 3AB4B 2JLGA 2M8HA 1JK9B 1G4CA 1VQNS 4F4YA 4O23A 3W64A 3X3UA 3K5LA 4ED1A 1TUGB 2KH9A 4H4KA 1LK5A 5LMNJ 4FPRA 4DR3F 3U1NA 3C46A 1GMVA 2BVZA 1HBMA 5KFMA 2D69A 2CKWA 3UD3P 4U67Q 4A8KA 4CQ1A 3A1YG 2A2DA 2OAUA 3HHLB 3CMES 4GO7X 2RJZA 2ZH9A 1JKHA 4IRKA 1UCNA 1K73T 2V9KA 2HZVA 4FYDA 3CJRA 3DMJA 4OZJA 1LW2B 2R2SA 2R7TA 1O51A 3EE3A 1CULA 1WG4A 1RDRA 1PJ5A 2Z2YB 3UO0A 3GR1A 2L9DA 4JI6J 1T95A 3F0NA 4A8OA 2WVCA 5GAHI 5BJRA 3U1MA 3AJDA 3KNAA 4QIGA 4LFCF 4A46A 5L38A 1I94F 3IC1A 1DZ5A 2QL5B 4XPCA 2OSQA 1SIWB 3TVYA 2BW7A 4CLSA 3PACA 4ES1A 4GMKA 3ILIA 5J2QA 3GFZA 2O66A 1ZM3A 4C8OA 3KG4A 3N28A 2LYVA 2YNHB 1JJCB 4OV1A 2J0QD 4L3KA 3G71S 1XMOF 4DU8A 5GMEA 5LJ5Y 1Y3KA 3MEDA 1GEHA 3BGUA 4QYZK 2QE5A 1E6YA 3CJKA 5DQHA 2CFXA 3KJFB 3J7Z5 5IT9U 2F9DA 4KKOB 2CQIA 2DIUA 3MM6A 3IM9A 1SJ1A 4N47A 5CYQB 1DTQA 3CJ4A 1S9FA 2K1RB 4ATNA 4DR4F 4M5MA 2W24A 2ZWOA 4LRCA 2CPJA 2QMWA 4WE1A 4DL2A 3NBPA 5I3UB 4RNFA 1D8YA 3R1LA 4J5OA 5THWA 3TP2A 4OJ1A 1VC6A 2GMJA 2RU9A 4YQWA 1M1HA 1NXIA 4USJC 3FBEA 2IMWP 3HFVA 2ZBCA 2UUBF 1TK0A 4JI5F 2M9KA 4IOCQ 4EBCA 3PYGA 5DQIA 4NE9C 4NLOA 1WORA 4OYIA 4CO2A 1J27A 2MKHA 4B3SF 1RK8A 2OLWA 4R0EA 1YKWA 1L3KA 1LFWA 1RWNB 3SXLA 1JNZB 4DUZF 4KYZA 5AE2A 5A8WB 1N34F 4L76A 2CADA 3DRXA 1UEVA 4MFBA 4UOFA 2ROEA 4FPIA 3SDEB 1Y5NB 4QW8A 3Q0AA 3QYYA 2B5JB 2CQ4A 3DYAB 2RS2A 2RF2B 3OR2B 4DV4J 2Z2MA 2IC3A 5KFXA 4YUDA 4ERDA 1S10A 3TEHB 2J7WA 4JI0J 3M9MB 5L1JA 1LWFB 4U6PA 4C0OC 2E7XA 4J9QA 5ETOA 2D3O1 2UXCJ 4WYWA 3OUYA 3OVSA 4PPDA 3BN7A 3H8YA 4AT1B 1RT6B 5GADU 1S0NA 2HHUA 2N7YA 3BF4A 1TAUA 1VISA 2CXEA 4H54A 2A3JA 1ZM9A 1FKOA 4NLPA 2XS7A 1RUSA 4OJHA 3ZNJ1 2E1PA 2BE2B 2OPSB 3H90A 1NPRA 3AH6A 4YY3J 4F0HA 4WKRA 2HQGA 2WVEA 4DQQA 3BQ0A 2CQBA 2E1AA 4P9SA 3D6HB 2DITA 3EGNA 2HVIA 3RJMB 2PEHA 1VMBA 4KY3A 1OIAA 2RS8A 2J6SA 3BDEA 4B9SA 3TZYA 4DL3A 2FUG9 2NXCA 4LBPA 1N5TA 2FVCA 4WXWA 2VQEJ 1U6ZA 3MD3A 4QR2A 2ZBIA 1JIHA 1S9GB 3H2VE 4B9UA 2AGPA 2OJ3A 2X3GA 1JMTA 2DGOA 4QCLA 3HSDA 3R7BB 5D0HA 1W25A 4F0KA 2COLA 3G82B 4OI3A 1BWEA 3NS7B 1EETA 3DGPB 4OYZA 2CZVC 3DLBA 2W7AA 4URGA 4QU7A 1X4BA 5C42A 4UY8T 2L9NA 2VA3A 2DY9A 5CYMB 1SB6A 1XK8A 2DGSA 3G87A 3K5PA 3HSGA 1R7IA 2ZZNA 4IR1A 2OMLA 2R7SA 1RAFB 4QR1A 4RU2A 1PGZA 3M6WA 1PAUB 3MHYA 3PR4A 5HMZA 1VIXA 2RUSA 3QFHA 2YKQA 2AJ1A 1RT7A 1LWCB 5B0FA 3UDLA 2BJ1A 1LXNA 1M5KC 3FEXB 2FZKB 3FVYA 2YXLA 2DNYA 3GSDA 1V9OA 3E3XA 1XR7A 1QD1A 3DDKA 3I0SA 3KHGA 3DRRB 3DRSA 1CC8A 4FBTA 3PEJA 2LFVA 4LF5F 5K8PA 4QU6A 2HZCA 1GXTA 4ES3A 1HNVB 5L46A 2LU1A 5KFJA 2AU0A 3ZZYA 1MU2A 3NAIA 3RAQA 2HURA 3UCGA 4X84A 4PABA 2M4MA 3CD6S 4F50A 1RTJA 1D8ZA 1HMVA 5KOXA 2E5LJ 4LBIA 3MR5A 1M1GA 1UEKA 3HI9A 4USWA 3PEHA 1SJRA 1VQ6S 3TQ1A 2RDJA 4OYAA 1RHMB 4Y2IA 2BJ9A 2OD6A 2DPIA 3IRXB 4YR0A 4ANDA 1KVIA 4TXSA 6FDRA 3JQKA 1KVKA 5HLFA 2LQBA 4XAKA 2HRTA 1TFYA 1HIYA 2F3JA 4G1IA 4YB1P 2KU7A 4HTJA 1U6BA 3G6YA 3QJLA 3C15B 4X62F 1KVJA 1PO6A 2H4YB 2P9CA 4ZPVR 3MEKA 1BQXA 5CA5A 1T94A 1B99A 4FKXA 2QN6B 1DLOA 1NJYA 5DDQC 5F8MA 4ZPDA 3MCNA 4KE5A 2KM8C 2OPPB 4NLWA 1APSA 2FVSA 2HAFA 3DNCA 4X66F 3T1YJ 4DEZA 3ADAC 2WW8A 4DSJA 3J81Y 2R42A 2CQ0A 1X9WA 3BSOA 4X4VA 5KFAA 1GXLA 2DIVA 3JAMY 1U47A 3GONA 1MROA 2W2NP 4KV8A 3IFEA 2QA1A 2CNLB 2ZUGA 1MNEA 3MECB 5A2QY 2R8HA 2PMZD 3KG0A 5DLFA 3B4DA 4LSNB 4MIAA 1HBOA 4I4BA 3NXZA 2LLZA 4KTQA 5GAGI 4N76A 5J2PA 5C7PA 2DHXA 1ROFA 4TQRA 2HVEA 2KI2A 4WK1A 3I4PA 3JSMB 2GVZB 3IBCB 3A8EA 4Y34A 4ICLB 4HT7A 3H20A 1WEYA 5DQGA 3NGSA 2LXUA 5LJ3Y 3KLIB 3ONQA 3VV2B 3H5YA 4DG1B 1FNMA 2M7SA 2CJXB 3CVKA 4DR2J 2KFZA 3BV8A 4DPYA 4P2MA 3KLEA 5B0BA 2B6AA 3RAMA 2J7UA 1FRXA 2EEYA 2OEKA 1C0UB 5B09A 3HFZB 4P72A 2E5JA 4B3TF 3LGHA 5KG0A 1TV6B 3P5TL 3VZIA 4K4SA 2X3DA 2GO9A 1QJHA 4RUCA 4WCEQ 1R27B 4MIBA 3NEKA 3WHIA 1T9VA 5J2MA 3N01A 2FQQB 1SL0A 2DR7A 1CSJA 2CWKA 2WBRA 2Q6CA 4JI2F 3RTVA 1XERA 3HK2A 1SXLA 2HVHA 2VDIA 3IWXA 2F5GA 2DNQA 3HSJA 4JI8F 5EWEA 1GAOA 1TR0A 2G2YA 1YDLA 2QGFB 4N8NA 1JLFB 3MOZA 5HP1B 4AQYF 4I6YA 4DN9A 5C2CA 3NLCA 5MAOA 2AZ1A 3MI7X 2ZUAA 2HFVA 2EG1A 2VHGA 3KWMA 2UUAF 4F4XA 1FHTA 5GAEU 3W60A 3RGIA 2HWHA 1YJNS 2C1EB 3AY0A 1RB0A 3ZTRA 3WIUA 2NXUA 1HYSA 4UTGA 3UN2A 5KFSA 3M2VB 4ZJOA 5A8KA 2XZTB 2ADCA 2RQ4A 5CCMA 4G1QA 2LKZA 5DGBA 4RUAA 3PW5A 5AE1A 4LFAF 2HS0A 4KH0B 3HKZD 5HO4A 3FZBA 2KN4A 3ENVA 1OWXA 4KC5A 3MZIA 1TL5A 1SBRA 2XMUA 4USMA 4DL4A 1C0TB 5F8JA 3UN3A 1MLAA 1ZAWA 4CO0A 3RB6A 1Q82T 5IOLA 1GFWB 5J1PA 5EX0A 2DHGA 1FJGJ 3GTYX 3MM7A 1RHRB 2YKAA 4Q45A 5HROA 2ROGA 3DM2A 3MM9A 3NCPA 1REGX 4OYMA 4YMEA 1RT4B 3A3OB 2DH9A 3V5RA 3RW6A 2HS4A 3C16B 3NS5A 1HNWJ 4KSEB 1CS4A 5KG3A 2NZ4A 1VQ9S 3M8PB 4NA1A 1H73A 1RLDA 1HI8A 3MPVA 2QLBB 2GHVC 1YJUA 4ANEA 4IFVB 3K5OA 1SVDA 2HHQA 1XEZA 2XS5A 4NI2B 4Y2AA 4Q44A 4GO5X 4DCOB 4OHXA 2RT3A 2R7XA 2BRLA 1OQ3A 4NXMJ 1RABB 4ANCA 1XMQJ 1FRIA 4EEYA 3M32B 4FF2A 3BM7A 3MM8B 3CE8A 5FDLA 2JDJA 3CCRS 3N6LA 2ZH4A 4PRFA 2YTCA 2NUHA 1PBUA 5IT9Y 4Q43A 3FQKA 1MMNA 4G6VB 2QLXA 1QM9A 1RADB 2RRAA 1X5TA 4ZIVA 3BQ1A 4K50A 1U09A 5E3AA 5IXUA 4LSZB 1VRUB 2AZ3A 1N6QB 4P2XA 3KLGB 2NPFA 1N36J 4CLKA 2WW4A 1CPZA 5J1EA 2V4RA 2RQMA 1WTBA 2OELA 4LVOP 3TJ9A 1JJHA 4OMFG 1S6UA 3ENQA 3B54A 5B0DA 2H54B 2KM8B 1RT5B 3R5CA 4ELVA 2GGPA 2YX4A 2W01A 1VQKS 1LEOA 2WSEC 4K4VA 2OTJS 5D15A 4JV5J 2XO6A 2VZ9A 4USKA 2AJQA 2UUCJ 1YRUA 4WFBQ 4ED4A 2D1CA 4J90A 3MM5A 3PW7A 1S1VB 1S6QA 1Y11A 3MMBA 2M88A 2HNDA 2DXEA 1YJTA 4C11B 1GMWD 1S49A 2ROPA 4DV6F 8RUCA 1BQMA 3CJ0A 1GK8A 3L9ZA 4DF8A 5CYJA 1PYOB 3TAPA 1NJXA 4LRAA 1FRMA 3DU5A 3IAM9 2CQ1A 4EK2A 2PFDA 4ZCKA 4DV5J 1RU2A 1PAEX 2VQFJ 5T7LB 3GLJA 1SV5A 2RKIA 2YH1A 5BR8J 4ECZA 3PW4A 3NWRA 3AA9A 3DOKB 2I5JA 2MZ1A 3T5JA 3QRPA 4XPEA 4Y28C 2MPUA 1UVIA 1U8SA 3KJQB 3Q8PB 1KQSR 4PQUA 1TL1A 1RT1B 1RWUA 4CNZA 5IM0B 3W1YC 1MMLA 2WAQD 3DGVA 3W8PA 3NP5A 2BYCA 3CC4S 3HVWA 5IQQA 4P71A 2DCLA 2D9PA 2YNFA 1RT3A 3MWBA 3H25A 3PW2A 2C2KB 2ATCB 3D0HE 2HQFA 3NGRA 2UV8G 5KFWA 3O44A 2HBQB 2AKWB 1G7CB 1D0EA 3HJVA 3SYZA 3RB0A 1S48A 1WHWA 2HBZB 1SQFA 3PYEA 2AMCB 4ES2A 4ZN1A 4CWBA 2DNOA 2VASA 3SQGB 4KO0A 3GQCA 4OLPA 3T9NA 4Q8FA 2LEPA 1VQPS 3TAQA 1DJ0A 4ID5B 3TO8A 3KJVA 2IFXA 3BKUA 4O4GB 3DHWC 3GIJA 4V1Ak 1I51B 1YX2A 4OV6A 2PE8A 3UVJB 1YQHA 3I31A 2HGNA 2MB0B 2X51A 2PEBA 5F8IA 4YFUA 1HLWA 2VPYB 1CQMA 1RWKB 2G0IA 2F8HA 4OX9J 1BY9A 2RU3A 1Q81T 4ZN3A 4RKUC 1IBKF 3KHLA 1HW9A 4UOGA 1X0FA 1OQ6A 4PQAA 4PKDB 3QQCD 1NK7A 4ZS6A 3ELHA 5A8RB 2JLFA 2J6TA 3W2WA 2JNJA 4I1TA 5KT6A 3CJQA 4R5PB 5KFUA 1TL3B 2MGZA 1WC4A 3ZZTA 5IQ6A 4H4OB 5CQGA 5KFGA 3THPA 3SZ2A 2ZM6F 4DS4A 5L9NA 3RAXA 5KFNA 1HBUA 2ZITA 3U02A 3G8SA 4IDKA 3VAFA 2DEJA 2ZC4A 2NLWA 4DSFA 1XN9A 1KLMB 2GNKA 3D66A 4C4WA 3CDEA 4I69A 2HEKA 1Q16B 3JYTB 1T9UA 4YEAA 2E1RA 4OI2A 1HQEA 3M8RA 2J0XA 1QDUB 5A6WA 1NK5A 3DOMA 5FIIA 4C8LA 2WB1D 2R9LA 1F5CA 3CJ8A 1NH7A 4Q0BA 2DISA 4Z37A 3KYLA 4AL6A 1PSDA 4QWBA 4O0NA 2MKJA 2IRXA 1WI6A 3EXYA 1IBMJ 4NASA 4X65F 3H7HB 1VGYA 2Z56B 3LAKA 2J8SA 3SFGA 1VK3A 3FEZA 2EFGA 5KT2A 4ECUA 3D4JA 1XMBA 3IWNC 2B51A 4TY8B 1BMQB 2DXFA 4JP8A 2Z4PA 4EO8A 4LF9J 4WZQA 3BR9A 3MMJA 2BKNA 2GZOA 1URRA 5L1IA 1B7FA 2KRRA 2PMHA 3FBBA 4ZVEA 1RAEB 2HQDA 2BM1A 4F0MA 2MHEA 1CJKB 4GKJJ 4RL1A 5FLXU 4OI0A 4Q2MA 1J5EF 2C3PA 2BDPA 4R8UA 4MAKA 4Z7YA 4RNMA 3CCUS 2VG7A 1KOOA 5K9FA 2WVBA 4X4OA 1S6PB 4F3OA 1RHJB 5HQ8A 2E1MC 4NLYA 4DHVA 4O3NA 1FVQA 2LEBA 2YWFA 3VQSA 3FCHA 1JJ4A 1ZM2A 2HZAA 2RSQA 3B8HA 2DR6A 4PWDB 3UR3C 1RACB 1WC6A 3BSCA 2POKA 2ZVSA 4PXCA 2RQKA 2DGUA 4LF8F 1GMWA 2A0FB 4WIIA 5ETKA 3W8GA 3BBFA 1BWVA 4BDPA 2IIHA 1KSPA 4DR7F 3EUNA 1YJVA 4I2QB 5B08A 3MEGA 4U95A 3RBDA 4FDFA 1OSDA 2CPIA 3DLJA 1UVLA 1IQTA 2PI4A 4G65A 1B0VA 1U4BA 3RB3A 3F56A 1UTAA 1FJ7A 1C1CB 3A8KA 4YS2A 4HH1A 1H7WA 1VRTB 1NJZA 4JI3F 2OIHA 5KG4A 3A3NB 2IDLA 3HHLD 2PO4A 5B0AA 2ZZTA 5CABA 2P9EA 2ZNYA 2J76E 4NZ7A 2IA0A 1BQNB 5J2NA 2H3EB 1VR6A 1S72S 2W2QP 2YQ1A 3BH7B 1TKZA 2B7BB 4FXDA 4WKYA 3CCVS 3IS9B 3GJRB 2PIIA 3IR7B 2HVZA 3CCMS 4BLGA 1CJUA 1Z2LA 5F41A 1DY3A 3PHEA 1Y10A 3B4MA 1DURA 3ZZOA 4RU9A 4XDDA 1SIZA 5DZ7A 4YB6A 4F67A 4U96A 3J80U 2GQQA 1CBKA 4NCGB 4EU0A 3IWLA 2ZH1A 5D3GA 1CLFA 3MCSA 1HQUA 4GKKF 3PXGa 2EFNA 3OR1A 4N5SA 1X5PA 3H0PA 3IM8A 4M5KA 2DPJA 4LBHA 2IAJB 4DV7F 1XTZA 1X31C 1UVNA 4FBUA 3P8BB 3C14B 4ECTA 3R5DA 3DLHA 3QZ8A 2Y0SD 3LOUA 2IVYA 1XIQA 1VS3A 2LXIA 1I5OB 4XK8C 1E6VA 1WDDA 2X7IA 4GVLA 5B7WA 2YY3A 3NS6A 4L74A 4JYAJ 1WC3A 5GAEI 3IBWA 2ALZA 3GJSB 1U1RA 2Q43A 1F9HA 4DUYJ 1FVSA 2F63A 3T19A 4RNOA 4NLQA 2DGWA 1T9TA 3T41A 2CZ9A 2R8GA 2IRYA 1X9SA 3D1OA 2CNNB 4UF4A 3ETOA 3F73A 3CD5A 4CO1A 2BV3A 2CVEA 1GXUA 5H9FJ 2YH0A 3M1VA 3FFIA 4JUZA 5KFRA 4LR7A 1AZSA 1S7IA 4IG3A 1TP7A 1FDNA 4DV2J 3OD2A 2YWWA 1N36F 1T11A 2FJAB 4Z2XA 1PC4A 4G1PA 3ILOA 3MPDA 4FYWB 4TVAB 4WIQA 4KR0B 4DCJB 2CIMA 4W92B 2XMTA 2R7OA 1ZAXA 3VAJA 1YG0A 3H42A 2IJFA 4CM2A 1PYSB 1YBAA 2G1DA 3W65A 2ZH6A 2BANB 3PO5A 2B4VA 3LTOA 1JKHB 3DRPA 3MFHA 2FC8A 4ED2A 4QOTA 3V81A 4OZ3A 3SBMA 5DM6Q 2I0XA 3OLAA 1OS5A 2AGQA 3BREA 2DNNA 2W7OA 2QEXS 3D1HA 5DG9A 4A8FA 5BXIA 5CCLA 2DB1A 3GFHA 2VG6A 3VGSA 3PX0A 1M90T 4DR1J 2A6MA 3DOLA 3L7OA 3W5YA 2ZWPA 1IR0A 3KK1B 4NOHA 1T8EA 3QGIA 3JXOA 3UCUP 1NJWA 1KS2A 2ZBPA 3M8SA 1OPIA 2ZHBA 2CPFA 2BJEA 5HQMA 4TQSA 2VONA 4OX6A 3J7ZT 2BX6A 3WX4A 3MEDB 6FD1A 4LF4F 4W90B 3X1LB 1E6YB 1VRQC 1KHVA 2ZDOA 1T05B 2DR8A 3P96A 2HRUA 2KKHA 1JLCA 1FK9B 3RR8A 2FD2A 4YHHF 2Y3YA 3T1HF 2Y1LB 3SQOP 1IKXA 3KLHB 1HQ2A 4P74A 3MM6B 3I87A 1WNEA 2DNGA 1WC0A 2KYXA 3EVWA 3ET6A 1S1WA 1Y0HA 1U1MA 4HHJA 1WDTA 1S9EA 2B56A 3CCWA 1U25A 5T14A 2JVOA 1RKJA 4DQIA 1L3UA 4YB5A 3H40A 3DHXA 1PILA 1VJQA 3QWPA 1EKSA 4WE1B 2KFYA 3RG6A 4M5IA 3R27A 4OLOA 1RAGB 4O3RA 2MYFA 1QAIA 2B4PA 2B3TB 1UPMB 2QMUB 1ZETA 1IBCB 4X4SA 3FMBA 4KAIA 2VJVA 1D09B 5F9LA 4EMDA 2IBOA 2F7VA 3QFWA 3AHPA 4RLEA 4USUA 2XY7A 4UUWA 1RISA 2LMIA 1DQ8A 2MEWA 1N33J 2CQ2A 4RW9B 1PKUA 2ZKUA 4I2PB 3HHLA 4KHRA 1M5HA 3LO3A 1T9XA 2FLNA 2MQPA 4RO0A 5EWGA 3LWMA 1UJ4A 2MQOA 1IKWB 1P6TA 2GMHA 3EMTA 4MFBB 1UETA 5IZHA 3HVTA 4C97A 2I9SA 1JLQB 1R6VA 4MKVA 1IM6A 3G8TA 2IVMA 3MPYA 1QY7A 3MGJA 2N3LA 4EBEA 4M5GA 4LR8A 1MN7A 5D4PA 3CW2C 4CLLA 3UR0A 4HI1A 2ALYB 4UT4A 3BGFA 2Y9HA 3KLFA 4PXEA 5EWFA 1F2HA 3FEYB 2IDEA 2DGXA 3M2UB 2R4FA 1S1XB 4USTA 2FHJD 3QIPB 2ZDPA 4RBTA 4B3RF 1RYSA 3ENWA 1ZZFA 2J9CA 3TRGA 1X0PA 3Q83A 1QUPA 2DK2A 2W7PA 1ZTTA 1NZ8A 3HSZA 2YNHA 1KNZA 2XZDB 2JSXA 3TZZA 3P4UB 5EUHA 4J9KA 2RDIA 5ETNA 2MHNA 2MKKA 2HHHJ 4B9LA 2FZCB 2YNIB 1WF2A 1IR1A 2BR0A 2HHXA 2P9GA 3K8VA 1S77D 4KKOA 1IBMF 2GJ2A 4KQZA 1RAOA 2ZNZA 5CYQA 1V3ZA 3BYRA 3NGUA 2K1RA 1IBLF 2XY6A 2ZHOA 3QLHA 3NCRA 3VZHA 4LF9F 3I96A 2FDNA 2R7WA 4ECYA 4FVCA 4RWWA 4QR0A 1RT2B 2R8KA 2C3OA 4I7FB 5I3UA 2VPWB 4M1KA 4ZCIA 2QC3A 4CZCA 4DBQA 4NXNF 2OEMA 2ZEJA 3AB2B 5CAAA 3QO9B 2RHQB 4LRDA 2DH8A 4C8YA 2BKOA 1NKCA 3OVAA 2C2NA 1RBLA 1FE4A 5H9FK 3VAGA 3LP2A 1ZBTA 4AL7A 2Y1RI 1SC3B 4ED5A 1AFIA 3OSNA 1RA6A 3UI3A 2N3OA 3FCWA 3C6UB 4LF7F 2VFTA 4AD6A 2NZCA 3UCZP 2OP5A 5KG2A 5J1NA 1P9QC 3CF5Q 3SDEA 3CULA 2B5JA 1J5OB 2RF2A 2KG1A 2YKOA 1S0OA 1U7LA 3GB0A 3BO3A 2CPXA 1KEKA 5A0YB 2DBBA 3QGGA 5EN1A 1C2PA 3K57A 4L73A 4OHWA 1LWFA 3O6QA 3I0SB 4AYBD 4YN3B 5HAOA 4JB8B 3NY0A 4OZ2A 1JLBA 2N7CA 3TANA 3OXGA 3EPIA 4F04B 1VQ5S 1U6FA 1DRZA 4BS2A 1PIEA 1RT6A 2OPRB 4O3SA 4P2FA 1N32F 2HLUA 2RDDA 1MU2B 4IO1A 3SFUA 3W7BA 1QE1B 3ZNUA 3SV4A 3HCXA 1RHKB 1RTIB 4NLRA 3A8IA 2OPSA 1VC0A 1O0PA 3VAKA 2C3YA 4WP8A 1QTMA 3US5A 3GPAA 2GHPA 3GIRA 2HGMA 4X64J 4U7UK 3NNCA 3NNAA 2WOMA 3OTCA 2O5DA 3KDOA 1K44A 1KFSA 2GC8A 3ZXWA 5DG7A 5HLFB 4URSA 3KNGA 4M5DB 4X4UA 5FLXY 2XNQA 1S6OA 3NWGA 4PYAA 5LMUF 1S9GA 4TU7A 1PC5A 2HSEB 4E98A 3N5FA 1DQ9A 4L3NA 2EK1A 1UWAA 3OW2R 3K89A 2UV8A 3KK2B 2AJFE 1HWKA 1FJCA 1D1UA 2UXDJ 2XI3A 4L75A 4ZDNA 5KOWA 4FKYA 3BBBA 4ETXA 4CLUA 1RWMB 2AEJA 1D3WA 2JWNA 3R2CJ 2HMIA 1TVRB 1UZHA 4ZLPA 3RR7A 2O01C 2DD8S 4OX7A 5LL6d 2CQ3A 2VA2A 1R6YA 4B02A 2LEAA 2CJ9A 4AFFA 1WOSA 1X4CA 2MY7A 3D0GE 2B43A 3QSYB 5KFLA 4DR6J 1L3SA 1UMJA 3Q8SB 1S79A 2N82B 2MZTA 4QW9A 1VQLS 2E9TA 4MYTA 3P49B 1LWCA 2K8GA 3OL6A 1HBOB 2VKZG 5AJ3F 2ZE2B 5M2RA 1OY9A 4LMZA 1W26A 4ED7A 3LW5C 1X5SA 4RW6A 4C98A 2QSFA 1R8HA 4PUOA 4DJBA 5T41A 1GTEA 5LSRA 3AD7C 3MUTP 2FHJA 2UUTA 2EC0A 3O2IA 2CJBA 1WOPA 4O4RA 2EFOA 4CLYA 2HYIB 4GVBB 3R5GA 3P3DA 3VAHA 1V3SA 3EXCX 1KBRA 2KT5A 3RZAA 2W9BB 3J80Y 1O8BA 2CG4A 1VDHA 2UU9J 4LF6F 1RWPB 2VG5B 2J9EA 4JI7J 3AFGA 1S0VA 1TFWA 2WVDA 1HI0P 1ZA1B 1HNXJ 1JLGB 4K0KJ 5RUBA 2K7JA 5J2MB 5LXRA 2MKIA 3J7A1 4QBUA 3QJPA 3W61A 3QAUA 2QLFB 2DGTA 2AYEA 2V8GA 4TNOA 2X1FA 3DLGA 3C2PA 2JH3A 4IUFA 3EJMA 4X4TA 3Q8UA 3OL8A 4OX8A 1IWAA 2VD3A 1XNQJ 2V34A 2E44A 3LGNA 4QWDA 4O0IA 5KFEA 1XBWA 2MZSA 4ZVFA 2GFFA 1I6JA 4QWCA 2FB0A 2LVWA 1HWUA 1SI9A 3Q8VA 2OPPA 4ECRA 2LQ8A 3THTA 2VOPA 3G4SS 1FDAA 3FNNA 2FTRA 1FRJA 4JI1F 2KHDA 4LIRA 4LF1A 2PA8D 5LOQA 4W4MA 1UFKA 2RRNA 1FRKA 1GQEA 2DHAA 2OKQA 4NYZA 3PNIA 5HSPA 1HYSB 2AJ2A 1I1GA 2JRSA 2RAQA 3AAWB 1XNRF 1NEEA 5LM7E 2XSJA 3MECA 4G1QB 2XMMA 3KFWX 1H7XA 3BEGB 4FYXB 3D9BA 2QV6A 3BN4A 5KT4A 3TNVA 4M95A 4LSNA 3C66A 4MTPA 4Q5VA 1L3VA 3OJSA 6AT1B 1KDNA 1UJ5A 4CRJA 4NZ0A 1NKEA 2CQPA 1HBNA 1N5YB 2DEIA 2GVZA 1UJ6A 3BO4A 2H4WB 5HROB 3RBEA 4WFNQ 3DM2B 2E29A 1QVGR 2O67A 3KLIA 3AQOA 4DG1A 5K5MA 2HQCA 2VH7A 1N33F 2JVRA 1ITPA 3DFEA 4DR5J 4QIEA 1CS4B 1C0UA 4DQSA 1TL4A 1RE1B 1F1BB 4J7CA 1TV6A 1OY6A 4PR6A 2LECA 1P27B 4J9NA 1Q79A 1FF2A 3LAMA 1K0TA 9ATCB 4E2FB 2G9OA 4TU9A 1U1OA 1YTYA 1DQAA 3CCSS 1N0VC 5F8LA 2FLOA 1NDCA 1F6TA 4LRFA 3HHKA 4OZ1A 4E8UA 1VCTA 2DY1A 3PVXA 1H3DA 5E41A 4ECSA 5IWAJ 3OTEA 3U1LA 3BKFA 3UNYA 3M6UA 4OYOA 3ZTSA 5FDLB 1K1SA 5E3PA 2GQCA 1Q0NA 4XDCA 2E5HA 2W9AA 2B9EA 2E9ZA 5HP1A 3S8SA 2IM1A 4HI2A 1YIJS 2E9RX 3MPUB 2B8PA 9RUBA 2IJNA 3ITHB 2HHHF 2Y8WA 4JI4F 5KT3A 3NNHA 4HKQA 1NSAA 4ZVPB 1CJTA 3EDQB 4DV1J 5DM7Q 4DV3J 4F2RA 3WIVA 4W98A 3ZZPA 4IG0A 3RU0A 2J8AA 4QIWD 3R3TA 3CUNA 2HWTA 3M2VA 4C0HA 3WDOA 4OHZA 4ZITA 3VGUA 1HR0F 1N0UA 2VC0A 2M2BA 1U0SA 1K8AT 1CVJA 1RP5A 2C2ZB 2GGPB 3TZWA 2A18A 2F4VJ 2J0SD 2XLJA 4LF2A 3S1TA 2XCAA 5K8MA 3CCES 3KUHA 3I4HX 3N5BA 1SJ3P 1W2IA 4J37A 1FTRA 3TUIC 4IFYB 3OBIA 4P73A 1FA0A 3IO1A 3EGVA 4I6WA 3O1LA 1MWYA 4KH1B 2MZQA 3POTB 1FWLA 1UVKA 3EZOA 3DRYA 1EIYB 4ZCMA 3R5AA 3PFOA 3I5AA 1ZYQA 3HZGA 2CZ4A 2DO4A 1T3NA 4IOBA 3PHTA 3NMAA 2V8PA 4Y6IA 3C16A 2XTJP 1H74A 3OTOJ 4DUTA 3M8WA 4RUHA 4NZ6A 3W9HA 2HNYA 3M8PA 2DRBA 4NLDA 4CT8A 2RKIB 3R9LA 2RE1A 5CH7B 3VF0B 5B0GA 4IFVA 3CDAA 5F8NA 1HNZF 1KQGB 4NLSA 2CRLA 4IKAA 2I5JB 3E51A 1PYTA 1HHQA 4LVNP 3GWCA 3FC9A 3D1QA 4KHPJ 2HIYA 1TELA 3M32A 4FF4A 4DMZA 3MM8A 2UXBJ 2BZ2A 2YKNA 1Q7LB 3H4DA 5KFKA 2FJBB 1LW0B 3QGPA 2RNEA 2YNFB 4ZCLA 3I5CA 1TTHB 4EYIB 4B3OA 3CJ2A 3AQPA 1Y4ZB 1MG7A 1X8DA 3CJ3A 2C2MB 1O6XA 4FVMA 1EQ0A 4WU3A 3HKWA 3FSXA 4DI6A 2LQJA 1VRUA 3I0RB 1NHUA 4KO0B 1JQGA 3I55S 4RW7A 3KLGA 2NR0A 4X64F 4DR3J 2JL9A 1C4CA 4PG4A 1D9DA 3ZZUA 2LP4A 3CJ5A 5K14A 1TL7B 1RT5A 1R43A 3W9IA 4HH0A 3GILA 3GG1A 1P1TA 2B0GA 1WKJA 2I1RA 3M2RA 1FEHA 2YPZA 1ICEB 1EHWA 5H9EJ 1TKXB 3MAHA 2NSCA 5ETVA 1CC7A 3OLBA 4C3KA 4ELTA 2BKPA 3DLLQ 4C2MA 1S1VA 2DT9A 3FUYA 2IYGA 2O1PA 3GIKA 5HQLA 4C11A 2UVRA 2AYMA 2ZH7A 1QSLA 2M5YA 3PYFA 2DYAA 2WHOA 1JLEB 1S0MA 3DI6A 2XNRA 4LFCJ 2YKPA 1I94J 1A7GE 1U1PA 5HK4A 3D3CJ 1HBUB 2IM2A 2OMOA 4IDKB 3UWTA 3M6XA 2B4OA 4JV2A 1VQ7S 1NB7A 1ULRA 2FLLA 1T03B 3JQMA 4OI1A 2ZD1B 4NLVA 3D68A 3CCZA 1FX2A 1I3OB 2AT1B 1XMOJ 1SC4B 1R8BA 3SCJE 3GSIA 1YBTA 5HMXA 1HQEB 2XLIA 4HACB 1H2TZ 4RW4B 1Q78A 3M7VA 3LH2S 4N7TA 1RT1A 5IM0A 2JC1A 1TMJA 2VC1A 2D3UA 5GMDA 2FJEB 2DNHA 1YITS 2D7SA 5DO2A 4H4MA 4PYDA 2QA4G 4ED6A 4DR4J 2AGOA 3DKDA 2L48A 2M52A 1TAQA 3GIIA 3LQVA 3GFYA 3TX8A 1K9MT 2ZH8A 4NMLA 4MK8A 1KQFB 3K17A 5D0RA 3TJ8A 3WBZA 3V4IB 5AXMA 3G6VA 1M0SA 2KL8A 2A6OA 2M3DA 5E0OA 1A0OB 2P5VA 2VOOA 2HHSA 3KOAA 4ID5A 2C2DA 1OPZA 2VG7B 4O4GA 2G0JA 1Q8IA 4B3SJ 1ZM4A 3E01B 5L39A 1RZMA 3UVJA 1U45A 2ZC3A 3CC7S 3HT0A 2JEFA 2V67A 1RAAB 2V94A 3MUMP 4B3MF 3PKYA 4DUZJ 4LSLA 2CA9A 2R3VA 2FPHX 3HHDA 3W62A 2NPIA 3ZFVA 1WKKA 4HDGA 1N34J 1CG2A 1QAJA 4MK9A 1NHKL 3W5ZA 1AROP 3CIZA 2MTLA 2JHEA 5A8RA 3TAMB 3H5SA 4R5PA 2XC9A 1U26A 4IYQA 1VLYA 4DXLA 2HNZB 4ILLA 3PJWA 4H4OA 5K8NA 3CDUA 1S76D 2XYPB 3KMQA 4MMOA 3K8WA 3HHLC 3QATA 2LDIA 3CD7A 4D3GA 2DXDA 3MAAB 2C2RA 1R8PA 4YOEA 4TLRA 2GIQA 1HWJA 2VBXA 2FJXA 5AXLA 1EB0A 1KLMA 3LA0A 3D67A 3DCAA 1Q86T 5B0EA 4M5HA 2MMYA 2QL9B 3D5MA 3VR1A 5KAKA 2AQ4A 5J2NB 1W2BR 1YRTA 1QLNA 4WFYA 3ZZ0A 4ZPTR 3HJFA 5KFOA 5C24A 1TMMA 2Q3PA 5HBMA 1TUWA 4QIFA 2E5IA 3OFGA 1HPZB 1FWKA 1N4LA 4OZLA 1FKPB 1UPPA 1EQMA 4DL7A 5LMNF 5LSLA 1K1QA 1M5PC 1A9NB 2ZFHA 5F0WA 2VODA 1RSCA 1N5QA 3LANA 2IA6A 4RJVA 2RUGA 3ENAA 4FN5A 3BSAA 2XMKA 4ED0A 3B82A 3OHAA 4Q7AA 4QWEA 2EK6A 1BD6A 2HWIA 2QX0A 2BA9A 2B9XA 4K4YA 1NO8A 4WXOA 4AXIA 2RB7A 4K7QA 1WSVA 4JI6F 1ELOA 2HPUA 1S6PA 4PWUA 3AXMA 1RKIA 5HMYA 3KUGA 5C25B 1AB8A 4QZVB 4J9OA 3H98A 3CTRA 3MXHP 1DAXA 4HTIA 1C1BB 3OQ2A 3ILLA 2KJVA 4LR9A 1KTQA 4AUKA 5H9EK 1FNOA 4ECXA 4O3PA 2UVWA 2FVRA 4CLPA 4OHYA 1U1NA 4MKYA 1Z1ZA 5H1SV 4F7VA 1CJVA 5IT4A 1WF1A 3FFIB 5KFIA 1IKYB 5DDRC 1UZDA 2PD1A 1AZSB 1LWEA 4CH7A 5CD4H 1HWIA 4IG3B 4BCAA 4EI2A 5I3QA 4DV1F 1OO0B 1F3FA 2XB2D 1C1CA 2KG0A 1KC8T 4FS2A 1FD8A 4M8LA 1VRTA 5ETLA 1S4FA 2WK4A 4F4WA 3K5NA 4NYPA 4YP3A 2J5AA 2ABYA 2HW3A 3ZTQA 2IVFB 3VHQA 3CEDA 2HFOA 3GP9A 3N0VA 3MR3A 1BQNA 2P6SA 4MT1A 4FXWA 3N9UC 1H72C 2IPOB 3IS9A 4RNHA 2BRKA 4YDXA 5KFDA 3V81B 2W8LA 4KGMA 3CDBA 4XO0A 1IWGA 3VTIA 1BLUA 2VBWA 4TY9A 2V8HA 3DDNA 5KTQA 1WWHA 4OI4A 5IC4B 2VIHA 3CO9A 3IR5B 3QT7A 2CNKB 1RTDA 4IOAQ 1VYAA 3BDPA 2VG6B 4NCGA 3MMCB 1NB2A 4RZRA 3C19A 2Y0BB 5AE3A 3D28A 3NG8A 5DDOC 3G6XA 4ID8A 2OPQA 2XI2A 3W3SA 4X62J 1TKTA 1UA0A 4YB7A 3TA0A 2XQCA 3QIDA 3TR5A 1F9FA 2WZ1A 2IAJA 4FS1A 3FK4A 4C8KA 5ETTA 3IG1B 4ZP7A 1RTZA 3FMWA 4DQPA 2J6UA 1S1UB 2GO8A 1F2GA 1S4EA 3C14A 2LXFA 4X66J 4DV4F 3E2EA 1NMEB 5HJYA 2IBKA 3GYXB 1X7VA 2ZJPQ 1ZPWX 2WVFA 4UUXA 2ZVIA 2VICA 1VK8A 2FJDB 2FHMA 4JI0F 3AOCA 4RBUA 4I6AA 4KHPF 4WTOB 1NK4A 1IKXB 1ZAVA 2EW9A 2DNKA 1VHFA 2MJNA 2UXCF 3PG9A 2V4JB 2V2QA 4ILRA 3M8YA 2J9DE 2A2CA 3W63A 4N41A 3TVKA 4MKAA 3B78A 1DHMA 1SKRA 1S9EB 1FNXH 1DFDA 3HDSA 3DXSX 4Y2CA 2FC9A 2PA3A 4WWSA 3RBZA 5HMWA 3L7UA 1QAXA 5CXTA 2HFNA 3IA0A 4LQ9A 1M5VC 4YY3F 5IS2A 1YZ6A 2PMWA 1D9AA 2F8MA 4CYUB 4DOZA 4CH1A 2EPIA 1NDLA 1EKRA 4NRTA 5IT0A 4Q2LA 4CCHA 3A12A 4IH5A 5E3CA 1S57A 3SIPB 2D41A 5LXYA 2CVIA 3GG0A 4DV0J 4FNIA 4F25A 1IKVB 2VQEF 2BANA 3NKYA 3K59A 3KG1A 4HHHA 3C8YA 2RHSB 3U7JA 3K5MA 4B3TJ 3IR6B 2N4DA 5EDWA 2W2OP 4MK7A 5FJ4A 3LUYA 1JLAA 3L3CA 3OSPA 3V6DB 2UZAA 2YKMB 3QNWB 1GX5A 3HVTB 4HHUA 4IO9Q 4C8NA 3CDWA 1RA7A 2AIRB 2XGQA 4CH0S 4F36A 5E7OB 2QL7B 3D0IE 4KGVB 4JI2J 1IUJA 4OZNA 4CIOA 3KLFB 1UKUA 4DX7A 3KK1A 1W7WA 3KXDA 5G4DA 4KPCA 1UEUA 4JI8J 4QPXA 4HEA9 4NCBA 2CPYA 1EZZB 1OY8A 5DZ6A 1T02A 3NGDA 2EKYA 4KT0C 1VQOS 1UWBA 4B08A 1VLOA 4C0BA 4PG7A 1WOOA 1FD2A 1WC1A 4AQYJ 5D4LA 1P9YA 2M8DB 4ZPAA 2VBZA 4NWBA 3BYPA 2F9JA 5GADI 2YWKA 4OFZA 5U47A 2DR9A 1SC1B 2RILA 4MYUA 5KFBA 2DHHA 2GCFA 1F60B 1T05A 2UUAJ 3D54A 1YJ7A 3M6VA 3FSIA 1BUXA 1FK9A 2V63A 2KT2A 4RW8B 2QA4S 3MTJA 2B8QA 3KLHA 5CZVA 1EP4B 2N4CA 1EAYC 4WJBA 3BSNA 2APOA 4M94A 1SH2A 5LT5A 2G13A 2MZJA 2KXNB 3WC0A 2MJUA 3BGRA 1XQIA 4WFZA 3EDRB 4LFAJ 3QLHB 3ETMA 4ZVUB 3HULA 5KFQA 2OTLS 3GV5B 3FCVA 1VBXA 3I9V9 3GZ7A 1SQGA 2E5LF 3J7YU 2XHCA 4C8MA 4DPWA 5CD4A 3M30B 2ILYA 3EPGA 4DF4A 1NDKA 1T0TV 1WSRA 1ZS6A 5HANA 3GMGA 3G8QA 3LP2B 1Q4RA 4XTTA 5D78A 3W2VB 2VFVA 1WUUA 2XY5A 4RW9A 2D74B 4I2PA 1LKZA 4AE5A 4J91A 2WSCC 1X60A 4WBFA 5KFVA 2ZOMA 4K2JA 1Q8BA 3LP0B 1BGXT 3R7NB 4O3QA 3GIMA 3RBXA 1T7PA 4Y0FA 4DX5A 3JTOA 1IKWA 4H4KC 2KXFA 1JLQA 1BE4A 4MKBA 3PX6A 4WTYA 1B4SA 2IJRA 4DS5A 3BPSP 3QRRA 1M5SA 1WTFA 2NYHA 3EYZA 4V19X 4KFBB 4UOCA 2Y8YA 3PRBA 3T1YF 2Z58B 3CIMA 3EM1A 3M2UA 2GVDA 3FRYA 1S1XA 2EVZA 3QIPA 2HG4A 4TLQA 3C6TA 2YWHA 4Y2MA 1JLBB 4C48A 2ZH3A 2CPZA 2KFNA 4CLZA 3QBCA 3BO2A 1FJEB 1RCXB 1HARA 3W9JA 1NKBA 2MKCA 1XC9A 2KHCA 2VL1A 3A13A 1FE0A 1WF0A 1LXJA 5D6GA 1JXEA 4FYVB 3MR2A 2DGQA 2R8IA 2IHR1 2YNIA 4RNNA 2GA7A 3CO0P 1Q1KA 1KFDA 4KHMA 4ZHRB 3JS9A 2QFIA 3IRWP 1AXQA 3D6TB 1RWOB 1N56A 2WOMB 1CQNA 4A48A 4V19J 5D8HB 3LWLA 2UVVA 4NL5A 4CP5A 3D2WA 2MDAA 2KRBA 5DETA 3EGWB 4ZLJA 1U02A 3LPYA 5KT5A 3LP1B 2CPDA 1L3TA 3CCJS 2KYZA 4JBCA 4DR2F 4L72B 2W2PP 3L4BC 2VPZB 2W9CA 3MMAB 2FLPA 3KK3B 1RT2A 3CB4A 1NM2A 3UDEA 2V4QA 4I7FA 2ZH5A 4USHA 3CMQA 3G6ES 2HBRB 2B4UA 2B9WA 1SPBP 1SH0A 3QO9A 2BM0A 1N48A 2NUUG 2QO3A 2BQUA 2QG9B 3B6BA 2HRYA 4DV6J 3HT3A 3GJTB 2GX8A 2XGPA 3MEEA 1SQEA 2V0NA 3PFEA 4CO3A 3FZ2A 1HWLA 2OSRA 3HO1A 1SKWA 1HL6A 2FY8A 2NS1B 3BGOP 3C6UA 2HMIB 2D3ZA 4KRWA 4DQRA 1YHQS 3WQPA 2R2UA 4K4WA 3PV8A 1KOHA 1O5JA 2AEMA 2PDAA 4K4TA 3NGTA 4PEOA 2ASLA 5I42B 4HLBA 1FT8A 1RWWB 1M1KT 4C7QA 3VQTA 3I5BA 1J5OA 5D0GA 3DLEA 3HHEA 3U27A 3BZQA 3D6FB 5M2PA 2YNGA 2EFQA 5KFCA 2DCUB 4P2SA 3ZZZA 3ICLA 4PG8A 5A0YA 3VALA 1JXVA 2H5IB 4B9NA 4ECQA 3UD4P 3ISND 2X1BA 2H65B 4F2SA 4RW6B 2MLXA 1VOMA 4PUOB 3HMJG 1FCAA 4ZIWA 4ITSA 2Z8QA 3OFHA 3DN9A 1P1LA 4ZLLA 5F8HA 2OPRA 1YSJA 2VF3A 4KBIA 1QE1A 1U0HA 4QPTA 3CGIA 3TVZA 1RTIA 1SUQB 4CTAB 2Q79A 4OHVA 1V5VA 4F02A 1RTHB 4RWXA 3M8QA 4UZBA 4AXJA 2Y1JA 3CMAS 3OHBA 1KKHA 2XBPA 1HD1A 2W4DA 2V6AA 4F3MA 2YX1A 3CT9A 1Z2ZA 1S1TA 3HLUA 5GVQA 1RWVB 2XYGB 3AXKA 5KFYA 3AODA 1VQSA 2YVSA 2DNMA 4PCQA 2I8EA 1FJGF 3W66A 3PRDA 5KFPA 5KFTA 3BKTA 3Q24A 3CCLS 2HHWA 3OVBA 5AXNA 4FXVA 4JOUA 2OUGA 5CHCB 4M5DA 1AT1B 3NOGA 3I82A 1X4HA 1X9MA 4ZVSB 3DLGB 3R97A 2B7CB 4ZVHA 1HNWF 3MOJB 1IBKJ 1NSKL 1H2UX 3KKFA 1R0AA 1HNIB 2UP1A 1FXDA 4X4RA 1SJ4P 3H2UB 4WP9A 3KK2A 2CJAA 5G0RA 4TYBA 3RB4A 1X4GA 3MCOA 5K20B 2WONB 1OMSA 1WEXA 4NPOA 1WG5A 2HKEA 2IY5B 1G6BA 3SSQA 2ZM6J 1TK8A 2QJ3A 3EZ5A 2DO0A 1MSWD 2VKRA 1TVRA 4P52A 4PAAA 3HZEA 4NXMF 2C3MA 3K7RA 1AYEA 5CZXA 4KGKA 4J9RA 2RD5C 1XMQF 1LQ9A 4GC7A 3IP0A 1PJ7A 2FJWA 3CJSA 3KJNB 4NX9A 2HFSA 3V4MA 3DLKA 1U1LA 2R7UA 3VAMA 4O44A 2XSJB 8ATCB 3HF5A 2CAJA 1A6LA 3PIPQ 3FBCA 3OV7A 2ZE2A 2V2VA 3GU0A 2FZGB 4MJKA 4X65J 2DR5A 2SXLA 1VI7A 2J9DA 1HBNB 4P75A 2HFZA 2QZ8A 4KGZB 3ZTOA 3LALA 2HQIA 1ZPVA 2BXJA 5AT1B 1N5VA 3J7AN 2V5HG 4U8VA 1HBMB 1VQYA 5JVGQ 2GIRA 4A4JA 4GVBA 3SMZA 8AT1B 1V3RA 2IM3A 3ILJA 3G96A 4DV0F 2M0GB 5E33A 2WCXA 4JV5F 2VB6A 3I9ZA 1N5SA 3SCIE 5JVHQ 2UUCF 4ILMA 2W9BA 3S6EA 2D9OA 4J9LA 2MSTA 5FD1A 2DVIA 2MSSA 3PCOB 1GTHA 4ZP6A 3AD9C 4U7CA 4J9MA 1J5EJ 2VG5A 1U1QA 4B9VA 4YR3A 3DMJB 2ILZA 3TWZA 1CULB 4P7TA 3QMQA 1JLGA 4TKTA 4CO5A
chains in the Genus database with same CATH topology
3GJRB 3R7BB 2XYPB 3GJQB 3IBCB 1GFWB 3R6GB 4ZVPB 2Y1LB 2CNOB 3EDQB 2CDRB 2H5IB 1RHRB 3NS7B 2H51B 3GJSB 1RE1B 4ZVSB 1F9EB 1RWPB 2H65B 2C2KB 2HBRB 2H5JB 2CJXB 4ZVOB 1BMQB 1RWXB 1PYOB 2HBQB 1RHQB 1I3OB 2QLJB 1SC4B 2CNNB 2C2ZB 1RWNB 3R5JB 3D6MB 3KJFB 4LSZB 2P2CB 2HBZB 3GJTB 5K20B 3R7SB 2C2MB 1ICEB 2H48B 2QL9B 3SIPB 1NMEB 2C1EB 2QLFB 3D6HB 1RHMB 2DKOB 3RJMB 1SC1B 2C2OB 1IBCB 2QLBB 4JB8B 2HBYB 2XZTB 4DCPB 1PAUB 2CNLB 3P45B 4DCJB 2H54B 3R7NB 4ZVRB 1I51B 4ZVQB 2FQQB 1RWOB 1RWVB 2H4WB 2XYHB 2XZDB 1RWWB 2XYGB 2QL5B 3QNWB 1QDUB 5IC4B 4DCOB 3P4UB 3IBFB 1SC3B 2CNKB 1RWKB 1RHKB 3KJNB 3R6LB 5IC6B 1RHJB 1RWMB 2CJYB 3KJQB 2H4YB 2QL7B 1QTNB 3EDRB 3D6FB 2Y0BB 4ZVUB 4ZVTB 1RHUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GJR B;  3R7B B;  2XYP B;  3GJQ B;  3IBC B;  1GFW B;  3R6G B;  4ZVP B;  2Y1L B;  2CNO B;  3EDQ B;  2CDR B;  2H5I B;  1RHR B;  3NS7 B;  2H51 B;  3GJS B;  1RE1 B;  4ZVS B;  1F9E B;  1RWP B;  2H65 B;  2C2K B;  2HBR B;  2H5J B;  2CJX B;  4ZVO B;  1BMQ B;  1RWX B;  1PYO B;  2HBQ B;  1RHQ B;  1I3O B;  2QLJ B;  1SC4 B;  2CNN B;  2C2Z B;  1RWN B;  3R5J B;  3D6M B;  3KJF B;  4LSZ B;  2P2C B;  2HBZ B;  3GJT B;  5K20 B;  3R7S B;  2C2M B;  1ICE B;  2H48 B;  2QL9 B;  3SIP B;  1NME B;  2C1E B;  2QLF B;  3D6H B;  1RHM B;  2DKO B;  3RJM B;  1SC1 B;  2C2O B;  1IBC B;  2QLB B;  4JB8 B;  2HBY B;  2XZT B;  4DCP B;  1PAU B;  2CNL B;  3P45 B;  4DCJ B;  2H54 B;  3R7N B;  4ZVR B;  1I51 B;  4ZVQ B;  2FQQ B;  1RWO B;  1RWV B;  2H4W B;  2XYH B;  2XZD B;  1RWW B;  2XYG B;  2QL5 B;  3QNW B;  1QDU B;  5IC4 B;  4DCO B;  3P4U B;  3IBF B;  1SC3 B;  2CNK B;  1RWK B;  1RHK B;  3KJN B;  3R6L B;  5IC6 B;  1RHJ B;  1RWM B;  2CJY B;  3KJQ B;  2H4Y B;  2QL7 B;  1QTN B;  3EDR B;  3D6F B;  2Y0B B;  4ZVU B;  4ZVT B;  1RHU B; 
#chains in the Genus database with same CATH topology
 4OIX A;  2O3D A;  3JTP A;  2CUY A;  1WG1 A;  4IH7 A;  3GYG A;  2Y1I A;  2OEJ A;  1YZ7 A;  2ASJ A;  3H59 A;  1HI1 A;  2YQ3 A;  4NEZ A;  2RML A;  2XCP A;  3TQE A;  1BC6 A;  3G86 A;  5KG6 A;  5KG1 A;  2HQ3 A;  4DV5 F;  3CC2 S;  2VQF F;  4BHQ A;  2OI2 A;  5J2Q B;  5BR8 F;  2ERR A;  5DS7 A;  2BJD A;  3I6P A;  5I4M A;  1HHT P;  4LF8 J;  2H9Z A;  2J7K A;  1XR5 A;  1T9W A;  1H0H B;  1DTT A;  4DR7 J;  2YQ0 A;  3AT1 B;  1HW8 A;  4NA3 A;  4ZVG A;  3TI0 A;  1UFL A;  4LT6 A;  4M63 A;  3ULH A;  3OL9 A;  3CJK B;  5BYR A;  1CJT B;  3UFC X;  1FWP A;  1REV A;  4DPO A;  2DRD A;  4IG0 B;  4F4K A;  4F4A A;  2HHT A;  4JI3 J;  1T9Y A;  1B0T A;  5D0E A;  3RRG A;  2G4B A;  1DTQ B;  3G9C A;  2K7K A;  2J0W A;  3WZ0 A;  2NRE A;  2PC6 A;  2MLY A;  1ACM B;  5ETR A;  3FQL A;  2BQR A;  1YLX A;  3BGL A;  4X4Q A;  2YBV A;  2NQP A;  1VBK A;  3NBP B;  3M8Z A;  2ZBQ A;  2OFH X;  1KTV A;  4OJ3 A;  1VFJ A;  2GV1 A;  1N5Y A;  2WRM A;  4K4X A;  3V2U C;  1BHN A;  3MD1 A;  2MZR A;  3TA1 A;  1GT8 A;  4ZLN A;  2E7W A;  1K0V A;  2JOQ A;  2IMO A;  1Q8K A;  3FSY A;  1FER A;  4K4Z A;  2AX0 A;  1Y9O A;  4LRE A;  4GKK J;  1N54 B;  3OFE A;  3EGZ A;  1U24 A;  1GX6 A;  3VGT A;  2HNY B;  4OX9 F;  2EFP A;  4DV7 J;  1XWL A;  3UDC A;  4M5J A;  1Q95 G;  1XR6 A;  3OTD A;  1LW2 A;  2AV5 A;  2GJI A;  5ITH A;  1G1X A;  4AL5 A;  2IC3 B;  3ISZ A;  2H5E A;  4CM0 A;  3VWS A;  3Q2T C;  3SCK E;  2HLT A;  1YBU A;  2DNZ A;  4CLW A;  4N8O A;  3TUP A;  4K2X A;  2YKN B;  3OUY B;  1PJ6 A;  2FGO A;  2MKY A;  1RAI B;  2CG8 A;  4DWI A;  2E5G A;  1LK7 A;  3EZU A;  1LOU A;  5BYQ A;  1URN A;  3THV A;  4B3O B;  2K3K A;  5E5N A;  3Q8Q B;  1YK9 A;  4A8Y A;  3OPK A;  3HFK A;  1FKO B;  2QA2 A;  3ITH A;  4DZD A;  3CPW R;  2UUW A;  4ZVR B;  1B3T A;  4RW7 B;  4WP3 A;  5A6P A;  2AWZ A;  4RX6 A;  3J7Y I;  1B64 A;  1NUE A;  4DL5 A;  1LNQ A;  5IC6 B;  1CEZ A;  4PXB A;  2LA6 A;  4C9D A;  1S99 A;  4OI6 A;  2OD4 A;  4PXD A;  1EX8 A;  5K14 B;  2OO4 A;  4LFB J;  3UDV A;  3M2R B;  3QSI A;  2OHD A;  1JB0 C;  2XG8 A;  2Z2Z A;  4DSE A;  2QIF A;  5DDP C;  3SCL E;  2L3M A;  3T3F A;  2EFV A;  1NK9 A;  1TKD A;  3HP6 A;  1SKU B;  4IFY A;  1EJ7 L;  4I67 A;  2K06 A;  2PT0 A;  5KT7 A;  3DXB A;  1WEZ A;  3POT A;  2F8E X;  5JXS A;  1L5U A;  5F3T A;  3R5B A;  4GKJ F;  3VGV A;  2MQ8 A;  4ZP9 A;  3KTQ A;  2BJ8 A;  3ZTP A;  5HI7 A;  1EET B;  5F0U A;  1NK0 A;  1H98 A;  3Q2S C;  2ZKT A;  3DI6 B;  3K58 A;  2F65 A;  4F3Q A;  3PDN A;  5C42 B;  2V2K A;  4B9M A;  1BXN A;  3GYN A;  1OSC A;  2PGC A;  5HAT A;  2RVJ A;  1JWW A;  1PBA A;  3T9Z A;  3NMR A;  4OYP A;  5A8W A;  5F9N A;  4FZV A;  4DU7 A;  1NH8 A;  1QTN B;  2C3U A;  4ZJL A;  2BEF A;  2R2R A;  4I0W A;  3DYA A;  3OR2 A;  4LF4 J;  2FHK A;  3QRQ A;  2EKN A;  1RT7 B;  1GH8 A;  1HD0 A;  3TZX A;  2XZW A;  3TW0 A;  5EGY A;  4P6Q A;  1TU0 B;  3TX0 A;  4YHH J;  3Q86 A;  3T1H J;  3ZC4 A;  1GMU A;  3NOC A;  4LIW A;  5HVG A;  5HVF A;  4LRB A;  3A8J A;  3DRS B;  4ENO A;  4OYB A;  2WB4 A;  3LF0 A;  4Y65 A;  1LW0 A;  2HS3 A;  3JSB A;  2DNP A;  1ZTW A;  1R8A A;  3R7S B;  3P6Y C;  4H4M B;  3GV7 B;  2JEG A;  4WK3 A;  1S7H A;  2BQ3 A;  1WHX A;  3CCT A;  2BE2 A;  1RTJ B;  1HMV B;  2JZ5 A;  3KUE A;  4UOH A;  1TK5 A;  2EBE A;  2V8V A;  3I0R A;  2QT7 A;  5ETS A;  1NRK A;  1FRL A;  2JFK A;  1DAR A;  3KLV A;  4ZJQ A;  3HVR A;  1RYR A;  4ZKA A;  3FGV A;  2G2Z A;  4YR2 A;  1FDD A;  3IN5 A;  3AD8 C;  4RUB A;  2XWY A;  1UVJ A;  1TL7 A;  2XO7 A;  2VDH A;  2XS2 A;  2XUL A;  1TKX A;  3C3L A;  4BC9 A;  1FXL A;  2ZOG A;  4C3L A;  1F9E B;  3R8Y A;  3MCM A;  4E0D A;  5IFM A;  2CJK A;  4DX8 H;  4LSL B;  2E1C A;  1R31 A;  2R7R A;  2V2Z A;  3SI8 A;  3V6H A;  4IQM A;  2ATL A;  3AA8 A;  2AP6 A;  4GC6 A;  4DFP A;  3NCQ A;  1DLO B;  3G82 A;  4NMX A;  4ZPC A;  3DGP A;  1JX4 A;  1JLE A;  2U1A A;  2V50 A;  1Z4U A;  1IXK A;  2XWX A;  2KO1 A;  4OJG A;  3BBC A;  5CYM A;  2M70 A;  4B3R J;  3K0J A;  1T03 A;  3O3L A;  2AX1 A;  2XMA A;  1MRO B;  4KV8 B;  4JYA F;  3I56 S;  2OH2 A;  1UP1 A;  5HJX A;  4TU8 A;  4ECW A;  2ZD1 A;  4EZ6 A;  2GIF A;  3H4B A;  2CPH A;  4UY8 5;  4QYR A;  1NZA A;  2XLK A;  3MDF A;  2AHO B;  4DUY F;  2V69 A;  3GJQ B;  3PY8 A;  1FRH A;  4HAC A;  4HVZ A;  2CDR B;  1D9F A;  1XJW B;  2L08 A;  2V9W A;  3ZZR A;  1KR4 A;  4RW4 A;  2KJW A;  3Q8Y A;  2ACY A;  2XM3 A;  5C24 B;  5HBM B;  1IJF B;  4I56 A;  5J2P B;  2IM0 A;  2QLW A;  1WHY A;  4K5S A;  3DRR A;  4MH8 A;  4J9S A;  1X4A A;  3WC2 A;  1FX4 A;  2ADB A;  2IYI A;  4DV2 F;  4NLX A;  4L6V 3;  4D3H A;  2H48 B;  1HNV A;  3T6B A;  3OFF A;  1FES A;  1IBL J;  1KWM A;  4URQ U;  1RU1 A;  2QYC A;  2AF6 A;  3N4W A;  4X4P A;  3S01 A;  1NK8 A;  2P6T A;  3TOQ A;  1M5O C;  2Q66 A;  1WI8 A;  3KLE B;  5K8O A;  3LPE A;  2B6A B;  2VBY A;  3TUZ C;  4DLG A;  4CLT A;  4NXN J;  1NPP A;  3GFX A;  3V4I A;  2CQD A;  3Q8R B;  2C22 A;  3NGK A;  1VJW A;  1LWX A;  2CWX A;  3R6L B;  2FGC A;  2C42 A;  3H5X A;  4Q8E A;  1S5Z A;  4DPX A;  3PO4 A;  4DLE A;  3IRX A;  1SC6 A;  2W2M P;  4DPT A;  2HK2 A;  3R2D J;  1KN6 A;  3E01 A;  1WAC A;  4K4U A;  2L41 A;  1J2V A;  1KQK A;  1AUD A;  4LF7 J;  3QJJ A;  3TUJ C;  4DR1 F;  5KFH A;  5D4O A;  3T6J A;  3C15 A;  2VV5 A;  3UE2 A;  3HM9 A;  4WZM A;  3PM9 A;  4U7U D;  1ZA2 B;  2LU2 A;  3OTB A;  2HVD A;  3CXC R;  3OL7 A;  5KFZ A;  1QSY A;  2NXJ A;  5C5J A;  3EVO A;  1IVZ A;  4EGL A;  3TAM A;  4DFM A;  2KZM A;  1X4F A;  4DSL A;  2E7V A;  2L9W A;  2D3O R;  2HNZ A;  1P8G A;  5IV4 A;  4A8S A;  1CJV B;  4OZ5 A;  4CLF A;  3F44 A;  1X4E A;  2QYG A;  4NYO A;  1LWE B;  2KVQ E;  3MAA A;  1NSQ A;  1OYD A;  4DDF A;  2LA4 A;  3EIC A;  2YWG A;  1NSP A;  4KPY A;  1NAQ A;  1N32 J;  1K47 A;  3FBF A;  5ETM A;  2CQC A;  5A8K B;  2QFJ A;  2Z0G A;  1B70 B;  4K59 A;  4B9T A;  5F8G A;  3AJ1 A;  4NEY A;  2BAC A;  1UAW A;  2XMV A;  5DJB A;  3RRK A;  1H6K X;  5KG7 A;  3IAS 9;  4B17 A;  4PG6 A;  2MQM A;  2EWH A;  5L1L A;  4ELU A;  2B9Y A;  1HPZ A;  1FKP A;  5JMN A;  3JSM A;  4FF3 A;  4DFK A;  3H5U A;  3MM7 B;  1Q7Y T;  3QWU A;  4ICL A;  1Y5L B;  3BQ2 A;  1RTD B;  1UFW A;  3FJ2 A;  4CNY A;  1RAJ A;  4ZMM A;  3MM9 B;  4HL9 A;  2GW8 A;  1Q53 A;  5LMU J;  3WX8 A;  1NPK A;  1VBZ A;  2OPQ B;  2C28 A;  2IRU A;  2AYG A;  4IH6 A;  1TKT B;  3L09 A;  3BH6 B;  2X1G A;  3N6M A;  5B0C A;  3TJA A;  2XEX A;  1DBD A;  4S0M A;  3CCQ S;  4KGX B;  1ZOT A;  1WHV A;  3A4T A;  1NHV A;  5AXK A;  5SUH A;  4FNH A;  4HDH A;  2W1B A;  3GCX P;  1RBA A;  2KDO A;  1HKA A;  5A76 A;  1TUV A;  2DNL A;  1KD1 T;  4N77 A;  3NAH A;  2PFF B;  4UZC A;  1AA1 B;  4DN0 A;  4K8R A;  2LCW A;  2F40 A;  1AW0 A;  1IJE B;  1S59 A;  5C25 A;  1UW9 A;  4ZP8 A;  2ZH2 A;  1SCJ B;  3VVT A;  1MN9 A;  1RAH B;  1VC5 A;  2Z57 B;  2BMB A;  2X1A A;  3Q23 A;  2DHS A;  3RW7 A;  1C1B A;  4GRS A;  1UA1 A;  1HHS A;  3MFI A;  4Y3C A;  2P2C B;  3QAE A;  2BE7 D;  3PJX A;  2VUG A;  1WD6 A;  2CDQ A;  3E8O A;  4G3I A;  3K2Y A;  4ZPW R;  5E3Q A;  3D7S B;  1GNK A;  1JLF A;  2VJU A;  2DTJ A;  5BYS A;  4YDD B;  3QT6 A;  1VHI A;  5AJ3 J;  1IQZ A;  2JC0 A;  1IKY A;  3HD2 A;  1R0B G;  2PI5 A;  3OT9 A;  2GS8 A;  4C8Z A;  2W25 A;  2BBE A;  5IV3 A;  3KMS A;  3PX4 A;  2E66 A;  3DC2 A;  5J1E B;  3VAI A;  2JX2 A;  4M5L A;  2MLZ A;  5MLC V;  3MAQ A;  3BB5 A;  4LFB F;  2RRB A;  2R8J A;  2UVU A;  1Q8L A;  5HVH A;  1MMD A;  2YPY A;  7FD1 A;  2BE9 B;  3QPI A;  4DX6 A;  2CQH A;  3EX7 B;  3R1H A;  1RWX B;  2DNR A;  1H38 A;  4I68 A;  1S12 A;  2ACM A;  3MM5 B;  4CT9 A;  1C0T A;  4LF6 J;  3FKB A;  1JLA B;  1S6Q B;  3TEG A;  3MMB B;  4WFA Q;  5DRK A;  2HND B;  2W4C A;  1IN0 A;  4O3O A;  5L8R C;  1F5A A;  2ASD A;  5SZT A;  4Y00 A;  1BQM B;  3GE9 A;  3MMC A;  1S97 A;  5C2G A;  4M5N A;  4PG5 A;  3PR5 B;  1YWX A;  1RT4 A;  1YGY A;  3P45 B;  2DJW A;  1HA1 A;  4HR2 A;  4U8Y A;  2F1F A;  2BOA A;  1OYE A;  4BWM A;  2PSZ A;  5HN0 A;  1KRP A;  5I3P A;  4LJM A;  4A8Q A;  1SV5 B;  2QMX A;  1N88 A;  3Q22 A;  1UWB B;  3IG1 A;  1H2V Z;  1U2R A;  5GAH U;  1S1U A;  3Q89 A;  7AT1 B;  3JTN A;  4FF1 A;  5F3Z A;  2AJ4 A;  4NI2 A;  2JJ4 D;  1WEL A;  3GR0 A;  3IGN A;  4JI1 J;  4BBY A;  1U49 A;  4P10 A;  4EBD A;  3QT8 A;  4IRD A;  4PQU B;  3G2X A;  1R89 A;  1TL1 B;  3D6M B;  3PIO Q;  2V4J A;  1XNR J;  2MY8 A;  1WKL A;  2FVP A;  1F5B A;  3T5K A;  1RT3 B;  1TQL A;  3BGR B;  3CSK A;  5EHH A;  5LSO A;  2HFU A;  3ZO7 A;  2KVI A;  5DGA A;  5ADZ A;  2VU5 A;  2NXN A;  2EG2 A;  1NDP A;  4KB7 A;  2WSF C;  3KHH A;  4Z7C A;  3FRZ A;  3BPD A;  1EAR A;  2KXH A;  1N6Q A;  2VFR A;  4CYU A;  4OL8 A;  2K3I A;  4UW2 A;  4NA2 A;  5EX3 A;  4PPZ A;  2RH3 A;  1JXL A;  1N52 B;  2FIU A;  4NLT A;  3KJV B;  2BJ3 A;  1MWZ A;  3R6G B;  2YWE A;  1WC5 A;  3UNG C;  3VVU A;  2ZJR Q;  4F8R A;  1IKV A;  1YRX A;  2MQQ A;  4CDI A;  4A8M P;  1U1K A;  2V68 A;  1RBO B;  4ZA1 A;  4LQ3 A;  3R5J B;  4IR9 A;  4EO6 A;  1UL3 A;  3PYD A;  4MIW A;  2DH7 A;  3V6D A;  3M05 A;  2YKM A;  3LGM A;  2MKS A;  2JEJ A;  2NXE A;  1OJ4 A;  1VIO A;  3BR8 A;  1SH3 A;  1F3V A;  4RR5 A;  2I6W A;  3W2W B;  3JSY A;  2UXD F;  1YJW S;  1U8W A;  2MGZ B;  1VBY A;  3PTW A;  4EZ9 A;  3SV3 A;  2NYI A;  1FFW B;  2GVD B;  3UN5 A;  3IMQ J;  1MW7 A;  4EYH B;  2XYH B;  2KTQ A;  2Q1L A;  2G1H A;  3C6T B;  2I2Y A;  2XSF A;  5T7L A;  3T5L A;  3RRH A;  4R0J A;  3DOK A;  1U2C A;  3AJ2 A;  3PJ9 A;  4DR6 F;  1AFJ A;  1LFP A;  2AJ0 A;  1T3O A;  2U2F A;  2H51 B;  3OJU A;  3N6N A;  4BC7 A;  4JI4 J;  2BUN A;  2EBG A;  5DLG A;  1FFS B;  1Y00 A;  3DOM B;  2H5J B;  2W8K A;  4ZVO B;  3S7R A;  2CJQ A;  1SL1 A;  4Q0B B;  4XIU A;  2EC2 A;  2RQC A;  4DFJ A;  4J9P A;  4P7V A;  4NLG A;  4RW8 A;  1V5I B;  2XHW A;  2VPX B;  3DU6 A;  2FHO B;  1EP4 A;  1FFG B;  1QAY A;  1HR0 J;  4JV1 A;  3M9O B;  2DKO B;  1RCO B;  4WPA A;  3IGV A;  3RYL A;  4ETZ A;  3MPW A;  1AUS L;  3J81 j;  2HK3 A;  3UPF A;  2FVQ A;  2W9C B;  1R0C B;  5HL7 Q;  3QT5 A;  2R7V A;  4J9V A;  2WTF A;  4U9R A;  2MQN A;  1U48 A;  4EUV A;  3L7P A;  1Y3J A;  1YVF A;  3M30 A;  3W5X A;  3SQG A;  2GHW A;  2MQL A;  1QVF R;  4WFX A;  1Y5I B;  4PZV A;  2UU9 F;  1RHU B;  2QTW A;  2ASY A;  3AOB A;  4R8U B;  1B0P A;  4JI7 F;  4K5R A;  2OFG X;  3W2V A;  2UUB J;  4JI5 J;  3VCD A;  1HNX F;  3NRB A;  4K0K F;  3MEE B;  1NJI T;  2EI5 A;  2GML A;  2XMJ A;  4ED8 A;  2DRA A;  3PW0 A;  1B7Y B;  4I64 A;  4N56 A;  1RGV A;  4IQX A;  3LP0 A;  1FEE A;  4DZ6 A;  1V6H A;  4QQB A;  3NL0 A;  4C6A A;  3P5B P;  1UW4 A;  3A3P B;  2Z30 B;  4IRC A;  3ISN C;  2VFU A;  1HNZ J;  1XNQ F;  2AEF A;  2MXY A;  2LQ5 A;  3UD5 A;  1NND A;  3DLE B;  1PCA A;  2QRR A;  1YJR A;  4JV0 A;  2YNG B;  1TL3 A;  2GAG C;  2GJF A;  2ZOF A;  2RIJ A;  3HHN B;  4KFB A;  4NLU A;  2NSB A;  3M9N B;  2LQ9 A;  4ZVQ B;  5ETQ A;  3MEG B;  4EFA C;  3I32 A;  4WYL A;  3BJY A;  2GAH C;  3RUB L;  3D3B J;  2LDY A;  4C3M A;  2W4P A;  5L9X A;  3BS9 A;  1JJ2 R;  2CNO B;  1U0H B;  1LV5 A;  3V6K A;  1NK6 A;  3JYT A;  4TYA A;  1WJ9 A;  4RBV A;  7FDR A;  3TAR A;  1RQ0 A;  5JJB A;  2G0C A;  3M8Q B;  4OYW A;  4OZ0 A;  4A8W A;  3M4X A;  4ZHR A;  1N8R T;  4ALZ A;  1KP6 A;  1RHQ B;  1TKZ B;  3SEO A;  1NLK L;  4EWT A;  1S1T B;  1VQM S;  2ZHA A;  1RXO B;  1IM4 A;  1RLC L;  1CJU B;  1PG5 B;  5D4N A;  5ETP A;  3HXM A;  4KJI A;  2C2O B;  1Y7P A;  1RI7 A;  4X2B A;  2HBY B;  5JUM A;  3LP1 A;  4UQT A;  4A8X A;  4TY8 A;  1KON A;  1SJF A;  2VFS A;  3MMA A;  4QIV A;  3KK3 A;  2H1Y A;  5D3G B;  2GQ2 A;  4LUB A;  1HQU B;  2KB2 A;  1FTC A;  3DDI A;  3MTK A;  4USV A;  3OR1 B;  4DR5 F;  3IBF B;  3OXF A;  3MUV P;  1ZH5 A;  2A10 A;  1R0A B;  2CJY B;  4QYZ J;  1SL2 A;  3JSR A;  5G0R B;  1CJK A;  1UVM A;  4CO4 A;  3PRV A;  2HIQ A;  4KIA A;  2DGV A;  2CPE A;  1F0X A;  4A47 A;  3N79 A;  3HPO A;  1SJQ A;  1NU4 A;  3JB9 k;  4QWA A;  4DSI A;  3HX9 A;  1R8C A;  1FDB A;  2OGU A;  2XMW A;  2HGL A;  4QJV A;  4DL6 A;  2QLJ B;  1E6V B;  5M2U A;  4ED3 A;  5IWA F;  5DG8 A;  2BAB A;  5I42 A;  2QSW A;  2P8I A;  4F4Z A;  5D77 A;  4PWD A;  3J81 U;  3DLK B;  1HFE L;  4O44 B;  2CQG A;  4ZPB A;  1R3N A;  2Q6B A;  3MR7 A;  3PZP A;  1IR2 A;  3JAM U;  2R2T A;  2FJV A;  2AD9 A;  2CYY A;  2YX7 A;  1Q5V A;  1ZZN A;  3T5H A;  3M1V B;  4I2Q A;  5L1K A;  2AYB A;  3F41 A;  1C4A A;  4J9U E;  1QSS A;  3FDS A;  2AW0 A;  3UW1 A;  2ZBR A;  1SKS A;  1G3O A;  4ECV A;  1VQ4 S;  3SSR A;  5A2Q U;  3SSS A;  4DV3 F;  2Z2L A;  4LF5 J;  3T1A A;  2FY1 A;  2PN6 A;  2EXU A;  4HYK A;  3QGH A;  4OYX A;  5KFF A;  4USI A;  1SUQ A;  4CTA A;  5GAG U;  4NRU A;  1X5O A;  1FXR A;  4R25 A;  2F4V F;  3TYT A;  2HHV A;  1RTH A;  2BW2 A;  3IXQ A;  3EVM A;  1KLN A;  3EWG A;  2K2P A;  3DRP B;  3H2L A;  2F4F A;  2A1B A;  2JFD A;  1YJ9 S;  4FP9 A;  2V8D A;  1G2E A;  2R7Q A;  5E2Q A;  3CNQ P;  4CI0 B;  4BWJ A;  4Y2K A;  1QUV A;  3O5T B;  1X4D A;  1NBE B;  2NCK L;  3CJT A;  1FI4 A;  3TA2 A;  1JNR B;  2WBM A;  4B3M J;  1KHW A;  3DOL B;  4NCA A;  4HT5 A;  2ZJQ Q;  2C2E A;  1U2F A;  1FKA F;  5GMK a;  3GCW P;  2G2O A;  3OTO F;  3HVA A;  4FYY B;  1HNI A;  2KZZ A;  4ZOS A;  1MWQ A;  4ZVT B;  3PKM A;  4RPF A;  2HAI A;  4ER8 A;  3MR6 A;  3CD0 A;  3QZ7 A;  3OXL A;  2WON A;  4F26 A;  3O8W A;  5KG5 A;  4WF9 Q;  4DL0 C;  1DTT B;  4PWW A;  2BJ7 A;  2JLE A;  4DSK A;  3KHR A;  1TZ0 A;  2I38 A;  3L95 X;  3CWJ A;  3V6J A;  4WU2 A;  3GV8 B;  3HD1 A;  1JLC B;  1REV B;  2ZZM A;  4ZK7 M;  3KDN A;  2BOP A;  4DPU A;  4TN2 A;  2JEI A;  2UXB F;  3MUR P;  1NCL A;  1RJJ A;  5E3R A;  4UQG A;  1Q5Y A;  4X4N A;  3ET6 B;  1S1W B;  1VQ8 S;  1FO1 A;  1YI2 S;  2KT3 A;  4DCP B;  2HHP A;  3UQS A;  4OQJ A;  3AOA A;  3MF5 A;  3JQJ A;  2FYX A;  3AB4 B;  2JLG A;  2M8H A;  1JK9 B;  1G4C A;  1VQN S;  4F4Y A;  4O23 A;  3W64 A;  3X3U A;  3K5L A;  4ED1 A;  1TUG B;  2KH9 A;  4H4K A;  1LK5 A;  5LMN J;  4FPR A;  4DR3 F;  3U1N A;  3C46 A;  1GMV A;  2BVZ A;  1HBM A;  5KFM A;  2D69 A;  2CKW A;  3UD3 P;  4U67 Q;  4A8K A;  4CQ1 A;  3A1Y G;  2A2D A;  2OAU A;  3HHL B;  3CME S;  4GO7 X;  2RJZ A;  2ZH9 A;  1JKH A;  4IRK A;  1UCN A;  1K73 T;  2V9K A;  2HZV A;  4FYD A;  3CJR A;  3DMJ A;  4OZJ A;  1LW2 B;  2R2S A;  2R7T A;  1O51 A;  3EE3 A;  1CUL A;  1WG4 A;  1RDR A;  1PJ5 A;  2Z2Y B;  3UO0 A;  3GR1 A;  2L9D A;  4JI6 J;  1T95 A;  3F0N A;  4A8O A;  2WVC A;  5GAH I;  5BJR A;  3U1M A;  3AJD A;  3KNA A;  4QIG A;  4LFC F;  4A46 A;  5L38 A;  1I94 F;  3IC1 A;  1DZ5 A;  2QL5 B;  4XPC A;  2OSQ A;  1SIW B;  3TVY A;  2BW7 A;  4CLS A;  3PAC A;  4ES1 A;  4GMK A;  3ILI A;  5J2Q A;  3GFZ A;  2O66 A;  1ZM3 A;  4C8O A;  3KG4 A;  3N28 A;  2LYV A;  2YNH B;  1JJC B;  4OV1 A;  2J0Q D;  4L3K A;  3G71 S;  1XMO F;  4DU8 A;  5GME A;  5LJ5 Y;  1Y3K A;  3MED A;  1GEH A;  3BGU A;  4QYZ K;  2QE5 A;  1E6Y A;  3CJK A;  5DQH A;  2CFX A;  3KJF B;  3J7Z 5;  5IT9 U;  2F9D A;  4KKO B;  2CQI A;  2DIU A;  3MM6 A;  3IM9 A;  1SJ1 A;  4N47 A;  5CYQ B;  1DTQ A;  3CJ4 A;  1S9F A;  2K1R B;  4ATN A;  4DR4 F;  4M5M A;  2W24 A;  2ZWO A;  4LRC A;  2CPJ A;  2QMW A;  4WE1 A;  4DL2 A;  3NBP A;  5I3U B;  4RNF A;  1D8Y A;  3R1L A;  4J5O A;  5THW A;  3TP2 A;  4OJ1 A;  1VC6 A;  2GMJ A;  2RU9 A;  4YQW A;  1M1H A;  1NXI A;  4USJ C;  3FBE A;  2IMW P;  3HFV A;  2ZBC A;  2UUB F;  1TK0 A;  4JI5 F;  2M9K A;  4IOC Q;  4EBC A;  3PYG A;  5DQI A;  4NE9 C;  4NLO A;  1WOR A;  4OYI A;  4CO2 A;  1J27 A;  2MKH A;  4B3S F;  1RK8 A;  2OLW A;  4R0E A;  1YKW A;  1L3K A;  1LFW A;  1RWN B;  3SXL A;  1JNZ B;  4DUZ F;  4KYZ A;  5AE2 A;  5A8W B;  1N34 F;  4L76 A;  2CAD A;  3DRX A;  1UEV A;  4MFB A;  4UOF A;  2ROE A;  4FPI A;  3SDE B;  1Y5N B;  4QW8 A;  3Q0A A;  3QYY A;  2B5J B;  2CQ4 A;  3DYA B;  2RS2 A;  2RF2 B;  3OR2 B;  4DV4 J;  2Z2M A;  2IC3 A;  5KFX A;  4YUD A;  4ERD A;  1S10 A;  3TEH B;  2J7W A;  4JI0 J;  3M9M B;  5L1J A;  1LWF B;  4U6P A;  4C0O C;  2E7X A;  4J9Q A;  5ETO A;  2D3O 1;  2UXC J;  4WYW A;  3OUY A;  3OVS A;  4PPD A;  3BN7 A;  3H8Y A;  4AT1 B;  1RT6 B;  5GAD U;  1S0N A;  2HHU A;  2N7Y A;  3BF4 A;  1TAU A;  1VIS A;  2CXE A;  4H54 A;  2A3J A;  1ZM9 A;  1FKO A;  4NLP A;  2XS7 A;  1RUS A;  4OJH A;  3ZNJ 1;  2E1P A;  2BE2 B;  2OPS B;  3H90 A;  1NPR A;  3AH6 A;  4YY3 J;  4F0H A;  4WKR A;  2HQG A;  2WVE A;  4DQQ A;  3BQ0 A;  2CQB A;  2E1A A;  4P9S A;  3D6H B;  2DIT A;  3EGN A;  2HVI A;  3RJM B;  2PEH A;  1VMB A;  4KY3 A;  1OIA A;  2RS8 A;  2J6S A;  3BDE A;  4B9S A;  3TZY A;  4DL3 A;  2FUG 9;  2NXC A;  4LBP A;  1N5T A;  2FVC A;  4WXW A;  2VQE J;  1U6Z A;  3MD3 A;  4QR2 A;  2ZBI A;  1JIH A;  1S9G B;  3H2V E;  4B9U A;  2AGP A;  2OJ3 A;  2X3G A;  1JMT A;  2DGO A;  4QCL A;  3HSD A;  3R7B B;  5D0H A;  1W25 A;  4F0K A;  2COL A;  3G82 B;  4OI3 A;  1BWE A;  3NS7 B;  1EET A;  3DGP B;  4OYZ A;  2CZV C;  3DLB A;  2W7A A;  4URG A;  4QU7 A;  1X4B A;  5C42 A;  4UY8 T;  2L9N A;  2VA3 A;  2DY9 A;  5CYM B;  1SB6 A;  1XK8 A;  2DGS A;  3G87 A;  3K5P A;  3HSG A;  1R7I A;  2ZZN A;  4IR1 A;  2OML A;  2R7S A;  1RAF B;  4QR1 A;  4RU2 A;  1PGZ A;  3M6W A;  1PAU B;  3MHY A;  3PR4 A;  5HMZ A;  1VIX A;  2RUS A;  3QFH A;  2YKQ A;  2AJ1 A;  1RT7 A;  1LWC B;  5B0F A;  3UDL A;  2BJ1 A;  1LXN A;  1M5K C;  3FEX B;  2FZK B;  3FVY A;  2YXL A;  2DNY A;  3GSD A;  1V9O A;  3E3X A;  1XR7 A;  1QD1 A;  3DDK A;  3I0S A;  3KHG A;  3DRR B;  3DRS A;  1CC8 A;  4FBT A;  3PEJ A;  2LFV A;  4LF5 F;  5K8P A;  4QU6 A;  2HZC A;  1GXT A;  4ES3 A;  1HNV B;  5L46 A;  2LU1 A;  5KFJ A;  2AU0 A;  3ZZY A;  1MU2 A;  3NAI A;  3RAQ A;  2HUR A;  3UCG A;  4X84 A;  4PAB A;  2M4M A;  3CD6 S;  4F50 A;  1RTJ A;  1D8Z A;  1HMV A;  5KOX A;  2E5L J;  4LBI A;  3MR5 A;  1M1G A;  1UEK A;  3HI9 A;  4USW A;  3PEH A;  1SJR A;  1VQ6 S;  3TQ1 A;  2RDJ A;  4OYA A;  1RHM B;  4Y2I A;  2BJ9 A;  2OD6 A;  2DPI A;  3IRX B;  4YR0 A;  4AND A;  1KVI A;  4TXS A;  6FDR A;  3JQK A;  1KVK A;  5HLF A;  2LQB A;  4XAK A;  2HRT A;  1TFY A;  1HIY A;  2F3J A;  4G1I A;  4YB1 P;  2KU7 A;  4HTJ A;  1U6B A;  3G6Y A;  3QJL A;  3C15 B;  4X62 F;  1KVJ A;  1PO6 A;  2H4Y B;  2P9C A;  4ZPV R;  3MEK A;  1BQX A;  5CA5 A;  1T94 A;  1B99 A;  4FKX A;  2QN6 B;  1DLO A;  1NJY A;  5DDQ C;  5F8M A;  4ZPD A;  3MCN A;  4KE5 A;  2KM8 C;  2OPP B;  4NLW A;  1APS A;  2FVS A;  2HAF A;  3DNC A;  4X66 F;  3T1Y J;  4DEZ A;  3ADA C;  2WW8 A;  4DSJ A;  3J81 Y;  2R42 A;  2CQ0 A;  1X9W A;  3BSO A;  4X4V A;  5KFA A;  1GXL A;  2DIV A;  3JAM Y;  1U47 A;  3GON A;  1MRO A;  2W2N P;  4KV8 A;  3IFE A;  2QA1 A;  2CNL B;  2ZUG A;  1MNE A;  3MEC B;  5A2Q Y;  2R8H A;  2PMZ D;  3KG0 A;  5DLF A;  3B4D A;  4LSN B;  4MIA A;  1HBO A;  4I4B A;  3NXZ A;  2LLZ A;  4KTQ A;  5GAG I;  4N76 A;  5J2P A;  5C7P A;  2DHX A;  1ROF A;  4TQR A;  2HVE A;  2KI2 A;  4WK1 A;  3I4P A;  3JSM B;  2GVZ B;  3IBC B;  3A8E A;  4Y34 A;  4ICL B;  4HT7 A;  3H20 A;  1WEY A;  5DQG A;  3NGS A;  2LXU A;  5LJ3 Y;  3KLI B;  3ONQ A;  3VV2 B;  3H5Y A;  4DG1 B;  1FNM A;  2M7S A;  2CJX B;  3CVK A;  4DR2 J;  2KFZ A;  3BV8 A;  4DPY A;  4P2M A;  3KLE A;  5B0B A;  2B6A A;  3RAM A;  2J7U A;  1FRX A;  2EEY A;  2OEK A;  1C0U B;  5B09 A;  3HFZ B;  4P72 A;  2E5J A;  4B3T F;  3LGH A;  5KG0 A;  1TV6 B;  3P5T L;  3VZI A;  4K4S A;  2X3D A;  2GO9 A;  1QJH A;  4RUC A;  4WCE Q;  1R27 B;  4MIB A;  3NEK A;  3WHI A;  1T9V A;  5J2M A;  3N01 A;  2FQQ B;  1SL0 A;  2DR7 A;  1CSJ A;  2CWK A;  2WBR A;  2Q6C A;  4JI2 F;  3RTV A;  1XER A;  3HK2 A;  1SXL A;  2HVH A;  2VDI A;  3IWX A;  2F5G A;  2DNQ A;  3HSJ A;  4JI8 F;  5EWE A;  1GAO A;  1TR0 A;  2G2Y A;  1YDL A;  2QGF B;  4N8N A;  1JLF B;  3MOZ A;  5HP1 B;  4AQY F;  4I6Y A;  4DN9 A;  5C2C A;  3NLC A;  5MAO A;  2AZ1 A;  3MI7 X;  2ZUA A;  2HFV A;  2EG1 A;  2VHG A;  3KWM A;  2UUA F;  4F4X A;  1FHT A;  5GAE U;  3W60 A;  3RGI A;  2HWH A;  1YJN S;  2C1E B;  3AY0 A;  1RB0 A;  3ZTR A;  3WIU A;  2NXU A;  1HYS A;  4UTG A;  3UN2 A;  5KFS A;  3M2V B;  4ZJO A;  5A8K A;  2XZT B;  2ADC A;  2RQ4 A;  5CCM A;  4G1Q A;  2LKZ A;  5DGB A;  4RUA A;  3PW5 A;  5AE1 A;  4LFA F;  2HS0 A;  4KH0 B;  3HKZ D;  5HO4 A;  3FZB A;  2KN4 A;  3ENV A;  1OWX A;  4KC5 A;  3MZI A;  1TL5 A;  1SBR A;  2XMU A;  4USM A;  4DL4 A;  1C0T B;  5F8J A;  3UN3 A;  1MLA A;  1ZAW A;  4CO0 A;  3RB6 A;  1Q82 T;  5IOL A;  1GFW B;  5J1P A;  5EX0 A;  2DHG A;  1FJG J;  3GTY X;  3MM7 A;  1RHR B;  2YKA A;  4Q45 A;  5HRO A;  2ROG A;  3DM2 A;  3MM9 A;  3NCP A;  1REG X;  4OYM A;  4YME A;  1RT4 B;  3A3O B;  2DH9 A;  3V5R A;  3RW6 A;  2HS4 A;  3C16 B;  3NS5 A;  1HNW J;  4KSE B;  1CS4 A;  5KG3 A;  2NZ4 A;  1VQ9 S;  3M8P B;  4NA1 A;  1H73 A;  1RLD A;  1HI8 A;  3MPV A;  2QLB B;  2GHV C;  1YJU A;  4ANE A;  4IFV B;  3K5O A;  1SVD A;  2HHQ A;  1XEZ A;  2XS5 A;  4NI2 B;  4Y2A A;  4Q44 A;  4GO5 X;  4DCO B;  4OHX A;  2RT3 A;  2R7X A;  2BRL A;  1OQ3 A;  4NXM J;  1RAB B;  4ANC A;  1XMQ J;  1FRI A;  4EEY A;  3M32 B;  4FF2 A;  3BM7 A;  3MM8 B;  3CE8 A;  5FDL A;  2JDJ A;  3CCR S;  3N6L A;  2ZH4 A;  4PRF A;  2YTC A;  2NUH A;  1PBU A;  5IT9 Y;  4Q43 A;  3FQK A;  1MMN A;  4G6V B;  2QLX A;  1QM9 A;  1RAD B;  2RRA A;  1X5T A;  4ZIV A;  3BQ1 A;  4K50 A;  1U09 A;  5E3A A;  5IXU A;  4LSZ B;  1VRU B;  2AZ3 A;  1N6Q B;  4P2X A;  3KLG B;  2NPF A;  1N36 J;  4CLK A;  2WW4 A;  1CPZ A;  5J1E A;  2V4R A;  2RQM A;  1WTB A;  2OEL A;  4LVO P;  3TJ9 A;  1JJH A;  4OMF G;  1S6U A;  3ENQ A;  3B54 A;  5B0D A;  2H54 B;  2KM8 B;  1RT5 B;  3R5C A;  4ELV A;  2GGP A;  2YX4 A;  2W01 A;  1VQK S;  1LEO A;  2WSE C;  4K4V A;  2OTJ S;  5D15 A;  4JV5 J;  2XO6 A;  2VZ9 A;  4USK A;  2AJQ A;  2UUC J;  1YRU A;  4WFB Q;  4ED4 A;  2D1C A;  4J90 A;  3MM5 A;  3PW7 A;  1S1V B;  1S6Q A;  1Y11 A;  3MMB A;  2M88 A;  2HND A;  2DXE A;  1YJT A;  4C11 B;  1GMW D;  1S49 A;  2ROP A;  4DV6 F;  8RUC A;  1BQM A;  3CJ0 A;  1GK8 A;  3L9Z A;  4DF8 A;  5CYJ A;  1PYO B;  3TAP A;  1NJX A;  4LRA A;  1FRM A;  3DU5 A;  3IAM 9;  2CQ1 A;  4EK2 A;  2PFD A;  4ZCK A;  4DV5 J;  1RU2 A;  1PAE X;  2VQF J;  5T7L B;  3GLJ A;  1SV5 A;  2RKI A;  2YH1 A;  5BR8 J;  4ECZ A;  3PW4 A;  3NWR A;  3AA9 A;  3DOK B;  2I5J A;  2MZ1 A;  3T5J A;  3QRP A;  4XPE A;  4Y28 C;  2MPU A;  1UVI A;  1U8S A;  3KJQ B;  3Q8P B;  1KQS R;  4PQU A;  1TL1 A;  1RT1 B;  1RWU A;  4CNZ A;  5IM0 B;  3W1Y C;  1MML A;  2WAQ D;  3DGV A;  3W8P A;  3NP5 A;  2BYC A;  3CC4 S;  3HVW A;  5IQQ A;  4P71 A;  2DCL A;  2D9P A;  2YNF A;  1RT3 A;  3MWB A;  3H25 A;  3PW2 A;  2C2K B;  2ATC B;  3D0H E;  2HQF A;  3NGR A;  2UV8 G;  5KFW A;  3O44 A;  2HBQ B;  2AKW B;  1G7C B;  1D0E A;  3HJV A;  3SYZ A;  3RB0 A;  1S48 A;  1WHW A;  2HBZ B;  1SQF A;  3PYE A;  2AMC B;  4ES2 A;  4ZN1 A;  4CWB A;  2DNO A;  2VAS A;  3SQG B;  4KO0 A;  3GQC A;  4OLP A;  3T9N A;  4Q8F A;  2LEP A;  1VQP S;  3TAQ A;  1DJ0 A;  4ID5 B;  3TO8 A;  3KJV A;  2IFX A;  3BKU A;  4O4G B;  3DHW C;  3GIJ A;  4V1A k;  1I51 B;  1YX2 A;  4OV6 A;  2PE8 A;  3UVJ B;  1YQH A;  3I31 A;  2HGN A;  2MB0 B;  2X51 A;  2PEB A;  5F8I A;  4YFU A;  1HLW A;  2VPY B;  1CQM A;  1RWK B;  2G0I A;  2F8H A;  4OX9 J;  1BY9 A;  2RU3 A;  1Q81 T;  4ZN3 A;  4RKU C;  1IBK F;  3KHL A;  1HW9 A;  4UOG A;  1X0F A;  1OQ6 A;  4PQA A;  4PKD B;  3QQC D;  1NK7 A;  4ZS6 A;  3ELH A;  5A8R B;  2JLF A;  2J6T A;  3W2W A;  2JNJ A;  4I1T A;  5KT6 A;  3CJQ A;  4R5P B;  5KFU A;  1TL3 B;  2MGZ A;  1WC4 A;  3ZZT A;  5IQ6 A;  4H4O B;  5CQG A;  5KFG A;  3THP A;  3SZ2 A;  2ZM6 F;  4DS4 A;  5L9N A;  3RAX A;  5KFN A;  1HBU A;  2ZIT A;  3U02 A;  3G8S A;  4IDK A;  3VAF A;  2DEJ A;  2ZC4 A;  2NLW A;  4DSF A;  1XN9 A;  1KLM B;  2GNK A;  3D66 A;  4C4W A;  3CDE A;  4I69 A;  2HEK A;  1Q16 B;  3JYT B;  1T9U A;  4YEA A;  2E1R A;  4OI2 A;  1HQE A;  3M8R A;  2J0X A;  1QDU B;  5A6W A;  1NK5 A;  3DOM A;  5FII A;  4C8L A;  2WB1 D;  2R9L A;  1F5C A;  3CJ8 A;  1NH7 A;  4Q0B A;  2DIS A;  4Z37 A;  3KYL A;  4AL6 A;  1PSD A;  4QWB A;  4O0N A;  2MKJ A;  2IRX A;  1WI6 A;  3EXY A;  1IBM J;  4NAS A;  4X65 F;  3H7H B;  1VGY A;  2Z56 B;  3LAK A;  2J8S A;  3SFG A;  1VK3 A;  3FEZ A;  2EFG A;  5KT2 A;  4ECU A;  3D4J A;  1XMB A;  3IWN C;  2B51 A;  4TY8 B;  1BMQ B;  2DXF A;  4JP8 A;  2Z4P A;  4EO8 A;  4LF9 J;  4WZQ A;  3BR9 A;  3MMJ A;  2BKN A;  2GZO A;  1URR A;  5L1I A;  1B7F A;  2KRR A;  2PMH A;  3FBB A;  4ZVE A;  1RAE B;  2HQD A;  2BM1 A;  4F0M A;  2MHE A;  1CJK B;  4GKJ J;  4RL1 A;  5FLX U;  4OI0 A;  4Q2M A;  1J5E F;  2C3P A;  2BDP A;  4R8U A;  4MAK A;  4Z7Y A;  4RNM A;  3CCU S;  2VG7 A;  1KOO A;  5K9F A;  2WVB A;  4X4O A;  1S6P B;  4F3O A;  1RHJ B;  5HQ8 A;  2E1M C;  4NLY A;  4DHV A;  4O3N A;  1FVQ A;  2LEB A;  2YWF A;  3VQS A;  3FCH A;  1JJ4 A;  1ZM2 A;  2HZA A;  2RSQ A;  3B8H A;  2DR6 A;  4PWD B;  3UR3 C;  1RAC B;  1WC6 A;  3BSC A;  2POK A;  2ZVS A;  4PXC A;  2RQK A;  2DGU A;  4LF8 F;  1GMW A;  2A0F B;  4WII A;  5ETK A;  3W8G A;  3BBF A;  1BWV A;  4BDP A;  2IIH A;  1KSP A;  4DR7 F;  3EUN A;  1YJV A;  4I2Q B;  5B08 A;  3MEG A;  4U95 A;  3RBD A;  4FDF A;  1OSD A;  2CPI A;  3DLJ A;  1UVL A;  1IQT A;  2PI4 A;  4G65 A;  1B0V A;  1U4B A;  3RB3 A;  3F56 A;  1UTA A;  1FJ7 A;  1C1C B;  3A8K A;  4YS2 A;  4HH1 A;  1H7W A;  1VRT B;  1NJZ A;  4JI3 F;  2OIH A;  5KG4 A;  3A3N B;  2IDL A;  3HHL D;  2PO4 A;  5B0A A;  2ZZT A;  5CAB A;  2P9E A;  2ZNY A;  2J76 E;  4NZ7 A;  2IA0 A;  1BQN B;  5J2N A;  2H3E B;  1VR6 A;  1S72 S;  2W2Q P;  2YQ1 A;  3BH7 B;  1TKZ A;  2B7B B;  4FXD A;  4WKY A;  3CCV S;  3IS9 B;  3GJR B;  2PII A;  3IR7 B;  2HVZ A;  3CCM S;  4BLG A;  1CJU A;  1Z2L A;  5F41 A;  1DY3 A;  3PHE A;  1Y10 A;  3B4M A;  1DUR A;  3ZZO A;  4RU9 A;  4XDD A;  1SIZ A;  5DZ7 A;  4YB6 A;  4F67 A;  4U96 A;  3J80 U;  2GQQ A;  1CBK A;  4NCG B;  4EU0 A;  3IWL A;  2ZH1 A;  5D3G A;  1CLF A;  3MCS A;  1HQU A;  4GKK F;  3PXG a;  2EFN A;  3OR1 A;  4N5S A;  1X5P A;  3H0P A;  3IM8 A;  4M5K A;  2DPJ A;  4LBH A;  2IAJ B;  4DV7 F;  1XTZ A;  1X31 C;  1UVN A;  4FBU A;  3P8B B;  3C14 B;  4ECT A;  3R5D A;  3DLH A;  3QZ8 A;  2Y0S D;  3LOU A;  2IVY A;  1XIQ A;  1VS3 A;  2LXI A;  1I5O B;  4XK8 C;  1E6V A;  1WDD A;  2X7I A;  4GVL A;  5B7W A;  2YY3 A;  3NS6 A;  4L74 A;  4JYA J;  1WC3 A;  5GAE I;  3IBW A;  2ALZ A;  3GJS B;  1U1R A;  2Q43 A;  1F9H A;  4DUY J;  1FVS A;  2F63 A;  3T19 A;  4RNO A;  4NLQ A;  2DGW A;  1T9T A;  3T41 A;  2CZ9 A;  2R8G A;  2IRY A;  1X9S A;  3D1O A;  2CNN B;  4UF4 A;  3ETO A;  3F73 A;  3CD5 A;  4CO1 A;  2BV3 A;  2CVE A;  1GXU A;  5H9F J;  2YH0 A;  3M1V A;  3FFI A;  4JUZ A;  5KFR A;  4LR7 A;  1AZS A;  1S7I A;  4IG3 A;  1TP7 A;  1FDN A;  4DV2 J;  3OD2 A;  2YWW A;  1N36 F;  1T11 A;  2FJA B;  4Z2X A;  1PC4 A;  4G1P A;  3ILO A;  3MPD A;  4FYW B;  4TVA B;  4WIQ A;  4KR0 B;  4DCJ B;  2CIM A;  4W92 B;  2XMT A;  2R7O A;  1ZAX A;  3VAJ A;  1YG0 A;  3H42 A;  2IJF A;  4CM2 A;  1PYS B;  1YBA A;  2G1D A;  3W65 A;  2ZH6 A;  2BAN B;  3PO5 A;  2B4V A;  3LTO A;  1JKH B;  3DRP A;  3MFH A;  2FC8 A;  4ED2 A;  4QOT A;  3V81 A;  4OZ3 A;  3SBM A;  5DM6 Q;  2I0X A;  3OLA A;  1OS5 A;  2AGQ A;  3BRE A;  2DNN A;  2W7O A;  2QEX S;  3D1H A;  5DG9 A;  4A8F A;  5BXI A;  5CCL A;  2DB1 A;  3GFH A;  2VG6 A;  3VGS A;  3PX0 A;  1M90 T;  4DR1 J;  2A6M A;  3DOL A;  3L7O A;  3W5Y A;  2ZWP A;  1IR0 A;  3KK1 B;  4NOH A;  1T8E A;  3QGI A;  3JXO A;  3UCU P;  1NJW A;  1KS2 A;  2ZBP A;  3M8S A;  1OPI A;  2ZHB A;  2CPF A;  2BJE A;  5HQM A;  4TQS A;  2VON A;  4OX6 A;  3J7Z T;  2BX6 A;  3WX4 A;  3MED B;  6FD1 A;  4LF4 F;  4W90 B;  3X1L B;  1E6Y B;  1VRQ C;  1KHV A;  2ZDO A;  1T05 B;  2DR8 A;  3P96 A;  2HRU A;  2KKH A;  1JLC A;  1FK9 B;  3RR8 A;  2FD2 A;  4YHH F;  2Y3Y A;  3T1H F;  2Y1L B;  3SQO P;  1IKX A;  3KLH B;  1HQ2 A;  4P74 A;  3MM6 B;  3I87 A;  1WNE A;  2DNG A;  1WC0 A;  2KYX A;  3EVW A;  3ET6 A;  1S1W A;  1Y0H A;  1U1M A;  4HHJ A;  1WDT A;  1S9E A;  2B56 A;  3CCW A;  1U25 A;  5T14 A;  2JVO A;  1RKJ A;  4DQI A;  1L3U A;  4YB5 A;  3H40 A;  3DHX A;  1PIL A;  1VJQ A;  3QWP A;  1EKS A;  4WE1 B;  2KFY A;  3RG6 A;  4M5I A;  3R27 A;  4OLO A;  1RAG B;  4O3R A;  2MYF A;  1QAI A;  2B4P A;  2B3T B;  1UPM B;  2QMU B;  1ZET A;  1IBC B;  4X4S A;  3FMB A;  4KAI A;  2VJV A;  1D09 B;  5F9L A;  4EMD A;  2IBO A;  2F7V A;  3QFW A;  3AHP A;  4RLE A;  4USU A;  2XY7 A;  4UUW A;  1RIS A;  2LMI A;  1DQ8 A;  2MEW A;  1N33 J;  2CQ2 A;  4RW9 B;  1PKU A;  2ZKU A;  4I2P B;  3HHL A;  4KHR A;  1M5H A;  3LO3 A;  1T9X A;  2FLN A;  2MQP A;  4RO0 A;  5EWG A;  3LWM A;  1UJ4 A;  2MQO A;  1IKW B;  1P6T A;  2GMH A;  3EMT A;  4MFB B;  1UET A;  5IZH A;  3HVT A;  4C97 A;  2I9S A;  1JLQ B;  1R6V A;  4MKV A;  1IM6 A;  3G8T A;  2IVM A;  3MPY A;  1QY7 A;  3MGJ A;  2N3L A;  4EBE A;  4M5G A;  4LR8 A;  1MN7 A;  5D4P A;  3CW2 C;  4CLL A;  3UR0 A;  4HI1 A;  2ALY B;  4UT4 A;  3BGF A;  2Y9H A;  3KLF A;  4PXE A;  5EWF A;  1F2H A;  3FEY B;  2IDE A;  2DGX A;  3M2U B;  2R4F A;  1S1X B;  4UST A;  2FHJ D;  3QIP B;  2ZDP A;  4RBT A;  4B3R F;  1RYS A;  3ENW A;  1ZZF A;  2J9C A;  3TRG A;  1X0P A;  3Q83 A;  1QUP A;  2DK2 A;  2W7P A;  1ZTT A;  1NZ8 A;  3HSZ A;  2YNH A;  1KNZ A;  2XZD B;  2JSX A;  3TZZ A;  3P4U B;  5EUH A;  4J9K A;  2RDI A;  5ETN A;  2MHN A;  2MKK A;  2HHH J;  4B9L A;  2FZC B;  2YNI B;  1WF2 A;  1IR1 A;  2BR0 A;  2HHX A;  2P9G A;  3K8V A;  1S77 D;  4KKO A;  1IBM F;  2GJ2 A;  4KQZ A;  1RAO A;  2ZNZ A;  5CYQ A;  1V3Z A;  3BYR A;  3NGU A;  2K1R A;  1IBL F;  2XY6 A;  2ZHO A;  3QLH A;  3NCR A;  3VZH A;  4LF9 F;  3I96 A;  2FDN A;  2R7W A;  4ECY A;  4FVC A;  4RWW A;  4QR0 A;  1RT2 B;  2R8K A;  2C3O A;  4I7F B;  5I3U A;  2VPW B;  4M1K A;  4ZCI A;  2QC3 A;  4CZC A;  4DBQ A;  4NXN F;  2OEM A;  2ZEJ A;  3AB2 B;  5CAA A;  3QO9 B;  2RHQ B;  4LRD A;  2DH8 A;  4C8Y A;  2BKO A;  1NKC A;  3OVA A;  2C2N A;  1RBL A;  1FE4 A;  5H9F K;  3VAG A;  3LP2 A;  1ZBT A;  4AL7 A;  2Y1R I;  1SC3 B;  4ED5 A;  1AFI A;  3OSN A;  1RA6 A;  3UI3 A;  2N3O A;  3FCW A;  3C6U B;  4LF7 F;  2VFT A;  4AD6 A;  2NZC A;  3UCZ P;  2OP5 A;  5KG2 A;  5J1N A;  1P9Q C;  3CF5 Q;  3SDE A;  3CUL A;  2B5J A;  1J5O B;  2RF2 A;  2KG1 A;  2YKO A;  1S0O A;  1U7L A;  3GB0 A;  3BO3 A;  2CPX A;  1KEK A;  5A0Y B;  2DBB A;  3QGG A;  5EN1 A;  1C2P A;  3K57 A;  4L73 A;  4OHW A;  1LWF A;  3O6Q A;  3I0S B;  4AYB D;  4YN3 B;  5HAO A;  4JB8 B;  3NY0 A;  4OZ2 A;  1JLB A;  2N7C A;  3TAN A;  3OXG A;  3EPI A;  4F04 B;  1VQ5 S;  1U6F A;  1DRZ A;  4BS2 A;  1PIE A;  1RT6 A;  2OPR B;  4O3S A;  4P2F A;  1N32 F;  2HLU A;  2RDD A;  1MU2 B;  4IO1 A;  3SFU A;  3W7B A;  1QE1 B;  3ZNU A;  3SV4 A;  3HCX A;  1RHK B;  1RTI B;  4NLR A;  3A8I A;  2OPS A;  1VC0 A;  1O0P A;  3VAK A;  2C3Y A;  4WP8 A;  1QTM A;  3US5 A;  3GPA A;  2GHP A;  3GIR A;  2HGM A;  4X64 J;  4U7U K;  3NNC A;  3NNA A;  2WOM A;  3OTC A;  2O5D A;  3KDO A;  1K44 A;  1KFS A;  2GC8 A;  3ZXW A;  5DG7 A;  5HLF B;  4URS A;  3KNG A;  4M5D B;  4X4U A;  5FLX Y;  2XNQ A;  1S6O A;  3NWG A;  4PYA A;  5LMU F;  1S9G A;  4TU7 A;  1PC5 A;  2HSE B;  4E98 A;  3N5F A;  1DQ9 A;  4L3N A;  2EK1 A;  1UWA A;  3OW2 R;  3K89 A;  2UV8 A;  3KK2 B;  2AJF E;  1HWK A;  1FJC A;  1D1U A;  2UXD J;  2XI3 A;  4L75 A;  4ZDN A;  5KOW A;  4FKY A;  3BBB A;  4ETX A;  4CLU A;  1RWM B;  2AEJ A;  1D3W A;  2JWN A;  3R2C J;  2HMI A;  1TVR B;  1UZH A;  4ZLP A;  3RR7 A;  2O01 C;  2DD8 S;  4OX7 A;  5LL6 d;  2CQ3 A;  2VA2 A;  1R6Y A;  4B02 A;  2LEA A;  2CJ9 A;  4AFF A;  1WOS A;  1X4C A;  2MY7 A;  3D0G E;  2B43 A;  3QSY B;  5KFL A;  4DR6 J;  1L3S A;  1UMJ A;  3Q8S B;  1S79 A;  2N82 B;  2MZT A;  4QW9 A;  1VQL S;  2E9T A;  4MYT A;  3P49 B;  1LWC A;  2K8G A;  3OL6 A;  1HBO B;  2VKZ G;  5AJ3 F;  2ZE2 B;  5M2R A;  1OY9 A;  4LMZ A;  1W26 A;  4ED7 A;  3LW5 C;  1X5S A;  4RW6 A;  4C98 A;  2QSF A;  1R8H A;  4PUO A;  4DJB A;  5T41 A;  1GTE A;  5LSR A;  3AD7 C;  3MUT P;  2FHJ A;  2UUT A;  2EC0 A;  3O2I A;  2CJB A;  1WOP A;  4O4R A;  2EFO A;  4CLY A;  2HYI B;  4GVB B;  3R5G A;  3P3D A;  3VAH A;  1V3S A;  3EXC X;  1KBR A;  2KT5 A;  3RZA A;  2W9B B;  3J80 Y;  1O8B A;  2CG4 A;  1VDH A;  2UU9 J;  4LF6 F;  1RWP B;  2VG5 B;  2J9E A;  4JI7 J;  3AFG A;  1S0V A;  1TFW A;  2WVD A;  1HI0 P;  1ZA1 B;  1HNX J;  1JLG B;  4K0K J;  5RUB A;  2K7J A;  5J2M B;  5LXR A;  2MKI A;  3J7A 1;  4QBU A;  3QJP A;  3W61 A;  3QAU A;  2QLF B;  2DGT A;  2AYE A;  2V8G A;  4TNO A;  2X1F A;  3DLG A;  3C2P A;  2JH3 A;  4IUF A;  3EJM A;  4X4T A;  3Q8U A;  3OL8 A;  4OX8 A;  1IWA A;  2VD3 A;  1XNQ J;  2V34 A;  2E44 A;  3LGN A;  4QWD A;  4O0I A;  5KFE A;  1XBW A;  2MZS A;  4ZVF A;  2GFF A;  1I6J A;  4QWC A;  2FB0 A;  2LVW A;  1HWU A;  1SI9 A;  3Q8V A;  2OPP A;  4ECR A;  2LQ8 A;  3THT A;  2VOP A;  3G4S S;  1FDA A;  3FNN A;  2FTR A;  1FRJ A;  4JI1 F;  2KHD A;  4LIR A;  4LF1 A;  2PA8 D;  5LOQ A;  4W4M A;  1UFK A;  2RRN A;  1FRK A;  1GQE A;  2DHA A;  2OKQ A;  4NYZ A;  3PNI A;  5HSP A;  1HYS B;  2AJ2 A;  1I1G A;  2JRS A;  2RAQ A;  3AAW B;  1XNR F;  1NEE A;  5LM7 E;  2XSJ A;  3MEC A;  4G1Q B;  2XMM A;  3KFW X;  1H7X A;  3BEG B;  4FYX B;  3D9B A;  2QV6 A;  3BN4 A;  5KT4 A;  3TNV A;  4M95 A;  4LSN A;  3C66 A;  4MTP A;  4Q5V A;  1L3V A;  3OJS A;  6AT1 B;  1KDN A;  1UJ5 A;  4CRJ A;  4NZ0 A;  1NKE A;  2CQP A;  1HBN A;  1N5Y B;  2DEI A;  2GVZ A;  1UJ6 A;  3BO4 A;  2H4W B;  5HRO B;  3RBE A;  4WFN Q;  3DM2 B;  2E29 A;  1QVG R;  2O67 A;  3KLI A;  3AQO A;  4DG1 A;  5K5M A;  2HQC A;  2VH7 A;  1N33 F;  2JVR A;  1ITP A;  3DFE A;  4DR5 J;  4QIE A;  1CS4 B;  1C0U A;  4DQS A;  1TL4 A;  1RE1 B;  1F1B B;  4J7C A;  1TV6 A;  1OY6 A;  4PR6 A;  2LEC A;  1P27 B;  4J9N A;  1Q79 A;  1FF2 A;  3LAM A;  1K0T A;  9ATC B;  4E2F B;  2G9O A;  4TU9 A;  1U1O A;  1YTY A;  1DQA A;  3CCS S;  1N0V C;  5F8L A;  2FLO A;  1NDC A;  1F6T A;  4LRF A;  3HHK A;  4OZ1 A;  4E8U A;  1VCT A;  2DY1 A;  3PVX A;  1H3D A;  5E41 A;  4ECS A;  5IWA J;  3OTE A;  3U1L A;  3BKF A;  3UNY A;  3M6U A;  4OYO A;  3ZTS A;  5FDL B;  1K1S A;  5E3P A;  2GQC A;  1Q0N A;  4XDC A;  2E5H A;  2W9A A;  2B9E A;  2E9Z A;  5HP1 A;  3S8S A;  2IM1 A;  4HI2 A;  1YIJ S;  2E9R X;  3MPU B;  2B8P A;  9RUB A;  2IJN A;  3ITH B;  2HHH F;  2Y8W A;  4JI4 F;  5KT3 A;  3NNH A;  4HKQ A;  1NSA A;  4ZVP B;  1CJT A;  3EDQ B;  4DV1 J;  5DM7 Q;  4DV3 J;  4F2R A;  3WIV A;  4W98 A;  3ZZP A;  4IG0 A;  3RU0 A;  2J8A A;  4QIW D;  3R3T A;  3CUN A;  2HWT A;  3M2V A;  4C0H A;  3WDO A;  4OHZ A;  4ZIT A;  3VGU A;  1HR0 F;  1N0U A;  2VC0 A;  2M2B A;  1U0S A;  1K8A T;  1CVJ A;  1RP5 A;  2C2Z B;  2GGP B;  3TZW A;  2A18 A;  2F4V J;  2J0S D;  2XLJ A;  4LF2 A;  3S1T A;  2XCA A;  5K8M A;  3CCE S;  3KUH A;  3I4H X;  3N5B A;  1SJ3 P;  1W2I A;  4J37 A;  1FTR A;  3TUI C;  4IFY B;  3OBI A;  4P73 A;  1FA0 A;  3IO1 A;  3EGV A;  4I6W A;  3O1L A;  1MWY A;  4KH1 B;  2MZQ A;  3POT B;  1FWL A;  1UVK A;  3EZO A;  3DRY A;  1EIY B;  4ZCM A;  3R5A A;  3PFO A;  3I5A A;  1ZYQ A;  3HZG A;  2CZ4 A;  2DO4 A;  1T3N A;  4IOB A;  3PHT A;  3NMA A;  2V8P A;  4Y6I A;  3C16 A;  2XTJ P;  1H74 A;  3OTO J;  4DUT A;  3M8W A;  4RUH A;  4NZ6 A;  3W9H A;  2HNY A;  3M8P A;  2DRB A;  4NLD A;  4CT8 A;  2RKI B;  3R9L A;  2RE1 A;  5CH7 B;  3VF0 B;  5B0G A;  4IFV A;  3CDA A;  5F8N A;  1HNZ F;  1KQG B;  4NLS A;  2CRL A;  4IKA A;  2I5J B;  3E51 A;  1PYT A;  1HHQ A;  4LVN P;  3GWC A;  3FC9 A;  3D1Q A;  4KHP J;  2HIY A;  1TEL A;  3M32 A;  4FF4 A;  4DMZ A;  3MM8 A;  2UXB J;  2BZ2 A;  2YKN A;  1Q7L B;  3H4D A;  5KFK A;  2FJB B;  1LW0 B;  3QGP A;  2RNE A;  2YNF B;  4ZCL A;  3I5C A;  1TTH B;  4EYI B;  4B3O A;  3CJ2 A;  3AQP A;  1Y4Z B;  1MG7 A;  1X8D A;  3CJ3 A;  2C2M B;  1O6X A;  4FVM A;  1EQ0 A;  4WU3 A;  3HKW A;  3FSX A;  4DI6 A;  2LQJ A;  1VRU A;  3I0R B;  1NHU A;  4KO0 B;  1JQG A;  3I55 S;  4RW7 A;  3KLG A;  2NR0 A;  4X64 F;  4DR3 J;  2JL9 A;  1C4C A;  4PG4 A;  1D9D A;  3ZZU A;  2LP4 A;  3CJ5 A;  5K14 A;  1TL7 B;  1RT5 A;  1R43 A;  3W9I A;  4HH0 A;  3GIL A;  3GG1 A;  1P1T A;  2B0G A;  1WKJ A;  2I1R A;  3M2R A;  1FEH A;  2YPZ A;  1ICE B;  1EHW A;  5H9E J;  1TKX B;  3MAH A;  2NSC A;  5ETV A;  1CC7 A;  3OLB A;  4C3K A;  4ELT A;  2BKP A;  3DLL Q;  4C2M A;  1S1V A;  2DT9 A;  3FUY A;  2IYG A;  2O1P A;  3GIK A;  5HQL A;  4C11 A;  2UVR A;  2AYM A;  2ZH7 A;  1QSL A;  2M5Y A;  3PYF A;  2DYA A;  2WHO A;  1JLE B;  1S0M A;  3DI6 A;  2XNR A;  4LFC J;  2YKP A;  1I94 J;  1A7G E;  1U1P A;  5HK4 A;  3D3C J;  1HBU B;  2IM2 A;  2OMO A;  4IDK B;  3UWT A;  3M6X A;  2B4O A;  4JV2 A;  1VQ7 S;  1NB7 A;  1ULR A;  2FLL A;  1T03 B;  3JQM A;  4OI1 A;  2ZD1 B;  4NLV A;  3D68 A;  3CCZ A;  1FX2 A;  1I3O B;  2AT1 B;  1XMO J;  1SC4 B;  1R8B A;  3SCJ E;  3GSI A;  1YBT A;  5HMX A;  1HQE B;  2XLI A;  4HAC B;  1H2T Z;  4RW4 B;  1Q78 A;  3M7V A;  3LH2 S;  4N7T A;  1RT1 A;  5IM0 A;  2JC1 A;  1TMJ A;  2VC1 A;  2D3U A;  5GMD A;  2FJE B;  2DNH A;  1YIT S;  2D7S A;  5DO2 A;  4H4M A;  4PYD A;  2QA4 G;  4ED6 A;  4DR4 J;  2AGO A;  3DKD A;  2L48 A;  2M52 A;  1TAQ A;  3GII A;  3LQV A;  3GFY A;  3TX8 A;  1K9M T;  2ZH8 A;  4NML A;  4MK8 A;  1KQF B;  3K17 A;  5D0R A;  3TJ8 A;  3WBZ A;  3V4I B;  5AXM A;  3G6V A;  1M0S A;  2KL8 A;  2A6O A;  2M3D A;  5E0O A;  1A0O B;  2P5V A;  2VOO A;  2HHS A;  3KOA A;  4ID5 A;  2C2D A;  1OPZ A;  2VG7 B;  4O4G A;  2G0J A;  1Q8I A;  4B3S J;  1ZM4 A;  3E01 B;  5L39 A;  1RZM A;  3UVJ A;  1U45 A;  2ZC3 A;  3CC7 S;  3HT0 A;  2JEF A;  2V67 A;  1RAA B;  2V94 A;  3MUM P;  4B3M F;  3PKY A;  4DUZ J;  4LSL A;  2CA9 A;  2R3V A;  2FPH X;  3HHD A;  3W62 A;  2NPI A;  3ZFV A;  1WKK A;  4HDG A;  1N34 J;  1CG2 A;  1QAJ A;  4MK9 A;  1NHK L;  3W5Z A;  1ARO P;  3CIZ A;  2MTL A;  2JHE A;  5A8R A;  3TAM B;  3H5S A;  4R5P A;  2XC9 A;  1U26 A;  4IYQ A;  1VLY A;  4DXL A;  2HNZ B;  4ILL A;  3PJW A;  4H4O A;  5K8N A;  3CDU A;  1S76 D;  2XYP B;  3KMQ A;  4MMO A;  3K8W A;  3HHL C;  3QAT A;  2LDI A;  3CD7 A;  4D3G A;  2DXD A;  3MAA B;  2C2R A;  1R8P A;  4YOE A;  4TLR A;  2GIQ A;  1HWJ A;  2VBX A;  2FJX A;  5AXL A;  1EB0 A;  1KLM A;  3LA0 A;  3D67 A;  3DCA A;  1Q86 T;  5B0E A;  4M5H A;  2MMY A;  2QL9 B;  3D5M A;  3VR1 A;  5KAK A;  2AQ4 A;  5J2N B;  1W2B R;  1YRT A;  1QLN A;  4WFY A;  3ZZ0 A;  4ZPT R;  3HJF A;  5KFO A;  5C24 A;  1TMM A;  2Q3P A;  5HBM A;  1TUW A;  4QIF A;  2E5I A;  3OFG A;  1HPZ B;  1FWK A;  1N4L A;  4OZL A;  1FKP B;  1UPP A;  1EQM A;  4DL7 A;  5LMN F;  5LSL A;  1K1Q A;  1M5P C;  1A9N B;  2ZFH A;  5F0W A;  2VOD A;  1RSC A;  1N5Q A;  3LAN A;  2IA6 A;  4RJV A;  2RUG A;  3ENA A;  4FN5 A;  3BSA A;  2XMK A;  4ED0 A;  3B82 A;  3OHA A;  4Q7A A;  4QWE A;  2EK6 A;  1BD6 A;  2HWI A;  2QX0 A;  2BA9 A;  2B9X A;  4K4Y A;  1NO8 A;  4WXO A;  4AXI A;  2RB7 A;  4K7Q A;  1WSV A;  4JI6 F;  1ELO A;  2HPU A;  1S6P A;  4PWU A;  3AXM A;  1RKI A;  5HMY A;  3KUG A;  5C25 B;  1AB8 A;  4QZV B;  4J9O A;  3H98 A;  3CTR A;  3MXH P;  1DAX A;  4HTI A;  1C1B B;  3OQ2 A;  3ILL A;  2KJV A;  4LR9 A;  1KTQ A;  4AUK A;  5H9E K;  1FNO A;  4ECX A;  4O3P A;  2UVW A;  2FVR A;  4CLP A;  4OHY A;  1U1N A;  4MKY A;  1Z1Z A;  5H1S V;  4F7V A;  1CJV A;  5IT4 A;  1WF1 A;  3FFI B;  5KFI A;  1IKY B;  5DDR C;  1UZD A;  2PD1 A;  1AZS B;  1LWE A;  4CH7 A;  5CD4 H;  1HWI A;  4IG3 B;  4BCA A;  4EI2 A;  5I3Q A;  4DV1 F;  1OO0 B;  1F3F A;  2XB2 D;  1C1C A;  2KG0 A;  1KC8 T;  4FS2 A;  1FD8 A;  4M8L A;  1VRT A;  5ETL A;  1S4F A;  2WK4 A;  4F4W A;  3K5N A;  4NYP A;  4YP3 A;  2J5A A;  2ABY A;  2HW3 A;  3ZTQ A;  2IVF B;  3VHQ A;  3CED A;  2HFO A;  3GP9 A;  3N0V A;  3MR3 A;  1BQN A;  2P6S A;  4MT1 A;  4FXW A;  3N9U C;  1H72 C;  2IPO B;  3IS9 A;  4RNH A;  2BRK A;  4YDX A;  5KFD A;  3V81 B;  2W8L A;  4KGM A;  3CDB A;  4XO0 A;  1IWG A;  3VTI A;  1BLU A;  2VBW A;  4TY9 A;  2V8H A;  3DDN A;  5KTQ A;  1WWH A;  4OI4 A;  5IC4 B;  2VIH A;  3CO9 A;  3IR5 B;  3QT7 A;  2CNK B;  1RTD A;  4IOA Q;  1VYA A;  3BDP A;  2VG6 B;  4NCG A;  3MMC B;  1NB2 A;  4RZR A;  3C19 A;  2Y0B B;  5AE3 A;  3D28 A;  3NG8 A;  5DDO C;  3G6X A;  4ID8 A;  2OPQ A;  2XI2 A;  3W3S A;  4X62 J;  1TKT A;  1UA0 A;  4YB7 A;  3TA0 A;  2XQC A;  3QID A;  3TR5 A;  1F9F A;  2WZ1 A;  2IAJ A;  4FS1 A;  3FK4 A;  4C8K A;  5ETT A;  3IG1 B;  4ZP7 A;  1RTZ A;  3FMW A;  4DQP A;  2J6U A;  1S1U B;  2GO8 A;  1F2G A;  1S4E A;  3C14 A;  2LXF A;  4X66 J;  4DV4 F;  3E2E A;  1NME B;  5HJY A;  2IBK A;  3GYX B;  1X7V A;  2ZJP Q;  1ZPW X;  2WVF A;  4UUX A;  2ZVI A;  2VIC A;  1VK8 A;  2FJD B;  2FHM A;  4JI0 F;  3AOC A;  4RBU A;  4I6A A;  4KHP F;  4WTO B;  1NK4 A;  1IKX B;  1ZAV A;  2EW9 A;  2DNK A;  1VHF A;  2MJN A;  2UXC F;  3PG9 A;  2V4J B;  2V2Q A;  4ILR A;  3M8Y A;  2J9D E;  2A2C A;  3W63 A;  4N41 A;  3TVK A;  4MKA A;  3B78 A;  1DHM A;  1SKR A;  1S9E B;  1FNX H;  1DFD A;  3HDS A;  3DXS X;  4Y2C A;  2FC9 A;  2PA3 A;  4WWS A;  3RBZ A;  5HMW A;  3L7U A;  1QAX A;  5CXT A;  2HFN A;  3IA0 A;  4LQ9 A;  1M5V C;  4YY3 F;  5IS2 A;  1YZ6 A;  2PMW A;  1D9A A;  2F8M A;  4CYU B;  4DOZ A;  4CH1 A;  2EPI A;  1NDL A;  1EKR A;  4NRT A;  5IT0 A;  4Q2L A;  4CCH A;  3A12 A;  4IH5 A;  5E3C A;  1S57 A;  3SIP B;  2D41 A;  5LXY A;  2CVI A;  3GG0 A;  4DV0 J;  4FNI A;  4F25 A;  1IKV B;  2VQE F;  2BAN A;  3NKY A;  3K59 A;  3KG1 A;  4HHH A;  3C8Y A;  2RHS B;  3U7J A;  3K5M A;  4B3T J;  3IR6 B;  2N4D A;  5EDW A;  2W2O P;  4MK7 A;  5FJ4 A;  3LUY A;  1JLA A;  3L3C A;  3OSP A;  3V6D B;  2UZA A;  2YKM B;  3QNW B;  1GX5 A;  3HVT B;  4HHU A;  4IO9 Q;  4C8N A;  3CDW A;  1RA7 A;  2AIR B;  2XGQ A;  4CH0 S;  4F36 A;  5E7O B;  2QL7 B;  3D0I E;  4KGV B;  4JI2 J;  1IUJ A;  4OZN A;  4CIO A;  3KLF B;  1UKU A;  4DX7 A;  3KK1 A;  1W7W A;  3KXD A;  5G4D A;  4KPC A;  1UEU A;  4JI8 J;  4QPX A;  4HEA 9;  4NCB A;  2CPY A;  1EZZ B;  1OY8 A;  5DZ6 A;  1T02 A;  3NGD A;  2EKY A;  4KT0 C;  1VQO S;  1UWB A;  4B08 A;  1VLO A;  4C0B A;  4PG7 A;  1WOO A;  1FD2 A;  1WC1 A;  4AQY J;  5D4L A;  1P9Y A;  2M8D B;  4ZPA A;  2VBZ A;  4NWB A;  3BYP A;  2F9J A;  5GAD I;  2YWK A;  4OFZ A;  5U47 A;  2DR9 A;  1SC1 B;  2RIL A;  4MYU A;  5KFB A;  2DHH A;  2GCF A;  1F60 B;  1T05 A;  2UUA J;  3D54 A;  1YJ7 A;  3M6V A;  3FSI A;  1BUX A;  1FK9 A;  2V63 A;  2KT2 A;  4RW8 B;  2QA4 S;  3MTJ A;  2B8Q A;  3KLH A;  5CZV A;  1EP4 B;  2N4C A;  1EAY C;  4WJB A;  3BSN A;  2APO A;  4M94 A;  1SH2 A;  5LT5 A;  2G13 A;  2MZJ A;  2KXN B;  3WC0 A;  2MJU A;  3BGR A;  1XQI A;  4WFZ A;  3EDR B;  4LFA J;  3QLH B;  3ETM A;  4ZVU B;  3HUL A;  5KFQ A;  2OTL S;  3GV5 B;  3FCV A;  1VBX A;  3I9V 9;  3GZ7 A;  1SQG A;  2E5L F;  3J7Y U;  2XHC A;  4C8M A;  4DPW A;  5CD4 A;  3M30 B;  2ILY A;  3EPG A;  4DF4 A;  1NDK A;  1T0T V;  1WSR A;  1ZS6 A;  5HAN A;  3GMG A;  3G8Q A;  3LP2 B;  1Q4R A;  4XTT A;  5D78 A;  3W2V B;  2VFV A;  1WUU A;  2XY5 A;  4RW9 A;  2D74 B;  4I2P A;  1LKZ A;  4AE5 A;  4J91 A;  2WSC C;  1X60 A;  4WBF A;  5KFV A;  2ZOM A;  4K2J A;  1Q8B A;  3LP0 B;  1BGX T;  3R7N B;  4O3Q A;  3GIM A;  3RBX A;  1T7P A;  4Y0F A;  4DX5 A;  3JTO A;  1IKW A;  4H4K C;  2KXF A;  1JLQ A;  1BE4 A;  4MKB A;  3PX6 A;  4WTY A;  1B4S A;  2IJR A;  4DS5 A;  3BPS P;  3QRR A;  1M5S A;  1WTF A;  2NYH A;  3EYZ A;  4V19 X;  4KFB B;  4UOC A;  2Y8Y A;  3PRB A;  3T1Y F;  2Z58 B;  3CIM A;  3EM1 A;  3M2U A;  2GVD A;  3FRY A;  1S1X A;  2EVZ A;  3QIP A;  2HG4 A;  4TLQ A;  3C6T A;  2YWH A;  4Y2M A;  1JLB B;  4C48 A;  2ZH3 A;  2CPZ A;  2KFN A;  4CLZ A;  3QBC A;  3BO2 A;  1FJE B;  1RCX B;  1HAR A;  3W9J A;  1NKB A;  2MKC A;  1XC9 A;  2KHC A;  2VL1 A;  3A13 A;  1FE0 A;  1WF0 A;  1LXJ A;  5D6G A;  1JXE A;  4FYV B;  3MR2 A;  2DGQ A;  2R8I A;  2IHR 1;  2YNI A;  4RNN A;  2GA7 A;  3CO0 P;  1Q1K A;  1KFD A;  4KHM A;  4ZHR B;  3JS9 A;  2QFI A;  3IRW P;  1AXQ A;  3D6T B;  1RWO B;  1N56 A;  2WOM B;  1CQN A;  4A48 A;  4V19 J;  5D8H B;  3LWL A;  2UVV A;  4NL5 A;  4CP5 A;  3D2W A;  2MDA A;  2KRB A;  5DET A;  3EGW B;  4ZLJ A;  1U02 A;  3LPY A;  5KT5 A;  3LP1 B;  2CPD A;  1L3T A;  3CCJ S;  2KYZ A;  4JBC A;  4DR2 F;  4L72 B;  2W2P P;  3L4B C;  2VPZ B;  2W9C A;  3MMA B;  2FLP A;  3KK3 B;  1RT2 A;  3CB4 A;  1NM2 A;  3UDE A;  2V4Q A;  4I7F A;  2ZH5 A;  4USH A;  3CMQ A;  3G6E S;  2HBR B;  2B4U A;  2B9W A;  1SPB P;  1SH0 A;  3QO9 A;  2BM0 A;  1N48 A;  2NUU G;  2QO3 A;  2BQU A;  2QG9 B;  3B6B A;  2HRY A;  4DV6 J;  3HT3 A;  3GJT B;  2GX8 A;  2XGP A;  3MEE A;  1SQE A;  2V0N A;  3PFE A;  4CO3 A;  3FZ2 A;  1HWL A;  2OSR A;  3HO1 A;  1SKW A;  1HL6 A;  2FY8 A;  2NS1 B;  3BGO P;  3C6U A;  2HMI B;  2D3Z A;  4KRW A;  4DQR A;  1YHQ S;  3WQP A;  2R2U A;  4K4W A;  3PV8 A;  1KOH A;  1O5J A;  2AEM A;  2PDA A;  4K4T A;  3NGT A;  4PEO A;  2ASL A;  5I42 B;  4HLB A;  1FT8 A;  1RWW B;  1M1K T;  4C7Q A;  3VQT A;  3I5B A;  1J5O A;  5D0G A;  3DLE A;  3HHE A;  3U27 A;  3BZQ A;  3D6F B;  5M2P A;  2YNG A;  2EFQ A;  5KFC A;  2DCU B;  4P2S A;  3ZZZ A;  3ICL A;  4PG8 A;  5A0Y A;  3VAL A;  1JXV A;  2H5I B;  4B9N A;  4ECQ A;  3UD4 P;  3ISN D;  2X1B A;  2H65 B;  4F2S A;  4RW6 B;  2MLX A;  1VOM A;  4PUO B;  3HMJ G;  1FCA A;  4ZIW A;  4ITS A;  2Z8Q A;  3OFH A;  3DN9 A;  1P1L A;  4ZLL A;  5F8H A;  2OPR A;  1YSJ A;  2VF3 A;  4KBI A;  1QE1 A;  1U0H A;  4QPT A;  3CGI A;  3TVZ A;  1RTI A;  1SUQ B;  4CTA B;  2Q79 A;  4OHV A;  1V5V A;  4F02 A;  1RTH B;  4RWX A;  3M8Q A;  4UZB A;  4AXJ A;  2Y1J A;  3CMA S;  3OHB A;  1KKH A;  2XBP A;  1HD1 A;  2W4D A;  2V6A A;  4F3M A;  2YX1 A;  3CT9 A;  1Z2Z A;  1S1T A;  3HLU A;  5GVQ A;  1RWV B;  2XYG B;  3AXK A;  5KFY A;  3AOD A;  1VQS A;  2YVS A;  2DNM A;  4PCQ A;  2I8E A;  1FJG F;  3W66 A;  3PRD A;  5KFP A;  5KFT A;  3BKT A;  3Q24 A;  3CCL S;  2HHW A;  3OVB A;  5AXN A;  4FXV A;  4JOU A;  2OUG A;  5CHC B;  4M5D A;  1AT1 B;  3NOG A;  3I82 A;  1X4H A;  1X9M A;  4ZVS B;  3DLG B;  3R97 A;  2B7C B;  4ZVH A;  1HNW F;  3MOJ B;  1IBK J;  1NSK L;  1H2U X;  3KKF A;  1R0A A;  1HNI B;  2UP1 A;  1FXD A;  4X4R A;  1SJ4 P;  3H2U B;  4WP9 A;  3KK2 A;  2CJA A;  5G0R A;  4TYB A;  3RB4 A;  1X4G A;  3MCO A;  5K20 B;  2WON B;  1OMS A;  1WEX A;  4NPO A;  1WG5 A;  2HKE A;  2IY5 B;  1G6B A;  3SSQ A;  2ZM6 J;  1TK8 A;  2QJ3 A;  3EZ5 A;  2DO0 A;  1MSW D;  2VKR A;  1TVR A;  4P52 A;  4PAA A;  3HZE A;  4NXM F;  2C3M A;  3K7R A;  1AYE A;  5CZX A;  4KGK A;  4J9R A;  2RD5 C;  1XMQ F;  1LQ9 A;  4GC7 A;  3IP0 A;  1PJ7 A;  2FJW A;  3CJS A;  3KJN B;  4NX9 A;  2HFS A;  3V4M A;  3DLK A;  1U1L A;  2R7U A;  3VAM A;  4O44 A;  2XSJ B;  8ATC B;  3HF5 A;  2CAJ A;  1A6L A;  3PIP Q;  3FBC A;  3OV7 A;  2ZE2 A;  2V2V A;  3GU0 A;  2FZG B;  4MJK A;  4X65 J;  2DR5 A;  2SXL A;  1VI7 A;  2J9D A;  1HBN B;  4P75 A;  2HFZ A;  2QZ8 A;  4KGZ B;  3ZTO A;  3LAL A;  2HQI A;  1ZPV A;  2BXJ A;  5AT1 B;  1N5V A;  3J7A N;  2V5H G;  4U8V A;  1HBM B;  1VQY A;  5JVG Q;  2GIR A;  4A4J A;  4GVB A;  3SMZ A;  8AT1 B;  1V3R A;  2IM3 A;  3ILJ A;  3G96 A;  4DV0 F;  2M0G B;  5E33 A;  2WCX A;  4JV5 F;  2VB6 A;  3I9Z A;  1N5S A;  3SCI E;  5JVH Q;  2UUC F;  4ILM A;  2W9B A;  3S6E A;  2D9O A;  4J9L A;  2MST A;  5FD1 A;  2DVI A;  2MSS A;  3PCO B;  1GTH A;  4ZP6 A;  3AD9 C;  4U7C A;  4J9M A;  1J5E J;  2VG5 A;  1U1Q A;  4B9V A;  4YR3 A;  3DMJ B;  2ILZ A;  3TWZ A;  1CUL B;  4P7T A;  3QMQ A;  1JLG A;  4TKT A;  4CO5 A; 
#chains in the Genus database with same CATH homology
 3GJR B;  3R7B B;  2XYP B;  3GJQ B;  3IBC B;  1GFW B;  3R6G B;  4ZVP B;  2Y1L B;  2CNO B;  3EDQ B;  2CDR B;  2H5I B;  1RHR B;  3NS7 B;  2H51 B;  3GJS B;  1RE1 B;  4ZVS B;  1F9E B;  1RWP B;  2H65 B;  2C2K B;  2HBR B;  2H5J B;  2CJX B;  4ZVO B;  1BMQ B;  1RWX B;  1PYO B;  2HBQ B;  1RHQ B;  1I3O B;  2QLJ B;  1SC4 B;  2CNN B;  2C2Z B;  1RWN B;  3R5J B;  3D6M B;  3KJF B;  4LSZ B;  2P2C B;  2HBZ B;  3GJT B;  5K20 B;  3R7S B;  2C2M B;  1ICE B;  2H48 B;  2QL9 B;  3SIP B;  1NME B;  2C1E B;  2QLF B;  3D6H B;  1RHM B;  2DKO B;  3RJM B;  1SC1 B;  2C2O B;  1IBC B;  2QLB B;  4JB8 B;  2HBY B;  2XZT B;  4DCP B;  1PAU B;  2CNL B;  3P45 B;  4DCJ B;  2H54 B;  3R7N B;  4ZVR B;  1I51 B;  4ZVQ B;  2FQQ B;  1RWO B;  1RWV B;  2H4W B;  2XYH B;  2XZD B;  1RWW B;  2XYG B;  2QL5 B;  3QNW B;  1QDU B;  5IC4 B;  4DCO B;  3P4U B;  3IBF B;  1SC3 B;  2CNK B;  1RWK B;  1RHK B;  3KJN B;  3R6L B;  5IC6 B;  1RHJ B;  1RWM B;  2CJY B;  3KJQ B;  2H4Y B;  2QL7 B;  1QTN B;  3EDR B;  3D6F B;  2Y0B B;  4ZVU B;  4ZVT B;  1RHU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...