2QL9B

Crystal structure of caspase-7 with inhibitor ac-dqmd-cho
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
b'KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 17
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2ql9B00
3R6GB 1F9EB 3QNWB 2QL9B 3R7SB 3SIPB 3R5JB 2C2ZB 1I51B 2HBRB 2HBZB 1RHQB 2QLBB 3P4UB 3GJSB 3D6HB 4DCJB 3P45B 1QDUB 2QLJB 1RWKB 1IBCB 1I3OB 2CNLB 2H4WB 2QL7B 3GJTB 3NS7B 2CNKB 2C2OB 3GJQB 2QLFB 2XYGB 2XZDB 3KJFB 2H65B 2Y0BB 2C2KB 2CNOB 4ZVRB 2H5IB 2XZTB 4DCOB 3IBFB 1RE1B 1SC3B 3IBCB 3KJNB 2FQQB 3R7BB 2H48B 3KJQB 1RWVB 2CJXB 2XYPB 1RHJB 3GJRB 2CJYB 2CDRB 1PYOB 2H51B 1PAUB 2CNNB 3RJMB 1RHRB 1RWNB 1GFWB 2XYHB 4ZVPB 4ZVOB 3EDRB 2HBQB 1ICEB 2QL5B 4ZVTB 5K20B 2HBYB 1SC4B 4DCPB 1SC1B 2H54B 2C2MB 2DKOB 1RWWB 5IC6B 1BMQB 3EDQB 1RWPB 4ZVQB 2C1EB 3R7NB 2P2CB 1RHUB 1RWXB 1RWOB 1NMEB 1RWMB 4ZVUB 5IC4B 1RHMB 1RHKB 3R6LB 2H4YB 1QTNB 4LSZB 4JB8B 2H5JB 2Y1LB 3D6FB 4ZVSB 3D6MB
chains in the Genus database with same CATH superfamily
5LL6d 1IM6A 3UW1A 1I6JA 3RR7A 2MKJA 2SXLA 2B4PA 3T9ZA 3HFVA 1VRUA 1XMBA 2FGCA 1DHMA 2A18A 1NPRA 4RO0A 4C0OC 4UUWA 2X51A 2ZH5A 3AJDA 4OX7A 2F5GA 2IAJB 3GIRA 3UCUP 2VH7A 3ENWA 1D8YA 5F8MA 2OPRB 3QIDA 4NCAA 3AAWB 3THTA 2FLNA 1HBMA 2B9YA 1WKKA 4RLEA 4MTPA 4N8OA 4I1TA 3TX8A 3MFIA 3DOMA 2CJXB 1ZAVA 1SUQA 2AT1B 2HHPA 4V1Ak 4ITSA 3IAM9 2IBOA 2LCWA 3QO9A 3EDRB 1OY8A 2DH7A 5K20B 4DPWA 4P75A 5HQLA 1UEUA 2IMWP 2VG5A 3MCNA 1NB2A 4C11A 2E9RX 4JP8A 1MN9A 4RW4A 1YHQS 2W8KA 4OYIA 4ES3A 3D28A 2ZH2A 1FNXH 1U1NA 1JKHB 1Q86T 1GXTA 3R5JB 3BDEA 3FCVA 1GXLA 3S01A 2HNZB 2CPXA 1R8CA 1G3OA 2ZOGA 3MUMP 4P2FA 1BWVA 3RB3A 2OMLA 4DL7A 1U25A 1P9YA 4EWTA 1FXDA 2CPDA 4AQYJ 3OL8A 2R7XA 3QT5A 2CPEA 4K4SA 3FKBA 1X4BA 1UPMB 2CJQA 2GQQA 2C2DA 1RWNB 5KT3A 2DR9A 3T1YF 4MK7A 2ACMA 3PJXA 3NNHA 5L9NA 1VRQC 2UV8A 1N54B 1AB8A 2CQDA 1RAOA 2HGMA 2VQFJ 4RBUA 2M52A 2QGFB 1U6BA 4H4KA 4J5OA 3SCLE 3KLHB 5L1JA 3EGVA 3HVTB 4DSJA 4IR9A 1IWGA 5B0CA 4DL6A 1VQ9S 3I5BA 2GMJA 1MU2B 4DF8A 3I9ZA 5D8HB 2YWKA 3DLHA 2HFZA 3PO4A 2BUNA 5CYJA 1CULB 1B0TA 1ZPVA 2P9EA 1FJEB 2EK6A 4NLPA 2D9PA 1CJVB 2OP5A 1BHNA 2LQ8A 3ULHA 1JLAB 3HVRA 4LFCJ 2DNNA 1ZZNA 1FFWB 8AT1B 1TK8A 4DSEA 1S97A 4O3OA 1IKWA 3QT7A 2DIUA 1F5AA 4ZVTB 2VODA 4GMKA 3FCHA 1NEEA 4DCPB 2Y0SD 4LF2A 1GXUA 2E29A 3AH6A 5KT2A 4EGLA 3UI3A 5CXTA 2RQCA 2OSQA 4Q7AA 4FYYB 4PG5A 1B64A 1KOHA 2KG0A 1EZZB 5FIIA 2ZC4A 1J5EJ 1O5JA 3ZZZA 4IFYA 3FBFA 3TZXA 1ZZFA 5DG9A 3NS6A 4ECSA 3HXMA 2XI3A 3HF5A 4E0DA 5C7PA 3EYZA 2CG8A 2PSZA 3ZZYA 3QGPA 3IBFB 1T0TV 1X9WA 1HHTP 2J7WA 3C16A 1UJ5A 2R2SA 4V19X 3M2VA 1ZTTA 3CDEA 2JWNA 3WIVA 1GX6A 3O44A 3DM2B 4M5DA 5DG8A 3OTDA 4WBFA 5C25A 4LUBA 4F4XA 3CT9A 4U95A 4C8YA 2GO8A 2ZZTA 3VAJA 4C8OA 3BGRA 5K14B 3A13A 5BJRA 4LF5F 4F7VA 3M9NB 3DI6A 3SCKE 1X0FA 4KBIA 4AE5A 1CS4B 3OHBA 5EDWA 2IMOA 3R6GB 1SL2A 2PI5A 2V4RA 3FSXA 2PMWA 3IRWP 1F0XA 1NJWA 3PO5A 2RF2A 3OFHA 2V6AA 4BC9A 2KN4A 1RHQB 1OO0B 1WWHA 4AXIA 1WKLA 1SV5B 3Q8QB 3FEXB 1RTDB 5A8WA 1S4FA 4YOEA 2EEYA 2VJUA 1C0UA 4M5HA 4J9MA 4YY3F 4H4OA 2VBYA 2ALYB 1HMVA 3IR6B 1Q81T 3CD0A 1TKTA 2J9EA 3ZNUA 3JSBA 3TRGA 3TUZC 2KHCA 4Q2LA 5ETSA 3A1YG 2FYXA 1S1UB 3BO2A 1RB0A 1T9TA 2KU7A 3M32B 3V6JA 3GYXB 3EWGA 1HARA 2J8SA 3DOMB 2GVZA 4HI1A 1UETA 3H25A 4KHMA 2HURA 3UD3P 2N7YA 1FNMA 4IYQA 4FNHA 2BQUA 3UR0A 3OL7A 1NJIT 3CDWA 4Z37A 4ECQA 2MQPA 3QZ8A 3V2UC 2CADA 3L4BC 1SPBP 1WTBA 2W4CA 2V8DA 2N4CA 4UZBA 3GFHA 4JV2A 1QUVA 3GWCA 3WX4A 3HHLC 4RW4B 1EIYB 3LP0B 1NNDA 5KFLA 3TAMA 2NS1B 2ASLA 2DBBA 3NBPA 4YQWA 2H5IB 4JI3J 4X4UA 3NAHA 3H8YA 3RRKA 4U9RA 2IFXA 3MM8A 5AE2A 3L9ZA 3OFEA 2ADCA 1TL7A 4NASA 2FHJD 4K59A 4C97A 3KNGA 1U09A 3CJ2A 3NP5A 2I6WA 3C6TB 3UR3C 2R7RA 4F25A 4P2SA 1JXLA 1KEKA 1XK8A 2X1AA 1X9MA 4NRTA 4R5PA 3GMGA 1H6KX 3T9NA 1X0PA 3EUNA 2UV8G 2BM0A 3P96A 5HBMB 4OHZA 2X1FA 3NG8A 4WZQA 3QZ7A 2PC6A 2RUGA 2BYCA 2Q43A 4DWIA 3FBBA 2GAHC 2IRYA 2EW9A 1KBRA 1N6QB 4TVAB 2Y9HA 3NOGA 4QR1A 3K7RA 4CYUA 1L3KA 4MT1A 1U02A 3CD5A 3OVAA 1NM2A 1VI7A 3ZZ0A 1Q95G 2HGLA 1GNKA 3ICLA 2ZH4A 1M5KC 1VCTA 2JEFA 2QA1A 1IKXB 3TQEA 1S10A 2GGPA 4ZVHA 1GAOA 1S9GB 2NZCA 1IKWB 2WRMA 3LO3A 2WK4A 1F9EB 4NLWA 2DRDA 2K3KA 4K4TA 1IKVA 4KQZA 2QJ3A 1VLOA 4HT5A 2RU9A 2J6SA 4DL2A 3I5CA 4WFZA 1RISA 3C3LA 1YJRA 4F3QA 1AYEA 1K1QA 5FJ4A 1KVIA 1G6BA 3E01B 3VAFA 4ZVFA 1TV6B 4KY3A 2BE2B 1RT1B 3EZOA 1OSCA 4F0KA 2O1PA 2EFPA 4BWJA 2V34A 1CG2A 1RCOB 4KTQA 4UUXA 4G65A 4K0KF 5ETQA 4QJVA 3KWMA 1RTJA 3S8SA 1Q8KA 2RH3A 4ZVOB 2ZDOA 3J7YU 2RIJA 4P9SA 4DI6A 3R5BA 5SUHA 1CPZA 3K17A 5LMUF 2P5VA 3QGHA 2OO4A 4JI4J 2CPIA 1RWXB 1B0VA 3CJSA 4GVBA 3N6LA 4M5DB 5CYMA 3G2XA 2CJKA 3G6VA 3ILJA 3H59A 3G6YA 1N32F 2LEBA 1NK7A 1DBDA 3VGVA 3GILA 1WKJA 3CC7S 5LSOA 5THWA 2K1RA 3D54A 3BGRB 4A8FA 3C19A 2R7SA 2C3OA 1TK5A 1HIYA 3B4MA 4PG7A 3DI6B 2FHOB 2H4WB 5CH7B 5B7WA 5DRKA 5A8RA 1FRMA 3GTYX 4J9SA 2OD4A 1HBNA 3MPWA 1NU4A 3C6UA 3HULA 2F4VJ 5CYQA 2RF2B 3W5ZA 4ZCMA 3RRGA 4LF4J 2GIQA 2GV1A 2KB2A 5ETNA 5LXYA 3WX8A 1NDCA 4I2QA 4B3SJ 1WI6A 1RXOB 4X4TA 2GHWA 3BYPA 4LQ3A 2QL5B 1P6TA 4LF6F 1M5HA 2VUGA 3LUYA 3R27A 2AEJA 4YB5A 5L8RC 4OYMA 1OQ6A 1HMVB 4DR2J 4I7FA 4RBVA 1TKTB 1CJUA 5L9XA 4XPEA 3PX4A 1M5PC 4DZDA 2MTLA 5F8HA 4M5JA 1L5UA 1RT5A 1BC6A 4CP5A 2HAFA 4WTOB 1WG1A 3M30B 2F8MA 4V19J 3MMAA 2YBVA 1QD1A 2CZ9A 3AY0A 2FVQA 4NEZA 3VAMA 4F8RA 2L9NA 3GU0A 2MGZA 2Y1RI 4DR6J 4K4WA 1FKAF 4DL3A 3R1HA 3DYAB 2BA9A 1SL0A 2NYHA 2J7UA 3A3OB 3L7PA 1VJQA 4XDCA 3LP2B 1HWIA 2DNHA 2HHHF 1IQTA 3DN9A 4CLUA 1IJEB 2E1AA 2H54B 2B4OA 4DR2F 4ZS6A 5IT4A 3OSNA 4FF2A 1VQNS 2JHEA 2P9CA 2QMXA 2F3JA 4QBUA 1FTCA 4XTTA 4ZN1A 3GV8B 1FKPA 4O3NA 1REVB 3IRXA 3M8WA 3MEDA 4CLTA 4N56A 4KHPJ 1QLNA 2H1YA 2W8LA 1N33F 4H4KC 3P4UB 3KUHA 1YGYA 3RBZA 2JLEA 4CLWA 1R8AA 1BLUA 2DY9A 3NWGA 1N0VC 3ISNC 1CEZA 1WSVA 2ZD1A 2HSEB 2IM3A 2MY8A 3UDLA 3CJKA 4A4JA 4KGVB 4B9SA 1R31A 5EGYA 2MLZA 1VQ6S 3J7ZT 1F2HA 1IR0A 2XS2A 2CZ4A 3VGTA 1YBUA 5LT5A 3M1VA 3ENVA 2LEPA 1N52B 4J9PA 1SQGA 4JI0F 2R3VA 4R8UB 1XN9A 1BMQB 2YY3A 3A8JA 3BPSP 2FY1A 3MZIA 4NE9C 1T95A 2MB0B 4QIFA 4CQ1A 4QWAA 4M5NA 4IG0A 4CYUB 3FRYA 4UOGA 3TZYA 1BQNA 4I56A 2CIMA 1Q78A 2JDJA 4DLEA 3OW2R 1D1UA 2VPZB 1X5PA 4P2MA 2UXCF 3S1TA 4M63A 3IS9B 3CCMS 4ZDNA 2B56A 1HHSA 4OLOA 4WFAQ 4YB6A 1LWCA 2HZCA 3EVWA 3R5CA 5DETA 1DTQA 2CPZA 1RHJB 4IO9Q 3TYTA 1KKHA 3LAMA 1FRKA 3POTB 1YZ7A 4OZ3A 3MOZA 2PT0A 4BWMA 3GYGA 3P8BB 3VHQA 3QJLA 1Z2LA 5E5NA 2PN6A 4ZCIA 3PYEA 4B3RJ 1T7PA 2PGCA 1OYEA 3X3UA 1M1HA 4ECWA 2XCAA 5B09A 2B5JA 4LSNB 5D15A 1JNZB 4PWWA 4AD6A 1Y9OA 5T14A 2MMYA 4K7QA 2K8GA 4OHXA 1HLWA 4PRFA 2E5IA 1N88A 4G1QA 4N47A 4RZRA 2L9DA 1YWXA 2Z58B 2LQJA 2IJRA 4PEOA 5E0OA 1VDHA 1OMSA 1RQ0A 4O3QA 1GMWA 4KRWA 3R5GA 3CULA 1JWWA 3R5DA 2IM2A 2W4PA 3PYGA 2Q6BA 1IBKJ 4DR1J 5J2PB 3EZ5A 2PEBA 4URSA 4OZ5A 3PIPQ 2HMIB 4N41A 3QATA 5A8RB 4CO3A 1HBNB 3BKTA 3CF5Q 3NWRA 1FEEA 1IBLJ 3C6UB 1CQNA 3GIMA 4ZP8A 3I6PA 1HW8A 1N5QA 3MCSA 1YZ6A 3F0NA 2W2QP 4F4KA 1QAXA 2AX0A 4FF3A 2XS7A 2N82B 1LWFA 1TMMA 2UUBJ 1RHKB 1AA1B 1KR4A 1X4CA 4F3OA 3NNAA 1X4GA 4I2QB 1NDKA 2FVCA 5KFXA 2JC0A 4HTJA 3WC0A 2EFVA 3RB6A 3OFFA 5KG0A 2J8AA 5HI7A 3HPOA 4I7FB 1ZETA 3S6EA 5CAAA 1CJUB 3U1MA 3GR0A 3I55S 2HK2A 4Z7CA 1H98A 5IM0A 2NUHA 2CQ3A 4PYAA 5D0GA 1RT5B 3H5SA 4P10A 3GFXA 4W90B 4OYWA 3KJQB 4RW8B 4MK8A 2W9BA 4DS5A 4DFPA 1IBMJ 2BANA 3P3DA 2V4JA 5GAHI 2HK3A 2UUCF 5CD4H 1PCAA 4HKQA 5G0RA 3AXMA 4QIWD 1EP4B 3CIZA 4KR0B 1BUXA 1HYSA 4CO0A 1J5OA 3J80U 3HZGA 2HQFA 4NCBA 3CJ3A 1JLEA 2UXBF 3KK1A 3EX7B 1HNXJ 3F41A 4CO2A 4DV6F 3NGSA 1SQEA 2G0IA 2AJFE 1F1BB 5ETTA 1Z1ZA 4OYPA 1D9FA 4NEYA 4LFAF 1F3FA 4ELTA 2MQLA 2LLZA 3W2VA 1TU0B 2GMHA 1N34J 3MUTP 4FYWB 2E1PA 2AJ4A 2X7IA 5EWGA 3JTPA 3SI8A 1U4BA 3MEKA 2YX4A 3DOKA 3OBIA 2J76E 4XDDA 1PG5B 1FKPB 3NY0A 2RRBA 5DLFA 1RYSA 3IRXB 3MEDB 4USUA 3EGZA 4DX8H 1KVKA 4LF9J 3KYLA 3VZHA 1YSJA 1S48A 1HNZJ 2HZAA 1U49A 3SMZA 3GSIA 1VQSA 4GKJJ 4QU6A 4QU7A 2RQMA 1I94F 3H0PA 1ROFA 3FMBA 2G9OA 5ETLA 5B0FA 4USIA 1IKYA 2B7BB 1R0BG 3MECA 2AKWB 2GHPA 4UW2A 2NREA 4NLYA 3BGFA 3IM8A 3M1VB 4HVZA 2VQEF 2FJXA 1LWEB 4O23A 5KFYA 1XTZA 1WOSA 3DLKB 3MM9A 3O5TB 2HRUA 1S59A 1FWKA 3N6MA 1LXNA 5E3QA 1HI8A 5HL7Q 1CJKB 5HLFB 2HFSA 3NGUA 2VKZG 3Q89A 2B4UA 4KV8B 4IG0B 7AT1B 2CQPA 5IFMA 4MFBB 1C0TB 2GX8A 3JSYA 2M0GB 4UOFA 2GC8A 2YKMB 4KE5A 1BQNB 4LJMA 3FBCA 3CD6S 1WEZA 2DCUB 1X31C 2DY1A 4C0BA 4MYTA 3M8PA 3CJ8A 3D1OA 5KFWA 3Q86A 2E5JA 4MIBA 1K0TA 3P49B 4BDPA 3K5MA 2PIIA 2MHEA 1QY7A 3BV8A 4H4MA 1UAWA 1KONA 4U7CA 1Q79A 4BBYA 1LWCB 5IC6B 4OX9F 3CPWR 4M5MA 3TJAA 3A8IA 1DTQB 2L08A 2DR6A 3TAQA 2V9KA 5A8KA 3E8OA 1BGXT 5IT9U 4ZVSB 2JVRA 1YDLA 5A6PA 3ETMA 1HWLA 1WC3A 4N8NA 2V9WA 2M8HA 4ZK7M 3K57A 2DT9A 2PI4A 4OV1A 4L73A 2FJAB 2WONA 2MKCA 4HH1A 4WIQA 4OI0A 2DNLA 4IOAQ 2MKYA 3JTOA 3PJ9A 2KZZA 5M2RA 3DMJB 1I3OB 2OPSB 1KN6A 2B5JB 4ILRA 2UU9F 2Z56B 2H65B 4KFBB 3GV5B 4DX5A 5IZHA 5HN0A 3W5YA 5KOXA 3DRSA 5D4PA 3EGNA 3QSIA 3F56A 2CQ4A 4YS2A 4PAAA 7FDRA 2HFOA 1RZMA 1TQLA 3C15B 1FT8A 1FD8A 2A3JA 2DJWA 5HSPA 5J1PA 3FQKA 4Q43A 4ZKAA 2HLUA 3IR5B 1RWMB 2ZZMA 4L72B 1Y00A 3OSPA 3DHWC 3TUIC 1S6PB 1QM9A 1URNA 1UW4A 5AJ3J 3HVWA 2XZWA 5KFKA 3HZEA 4Y28C 1S57A 1LWFB 1VQPS 3D9BA 3CC4S 3KK3A 2XMVA 4OI3A 2FUG9 2XEXA 4ZLLA 5J2QB 3N5BA 2A2DA 3L7OA 3LGHA 1D3WA 1NHKL 3H90A 4YB1P 2QLXA 1K73T 4O44B 3QGGA 3TEGA 5F8LA 4FS2A 2FQQB 3FVYA 1XWLA 3DLJA 3LPEA 1NUEA 1W2IA 4FYXB 1A9NB 1HD1A 2CAJA 1TUWA 5HMZA 2QA2A 4JI2F 4X64F 2NXJA 2AZ3A 1QAYA 2B9EA 4PKDB 1SC1B 2VFUA 1NBEB 4LIWA 5KFCA 2MZRA 2DNQA 3DRPA 2W9BB 4Z2XA 2E7WA 1S1VB 2HLTA 3LW5C 1RKJA 1RA7A 1LNQA 4USKA 2FC9A 3PYDA 3X1LB 5B0DA 5G0RB 3TANA 5HK4A 1HYSB 4C8ZA 2QSWA 1E6YA 4ELUA 3Q8VA 2EFQA 2IYIA 4DJBA 3KTQA 4Y2KA 4DV2J 1HW9A 3DLLQ 1IR1A 3W5XA 4ENOA 2CQ0A 3HI9A 3GIJA 4I67A 4B9VA 5IT9Y 1S49A 3Q83A 4X66J 2OI2A 1FHTA 1K44A 4ZVEA 2LDYA 4Y2MA 1WJ9A 4OHWA 4PPZA 4F67A 2FVRA 3W3SA 1M1KT 1UJ6A 1T8EA 5J2MA 5T7LA 1S99A 3JXOA 3DOKB 5DQHA 2VG7A 2U2FA 3OXGA 3TOQA 3I0RB 1G1XA 3L3CA 2NQPA 3MM5B 2YWGA 3G71S 1C1BA 3A4TA 2RT3A 2W1BA 2HWHA 3R6LB 4DMZA 4C3KA 3NOCA 3SXLA 2RE1A 1B7FA 4P71A 1N48A 2A1BA 4UTGA 4JI8J 1XQIA 2MZJA 1IKYB 2VDIA 4LMZA 5ETKA 4JI5F 1AW0A 1K47A 3LTOA 3IGVA 3MECB 1U8WA 4ANDA 5KFAA 4DDFA 3FSYA 2WVDA 5KG2A 1TKXA 3MM9B 2QTWA 2G2OA 3M4XA 5T41A 3LALA 1SKWA 4WU2A 3FQLA 4YEAA 4RUAA 3RBDA 1FE0A 4BC7A 1RYRA 5F41A 5HO4A 4IFVB 3BO3A 2LFVA 4ILLA 3NEKA 1GFWB 2BEFA 4R0EA 1W25A 2UUWA 3GR1A 2KYXA 2C2MB 1OS5A 2C1EB 1H2TZ 2RB7A 5KFSA 4JYAJ 4J9OA 4NLQA 3M8PB 1VBYA 2AMCB 4TXSA 4Y00A 1ZS6A 4USJC 3Q24A 3MMCA 4NLRA 4H4MB 3DOLA 3CJ0A 1BE4A 4FXVA 1S0OA 2KYZA 3OPKA 2V8PA 2XWYA 4X4PA 5C2GA 2BJ7A 1UP1A 1SVDA 1SJ3P 2ZWPA 1TKZA 2I5JA 5A8KB 5L38A 1GX5A 3IG1A 2QL7B 1HHQA 2AYEA 5FD1A 3ZC4A 3I4PA 3CCLS 2CQIA 3K0JA 4DR5J 2OSRA 3PRVA 4O3RA 1HR0J 4KGZB 2W4DA 3H20A 2EKYA 4NLDA 4WIIA 2QEXS 1UMJA 1UCNA 2E1MC 2W2MP 2OPQA 3CJ5A 3UDCA 1JK9B 4ED4A 5EWFA 2D3O1 2K3IA 2JRSA 1EX8A 2ZNYA 2XMWA 1RUSA 3MTJA 1R0AB 4KAIA 1RT3A 4CLKA 3MFHA 2CZVC 2HS3A 5F8NA 2QA4G 2NYIA 5IS2A 5HMYA 4K5RA 1Y7PA 2IIHA 5DGAA 2V0NA 1R8HA 5DDRC 4B3MF 5HVGA 2DISA 3AJ2A 2KM8B 3BH6B 3BDPA 4DCJB 2MJUA 1VRTA 4ZOSA 1LFWA 1VBZA 5J1EA 3IO1A 4OZ2A 5M2UA 4QPTA 5F8IA 1CC8A 3QGIA 3ZFVA 1YI2S 3KG1A 4A46A 5HROA 3KXDA 3QWPA 3BEGB 1X4AA 3TUPA 1HNWJ 1HBUA 1MSWD 3M7VA 1NRKA 1RU1A 2EBEA 4FKYA 3CTRA 1WHVA 1VOMA 3D66A 2IJFA 1GK8A 3DGPA 2D74B 5E7OB 4KPYA 3QSYB 1WSRA 4CLLA 4DR3J 3DDNA 1P1LA 4A8QA 3LQVA 1GMUA 1LW2A 2RDJA 4ELVA 2QL9B 2ZUAA 3CNQP 3R3TA 3M8YA 1X4EA 1I51B 2HBZB 3DRPB 4Y0FA 5KFZA 3MD3A 1RWKB 2ZEJA 2J0XA 2E5LF 3C8YA 3M8RA 5GAHU 4J37A 1NH7A 1Y4ZB 4F2RA 3M2RA 2AGOA 1NLKL 2HPUA 1P9QC 3HSGA 2PFFB 2QT7A 2YX7A 2CKWA 2F8HA 2ZM6F 2AU0A 1EAYC 4DV7J 5H9EJ 3MM6B 2XMKA 2CDQA 4DSLA 5KT6A 4C3LA 4X4NA 2I9SA 5AE3A 1NK8A 2ZC3A 1OSDA 1MNEA 2Z57B 2EBGA 5D3GA 3LH2S 4JI6J 1RWPB 1LXJA 3DLBA 1H38A 4DPUA 5HMWA 2W01A 3MAHA 5T7LB 1N5TA 5A6WA 4IRCA 2FZKB 2VG7B 4WP8A 3M8QB 3QFHA 1RAEB 5JVGQ 5KFGA 2WW4A 4RU2A 1C1BB 4UZCA 4R0JA 2Y8WA 1HL6A 3ENAA 2IM1A 1Q53A 3RAXA 1T11A 3KKFA 1OY6A 2D3ZA 4KPCA 1IXKA 1B99A 4U96A 5JJBA 3CCVS 5LSRA 3T5JA 3TX0A 3GPAA 5BXIA 2AGQA 3LWLA 5B0BA 2RS2A 2BJ9A 4QR0A 2B51A 1S1WA 2HWIA 3TNVA 4FBTA 4DS4A 2YWFA 4IR1A 2D9OA 1MG7A 1T03B 2OPPA 4RNNA 1NSKL 2VZ9A 3ZTOA 3WQPA 2ZOMA 1FX4A 3TI0A 1S1XA 1Q7LB 3M2UA 4O4GA 3HHLA 3A8KA 4DN0A 2EI5A 1Q8LA 3FC9A 2VPXB 1YJTA 1KTQA 4NLUA 5I3UB 1XNQJ 4LF7F 4CTAA 4EO6A 3QNWB 2NPIA 1U2RA 2BACA 1U26A 1Y5LB 1HFEL 1JJ2R 2OTJS 3W9JA 4DUTA 4RX6A 2ZJQQ 4MKAA 1RT6A 3MHYA 2CA9A 1F60B 5KFDA 2EFGA 2BRKA 1NK4A 4C9DA 1DY3A 1QUPA 3PTWA 4OIXA 3DOLB 2AJ1A 2NLWA 3OVBA 2FJEB 1SCJB 3MMBB 2R8KA 4EZ9A 3VCDA 1RT7A 4QOTA 2QYCA 3NCRA 1FDBA 4A8SA 5K9FA 2I5JB 4GKKF 1YRTA 4I2PA 3W9IA 1Z4UA 4B9MA 3IC1A 2HWTA 1F9HA 4EBDA 1JXEA 5CD4A 1U0HA 4X65F 1RU2A 2YWEA 5F9LA 4U8YA 3DKDA 5HVHA 4NA1A 1JLCA 2QC3A 4ECRA 1OYDA 2A6MA 3MEEB 1RWWB 2LDIA 5C42B 2HNYA 2M88A 4B9TA 1JIHA 1KLNA 4JI7F 2FPHX 4DV3J 1BQMA 2MYFA 2HVDA 4RWXA 3PJWA 1UVMA 3HLUA 2V2KA 5BR8J 4DR7J 3IMQJ 2HFNA 2EG1A 2HAIA 2FLLA 3MOJB 3DFEA 1RT3B 4ED1A 3EE3A 4I6YA 2VHGA 3V6KA 2LQ5A 2DVIA 1R27B 3K5PA 1AROP 3QWUA 2IC3A 3O1LA 4B3TJ 5D77A 2KFYA 1U1KA 3H5XA 3UVJA 1RE1B 2MSSA 4X84A 3G82A 2CJAA 3N01A 4DV5F 2DHHA 2VA2A 3I4HX 2DR5A 4X4OA 4DUZF 3PZPA 2ZBPA 1WDDA 2RU3A 3C14A 1BXNA 4MK9A 1VC0A 2VPWB 3OTOF 2AD9A 2M3DA 3ISZA 1NCLA 1RCXB 3J7YI 5ETVA 1TAQA 2XSFA 4Q0BA 5HROB 1UL3A 2UUAJ 4NOHA 1HBUB 2GO9A 1TL3B 3CW2C 2NXEA 3GE9A 2XLJA 1XNRJ 3H2LA 3V4IB 2Y1LB 3EPIA 4FPIA 1KLMA 5MLCV 2XSJA 5I4MA 1QAIA 1IWAA 1BD6A 4ED3A 3W9HA 2DEJA 4C3MA 1SJFA 3I32A 4NCGB 1VJWA 2RUSA 1UVKA 4U7UK 1S0MA 1LW0B 2EFNA 5KFTA 4CM0A 4ZLPA 1LW2B 2XYGB 4BLGA 3CC2S 3GSDA 4DV1J 4ZLNA 1DRZA 1WI8A 4YB7A 1VQ7S 2XZTB 1LK7A 3T6BA 3W65A 4A8XA 3VR1A 3AFGA 5EUHA 4NX9A 2ABYA 2HG4A 4CLZA 3J7Z5 4PQAA 3W2WB 4ZP7A 1TL1A 4PZVA 1S6UA 3O6QA 3MR5A 2W7AA 5KFNA 2BE7D 3JQJA 4ZPWR 3L95X 3IN5A 3O3LA 4Y3CA 1RADB 3BB5A 4AUKA 5IV3A 1RHMB 5KFVA 4QW8A 4LSLA 1JJHA 2WSEC 2UVWA 5LMNJ 4NZ6A 1JLGA 1VK8A 3HJFA 4C0HA 1WOOA 4DF4A 3M9OB 3KNAA 1NAQA 1REGX 3RRHA 4RW6A 4IKAA 4URGA 3RGIA 4AL7A 1AT1B 1TUVA 1WELA 2CNKB 2C2OB 2JEJA 4BS2A 4B9UA 2KFNA 2VG6B 1FWLA 1E6VA 3TEHB 2KVQE 2C2KB 4ZJQA 2WVEA 3CUNA 2EC0A 1QE1B 1U8SA 3G96A 2DNOA 3MD1A 1WC4A 2ZZNA 4ED5A 1AUSL 1WOPA 1T9YA 2XY6A 2X3DA 2GZOA 3HT0A 3BN7A 4FKXA 1LV5A 1S9FA 4ZVQB 2V8VA 5DM7Q 3NMRA 2R9LA 4N77A 1S1WB 1F5CA 3G9CA 4OI4A 3KDOA 3CXCR 1KHVA 3N0VA 1YG0A 2GMLA 3HP6A 1HPZA 2OPPB 2BRLA 4R25A 1O0PA 5LMNF 2BW7A 3MURP 2YKPA 3QYYA 3H4BA 4NMXA 1YJ9S 1IVZA 4WXWA 4O4GB 4IDKA 3HHLB 4OHYA 5KFMA 4K4UA 2OJ3A 4WP9A 1N5VA 4L3KA 1Q5YA 3PYFA 3E2EA 2AYBA 2VC1A 4GO7X 4CTAB 3Q8UA 1XR6A 1A6LA 3PW2A 3FSIA 2QYGA 2FVPA 4LF8J 1HQEA 1ZM9A 1RT6B 3G8QA 1VBXA 1C1CA 4WYLA 1C4CA 2R2RA 2YKNA 4NLXA 4ZVGA 1LWXA 2NPFA 1RABB 1H2VZ 1XIQA 5IWAJ 3MM7A 4FN5A 1HBOA 1SC6A 2DGXA 4C8KA 1TR0A 1X9SA 1NK6A 2M4MA 3JQMA 4MMOA 1U0HB 3KJVA 5EX3A 1SJ4P 2YNHA 2DGUA 2IRUA 1JLCB 3U1LA 4A8WA 1VS3A 2HNYB 4B9NA 1D9AA 2WOMB 1VISA 2DR7A 2QG9B 4AQYF 4CIOA 3P45B 4F4YA 4PQUB 1F6TA 2HHTA 2XBPA 2J0SD 4M5KA 2DHAA 4GO5X 3TWZA 2HHWA 2LVWA 1SH0A 4O0IA 4RUBA 3OD2A 4F36A 2IYGA 2RQ4A 4TY8A 2VQFF 3TZWA 3EGWB 4K4XA 4QYZJ 2OHDA 2IC3B 4JI1J 4ZVPB 3T19A 4TNOA 2F4FA 3UVJB 4OI1A 1KSPA 3C2PA 3IWNC 3G82B 2JX2A 3E51A 3R2DJ 1JLQA 5L1KA 5CZXA 1WACA 5KT5A 4PG4A 3B82A 3G6ES 4I64A 1U47A 3C14B 4OLPA 1CSJA 2J6UA 3SSQA 1FDDA 2BBEA 4RWWA 2X1GA 4DQPA 1RT4A 1XMQJ 1WG5A 2WZ1A 1KRPA 4Q0BB 2X1BA 2YTCA 2OFHX 2QX0A 4TU8A 5C24A 2ZHAA 3MCMA 4LFCF 2QIFA 1EB0A 4UT4A 3UNYA 2J9CA 3CCQS 1H0HB 2LXUA 5CCLA 4N76A 4WE1A 1RT2B 2J6TA 1KLMB 3BS9A 3W1YC 3V4MA 2LA4A 4OZNA 2IJNA 3H42A 5I42A 1GTEA 4ECVA 2DTJA 4QWCA 1QTMA 2WTFA 3SSSA 3NLCA 4USHA 4X62J 2W2NP 3THVA 3GB0A 2N4DA 1FRLA 2AQ4A 2XNQA 2RAQA 3ADAC 3SCJE 3I0SA 1RTZA 1SJ1A 2AW0A 2V94A 4ZHRA 4M95A 4WP3A 5E33A 2VF3A 5BYSA 1J5EF 2OIHA 4DPTA 2DKOB 3Q2SC 2XM3A 1RGVA 5ITHA 1BWEA 2C3UA 1JNRB 3D1HA 4G6VB 3PDNA 3S7RA 4PXDA 1TL1B 1FKOA 1CLFA 2YNIB 2ZH1A 2UUTA 4DU8A 1S9EA 1XMOJ 3CVKA 1VBKA 2OH2A 1C4AA 3CCES 4LREA 4A8YA 4E8UA 3PKYA 2KXHA 2DD8S 1VRUB 1V5IB 2WVCA 1T9XA 3ZZUA 5KAKA 2D3UA 4DL5A 2XLIA 2KZMA 4LSLB 1MW7A 3TARA 2R4FA 2V67A 4Q8EA 3EJMA 4D3HA 3BZQA 1HBMB 3CCWA 2WHOA 1PILA 2Z8QA 3BPDA 1FJGJ 1SUQB 1UTAA 2ZVIA 4ER8A 2OUGA 3QO9B 3LPYA 4X4RA 1K0VA 2VB6A 3LGMA 1ZA1B 2MZQA 2P6SA 5KTQA 4NXNJ 2VG5B 2JEGA 4HYKA 3BQ0A 1YK9A 4C8MA 5D78A 3U02A 3D6MB 3OLAA 3OL6A 4C11B 4CRJA 1S6QA 3ZNJ1 4U8VA 4HT7A 1ZH5A 4TN2A 3TQ1A 1SI9A 4AL5A 1IR2A 2DH8A 3WZ0A 4ETZA 4J7CA 3MAAA 2DPIA 2V4QA 2XY7A 2E5HA 3VAHA 2JJ4D 1D9DA 1U1PA 4DR4J 1FA0A 5DQGA 1HPZB 3G87A 1ZA2B 2XZDB 3FZBA 3OUYA 5KG7A 1S77D 1EETA 5CCMA 4XPCA 5DM6Q 2KJVA 4IDKB 1FDAA 4GRSA 4YN3B 2MHNA 2HEKA 5E3RA 2RDDA 1YJWS 1VK3A 2ILYA 3ELHA 2MLXA 3BM7A 1PBUA 4DXLA 2C2NA 1RAAB 2CJBA 4QYRA 5KG5A 1VQ8S 2GW8A 4WZMA 3G86A 1ZTWA 2AWZA 3A3NB 3SZ2A 1FFGB 1HQEB 1NMEB 3EMTA 3TA2A 4NA2A 2PE8A 1U7LA 3KLEA 2LXFA 4DQRA 3SFGA 3FJ2A 2UP1A 1JJCB 3HSZA 2YKNB 3M9MB 3JAMY 4JBCA 3GIIA 4KJIA 2HHVA 3BR9A 3MM7B 2IVMA 4JI3F 2Z2ZA 3TAPA 3GJSB 2Q79A 3I9V9 2R42A 4FXWA 1N36J 2XB2D 1TMJA 2LQBA 2MEWA 3FFIA 2E66A 2DXEA 3KJVB 4ICLA 2VIHA 3TA0A 1UVLA 1NZ8A 2YNHB 1NHUA 1Q8IA 2CNOB 3FK4A 3FUYA 4K4YA 2PO4A 4QQBA 1XR7A 3N4WA 4KT0C 2W2PP 3CD7A 5D0RA 4J9NA 2JFKA 5J2NA 1KC8T 4USTA 1G7CB 2QFIA 1YJVA 2H3EB 2KI2A 3CCTA 3U1NA 4RUHA 3OV7A 4AT1B 2P2CB 5JXSA 2CRLA 4TY8B 4ETXA 1DQ9A 3OTEA 3ENQA 4F3MA 2BJ1A 2DR8A 1D8ZA 5HQ8A 5K8PA 2LU2A 2HIQA 4PWDA 5U47A 4WU3A 2XO6A 2V68A 4E2FB 3H4DA 4DV0J 1JQGA 3SSRA 4IFYB 2F40A 1Y0HA 3SYZA 2E1CA 2BX6A 3VAGA 2F65A 3NS7B 2DNPA 3VWSA 1KVJA 2RD5C 1QJHA 1V3SA 4DSIA 1RT4B 2IA0A 3NGDA 2VJVA 2G13A 1SKSA 3JYTA 5CHCB 4ZITA 1LEOA 3C16B 2LECA 4PPDA 3M2VB 5EX0A 2EPIA 4PUOA 1R6YA 2IHR1 4WE1B 5AT1B 5IXUA 4DV4J 1RAJA 1P1TA 5C25B 4OI2A 2ROEA 1T3OA 4LRFA 3QJJA 3KG0A 4KYZA 4OYXA 2P9GA 4OZJA 5KT7A 1JX4A 2WVFA 4KB7A 2Q1LA 3CB4A 3WC2A 4LT6A 4O4RA 1WF2A 3CIMA 3HFZB 2H5JB 4ECUA 3I0SB 3KLHA 3HVTA 3MTKA 3BQ2A 4N7TA 3LP1A 1Q0NA 1PO6A 5ETOA 2F63A 5DDQC 4PXBA 1MU2A 4PG6A 2ZH7A 5L1LA 1OPZA 4HDGA 4EBEA 5D0HA 3IWXA 2QSFA 2KG1A 2FZGB 1R8PA 1NO8A 3QMQA 2GNKA 4FP9A 2KKHA 4RNMA 1VQMS 2B0GA 4LBIA 1NH8A 2IM0A 5A8WB 1JLAA 1NDPA 4ZVRB 2BJ3A 1S12A 1C0UB 3W61A 3KK2A 4H4OB 4JI4F 3DNCA 4NPOA 4JV5J 4NXMJ 3IM9A 2HS0A 3OHAA 4DV4F 4NZ7A 3NMAA 3VVUA 3RU0A 2WSCC 3VAIA 4FXDA 3QT8A 3AODA 4Y2AA 2D69A 1HQ2A 3CJ4A 5L46A 2MKHA 2F9DA 1UZHA 3M8ZA 2GVZB 1XJWB 2XGPA 3CO0P 5H1SV 2GAGC 4JV1A 2CPJA 1U24A 2MJNA 1M5OC 3M8SA 2AV5A 4X4SA 4ILMA 3KLFA 1KWMA 6AT1B 1K1SA 2F4VF 1DTTA 4LQ9A 4OL8A 2MKIA 4LF4F 3KUEA 3W7BA 1XBWA 1FO1A 1RAIB 2J7KA 2KL8A 3W62A 3GJTB 2OEJA 4FNIA 4B3SF 2B3TB 1S6QB 3GFYA 3PR5B 1FRJA 3TAMB 2JSXA 2XMJA 1GMVA 2HQ3A 1T05A 2HHUA 3NBPB 1L3VA 4Q8FA 4NLOA 3DM2A 3EXYA 2G2YA 3MM8B 4LRAA 1NJXA 4TQRA 3ZTRA 4P72A 3GQCA 2PDAA 1SL1A 1TL7B 5K8NA 4FVMA 3NGKA 1EETB 3W8GA 4RW7A 2MKKA 3QRQA 4WYWA 4DQIA 4IH7A 1Z2ZA 3EDQB 5D0EA 4P2XA 4BHQA 5DS7A 1LQ9A 2RS8A 2MKSA 4ZIVA 1TUGB 1A0OB 4I0WA 3L7UA 4DR6F 1GH8A 3HSJA 3DLEA 1T9UA 4P7TA 4O0NA 3UO0A 1WG4A 3H2UB 1WDTA 1RTDA 4R5PB 4DPYA 2AF6A 1U45A 3KLEB 3QQCD 2N3LA 1HI0P 2FY8A 2Y0BB 3HX9A 3U7JA 2FLOA 2XMAA 4L75A 3I87A 1Y5IB 4N5SA 2JEIA 2BKNA 1EJ7L 3KHLA 1R0CB 1JB0C 1UWBA 5DDPC 3B78A 2O5DA 3KOAA 2XMTA 3GG0A 4WF9Q 4WTYA 3FFIB 1GQEA 4ICLB 1S1UA 1SQFA 1QSLA 3M32A 4QCLA 3O8WA 4KHPF 3MGJA 2GIRA 3H98A 2DPJA 1RLCL 3GCWP 4TY9A 3I96A 4RL1A 3ITHA 1DQAA 4OFZA 3PHTA 3PFEA 4C48A 2YXLA 3D6FB 4ZPDA 2GGPB 5DZ7A 5J2NB 2ZBRA 1OQ3A 3T1YJ 3KHRA 4C8NA 1VQYA 4WJBA 4L76A 3ZO7A 5H9FJ 4EYIB 1IKVB 1NSAA 2FHKA 3Q23A 3VQSA 2XQCA 4QZVB 3V6HA 3A8EA 5LJ3Y 3QRRA 4MIWA 2YNFA 1Y11A 3LP0A 4CI0B 1AFJA 5DO2A 3A3PB 5MAOA 4CT8A 5KFBA 2C22A 4PWDB 5DZ6A 3OJUA 2YKAA 3AD8C 2ASJA 2XULA 2VKRA 1CC7A 4KSEB 4DSFA 3MPYA 4XO0A 2AJQA 2I8EA 3BKFA 1XERA 2XWXA 1Y5NB 2BXJA 1APSA 3BKUA 1XC9A 1TKDA 1RTJB 4TQSA 1X4HA 1KDNA 4NA3A 1WC6A 4CZCA 3D3CJ 3C6TA 4PG8A 4YMEA 3JYTB 1N5SA 4I4BA 1VFJA 5F3TA 4LBHA 5IT0A 1LFPA 2GQ2A 4PUOB 4JOUA 4GVBB 3DC2A 1BY9A 2VFRA 5CYMB 4CLFA 2HS4A 3PEJA 4NYZA 1B70B 4G3IA 3UQSA 3ILLA 3SIPB 3D0GE 2DITA 1X60A 5DJBA 2KO1A 5E2QA 4B08A 3O2IA 1MWYA 2K1RB 3CMAS 5HBMA 2KTQA 2B4VA 2ZH8A 2LEAA 2RJZA 4U67Q 2Q6CA 2YVSA 3RB0A 1IQZA 4GC7A 1PIEA 5GMEA 1NDLA 2MQ8A 2AHOB 2ZE2A 3DU5A 1RA6A 3HMJG 3LP1B 3PHEA 2W2OP 3H5YA 3C46A 2DIVA 5KFQA 1FJ7A 1N6QA 5ETMA 3ZZRA 2V2ZA 3R7BB 3VVTA 2H48B 4UOCA 5CYQB 2R8JA 3AHPA 1FDNA 4B3RF 4YR3A 3CEDA 3BSNA 1U1RA 5E41A 1IN0A 3RZAA 1N0UA 1HD0A 3BO4A 4F04B 3GG1A 1ICEB 1T02A 3BSAA 1WD6A 4WXOA 1CBKA 3KHGA 4KGKA 3KK2B 3UDVA 1U6ZA 2ZKTA 1IKXA 1S9GA 1ELOA 2M70A 4HI2A 1WF1A 4UOHA 2QN6B 1GMWD 2A6OA 3D7SB 2XS5A 3CCZA 3D3BJ 4FVCA 5KFJA 3HD1A 5KFPA 3KHHA 2CYYA 1I5OB 3EVOA 1SB6A 3CCSS 3PRBA 1IBKF 3QRPA 4DR1F 3PVXA 2FJVA 4LF5J 2O66A 3MMAB 3ZZOA 4M1KA 3E01A 2MGZB 2Y1JA 1RTIA 4P7VA 3QBCA 1TV6A 3KLFB 4LBPA 3ET6A 2BE2A 2XMUA 1IBLF 1RT1A 5FDLA 1DTTB 4XAKA 4WKYA 1U1QA 2QA4S 3QPIA 3P5BP 2XG8A 2UUBF 1S7HA 1EARA 3OQ2A 3K5OA 3R1LA 3B54A 3KG4A 2LA6A 1NB7A 4LF1A 3NCPA 5ETRA 2ROPA 4YY3J 4NLTA 5GMKa 1T05B 4ZPBA 3WDOA 2GJFA 3QJPA 4EO8A 2V2VA 5D4LA 1PJ7A 2XHWA 2CVIA 3KFWX 2G0CA 4ZPVR 3HFKA 4WKRA 3SEOA 4RW7B 2HQCA 8RUCA 5IQQA 2VASA 4LRCA 1GT8A 3PW0A 2DGQA 1HWKA 1IBMF 4CNYA 2J9DA 4MIAA 3A12A 3RYLA 3UCGA 2I1RA 2M5YA 2GFFA 5K8OA 3DLEB 3M05A 4J9KA 2ZD1B 4QIEA 3G4SS 3ONQA 4IRKA 3CJKB 1R43A 4X4VA 4XK8C 1DURA 5C2CA 3J7AN 3HO1A 5CZVA 5DG7A 4L3NA 4CH1A 3V6DA 2WW8A 1KQSR 2WB4A 1S72S 1HNXF 3M6WA 5F0UA 2RSQA 3DRXA 1U1MA 1F2GA 2G4BA 1U2FA 3MMJA 4RPFA 2C42A 1UJ4A 5F0WA 3EM1A 4QWBA 1N34F 2FD2A 4IRDA 1UWBB 3BF4A 4RR5A 3H5UA 2A0FB 1WNEA 2DYAA 4AL6A 3UD5A 2EG2A 2ZHBA 4PCQA 4Q2MA 1RLDA 4UY85 2MZSA 2HZVA 1UPPA 5C5JA 3JSMA 2YH0A 3M30A 2N7CA 2MPUA 4MKVA 2FHJA 4LF9F 1UEKA 2IRXA 2WBRA 1HNZF 3ITHB 1V3RA 1QDUB 2E9ZA 3J81U 2HRYA 4GKJF 3HKZD 2CNLB 1D0EA 1WTFA 5DQIA 4B02A 2QMUB 3D5MA 5AE1A 3DYAA 1AXQA 5DGBA 2ZJRQ 4Y2CA 3PKMA 3LP2A 2CPFA 3P6YC 4ZP9A 2XYPB 2YNFB 3UNGC 1YLXA 3OFGA 4KGXB 2VFVA 3OTBA 3AOCA 4C8LA 4DG1A 2IVFB 4HEA9 1OY9A 2FJDB 5LOQA 1EKSA 1FCAA 3N6NA 2DB1A 2C3PA 3RTVA 1IM4A 1FEHA 3TZZA 2Y8YA 2BE9B 5AXMA 1KHWA 3ZXWA 1T94A 2VICA 3MDFA 1REVA 2GQCA 2CVEA 3HK2A 2QFJA 2BOAA 4DOZA 2Z4PA 4OZLA 4CM2A 4A8MP 3BBCA 3TVZA 2NR0A 1KQFB 5M2PA 3LOUA 4G1QB 2AGPA 3RBXA 2KJWA 3ZTSA 2DGOA 5CQGA 3M6UA 1NKCA 2B9XA 2VPYB 2V69A 1AZSA 4X2BA 2BQ3A 5D6GA 1UA1A 2HFUA 1VHFA 4I69A 4IQXA 3MCOA 2K7KA 1S1TA 2A2CA 2NXCA 2CDRB 2ZH3A 1V5VA 4R8UA 2ZE2B 2FJBB 4NYOA 2FHMA 4YHHJ 3IP0A 1RAGB 2VL1A 4P74A 2HHXA 1TK0A 5A76A 2MQQA 1JJ4A 4EBCA 1VQKS 4K0KJ 1YJUA 2L9WA 2J9DE 1HNVA 4CO1A 2ZDPA 2CWKA 3LGNA 3FBEA 2RRAA 4F0HA 1HNIA 1RAHB 2DO0A 4HH0A 5LMUJ 4AFFA 2MDAA 4OJGA 3IS9A 3NXZA 1N4LA 2R7UA 2LP4A 1P27B 2HVZA 4U6PA 3TUJC 3QAUA 1N32J 1Q4RA 3HKWA 2XO7A 2HHSA 1RSCA 5EN1A 3IBWA 2O3DA 3IXQA 1MWZA 5IM0B 4IH6A 4GVLA 3WHIA 2R2TA 1VGYA 2GIFA 2RQKA 6FDRA 3POTA 2L3MA 2OKQA 4EZ6A 2JLGA 1SH3A 1HWJA 3SV3A 2YKQA 2ZH9A 2BANB 2OLWA 1RTIB 4YHHF 4OYAA 2PEHA 2AX1A 3ET6B 1NZAA 5KFIA 3J81Y 1K9MT 2EVZA 2V4JB 1R8BA 3Q2TC 5FDLB 5AJ3F 1KOOA 4ATNA 3R7NB 3KLVA 1SJQA 1J5OB 3EPGA 2HYIB 2IPOB 4LSNA 1JLEB 3KK1B 4RUCA 1CJTA 4PABA 4ZMMA 2V8GA 4J91A 1F9FA 4LF6J 2IY5B 3CMQA 1UW9A 2NSCA 1N56A 2D7SA 2CJ9A 2VD3A 2MLYA 1R89A 3MPUB 3W2VB 4LRBA 2GHVC 2V5HG 3IR7B 4F4AA 1SBRA 3UWTA 1QVGR 2BABA 5H9EK 1RK8A 4B3OA 4FS1A 3PR4A 3IWLA 4A8OA 5J2PA 2QZ8A 1O6XA 4RNOA 4AXJA 1IUJA 4DX6A 5F9NA 5KFOA 2HMIA 2ADBA 2R7OA 2YX1A 1TFYA 3I5AA 4TU9A 2UVUA 2OEKA 1PAUB 4ZJLA 2W25A 4DPXA 3LA0A 2YWHA 1UA0A 1H74A 1T3NA 3TR5A 3MWBA 1WC5A 4KO0A 4Y34A 3HCXA 1GTHA 2ASDA 3V6DB 3SQGA 2RKIA 4DV2F 3D4JA 3UDEA 2HHHJ 3RBEA 4TKTA 2ILZA 4ERDA 3GV7B 8ATCB 3V5RA 4X66F 3CDAA 4M5LA 2UZAA 1YBTA 2MQNA 2GJ2A 3NRBA 2CFXA 3JTNA 2LKZA 4FYVB 2R7WA 4CLSA 2WBMA 1UVIA 1V3ZA 1SH2A 5BYRA 4DFMA 1YKWA 2K7JA 3JSMB 4J9LA 2FGOA 4IO1A 1N33J 2MY7A 1S0NA 2BJ8A 3TVKA 1Q82T 4RW8A 1NSQA 3HHNB 4QWDA 2HRTA 3Q22A 3UPFA 1FRHA 1KFSA 4L74A 4DZ6A 2ZVSA 2AEMA 4OQJA 1EP4A 5GMDA 3HD2A 4NI2A 4U7UD 5KOWA 4JI8F 4K4ZA 1YRUA 2KRBA 5IV4A 1O8BA 1X8DA 1FJCA 3CCUS 1YTYA 4ZVUB 4J90A 4K50A 1RI7A 2H4YB 3MR7A 2AP6A 1PC4A 4HLBA 4MKBA 5LXRA 4MKYA 4JI0J 3DCAA 4ANEA 4DG1B 2E44A 3TJ8A 4PYDA 5DLGA 5JUMA 4MYUA 4CO4A 2ZJPQ 1FNOA 2CUYA 2DHSA 4NMLA 3DU6A 4RJVA 3RW6A 3BYRA 3NL0A 5KFEA 2WONB 4K2JA 3NS5A 3D6TB 5HJYA 4OHVA 3HM9A 2B7CB 1MROA 2B8PA 1MWQA 1NKEA 2E1RA 3OR1A 1S5ZA 3MR3A 3GCXP 4C7QA 2UXCJ 3NNCA 1NJZA 4QW9A 4JYAF 3DRSB 2O01C 3HT3A 4GC6A 3R5AA 2YWWA 3GJRB 3CJQA 2PMZD 3CMES 2H51B 3DGVA 1OWXA 3RAQA 3PNIA 1S4EA 2P6TA 2U1AA 2ATCB 1S76D 3FRZA 2DH9A 1L3TA 1AZSB 3BGUA 4FPRA 3UE2A 4F50A 1EKRA 2IBKA 5GAGI 3K2YA 1W26A 2F8EX 5IC4B 1Q7YT 1LWEA 3FZ2A 1S1TB 3DLKA 1RBOB 3D68A 4OJ1A 2VBWA 2NSBA 2GCFA 1FXLA 4MJKA 3VTIA 1X5TA 4EUVA 1CJKA 5HLFA 4DR5F 1W7WA 3VGUA 2FJWA 1HR0F 4G1IA 2ZNZA 4KV8A 1SJRA 3I56S 4MFBA 1C0TA 4KC5A 2C2EA 5HQMA 3HVAA 1HNVB 4QIGA 2QLJB 4OYOA 2YKMA 3KK3B 3JS9A 4LFBJ 2GJIA 3DDIA 4DUYJ 1HNIB 1NSPA 2MSTA 3ETOA 3BN4A 5D4OA 4LIRA 2F7VA 1RJJA 2JZ5A 1M90T 1NPPA 3AQOA 2ZBIA 4OZ1A 2C3YA 3R97A 2KHDA 4QPXA 1N5YA 2RDIA 1LKZA 3SQOP 3RR8A 4ZCLA 1UFKA 5E3CA 2CQBA 3SDEA 2HVEA 4O3PA 1WC1A 3FDSA 3MAQA 5A2QU 5B0EA 2XGQA 4WCEQ 2MQMA 3MUVP 1GEHA 1VIXA 4IH5A 2FZCB 4RW9A 2HNDA 3DMJA 2AZ1A 2CQCA 5LSLA 2OPSA 1E6YB 1Q1KA 1VR6A 4NYPA 3Q8PB 2KT5A 1PBAA 2NZ4A 3MPVA 1HNWF 4LFBF 1CQMA 4ZPAA 4KFBA 1CJTB 4DUYF 4QIVA 2R2UA 1NHVA 1WC0A 1QSYA 4OMFG 1X7VA 1HQUA 4YUDA 1R3NA 3PFOA 4TU7A 3TA1A 4Q44A 2UVRA 3C15A 3CO9A 1QVFR 1JLBA 1NPKA 2P8IA 5J2MB 4DR3F 1ULRA 2DRAA 4B3OB 2AJ0A 4PXCA 3MEGA 4A47A 5GAEI 2LMIA 3T5KA 5KFUA 1SIZA 3Q8SB 3WIUA 1R7IA 4LR9A 2HQGA 3NAIA 4J9VA 1S6PA 3RG6A 2UUCJ 3SBMA 3H2VE 3UN2A 3D2WA 2PA8D 3D0IE 3OJSA 4PXEA 3R7SB 2VV5A 2ZUGA 1PAEX 4KO0B 1UVJA 2HBRB 2UXBJ 2HGNA 3SQGB 2KRRA 3D6HB 4DV7F 5J2QA 2RKIB 2DK2A 4G1PA 4DEZA 3LAKA 2LU1A 2BKOA 2J0QD 1HKAA 1S0VA 4DV6J 5KT4A 1IJFB 4W98A 4KH1B 1NK5A 1DJ0A 1TKXB 4O44A 4LFAJ 2DGSA 2RHQB 4C6AA 4RNHA 2VA3A 2QE5A 4JI6F 2FDNA 4W92B 4IOBA 3AA9A 2KFZA 4PWUA 2WSFC 1KD1T 3EICA 1KNZA 4ZP6A 2XYHB 1WUUA 3AT1B 2H5EA 1YQHA 2DNGA 1Q8BA 3QIPA 4I68A 1FVQA 3EVMA 2V8HA 2VDHA 2BQRA 1U1LA 1KP6A 2Z2MA 1S1VA 2R7QA 4HTIA 1NK0A 1NKBA 1I94J 2JH3A 4NRUA 3PW7A 3OLBA 3MPDA 3MMCB 4NI2B 3QFWA 1R6VA 1FD2A 3DDKA 1FX2A 1TVRA 4EFAC 3J81j 2G1HA 1X5OA 1M0SA 2XY5A 1TKZB 2VQEJ 2WB1D 1S79A 1H2UX 2B43A 4M5GA 1AUDA 3IG1B 3BQ1A 3HHLD 4FF1A 2DNRA 4ED7A 4ID8A 1KS2A 3KJNB 5A2QY 3PX6A 2ZBCA 2BM1A 2H9ZA 3B8HA 4DFKA 2YH1A 1TAUA 1B0PA 1TP7A 4DN9A 4ZA1A 4ZIWA 2OPQB 4CWBA 5LJ5Y 3I0RA 1MROB 2CQ1A 5HP1A 1A7GE 1U2CA 3MM5A 1XNQF 2QO3A 3OR1B 3ZZTA 1VMBA 3OXLA 1FVSA 2BJDA 1SXLA 3LF0A 4JB8B 1T9WA 3OR2A 1X5SA 4K2XA 4F4WA 2DNKA 4KKOA 2M8DB 2NXUA 3D67A 4OX9J 4CH0S 1PJ5A 3KUGA 5I3PA 2DGTA 2BOPA 1WEYA 5B08A 4E98A 1JXVA 3ZTPA 3N9UC 1VRTB 4F26A 3PW4A 2Y3YA 4Q45A 4OYBA 2HFVA 3SV4A 2Q66A 5J1EB 2RILA 4DCOB 4QYZK 2X3GA 3AOBA 2PA3A 4DSKA 3LANA 5KG1A 2BJEA 3U27A 3M6VA 1SKRA 3MXHP 2BV3A 4IFVA 4DU7A 5GVQA 2A10A 2ZKUA 4DV3F 1FI4A 4ZPCA 3PY8A 3FEYB 5HVFA 3QT6A 1O51A 4C2MA 2UU9J 3EXCX 1M5VC 4HR2A 5BR8F 4DR7F 4IG3A 2DXDA 1M5SA 1PGZA 4CT9A 2JC1A 3PRDA 1FTRA 4ID5A 1RHUB 3DGPB 1DAXA 5I3QA 1TFWA 1L3UA 4ECTA 1UEVA 1N5YB 4B3TF 1U0SA 2V50A 3G8TA 3RUBL 3RW7A 4FF4A 1FF2A 1VLYA 2LQ9A 3CDUA 5ADZA 2GA7A 4EU0A 3SDEB 4NLGA 4ZN3A 1P8GA 2COLA 3BREA 2E5GA 1DARA 1ZAWA 4NLSA 5KFRA 3M2RB 4FZVA 2HHQA 4O3SA 1WORA 2WCXA 4RW9B 5JMNA 3DLGA 2HNDB 3D1QA 2I0XA 2UUAF 3DRYA 4CNZA 3P5TL 3J80Y 3G6XA 1XNRF 2YQ1A 1KTVA 4IQMA 9ATCB 2EC2A 2EXUA 3GP9A 4CLPA 1PYSB 1YJ7A 2B6AA 2VU5A 1HQUB 3PXGa 1R0AA 3VAKA 2ZITA 1X4FA 2E7VA 4CCHA 2FTRA 5D3GB 2HKEA 2FIUA 4CLYA 2OTLS 2DCLA 4ALZA 4DHVA 1L3SA 2R8GA 3OVSA 4TYBA 5KG3A 1JLBB 3R2CJ 4EK2A 2W9CA 4ZJOA 2FC8A 4C98A 4JI2J 2BMBA 3KMSA 4X64J 2KDOA 3MEGB 4ED6A 2ZWOA 4DV1F 3R9LA 2DRBA 2BW2A 1U6FA 2POKA 5BYQA 3BJYA 2I2YA 3OXFA 1MMLA 2JFDA 4HACA 2IVYA 4LRDA 4F0MA 2YKOA 3CJTA 4OZ0A 3G8SA 1RKIA 1FE4A 3VV2B 1Y3KA 1UKUA 1FK9A 4L6V3 5K5MA 3VQTA 2N3OA 2XMMA 2ERRA 3JSRA 4Q5VA 3PCOB 1PJ6A 2ZH6A 3IGNA 2QLWA 1RAFB 4OI6A 4FDFA 3W66A 4ED2A 4NWBA 3T5LA 1ITPA 2LXIA 4B9LA 4ES1A 3Q8RB 4DQQA 3C66A 3BGOP 2VONA 1YITS 4CH7A 2R7TA 2HW3A 3BSCA 1DLOA 3M6XA 4OV6A 2XI2A 2Z2LA 1S1XB 1URRA 3M2UB 5L39A 3SCIE 1CVJA 3GFZA 4KGMA 2JNJA 1VYAA 3AXKA 3EZUA 2AJ2A 4WK1A 3CE8A 4UQTA 5GADI 3VALA 3ILOA 3US5A 3B6BA 3PIOQ 1ACMB 3QIPB 2HVHA 5DDOC 3V81A 2ASYA 3W8PA 2OEMA 3OTCA 4EMDA 3VZIA 4DPOA 4JV0A 3PEHA 4J9UE 3WBZA 2O67A 3K5NA 4M8LA 1TVRB 1ZOTA 4YDXA 3MM6A 4JI5J 4DBQA 1RT7B 4QR2A 3MR2A 1RTHA 3W64A 3UN3A 3FGVA 3KLGA 3DRRA 4I2PB 2CNNB 2AYGA 3CSKA 1NJYA 3ZZPA 4I6WA 4IOCQ 3BBBA 4DL4A 1SC4B 3BSOA 4UQGA 3AB2B 2MXYA 2YNGA 3F73A 3J7A1 4WK3A 2VFTA 2NUUG 4ZCKA 1BQMB 3M8QA 2OFGX 5HP1B 5HJXA 3IA0A 3LWMA 5AXLA 3AQPA 9RUBA 4Y6IA 1QAJA 3JB9k 3W63A 4DX7A 1PC5A 4ZLJA 4LF8F 2DNZA 4LVOP 3OR2B 1XR5A 4P6QA 4CDIA 4USVA 3BGLA 3KJFB 2QRRA 1VC5A 4KKOB 3BBFA 3ISND 4LR7A 5IWAF 1RWUA 5GAGU 1VC6A 2FVSA 2OD6A 1FWPA 5F8GA 3H7HB 5SZTA 1ZYQA 3CJRA 1T03A 2RNEA 1UZDA 4RU9A 1TL5A 3UFCX 2R8HA 4USMA 3RAMA 2W9AA 1TELA 2YQ0A 4HHHA 2G0JA 2FLPA 3SFUA 2C2RA 2AYMA 3K89A 1RACB 2XC9A 4WFYA 5I3UA 2Y1IA 3PG9A 1RDRA 2W24A 2YQ3A 4WPAA 1N8RT 1NXIA 4IG3B 4JUZA 4RBTA 2MZ1A 4Y65A 2XSJB 1MMDA 5ETPA 4ID5B 1J2VA 4A8KA 2NXNA 5L1IA 1ZM2A 2CQ2A 2JLFA 3GJQB 3JAMU 4UF4A 2G2ZA 1UWAA 4JI1F 4MAKA 4ECYA 4ECZA 3MMBA 1Q5VA 3HHDA 2DNYA 2KVIA 1MN7A 2F1FA 4B3MJ 1JLFA 3CCRS 5HMXA 1OJ4A 2CJYB 4DLGA 2CXEA 2KXNB 2YPYA 1S6OA 3MEEA 4F4ZA 4NL5A 4A48A 5C42A 2DO4A 3CGIA 1XMQF 4K4VA 4IUFA 5KG6A 2NCKL 3CDBA 3DLGB 3AA8A 3QLHA 1QTNB 4HHJA 1HWUA 4RNFA 3AB4B 2CQHA 2CPYA 2MZTA 2APOA 2B6AB 1V6HA 2VBZA 3PW5A 4ED8A 2BVZA 3KLIA 5A0YA 1JLGB 2J0WA 2QLBB 4X62F 3ZTQA 4PR6A 1SIWB 4USWA 2W9CB 4RW6B 4HL9A 4J9QA 2QLFB 2EK1A 2UVVA 5KFHA 3Q0AA 5GAEU 1E6VB 3FNNA 5J1NA 4P73A 4I6AA 4HACB 1YIJS 3GYNA 2KH9A 3FEZA 4LVNP 2E5LJ 1JMTA 2VBXA 1EQ0A 2DHXA 1FK9B 1H3DA 1XMOF 1B3TA 2ZOFA 2JVOA 5LM7E 5CA5A 3TJ9A 2ZM6J 2KT2A 1TL3A 4MH8A 3V4IA 4H54A 4URQU 4AYBD 2DGVA 3UD4P 3HHEA 4Z7YA 5IOLA 3T6JA 1DZ5A 3K8WA 4YP3A 2GVDA 1VQ4S 1YBAA 2B8QA 5HAOA 1QSSA 1DLOB 3W60A 3GLJA 4QWEA 2ZBQA 4NCGA 4WFXA 3BH7B 1WHXA 1ZBTA 3NCQA 2XTJP 3AD7C 1LW0A 1H7XA 3DXBA 3T1AA 1FJGF 2Q3PA 2ROGA 3I31A 1WHWA 2MQOA 2R7VA 2VOOA 2ZFHA 1M1GA 3TO8A 2V63A 4DQSA 2B9WA 4J9RA 2M9KA 3V81B 2E7XA 1U1OA 1H7WA 1BQXA 3W2WA 1NK9A 2E9TA 3VF0B 4K5SA 1FERA 4NXNF 3PM9A 1LOUA 2I38A 1UFWA 2XNRA 1C1CB 2G1DA 5FLXU 1FFSB 1MLAA 1UFLA 2JOQA 3K5LA 3H40A 1HBOB 4DFJA 2XHCA 3PACA 3GONA 1TTHB 1RTHB 4EYHB 3IAS9 3KLGB 4ECXA 1FESA 2IAJA 3DRRB 2ATLA 5KFFA 2F9JA 4DR4F 2OPRA 3E3XA 3HJVA 4OJHA 3HDSA 1Y3JA 1ZPWX 2BDPA 3CWJA 1EQMA 2C2ZB 2XLKA 3OT9A 4OX6A 2DEIA 2YNGB 3VGSA 2IDLA 4WFBQ 1WF0A 1RBLA 6FD1A 2VG6A 1X4DA 4TLQA 1XEZA 2C28A 4LF7J 5D4NA 4TLRA 1QE1A 1T9VA 2BKPA 2GS8A 2DNMA 3RB4A 2WAQD 2ALZA 5HANA 2UXDJ 5G4DA 2M7SA 1RBAA 2V2QA 2L48A 3AD9C 4HDHA 3RJMB 2PD1A 2CQGA 2HBQB 2WVBA 2PFDA 3K58A 4M5IA 3K59A 4W4MA 1VQ5S 3N5FA 1JKHA 3QAEA 2JL9A 3K8VA 2HNZA 4GKKJ 1JLQB 5H9FK 1VQLS 3Q8YA 4LSZB 2RRNA 2EFOA 1N36F 1G2EA 1B4SA 1YJNS 1C2PA 4X65J 4ZPTR 3T1HJ 3MR6A 1KFDA 3NKYA 2M2BA 2EKNA 5K8MA 3D0HE 1VIOA 3B4DA 4JI7J 4DL0C 2ACYA 3JQKA 5C24B 3F44A 4FYDA 2Z0GA 3N28A 3KMQA 2C3MA 4EEYA 5F8JA 4NZ0A 1OIAA 2KXFA 3PX0A 4FBUA 1WEXA 1W2BR 1U48A 1HA1A 1WHYA 1FRXA 3UCZP 2D41A 4C4WA 1SKUB 2UXDF 5I42B 1LK5A 2K06A 1RWVB 4Y2IA 1EHWA 3TW0A 1UVNA 3DHXA 1VHIA 2RVJA 5KG4A 4RKUC 2K2PA 3FCWA 1PYOB 1ZM4A 3IFEA 4F2SA 1VQOS 5EHHA 2XCPA 3MI7X 3AJ1A 4ZHRB 4DV5J 2Z2YB 1TZ0A 1PKUA 3CCJS 4WFNQ 4DV0F 4M94A 1JLFB 3GZ7A 1HI1A 4DUZJ 5B0GA 2D1CA 5AXNA 2Z30B 2OAUA 1F5BA 1RP5A 1CULA 3T1HF 4D3GA 1FKOB 3BR8A 3OTOJ 1CJVA 1YRXA 1Q16B 3T3FA 1S9EB 5HATA 2AEFA 2WOMA 5FLXY 2W7OA 4YR2A 2FB0A 2VOPA 3QLHB 3OL9A 4PQUA 2HQIA 5IQ6A 1OPIA 2D3OR 3N79A 4P52A 3NGTA 3DXSX 1Y10A 2KM8C 3FMWA 5E3PA 3HSDA 4YDDB 3ILIA 4BCAA 1SC3B 5AXKA 3IBCB 3KLIB 1ZM3A 2IDEA 5A0YB 5EWEA 2CG4A 5CABA 2CPHA 5F3ZA 4LR8A 3I82A 1DQ8A 4S0MA 2CWXA 3THPA 5JVHQ 3TP2A 1YVFA 2HBYB 2YPZA 1G4CA 2LYVA 3HHKA 4KIAA 3UN5A 2ZHOA 2DHGA 2RMLA 4KHRA 2QV6A 2J5AA 1PYTA 1RWOB 2VFSA 1H72C 1KQGB 4EI2A 2QMWA 4HHUA 4WWSA 1MMNA 4ANCA 2DGWA 2L41A 2W7PA 3GIKA 1ZAXA 1B7YB 2HQDA 2IA6A 7FD1A 4OYZA 4ED0A 1YX2A 1KQKA 4YR0A 4K8RA 1H73A 3MF5A 1V9OA 2HVIA 2PMHA 2BR0A 1RT2A 2R8IA 3MAAB 1IBCB 4JV5F 4NXMF 4NLVA 4UY8T 1I1GA 4F02A 4YFUA 2GVDB 4OX8A 5E3AA 3OUYB 3AOAA 5RUBA 2VC0A 1K8AT 3KDNA 5K14A 1D09B 2AIRB 3NGRA 5B0AA 4ES2A 4B17A 1CS4A 1RHRB 1DFDA 1S7IA 4TYAA 5GADU 3T5HA 2OELA 3TVYA 2KT3A 1AFIA 1TL4A 3R8YA 2OGUA 4CO5A 2BZ2A 3PV8A 2RHSB 2EWHA 1FRIA 2DXFA 1FXRA 1PSDA 2OMOA 3L09A 1J27A 4OJ3A 2YNIA 4X4QA 4KH0B 4XIUA 1SV5A 3T41A 1F3VA 2HIYA
chains in the Genus database with same CATH topology
3R6GB 1F9EB 3QNWB 2QL9B 3R7SB 3SIPB 3R5JB 2C2ZB 1I51B 2HBRB 2HBZB 1RHQB 2QLBB 3P4UB 3GJSB 3D6HB 4DCJB 3P45B 1QDUB 2QLJB 1RWKB 1IBCB 1I3OB 2CNLB 2H4WB 2QL7B 3GJTB 3NS7B 2CNKB 2C2OB 3GJQB 2QLFB 2XYGB 2XZDB 3KJFB 2H65B 2Y0BB 2C2KB 2CNOB 4ZVRB 2H5IB 2XZTB 4DCOB 3IBFB 1RE1B 1SC3B 3IBCB 3KJNB 2FQQB 3R7BB 2H48B 3KJQB 1RWVB 2CJXB 2XYPB 1RHJB 3GJRB 2CJYB 2CDRB 1PYOB 2H51B 1PAUB 2CNNB 3RJMB 1RHRB 1RWNB 1GFWB 2XYHB 4ZVPB 4ZVOB 3EDRB 2HBQB 1ICEB 2QL5B 4ZVTB 5K20B 2HBYB 1SC4B 4DCPB 1SC1B 2H54B 2C2MB 2DKOB 1RWWB 5IC6B 1BMQB 3EDQB 1RWPB 4ZVQB 2C1EB 3R7NB 2P2CB 1RHUB 1RWXB 1RWOB 1NMEB 1RWMB 4ZVUB 5IC4B 1RHMB 1RHKB 3R6LB 2H4YB 1QTNB 4LSZB 4JB8B 2H5JB 2Y1LB 3D6FB 4ZVSB 3D6MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6G B;  1F9E B;  3QNW B;  2QL9 B;  3R7S B;  3SIP B;  3R5J B;  2C2Z B;  1I51 B;  2HBR B;  2HBZ B;  1RHQ B;  2QLB B;  3P4U B;  3GJS B;  3D6H B;  4DCJ B;  3P45 B;  1QDU B;  2QLJ B;  1RWK B;  1IBC B;  1I3O B;  2CNL B;  2H4W B;  2QL7 B;  3GJT B;  3NS7 B;  2CNK B;  2C2O B;  3GJQ B;  2QLF B;  2XYG B;  2XZD B;  3KJF B;  2H65 B;  2Y0B B;  2C2K B;  2CNO B;  4ZVR B;  2H5I B;  2XZT B;  4DCO B;  3IBF B;  1RE1 B;  1SC3 B;  3IBC B;  3KJN B;  2FQQ B;  3R7B B;  2H48 B;  3KJQ B;  1RWV B;  2CJX B;  2XYP B;  1RHJ B;  3GJR B;  2CJY B;  2CDR B;  1PYO B;  2H51 B;  1PAU B;  2CNN B;  3RJM B;  1RHR B;  1RWN B;  1GFW B;  2XYH B;  4ZVP B;  4ZVO B;  3EDR B;  2HBQ B;  1ICE B;  2QL5 B;  4ZVT B;  5K20 B;  2HBY B;  1SC4 B;  4DCP B;  1SC1 B;  2H54 B;  2C2M B;  2DKO B;  1RWW B;  5IC6 B;  1BMQ B;  3EDQ B;  1RWP B;  4ZVQ B;  2C1E B;  3R7N B;  2P2C B;  1RHU B;  1RWX B;  1RWO B;  1NME B;  1RWM B;  4ZVU B;  5IC4 B;  1RHM B;  1RHK B;  3R6L B;  2H4Y B;  1QTN B;  4LSZ B;  4JB8 B;  2H5J B;  2Y1L B;  3D6F B;  4ZVS B;  3D6M B; 
#chains in the Genus database with same CATH topology
 5LL6 d;  1IM6 A;  3UW1 A;  1I6J A;  3RR7 A;  2MKJ A;  2SXL A;  2B4P A;  3T9Z A;  3HFV A;  1VRU A;  1XMB A;  2FGC A;  1DHM A;  2A18 A;  1NPR A;  4RO0 A;  4C0O C;  4UUW A;  2X51 A;  2ZH5 A;  3AJD A;  4OX7 A;  2F5G A;  2IAJ B;  3GIR A;  3UCU P;  2VH7 A;  3ENW A;  1D8Y A;  5F8M A;  2OPR B;  3QID A;  4NCA A;  3AAW B;  3THT A;  2FLN A;  1HBM A;  2B9Y A;  1WKK A;  4RLE A;  4MTP A;  4N8O A;  4I1T A;  3TX8 A;  3MFI A;  3DOM A;  2CJX B;  1ZAV A;  1SUQ A;  2AT1 B;  2HHP A;  4V1A k;  4ITS A;  3IAM 9;  2IBO A;  2LCW A;  3QO9 A;  3EDR B;  1OY8 A;  2DH7 A;  5K20 B;  4DPW A;  4P75 A;  5HQL A;  1UEU A;  2IMW P;  2VG5 A;  3MCN A;  1NB2 A;  4C11 A;  2E9R X;  4JP8 A;  1MN9 A;  4RW4 A;  1YHQ S;  2W8K A;  4OYI A;  4ES3 A;  3D28 A;  2ZH2 A;  1FNX H;  1U1N A;  1JKH B;  1Q86 T;  1GXT A;  3R5J B;  3BDE A;  3FCV A;  1GXL A;  3S01 A;  2HNZ B;  2CPX A;  1R8C A;  1G3O A;  2ZOG A;  3MUM P;  4P2F A;  1BWV A;  3RB3 A;  2OML A;  4DL7 A;  1U25 A;  1P9Y A;  4EWT A;  1FXD A;  2CPD A;  4AQY J;  3OL8 A;  2R7X A;  3QT5 A;  2CPE A;  4K4S A;  3FKB A;  1X4B A;  1UPM B;  2CJQ A;  2GQQ A;  2C2D A;  1RWN B;  5KT3 A;  2DR9 A;  3T1Y F;  4MK7 A;  2ACM A;  3PJX A;  3NNH A;  5L9N A;  1VRQ C;  2UV8 A;  1N54 B;  1AB8 A;  2CQD A;  1RAO A;  2HGM A;  2VQF J;  4RBU A;  2M52 A;  2QGF B;  1U6B A;  4H4K A;  4J5O A;  3SCL E;  3KLH B;  5L1J A;  3EGV A;  3HVT B;  4DSJ A;  4IR9 A;  1IWG A;  5B0C A;  4DL6 A;  1VQ9 S;  3I5B A;  2GMJ A;  1MU2 B;  4DF8 A;  3I9Z A;  5D8H B;  2YWK A;  3DLH A;  2HFZ A;  3PO4 A;  2BUN A;  5CYJ A;  1CUL B;  1B0T A;  1ZPV A;  2P9E A;  1FJE B;  2EK6 A;  4NLP A;  2D9P A;  1CJV B;  2OP5 A;  1BHN A;  2LQ8 A;  3ULH A;  1JLA B;  3HVR A;  4LFC J;  2DNN A;  1ZZN A;  1FFW B;  8AT1 B;  1TK8 A;  4DSE A;  1S97 A;  4O3O A;  1IKW A;  3QT7 A;  2DIU A;  1F5A A;  4ZVT B;  2VOD A;  4GMK A;  3FCH A;  1NEE A;  4DCP B;  2Y0S D;  4LF2 A;  1GXU A;  2E29 A;  3AH6 A;  5KT2 A;  4EGL A;  3UI3 A;  5CXT A;  2RQC A;  2OSQ A;  4Q7A A;  4FYY B;  4PG5 A;  1B64 A;  1KOH A;  2KG0 A;  1EZZ B;  5FII A;  2ZC4 A;  1J5E J;  1O5J A;  3ZZZ A;  4IFY A;  3FBF A;  3TZX A;  1ZZF A;  5DG9 A;  3NS6 A;  4ECS A;  3HXM A;  2XI3 A;  3HF5 A;  4E0D A;  5C7P A;  3EYZ A;  2CG8 A;  2PSZ A;  3ZZY A;  3QGP A;  3IBF B;  1T0T V;  1X9W A;  1HHT P;  2J7W A;  3C16 A;  1UJ5 A;  2R2S A;  4V19 X;  3M2V A;  1ZTT A;  3CDE A;  2JWN A;  3WIV A;  1GX6 A;  3O44 A;  3DM2 B;  4M5D A;  5DG8 A;  3OTD A;  4WBF A;  5C25 A;  4LUB A;  4F4X A;  3CT9 A;  4U95 A;  4C8Y A;  2GO8 A;  2ZZT A;  3VAJ A;  4C8O A;  3BGR A;  5K14 B;  3A13 A;  5BJR A;  4LF5 F;  4F7V A;  3M9N B;  3DI6 A;  3SCK E;  1X0F A;  4KBI A;  4AE5 A;  1CS4 B;  3OHB A;  5EDW A;  2IMO A;  3R6G B;  1SL2 A;  2PI5 A;  2V4R A;  3FSX A;  2PMW A;  3IRW P;  1F0X A;  1NJW A;  3PO5 A;  2RF2 A;  3OFH A;  2V6A A;  4BC9 A;  2KN4 A;  1RHQ B;  1OO0 B;  1WWH A;  4AXI A;  1WKL A;  1SV5 B;  3Q8Q B;  3FEX B;  1RTD B;  5A8W A;  1S4F A;  4YOE A;  2EEY A;  2VJU A;  1C0U A;  4M5H A;  4J9M A;  4YY3 F;  4H4O A;  2VBY A;  2ALY B;  1HMV A;  3IR6 B;  1Q81 T;  3CD0 A;  1TKT A;  2J9E A;  3ZNU A;  3JSB A;  3TRG A;  3TUZ C;  2KHC A;  4Q2L A;  5ETS A;  3A1Y G;  2FYX A;  1S1U B;  3BO2 A;  1RB0 A;  1T9T A;  2KU7 A;  3M32 B;  3V6J A;  3GYX B;  3EWG A;  1HAR A;  2J8S A;  3DOM B;  2GVZ A;  4HI1 A;  1UET A;  3H25 A;  4KHM A;  2HUR A;  3UD3 P;  2N7Y A;  1FNM A;  4IYQ A;  4FNH A;  2BQU A;  3UR0 A;  3OL7 A;  1NJI T;  3CDW A;  4Z37 A;  4ECQ A;  2MQP A;  3QZ8 A;  3V2U C;  2CAD A;  3L4B C;  1SPB P;  1WTB A;  2W4C A;  2V8D A;  2N4C A;  4UZB A;  3GFH A;  4JV2 A;  1QUV A;  3GWC A;  3WX4 A;  3HHL C;  4RW4 B;  1EIY B;  3LP0 B;  1NND A;  5KFL A;  3TAM A;  2NS1 B;  2ASL A;  2DBB A;  3NBP A;  4YQW A;  2H5I B;  4JI3 J;  4X4U A;  3NAH A;  3H8Y A;  3RRK A;  4U9R A;  2IFX A;  3MM8 A;  5AE2 A;  3L9Z A;  3OFE A;  2ADC A;  1TL7 A;  4NAS A;  2FHJ D;  4K59 A;  4C97 A;  3KNG A;  1U09 A;  3CJ2 A;  3NP5 A;  2I6W A;  3C6T B;  3UR3 C;  2R7R A;  4F25 A;  4P2S A;  1JXL A;  1KEK A;  1XK8 A;  2X1A A;  1X9M A;  4NRT A;  4R5P A;  3GMG A;  1H6K X;  3T9N A;  1X0P A;  3EUN A;  2UV8 G;  2BM0 A;  3P96 A;  5HBM B;  4OHZ A;  2X1F A;  3NG8 A;  4WZQ A;  3QZ7 A;  2PC6 A;  2RUG A;  2BYC A;  2Q43 A;  4DWI A;  3FBB A;  2GAH C;  2IRY A;  2EW9 A;  1KBR A;  1N6Q B;  4TVA B;  2Y9H A;  3NOG A;  4QR1 A;  3K7R A;  4CYU A;  1L3K A;  4MT1 A;  1U02 A;  3CD5 A;  3OVA A;  1NM2 A;  1VI7 A;  3ZZ0 A;  1Q95 G;  2HGL A;  1GNK A;  3ICL A;  2ZH4 A;  1M5K C;  1VCT A;  2JEF A;  2QA1 A;  1IKX B;  3TQE A;  1S10 A;  2GGP A;  4ZVH A;  1GAO A;  1S9G B;  2NZC A;  1IKW B;  2WRM A;  3LO3 A;  2WK4 A;  1F9E B;  4NLW A;  2DRD A;  2K3K A;  4K4T A;  1IKV A;  4KQZ A;  2QJ3 A;  1VLO A;  4HT5 A;  2RU9 A;  2J6S A;  4DL2 A;  3I5C A;  4WFZ A;  1RIS A;  3C3L A;  1YJR A;  4F3Q A;  1AYE A;  1K1Q A;  5FJ4 A;  1KVI A;  1G6B A;  3E01 B;  3VAF A;  4ZVF A;  1TV6 B;  4KY3 A;  2BE2 B;  1RT1 B;  3EZO A;  1OSC A;  4F0K A;  2O1P A;  2EFP A;  4BWJ A;  2V34 A;  1CG2 A;  1RCO B;  4KTQ A;  4UUX A;  4G65 A;  4K0K F;  5ETQ A;  4QJV A;  3KWM A;  1RTJ A;  3S8S A;  1Q8K A;  2RH3 A;  4ZVO B;  2ZDO A;  3J7Y U;  2RIJ A;  4P9S A;  4DI6 A;  3R5B A;  5SUH A;  1CPZ A;  3K17 A;  5LMU F;  2P5V A;  3QGH A;  2OO4 A;  4JI4 J;  2CPI A;  1RWX B;  1B0V A;  3CJS A;  4GVB A;  3N6L A;  4M5D B;  5CYM A;  3G2X A;  2CJK A;  3G6V A;  3ILJ A;  3H59 A;  3G6Y A;  1N32 F;  2LEB A;  1NK7 A;  1DBD A;  3VGV A;  3GIL A;  1WKJ A;  3CC7 S;  5LSO A;  5THW A;  2K1R A;  3D54 A;  3BGR B;  4A8F A;  3C19 A;  2R7S A;  2C3O A;  1TK5 A;  1HIY A;  3B4M A;  4PG7 A;  3DI6 B;  2FHO B;  2H4W B;  5CH7 B;  5B7W A;  5DRK A;  5A8R A;  1FRM A;  3GTY X;  4J9S A;  2OD4 A;  1HBN A;  3MPW A;  1NU4 A;  3C6U A;  3HUL A;  2F4V J;  5CYQ A;  2RF2 B;  3W5Z A;  4ZCM A;  3RRG A;  4LF4 J;  2GIQ A;  2GV1 A;  2KB2 A;  5ETN A;  5LXY A;  3WX8 A;  1NDC A;  4I2Q A;  4B3S J;  1WI6 A;  1RXO B;  4X4T A;  2GHW A;  3BYP A;  4LQ3 A;  2QL5 B;  1P6T A;  4LF6 F;  1M5H A;  2VUG A;  3LUY A;  3R27 A;  2AEJ A;  4YB5 A;  5L8R C;  4OYM A;  1OQ6 A;  1HMV B;  4DR2 J;  4I7F A;  4RBV A;  1TKT B;  1CJU A;  5L9X A;  4XPE A;  3PX4 A;  1M5P C;  4DZD A;  2MTL A;  5F8H A;  4M5J A;  1L5U A;  1RT5 A;  1BC6 A;  4CP5 A;  2HAF A;  4WTO B;  1WG1 A;  3M30 B;  2F8M A;  4V19 J;  3MMA A;  2YBV A;  1QD1 A;  2CZ9 A;  3AY0 A;  2FVQ A;  4NEZ A;  3VAM A;  4F8R A;  2L9N A;  3GU0 A;  2MGZ A;  2Y1R I;  4DR6 J;  4K4W A;  1FKA F;  4DL3 A;  3R1H A;  3DYA B;  2BA9 A;  1SL0 A;  2NYH A;  2J7U A;  3A3O B;  3L7P A;  1VJQ A;  4XDC A;  3LP2 B;  1HWI A;  2DNH A;  2HHH F;  1IQT A;  3DN9 A;  4CLU A;  1IJE B;  2E1A A;  2H54 B;  2B4O A;  4DR2 F;  4ZS6 A;  5IT4 A;  3OSN A;  4FF2 A;  1VQN S;  2JHE A;  2P9C A;  2QMX A;  2F3J A;  4QBU A;  1FTC A;  4XTT A;  4ZN1 A;  3GV8 B;  1FKP A;  4O3N A;  1REV B;  3IRX A;  3M8W A;  3MED A;  4CLT A;  4N56 A;  4KHP J;  1QLN A;  2H1Y A;  2W8L A;  1N33 F;  4H4K C;  3P4U B;  3KUH A;  1YGY A;  3RBZ A;  2JLE A;  4CLW A;  1R8A A;  1BLU A;  2DY9 A;  3NWG A;  1N0V C;  3ISN C;  1CEZ A;  1WSV A;  2ZD1 A;  2HSE B;  2IM3 A;  2MY8 A;  3UDL A;  3CJK A;  4A4J A;  4KGV B;  4B9S A;  1R31 A;  5EGY A;  2MLZ A;  1VQ6 S;  3J7Z T;  1F2H A;  1IR0 A;  2XS2 A;  2CZ4 A;  3VGT A;  1YBU A;  5LT5 A;  3M1V A;  3ENV A;  2LEP A;  1N52 B;  4J9P A;  1SQG A;  4JI0 F;  2R3V A;  4R8U B;  1XN9 A;  1BMQ B;  2YY3 A;  3A8J A;  3BPS P;  2FY1 A;  3MZI A;  4NE9 C;  1T95 A;  2MB0 B;  4QIF A;  4CQ1 A;  4QWA A;  4M5N A;  4IG0 A;  4CYU B;  3FRY A;  4UOG A;  3TZY A;  1BQN A;  4I56 A;  2CIM A;  1Q78 A;  2JDJ A;  4DLE A;  3OW2 R;  1D1U A;  2VPZ B;  1X5P A;  4P2M A;  2UXC F;  3S1T A;  4M63 A;  3IS9 B;  3CCM S;  4ZDN A;  2B56 A;  1HHS A;  4OLO A;  4WFA Q;  4YB6 A;  1LWC A;  2HZC A;  3EVW A;  3R5C A;  5DET A;  1DTQ A;  2CPZ A;  1RHJ B;  4IO9 Q;  3TYT A;  1KKH A;  3LAM A;  1FRK A;  3POT B;  1YZ7 A;  4OZ3 A;  3MOZ A;  2PT0 A;  4BWM A;  3GYG A;  3P8B B;  3VHQ A;  3QJL A;  1Z2L A;  5E5N A;  2PN6 A;  4ZCI A;  3PYE A;  4B3R J;  1T7P A;  2PGC A;  1OYE A;  3X3U A;  1M1H A;  4ECW A;  2XCA A;  5B09 A;  2B5J A;  4LSN B;  5D15 A;  1JNZ B;  4PWW A;  4AD6 A;  1Y9O A;  5T14 A;  2MMY A;  4K7Q A;  2K8G A;  4OHX A;  1HLW A;  4PRF A;  2E5I A;  1N88 A;  4G1Q A;  4N47 A;  4RZR A;  2L9D A;  1YWX A;  2Z58 B;  2LQJ A;  2IJR A;  4PEO A;  5E0O A;  1VDH A;  1OMS A;  1RQ0 A;  4O3Q A;  1GMW A;  4KRW A;  3R5G A;  3CUL A;  1JWW A;  3R5D A;  2IM2 A;  2W4P A;  3PYG A;  2Q6B A;  1IBK J;  4DR1 J;  5J2P B;  3EZ5 A;  2PEB A;  4URS A;  4OZ5 A;  3PIP Q;  2HMI B;  4N41 A;  3QAT A;  5A8R B;  4CO3 A;  1HBN B;  3BKT A;  3CF5 Q;  3NWR A;  1FEE A;  1IBL J;  3C6U B;  1CQN A;  3GIM A;  4ZP8 A;  3I6P A;  1HW8 A;  1N5Q A;  3MCS A;  1YZ6 A;  3F0N A;  2W2Q P;  4F4K A;  1QAX A;  2AX0 A;  4FF3 A;  2XS7 A;  2N82 B;  1LWF A;  1TMM A;  2UUB J;  1RHK B;  1AA1 B;  1KR4 A;  1X4C A;  4F3O A;  3NNA A;  1X4G A;  4I2Q B;  1NDK A;  2FVC A;  5KFX A;  2JC0 A;  4HTJ A;  3WC0 A;  2EFV A;  3RB6 A;  3OFF A;  5KG0 A;  2J8A A;  5HI7 A;  3HPO A;  4I7F B;  1ZET A;  3S6E A;  5CAA A;  1CJU B;  3U1M A;  3GR0 A;  3I55 S;  2HK2 A;  4Z7C A;  1H98 A;  5IM0 A;  2NUH A;  2CQ3 A;  4PYA A;  5D0G A;  1RT5 B;  3H5S A;  4P10 A;  3GFX A;  4W90 B;  4OYW A;  3KJQ B;  4RW8 B;  4MK8 A;  2W9B A;  4DS5 A;  4DFP A;  1IBM J;  2BAN A;  3P3D A;  2V4J A;  5GAH I;  2HK3 A;  2UUC F;  5CD4 H;  1PCA A;  4HKQ A;  5G0R A;  3AXM A;  4QIW D;  1EP4 B;  3CIZ A;  4KR0 B;  1BUX A;  1HYS A;  4CO0 A;  1J5O A;  3J80 U;  3HZG A;  2HQF A;  4NCB A;  3CJ3 A;  1JLE A;  2UXB F;  3KK1 A;  3EX7 B;  1HNX J;  3F41 A;  4CO2 A;  4DV6 F;  3NGS A;  1SQE A;  2G0I A;  2AJF E;  1F1B B;  5ETT A;  1Z1Z A;  4OYP A;  1D9F A;  4NEY A;  4LFA F;  1F3F A;  4ELT A;  2MQL A;  2LLZ A;  3W2V A;  1TU0 B;  2GMH A;  1N34 J;  3MUT P;  4FYW B;  2E1P A;  2AJ4 A;  2X7I A;  5EWG A;  3JTP A;  3SI8 A;  1U4B A;  3MEK A;  2YX4 A;  3DOK A;  3OBI A;  2J76 E;  4XDD A;  1PG5 B;  1FKP B;  3NY0 A;  2RRB A;  5DLF A;  1RYS A;  3IRX B;  3MED B;  4USU A;  3EGZ A;  4DX8 H;  1KVK A;  4LF9 J;  3KYL A;  3VZH A;  1YSJ A;  1S48 A;  1HNZ J;  2HZA A;  1U49 A;  3SMZ A;  3GSI A;  1VQS A;  4GKJ J;  4QU6 A;  4QU7 A;  2RQM A;  1I94 F;  3H0P A;  1ROF A;  3FMB A;  2G9O A;  5ETL A;  5B0F A;  4USI A;  1IKY A;  2B7B B;  1R0B G;  3MEC A;  2AKW B;  2GHP A;  4UW2 A;  2NRE A;  4NLY A;  3BGF A;  3IM8 A;  3M1V B;  4HVZ A;  2VQE F;  2FJX A;  1LWE B;  4O23 A;  5KFY A;  1XTZ A;  1WOS A;  3DLK B;  3MM9 A;  3O5T B;  2HRU A;  1S59 A;  1FWK A;  3N6M A;  1LXN A;  5E3Q A;  1HI8 A;  5HL7 Q;  1CJK B;  5HLF B;  2HFS A;  3NGU A;  2VKZ G;  3Q89 A;  2B4U A;  4KV8 B;  4IG0 B;  7AT1 B;  2CQP A;  5IFM A;  4MFB B;  1C0T B;  2GX8 A;  3JSY A;  2M0G B;  4UOF A;  2GC8 A;  2YKM B;  4KE5 A;  1BQN B;  4LJM A;  3FBC A;  3CD6 S;  1WEZ A;  2DCU B;  1X31 C;  2DY1 A;  4C0B A;  4MYT A;  3M8P A;  3CJ8 A;  3D1O A;  5KFW A;  3Q86 A;  2E5J A;  4MIB A;  1K0T A;  3P49 B;  4BDP A;  3K5M A;  2PII A;  2MHE A;  1QY7 A;  3BV8 A;  4H4M A;  1UAW A;  1KON A;  4U7C A;  1Q79 A;  4BBY A;  1LWC B;  5IC6 B;  4OX9 F;  3CPW R;  4M5M A;  3TJA A;  3A8I A;  1DTQ B;  2L08 A;  2DR6 A;  3TAQ A;  2V9K A;  5A8K A;  3E8O A;  1BGX T;  5IT9 U;  4ZVS B;  2JVR A;  1YDL A;  5A6P A;  3ETM A;  1HWL A;  1WC3 A;  4N8N A;  2V9W A;  2M8H A;  4ZK7 M;  3K57 A;  2DT9 A;  2PI4 A;  4OV1 A;  4L73 A;  2FJA B;  2WON A;  2MKC A;  4HH1 A;  4WIQ A;  4OI0 A;  2DNL A;  4IOA Q;  2MKY A;  3JTO A;  3PJ9 A;  2KZZ A;  5M2R A;  3DMJ B;  1I3O B;  2OPS B;  1KN6 A;  2B5J B;  4ILR A;  2UU9 F;  2Z56 B;  2H65 B;  4KFB B;  3GV5 B;  4DX5 A;  5IZH A;  5HN0 A;  3W5Y A;  5KOX A;  3DRS A;  5D4P A;  3EGN A;  3QSI A;  3F56 A;  2CQ4 A;  4YS2 A;  4PAA A;  7FDR A;  2HFO A;  1RZM A;  1TQL A;  3C15 B;  1FT8 A;  1FD8 A;  2A3J A;  2DJW A;  5HSP A;  5J1P A;  3FQK A;  4Q43 A;  4ZKA A;  2HLU A;  3IR5 B;  1RWM B;  2ZZM A;  4L72 B;  1Y00 A;  3OSP A;  3DHW C;  3TUI C;  1S6P B;  1QM9 A;  1URN A;  1UW4 A;  5AJ3 J;  3HVW A;  2XZW A;  5KFK A;  3HZE A;  4Y28 C;  1S57 A;  1LWF B;  1VQP S;  3D9B A;  3CC4 S;  3KK3 A;  2XMV A;  4OI3 A;  2FUG 9;  2XEX A;  4ZLL A;  5J2Q B;  3N5B A;  2A2D A;  3L7O A;  3LGH A;  1D3W A;  1NHK L;  3H90 A;  4YB1 P;  2QLX A;  1K73 T;  4O44 B;  3QGG A;  3TEG A;  5F8L A;  4FS2 A;  2FQQ B;  3FVY A;  1XWL A;  3DLJ A;  3LPE A;  1NUE A;  1W2I A;  4FYX B;  1A9N B;  1HD1 A;  2CAJ A;  1TUW A;  5HMZ A;  2QA2 A;  4JI2 F;  4X64 F;  2NXJ A;  2AZ3 A;  1QAY A;  2B9E A;  4PKD B;  1SC1 B;  2VFU A;  1NBE B;  4LIW A;  5KFC A;  2MZR A;  2DNQ A;  3DRP A;  2W9B B;  4Z2X A;  2E7W A;  1S1V B;  2HLT A;  3LW5 C;  1RKJ A;  1RA7 A;  1LNQ A;  4USK A;  2FC9 A;  3PYD A;  3X1L B;  5B0D A;  5G0R B;  3TAN A;  5HK4 A;  1HYS B;  4C8Z A;  2QSW A;  1E6Y A;  4ELU A;  3Q8V A;  2EFQ A;  2IYI A;  4DJB A;  3KTQ A;  4Y2K A;  4DV2 J;  1HW9 A;  3DLL Q;  1IR1 A;  3W5X A;  4ENO A;  2CQ0 A;  3HI9 A;  3GIJ A;  4I67 A;  4B9V A;  5IT9 Y;  1S49 A;  3Q83 A;  4X66 J;  2OI2 A;  1FHT A;  1K44 A;  4ZVE A;  2LDY A;  4Y2M A;  1WJ9 A;  4OHW A;  4PPZ A;  4F67 A;  2FVR A;  3W3S A;  1M1K T;  1UJ6 A;  1T8E A;  5J2M A;  5T7L A;  1S99 A;  3JXO A;  3DOK B;  5DQH A;  2VG7 A;  2U2F A;  3OXG A;  3TOQ A;  3I0R B;  1G1X A;  3L3C A;  2NQP A;  3MM5 B;  2YWG A;  3G71 S;  1C1B A;  3A4T A;  2RT3 A;  2W1B A;  2HWH A;  3R6L B;  4DMZ A;  4C3K A;  3NOC A;  3SXL A;  2RE1 A;  1B7F A;  4P71 A;  1N48 A;  2A1B A;  4UTG A;  4JI8 J;  1XQI A;  2MZJ A;  1IKY B;  2VDI A;  4LMZ A;  5ETK A;  4JI5 F;  1AW0 A;  1K47 A;  3LTO A;  3IGV A;  3MEC B;  1U8W A;  4AND A;  5KFA A;  4DDF A;  3FSY A;  2WVD A;  5KG2 A;  1TKX A;  3MM9 B;  2QTW A;  2G2O A;  3M4X A;  5T41 A;  3LAL A;  1SKW A;  4WU2 A;  3FQL A;  4YEA A;  4RUA A;  3RBD A;  1FE0 A;  4BC7 A;  1RYR A;  5F41 A;  5HO4 A;  4IFV B;  3BO3 A;  2LFV A;  4ILL A;  3NEK A;  1GFW B;  2BEF A;  4R0E A;  1W25 A;  2UUW A;  3GR1 A;  2KYX A;  2C2M B;  1OS5 A;  2C1E B;  1H2T Z;  2RB7 A;  5KFS A;  4JYA J;  4J9O A;  4NLQ A;  3M8P B;  1VBY A;  2AMC B;  4TXS A;  4Y00 A;  1ZS6 A;  4USJ C;  3Q24 A;  3MMC A;  4NLR A;  4H4M B;  3DOL A;  3CJ0 A;  1BE4 A;  4FXV A;  1S0O A;  2KYZ A;  3OPK A;  2V8P A;  2XWY A;  4X4P A;  5C2G A;  2BJ7 A;  1UP1 A;  1SVD A;  1SJ3 P;  2ZWP A;  1TKZ A;  2I5J A;  5A8K B;  5L38 A;  1GX5 A;  3IG1 A;  2QL7 B;  1HHQ A;  2AYE A;  5FD1 A;  3ZC4 A;  3I4P A;  3CCL S;  2CQI A;  3K0J A;  4DR5 J;  2OSR A;  3PRV A;  4O3R A;  1HR0 J;  4KGZ B;  2W4D A;  3H20 A;  2EKY A;  4NLD A;  4WII A;  2QEX S;  1UMJ A;  1UCN A;  2E1M C;  2W2M P;  2OPQ A;  3CJ5 A;  3UDC A;  1JK9 B;  4ED4 A;  5EWF A;  2D3O 1;  2K3I A;  2JRS A;  1EX8 A;  2ZNY A;  2XMW A;  1RUS A;  3MTJ A;  1R0A B;  4KAI A;  1RT3 A;  4CLK A;  3MFH A;  2CZV C;  2HS3 A;  5F8N A;  2QA4 G;  2NYI A;  5IS2 A;  5HMY A;  4K5R A;  1Y7P A;  2IIH A;  5DGA A;  2V0N A;  1R8H A;  5DDR C;  4B3M F;  5HVG A;  2DIS A;  3AJ2 A;  2KM8 B;  3BH6 B;  3BDP A;  4DCJ B;  2MJU A;  1VRT A;  4ZOS A;  1LFW A;  1VBZ A;  5J1E A;  3IO1 A;  4OZ2 A;  5M2U A;  4QPT A;  5F8I A;  1CC8 A;  3QGI A;  3ZFV A;  1YI2 S;  3KG1 A;  4A46 A;  5HRO A;  3KXD A;  3QWP A;  3BEG B;  1X4A A;  3TUP A;  1HNW J;  1HBU A;  1MSW D;  3M7V A;  1NRK A;  1RU1 A;  2EBE A;  4FKY A;  3CTR A;  1WHV A;  1VOM A;  3D66 A;  2IJF A;  1GK8 A;  3DGP A;  2D74 B;  5E7O B;  4KPY A;  3QSY B;  1WSR A;  4CLL A;  4DR3 J;  3DDN A;  1P1L A;  4A8Q A;  3LQV A;  1GMU A;  1LW2 A;  2RDJ A;  4ELV A;  2QL9 B;  2ZUA A;  3CNQ P;  3R3T A;  3M8Y A;  1X4E A;  1I51 B;  2HBZ B;  3DRP B;  4Y0F A;  5KFZ A;  3MD3 A;  1RWK B;  2ZEJ A;  2J0X A;  2E5L F;  3C8Y A;  3M8R A;  5GAH U;  4J37 A;  1NH7 A;  1Y4Z B;  4F2R A;  3M2R A;  2AGO A;  1NLK L;  2HPU A;  1P9Q C;  3HSG A;  2PFF B;  2QT7 A;  2YX7 A;  2CKW A;  2F8H A;  2ZM6 F;  2AU0 A;  1EAY C;  4DV7 J;  5H9E J;  3MM6 B;  2XMK A;  2CDQ A;  4DSL A;  5KT6 A;  4C3L A;  4X4N A;  2I9S A;  5AE3 A;  1NK8 A;  2ZC3 A;  1OSD A;  1MNE A;  2Z57 B;  2EBG A;  5D3G A;  3LH2 S;  4JI6 J;  1RWP B;  1LXJ A;  3DLB A;  1H38 A;  4DPU A;  5HMW A;  2W01 A;  3MAH A;  5T7L B;  1N5T A;  5A6W A;  4IRC A;  2FZK B;  2VG7 B;  4WP8 A;  3M8Q B;  3QFH A;  1RAE B;  5JVG Q;  5KFG A;  2WW4 A;  4RU2 A;  1C1B B;  4UZC A;  4R0J A;  2Y8W A;  1HL6 A;  3ENA A;  2IM1 A;  1Q53 A;  3RAX A;  1T11 A;  3KKF A;  1OY6 A;  2D3Z A;  4KPC A;  1IXK A;  1B99 A;  4U96 A;  5JJB A;  3CCV S;  5LSR A;  3T5J A;  3TX0 A;  3GPA A;  5BXI A;  2AGQ A;  3LWL A;  5B0B A;  2RS2 A;  2BJ9 A;  4QR0 A;  2B51 A;  1S1W A;  2HWI A;  3TNV A;  4FBT A;  4DS4 A;  2YWF A;  4IR1 A;  2D9O A;  1MG7 A;  1T03 B;  2OPP A;  4RNN A;  1NSK L;  2VZ9 A;  3ZTO A;  3WQP A;  2ZOM A;  1FX4 A;  3TI0 A;  1S1X A;  1Q7L B;  3M2U A;  4O4G A;  3HHL A;  3A8K A;  4DN0 A;  2EI5 A;  1Q8L A;  3FC9 A;  2VPX B;  1YJT A;  1KTQ A;  4NLU A;  5I3U B;  1XNQ J;  4LF7 F;  4CTA A;  4EO6 A;  3QNW B;  2NPI A;  1U2R A;  2BAC A;  1U26 A;  1Y5L B;  1HFE L;  1JJ2 R;  2OTJ S;  3W9J A;  4DUT A;  4RX6 A;  2ZJQ Q;  4MKA A;  1RT6 A;  3MHY A;  2CA9 A;  1F60 B;  5KFD A;  2EFG A;  2BRK A;  1NK4 A;  4C9D A;  1DY3 A;  1QUP A;  3PTW A;  4OIX A;  3DOL B;  2AJ1 A;  2NLW A;  3OVB A;  2FJE B;  1SCJ B;  3MMB B;  2R8K A;  4EZ9 A;  3VCD A;  1RT7 A;  4QOT A;  2QYC A;  3NCR A;  1FDB A;  4A8S A;  5K9F A;  2I5J B;  4GKK F;  1YRT A;  4I2P A;  3W9I A;  1Z4U A;  4B9M A;  3IC1 A;  2HWT A;  1F9H A;  4EBD A;  1JXE A;  5CD4 A;  1U0H A;  4X65 F;  1RU2 A;  2YWE A;  5F9L A;  4U8Y A;  3DKD A;  5HVH A;  4NA1 A;  1JLC A;  2QC3 A;  4ECR A;  1OYD A;  2A6M A;  3MEE B;  1RWW B;  2LDI A;  5C42 B;  2HNY A;  2M88 A;  4B9T A;  1JIH A;  1KLN A;  4JI7 F;  2FPH X;  4DV3 J;  1BQM A;  2MYF A;  2HVD A;  4RWX A;  3PJW A;  1UVM A;  3HLU A;  2V2K A;  5BR8 J;  4DR7 J;  3IMQ J;  2HFN A;  2EG1 A;  2HAI A;  2FLL A;  3MOJ B;  3DFE A;  1RT3 B;  4ED1 A;  3EE3 A;  4I6Y A;  2VHG A;  3V6K A;  2LQ5 A;  2DVI A;  1R27 B;  3K5P A;  1ARO P;  3QWU A;  2IC3 A;  3O1L A;  4B3T J;  5D77 A;  2KFY A;  1U1K A;  3H5X A;  3UVJ A;  1RE1 B;  2MSS A;  4X84 A;  3G82 A;  2CJA A;  3N01 A;  4DV5 F;  2DHH A;  2VA2 A;  3I4H X;  2DR5 A;  4X4O A;  4DUZ F;  3PZP A;  2ZBP A;  1WDD A;  2RU3 A;  3C14 A;  1BXN A;  4MK9 A;  1VC0 A;  2VPW B;  3OTO F;  2AD9 A;  2M3D A;  3ISZ A;  1NCL A;  1RCX B;  3J7Y I;  5ETV A;  1TAQ A;  2XSF A;  4Q0B A;  5HRO B;  1UL3 A;  2UUA J;  4NOH A;  1HBU B;  2GO9 A;  1TL3 B;  3CW2 C;  2NXE A;  3GE9 A;  2XLJ A;  1XNR J;  3H2L A;  3V4I B;  2Y1L B;  3EPI A;  4FPI A;  1KLM A;  5MLC V;  2XSJ A;  5I4M A;  1QAI A;  1IWA A;  1BD6 A;  4ED3 A;  3W9H A;  2DEJ A;  4C3M A;  1SJF A;  3I32 A;  4NCG B;  1VJW A;  2RUS A;  1UVK A;  4U7U K;  1S0M A;  1LW0 B;  2EFN A;  5KFT A;  4CM0 A;  4ZLP A;  1LW2 B;  2XYG B;  4BLG A;  3CC2 S;  3GSD A;  4DV1 J;  4ZLN A;  1DRZ A;  1WI8 A;  4YB7 A;  1VQ7 S;  2XZT B;  1LK7 A;  3T6B A;  3W65 A;  4A8X A;  3VR1 A;  3AFG A;  5EUH A;  4NX9 A;  2ABY A;  2HG4 A;  4CLZ A;  3J7Z 5;  4PQA A;  3W2W B;  4ZP7 A;  1TL1 A;  4PZV A;  1S6U A;  3O6Q A;  3MR5 A;  2W7A A;  5KFN A;  2BE7 D;  3JQJ A;  4ZPW R;  3L95 X;  3IN5 A;  3O3L A;  4Y3C A;  1RAD B;  3BB5 A;  4AUK A;  5IV3 A;  1RHM B;  5KFV A;  4QW8 A;  4LSL A;  1JJH A;  2WSE C;  2UVW A;  5LMN J;  4NZ6 A;  1JLG A;  1VK8 A;  3HJF A;  4C0H A;  1WOO A;  4DF4 A;  3M9O B;  3KNA A;  1NAQ A;  1REG X;  3RRH A;  4RW6 A;  4IKA A;  4URG A;  3RGI A;  4AL7 A;  1AT1 B;  1TUV A;  1WEL A;  2CNK B;  2C2O B;  2JEJ A;  4BS2 A;  4B9U A;  2KFN A;  2VG6 B;  1FWL A;  1E6V A;  3TEH B;  2KVQ E;  2C2K B;  4ZJQ A;  2WVE A;  3CUN A;  2EC0 A;  1QE1 B;  1U8S A;  3G96 A;  2DNO A;  3MD1 A;  1WC4 A;  2ZZN A;  4ED5 A;  1AUS L;  1WOP A;  1T9Y A;  2XY6 A;  2X3D A;  2GZO A;  3HT0 A;  3BN7 A;  4FKX A;  1LV5 A;  1S9F A;  4ZVQ B;  2V8V A;  5DM7 Q;  3NMR A;  2R9L A;  4N77 A;  1S1W B;  1F5C A;  3G9C A;  4OI4 A;  3KDO A;  3CXC R;  1KHV A;  3N0V A;  1YG0 A;  2GML A;  3HP6 A;  1HPZ A;  2OPP B;  2BRL A;  4R25 A;  1O0P A;  5LMN F;  2BW7 A;  3MUR P;  2YKP A;  3QYY A;  3H4B A;  4NMX A;  1YJ9 S;  1IVZ A;  4WXW A;  4O4G B;  4IDK A;  3HHL B;  4OHY A;  5KFM A;  4K4U A;  2OJ3 A;  4WP9 A;  1N5V A;  4L3K A;  1Q5Y A;  3PYF A;  3E2E A;  2AYB A;  2VC1 A;  4GO7 X;  4CTA B;  3Q8U A;  1XR6 A;  1A6L A;  3PW2 A;  3FSI A;  2QYG A;  2FVP A;  4LF8 J;  1HQE A;  1ZM9 A;  1RT6 B;  3G8Q A;  1VBX A;  1C1C A;  4WYL A;  1C4C A;  2R2R A;  2YKN A;  4NLX A;  4ZVG A;  1LWX A;  2NPF A;  1RAB B;  1H2V Z;  1XIQ A;  5IWA J;  3MM7 A;  4FN5 A;  1HBO A;  1SC6 A;  2DGX A;  4C8K A;  1TR0 A;  1X9S A;  1NK6 A;  2M4M A;  3JQM A;  4MMO A;  1U0H B;  3KJV A;  5EX3 A;  1SJ4 P;  2YNH A;  2DGU A;  2IRU A;  1JLC B;  3U1L A;  4A8W A;  1VS3 A;  2HNY B;  4B9N A;  1D9A A;  2WOM B;  1VIS A;  2DR7 A;  2QG9 B;  4AQY F;  4CIO A;  3P45 B;  4F4Y A;  4PQU B;  1F6T A;  2HHT A;  2XBP A;  2J0S D;  4M5K A;  2DHA A;  4GO5 X;  3TWZ A;  2HHW A;  2LVW A;  1SH0 A;  4O0I A;  4RUB A;  3OD2 A;  4F36 A;  2IYG A;  2RQ4 A;  4TY8 A;  2VQF F;  3TZW A;  3EGW B;  4K4X A;  4QYZ J;  2OHD A;  2IC3 B;  4JI1 J;  4ZVP B;  3T19 A;  4TNO A;  2F4F A;  3UVJ B;  4OI1 A;  1KSP A;  3C2P A;  3IWN C;  3G82 B;  2JX2 A;  3E51 A;  3R2D J;  1JLQ A;  5L1K A;  5CZX A;  1WAC A;  5KT5 A;  4PG4 A;  3B82 A;  3G6E S;  4I64 A;  1U47 A;  3C14 B;  4OLP A;  1CSJ A;  2J6U A;  3SSQ A;  1FDD A;  2BBE A;  4RWW A;  2X1G A;  4DQP A;  1RT4 A;  1XMQ J;  1WG5 A;  2WZ1 A;  1KRP A;  4Q0B B;  2X1B A;  2YTC A;  2OFH X;  2QX0 A;  4TU8 A;  5C24 A;  2ZHA A;  3MCM A;  4LFC F;  2QIF A;  1EB0 A;  4UT4 A;  3UNY A;  2J9C A;  3CCQ S;  1H0H B;  2LXU A;  5CCL A;  4N76 A;  4WE1 A;  1RT2 B;  2J6T A;  1KLM B;  3BS9 A;  3W1Y C;  3V4M A;  2LA4 A;  4OZN A;  2IJN A;  3H42 A;  5I42 A;  1GTE A;  4ECV A;  2DTJ A;  4QWC A;  1QTM A;  2WTF A;  3SSS A;  3NLC A;  4USH A;  4X62 J;  2W2N P;  3THV A;  3GB0 A;  2N4D A;  1FRL A;  2AQ4 A;  2XNQ A;  2RAQ A;  3ADA C;  3SCJ E;  3I0S A;  1RTZ A;  1SJ1 A;  2AW0 A;  2V94 A;  4ZHR A;  4M95 A;  4WP3 A;  5E33 A;  2VF3 A;  5BYS A;  1J5E F;  2OIH A;  4DPT A;  2DKO B;  3Q2S C;  2XM3 A;  1RGV A;  5ITH A;  1BWE A;  2C3U A;  1JNR B;  3D1H A;  4G6V B;  3PDN A;  3S7R A;  4PXD A;  1TL1 B;  1FKO A;  1CLF A;  2YNI B;  2ZH1 A;  2UUT A;  4DU8 A;  1S9E A;  1XMO J;  3CVK A;  1VBK A;  2OH2 A;  1C4A A;  3CCE S;  4LRE A;  4A8Y A;  4E8U A;  3PKY A;  2KXH A;  2DD8 S;  1VRU B;  1V5I B;  2WVC A;  1T9X A;  3ZZU A;  5KAK A;  2D3U A;  4DL5 A;  2XLI A;  2KZM A;  4LSL B;  1MW7 A;  3TAR A;  2R4F A;  2V67 A;  4Q8E A;  3EJM A;  4D3H A;  3BZQ A;  1HBM B;  3CCW A;  2WHO A;  1PIL A;  2Z8Q A;  3BPD A;  1FJG J;  1SUQ B;  1UTA A;  2ZVI A;  4ER8 A;  2OUG A;  3QO9 B;  3LPY A;  4X4R A;  1K0V A;  2VB6 A;  3LGM A;  1ZA1 B;  2MZQ A;  2P6S A;  5KTQ A;  4NXN J;  2VG5 B;  2JEG A;  4HYK A;  3BQ0 A;  1YK9 A;  4C8M A;  5D78 A;  3U02 A;  3D6M B;  3OLA A;  3OL6 A;  4C11 B;  4CRJ A;  1S6Q A;  3ZNJ 1;  4U8V A;  4HT7 A;  1ZH5 A;  4TN2 A;  3TQ1 A;  1SI9 A;  4AL5 A;  1IR2 A;  2DH8 A;  3WZ0 A;  4ETZ A;  4J7C A;  3MAA A;  2DPI A;  2V4Q A;  2XY7 A;  2E5H A;  3VAH A;  2JJ4 D;  1D9D A;  1U1P A;  4DR4 J;  1FA0 A;  5DQG A;  1HPZ B;  3G87 A;  1ZA2 B;  2XZD B;  3FZB A;  3OUY A;  5KG7 A;  1S77 D;  1EET A;  5CCM A;  4XPC A;  5DM6 Q;  2KJV A;  4IDK B;  1FDA A;  4GRS A;  4YN3 B;  2MHN A;  2HEK A;  5E3R A;  2RDD A;  1YJW S;  1VK3 A;  2ILY A;  3ELH A;  2MLX A;  3BM7 A;  1PBU A;  4DXL A;  2C2N A;  1RAA B;  2CJB A;  4QYR A;  5KG5 A;  1VQ8 S;  2GW8 A;  4WZM A;  3G86 A;  1ZTW A;  2AWZ A;  3A3N B;  3SZ2 A;  1FFG B;  1HQE B;  1NME B;  3EMT A;  3TA2 A;  4NA2 A;  2PE8 A;  1U7L A;  3KLE A;  2LXF A;  4DQR A;  3SFG A;  3FJ2 A;  2UP1 A;  1JJC B;  3HSZ A;  2YKN B;  3M9M B;  3JAM Y;  4JBC A;  3GII A;  4KJI A;  2HHV A;  3BR9 A;  3MM7 B;  2IVM A;  4JI3 F;  2Z2Z A;  3TAP A;  3GJS B;  2Q79 A;  3I9V 9;  2R42 A;  4FXW A;  1N36 J;  2XB2 D;  1TMJ A;  2LQB A;  2MEW A;  3FFI A;  2E66 A;  2DXE A;  3KJV B;  4ICL A;  2VIH A;  3TA0 A;  1UVL A;  1NZ8 A;  2YNH B;  1NHU A;  1Q8I A;  2CNO B;  3FK4 A;  3FUY A;  4K4Y A;  2PO4 A;  4QQB A;  1XR7 A;  3N4W A;  4KT0 C;  2W2P P;  3CD7 A;  5D0R A;  4J9N A;  2JFK A;  5J2N A;  1KC8 T;  4UST A;  1G7C B;  2QFI A;  1YJV A;  2H3E B;  2KI2 A;  3CCT A;  3U1N A;  4RUH A;  3OV7 A;  4AT1 B;  2P2C B;  5JXS A;  2CRL A;  4TY8 B;  4ETX A;  1DQ9 A;  3OTE A;  3ENQ A;  4F3M A;  2BJ1 A;  2DR8 A;  1D8Z A;  5HQ8 A;  5K8P A;  2LU2 A;  2HIQ A;  4PWD A;  5U47 A;  4WU3 A;  2XO6 A;  2V68 A;  4E2F B;  3H4D A;  4DV0 J;  1JQG A;  3SSR A;  4IFY B;  2F40 A;  1Y0H A;  3SYZ A;  2E1C A;  2BX6 A;  3VAG A;  2F65 A;  3NS7 B;  2DNP A;  3VWS A;  1KVJ A;  2RD5 C;  1QJH A;  1V3S A;  4DSI A;  1RT4 B;  2IA0 A;  3NGD A;  2VJV A;  2G13 A;  1SKS A;  3JYT A;  5CHC B;  4ZIT A;  1LEO A;  3C16 B;  2LEC A;  4PPD A;  3M2V B;  5EX0 A;  2EPI A;  4PUO A;  1R6Y A;  2IHR 1;  4WE1 B;  5AT1 B;  5IXU A;  4DV4 J;  1RAJ A;  1P1T A;  5C25 B;  4OI2 A;  2ROE A;  1T3O A;  4LRF A;  3QJJ A;  3KG0 A;  4KYZ A;  4OYX A;  2P9G A;  4OZJ A;  5KT7 A;  1JX4 A;  2WVF A;  4KB7 A;  2Q1L A;  3CB4 A;  3WC2 A;  4LT6 A;  4O4R A;  1WF2 A;  3CIM A;  3HFZ B;  2H5J B;  4ECU A;  3I0S B;  3KLH A;  3HVT A;  3MTK A;  3BQ2 A;  4N7T A;  3LP1 A;  1Q0N A;  1PO6 A;  5ETO A;  2F63 A;  5DDQ C;  4PXB A;  1MU2 A;  4PG6 A;  2ZH7 A;  5L1L A;  1OPZ A;  4HDG A;  4EBE A;  5D0H A;  3IWX A;  2QSF A;  2KG1 A;  2FZG B;  1R8P A;  1NO8 A;  3QMQ A;  2GNK A;  4FP9 A;  2KKH A;  4RNM A;  1VQM S;  2B0G A;  4LBI A;  1NH8 A;  2IM0 A;  5A8W B;  1JLA A;  1NDP A;  4ZVR B;  2BJ3 A;  1S12 A;  1C0U B;  3W61 A;  3KK2 A;  4H4O B;  4JI4 F;  3DNC A;  4NPO A;  4JV5 J;  4NXM J;  3IM9 A;  2HS0 A;  3OHA A;  4DV4 F;  4NZ7 A;  3NMA A;  3VVU A;  3RU0 A;  2WSC C;  3VAI A;  4FXD A;  3QT8 A;  3AOD A;  4Y2A A;  2D69 A;  1HQ2 A;  3CJ4 A;  5L46 A;  2MKH A;  2F9D A;  1UZH A;  3M8Z A;  2GVZ B;  1XJW B;  2XGP A;  3CO0 P;  5H1S V;  2GAG C;  4JV1 A;  2CPJ A;  1U24 A;  2MJN A;  1M5O C;  3M8S A;  2AV5 A;  4X4S A;  4ILM A;  3KLF A;  1KWM A;  6AT1 B;  1K1S A;  2F4V F;  1DTT A;  4LQ9 A;  4OL8 A;  2MKI A;  4LF4 F;  3KUE A;  3W7B A;  1XBW A;  1FO1 A;  1RAI B;  2J7K A;  2KL8 A;  3W62 A;  3GJT B;  2OEJ A;  4FNI A;  4B3S F;  2B3T B;  1S6Q B;  3GFY A;  3PR5 B;  1FRJ A;  3TAM B;  2JSX A;  2XMJ A;  1GMV A;  2HQ3 A;  1T05 A;  2HHU A;  3NBP B;  1L3V A;  4Q8F A;  4NLO A;  3DM2 A;  3EXY A;  2G2Y A;  3MM8 B;  4LRA A;  1NJX A;  4TQR A;  3ZTR A;  4P72 A;  3GQC A;  2PDA A;  1SL1 A;  1TL7 B;  5K8N A;  4FVM A;  3NGK A;  1EET B;  3W8G A;  4RW7 A;  2MKK A;  3QRQ A;  4WYW A;  4DQI A;  4IH7 A;  1Z2Z A;  3EDQ B;  5D0E A;  4P2X A;  4BHQ A;  5DS7 A;  1LQ9 A;  2RS8 A;  2MKS A;  4ZIV A;  1TUG B;  1A0O B;  4I0W A;  3L7U A;  4DR6 F;  1GH8 A;  3HSJ A;  3DLE A;  1T9U A;  4P7T A;  4O0N A;  3UO0 A;  1WG4 A;  3H2U B;  1WDT A;  1RTD A;  4R5P B;  4DPY A;  2AF6 A;  1U45 A;  3KLE B;  3QQC D;  2N3L A;  1HI0 P;  2FY8 A;  2Y0B B;  3HX9 A;  3U7J A;  2FLO A;  2XMA A;  4L75 A;  3I87 A;  1Y5I B;  4N5S A;  2JEI A;  2BKN A;  1EJ7 L;  3KHL A;  1R0C B;  1JB0 C;  1UWB A;  5DDP C;  3B78 A;  2O5D A;  3KOA A;  2XMT A;  3GG0 A;  4WF9 Q;  4WTY A;  3FFI B;  1GQE A;  4ICL B;  1S1U A;  1SQF A;  1QSL A;  3M32 A;  4QCL A;  3O8W A;  4KHP F;  3MGJ A;  2GIR A;  3H98 A;  2DPJ A;  1RLC L;  3GCW P;  4TY9 A;  3I96 A;  4RL1 A;  3ITH A;  1DQA A;  4OFZ A;  3PHT A;  3PFE A;  4C48 A;  2YXL A;  3D6F B;  4ZPD A;  2GGP B;  5DZ7 A;  5J2N B;  2ZBR A;  1OQ3 A;  3T1Y J;  3KHR A;  4C8N A;  1VQY A;  4WJB A;  4L76 A;  3ZO7 A;  5H9F J;  4EYI B;  1IKV B;  1NSA A;  2FHK A;  3Q23 A;  3VQS A;  2XQC A;  4QZV B;  3V6H A;  3A8E A;  5LJ3 Y;  3QRR A;  4MIW A;  2YNF A;  1Y11 A;  3LP0 A;  4CI0 B;  1AFJ A;  5DO2 A;  3A3P B;  5MAO A;  4CT8 A;  5KFB A;  2C22 A;  4PWD B;  5DZ6 A;  3OJU A;  2YKA A;  3AD8 C;  2ASJ A;  2XUL A;  2VKR A;  1CC7 A;  4KSE B;  4DSF A;  3MPY A;  4XO0 A;  2AJQ A;  2I8E A;  3BKF A;  1XER A;  2XWX A;  1Y5N B;  2BXJ A;  1APS A;  3BKU A;  1XC9 A;  1TKD A;  1RTJ B;  4TQS A;  1X4H A;  1KDN A;  4NA3 A;  1WC6 A;  4CZC A;  3D3C J;  3C6T A;  4PG8 A;  4YME A;  3JYT B;  1N5S A;  4I4B A;  1VFJ A;  5F3T A;  4LBH A;  5IT0 A;  1LFP A;  2GQ2 A;  4PUO B;  4JOU A;  4GVB B;  3DC2 A;  1BY9 A;  2VFR A;  5CYM B;  4CLF A;  2HS4 A;  3PEJ A;  4NYZ A;  1B70 B;  4G3I A;  3UQS A;  3ILL A;  3SIP B;  3D0G E;  2DIT A;  1X60 A;  5DJB A;  2KO1 A;  5E2Q A;  4B08 A;  3O2I A;  1MWY A;  2K1R B;  3CMA S;  5HBM A;  2KTQ A;  2B4V A;  2ZH8 A;  2LEA A;  2RJZ A;  4U67 Q;  2Q6C A;  2YVS A;  3RB0 A;  1IQZ A;  4GC7 A;  1PIE A;  5GME A;  1NDL A;  2MQ8 A;  2AHO B;  2ZE2 A;  3DU5 A;  1RA6 A;  3HMJ G;  3LP1 B;  3PHE A;  2W2O P;  3H5Y A;  3C46 A;  2DIV A;  5KFQ A;  1FJ7 A;  1N6Q A;  5ETM A;  3ZZR A;  2V2Z A;  3R7B B;  3VVT A;  2H48 B;  4UOC A;  5CYQ B;  2R8J A;  3AHP A;  1FDN A;  4B3R F;  4YR3 A;  3CED A;  3BSN A;  1U1R A;  5E41 A;  1IN0 A;  3RZA A;  1N0U A;  1HD0 A;  3BO4 A;  4F04 B;  3GG1 A;  1ICE B;  1T02 A;  3BSA A;  1WD6 A;  4WXO A;  1CBK A;  3KHG A;  4KGK A;  3KK2 B;  3UDV A;  1U6Z A;  2ZKT A;  1IKX A;  1S9G A;  1ELO A;  2M70 A;  4HI2 A;  1WF1 A;  4UOH A;  2QN6 B;  1GMW D;  2A6O A;  3D7S B;  2XS5 A;  3CCZ A;  3D3B J;  4FVC A;  5KFJ A;  3HD1 A;  5KFP A;  3KHH A;  2CYY A;  1I5O B;  3EVO A;  1SB6 A;  3CCS S;  3PRB A;  1IBK F;  3QRP A;  4DR1 F;  3PVX A;  2FJV A;  4LF5 J;  2O66 A;  3MMA B;  3ZZO A;  4M1K A;  3E01 A;  2MGZ B;  2Y1J A;  1RTI A;  4P7V A;  3QBC A;  1TV6 A;  3KLF B;  4LBP A;  3ET6 A;  2BE2 A;  2XMU A;  1IBL F;  1RT1 A;  5FDL A;  1DTT B;  4XAK A;  4WKY A;  1U1Q A;  2QA4 S;  3QPI A;  3P5B P;  2XG8 A;  2UUB F;  1S7H A;  1EAR A;  3OQ2 A;  3K5O A;  3R1L A;  3B54 A;  3KG4 A;  2LA6 A;  1NB7 A;  4LF1 A;  3NCP A;  5ETR A;  2ROP A;  4YY3 J;  4NLT A;  5GMK a;  1T05 B;  4ZPB A;  3WDO A;  2GJF A;  3QJP A;  4EO8 A;  2V2V A;  5D4L A;  1PJ7 A;  2XHW A;  2CVI A;  3KFW X;  2G0C A;  4ZPV R;  3HFK A;  4WKR A;  3SEO A;  4RW7 B;  2HQC A;  8RUC A;  5IQQ A;  2VAS A;  4LRC A;  1GT8 A;  3PW0 A;  2DGQ A;  1HWK A;  1IBM F;  4CNY A;  2J9D A;  4MIA A;  3A12 A;  3RYL A;  3UCG A;  2I1R A;  2M5Y A;  2GFF A;  5K8O A;  3DLE B;  3M05 A;  4J9K A;  2ZD1 B;  4QIE A;  3G4S S;  3ONQ A;  4IRK A;  3CJK B;  1R43 A;  4X4V A;  4XK8 C;  1DUR A;  5C2C A;  3J7A N;  3HO1 A;  5CZV A;  5DG7 A;  4L3N A;  4CH1 A;  3V6D A;  2WW8 A;  1KQS R;  2WB4 A;  1S72 S;  1HNX F;  3M6W A;  5F0U A;  2RSQ A;  3DRX A;  1U1M A;  1F2G A;  2G4B A;  1U2F A;  3MMJ A;  4RPF A;  2C42 A;  1UJ4 A;  5F0W A;  3EM1 A;  4QWB A;  1N34 F;  2FD2 A;  4IRD A;  1UWB B;  3BF4 A;  4RR5 A;  3H5U A;  2A0F B;  1WNE A;  2DYA A;  4AL6 A;  3UD5 A;  2EG2 A;  2ZHB A;  4PCQ A;  4Q2M A;  1RLD A;  4UY8 5;  2MZS A;  2HZV A;  1UPP A;  5C5J A;  3JSM A;  2YH0 A;  3M30 A;  2N7C A;  2MPU A;  4MKV A;  2FHJ A;  4LF9 F;  1UEK A;  2IRX A;  2WBR A;  1HNZ F;  3ITH B;  1V3R A;  1QDU B;  2E9Z A;  3J81 U;  2HRY A;  4GKJ F;  3HKZ D;  2CNL B;  1D0E A;  1WTF A;  5DQI A;  4B02 A;  2QMU B;  3D5M A;  5AE1 A;  3DYA A;  1AXQ A;  5DGB A;  2ZJR Q;  4Y2C A;  3PKM A;  3LP2 A;  2CPF A;  3P6Y C;  4ZP9 A;  2XYP B;  2YNF B;  3UNG C;  1YLX A;  3OFG A;  4KGX B;  2VFV A;  3OTB A;  3AOC A;  4C8L A;  4DG1 A;  2IVF B;  4HEA 9;  1OY9 A;  2FJD B;  5LOQ A;  1EKS A;  1FCA A;  3N6N A;  2DB1 A;  2C3P A;  3RTV A;  1IM4 A;  1FEH A;  3TZZ A;  2Y8Y A;  2BE9 B;  5AXM A;  1KHW A;  3ZXW A;  1T94 A;  2VIC A;  3MDF A;  1REV A;  2GQC A;  2CVE A;  3HK2 A;  2QFJ A;  2BOA A;  4DOZ A;  2Z4P A;  4OZL A;  4CM2 A;  4A8M P;  3BBC A;  3TVZ A;  2NR0 A;  1KQF B;  5M2P A;  3LOU A;  4G1Q B;  2AGP A;  3RBX A;  2KJW A;  3ZTS A;  2DGO A;  5CQG A;  3M6U A;  1NKC A;  2B9X A;  2VPY B;  2V69 A;  1AZS A;  4X2B A;  2BQ3 A;  5D6G A;  1UA1 A;  2HFU A;  1VHF A;  4I69 A;  4IQX A;  3MCO A;  2K7K A;  1S1T A;  2A2C A;  2NXC A;  2CDR B;  2ZH3 A;  1V5V A;  4R8U A;  2ZE2 B;  2FJB B;  4NYO A;  2FHM A;  4YHH J;  3IP0 A;  1RAG B;  2VL1 A;  4P74 A;  2HHX A;  1TK0 A;  5A76 A;  2MQQ A;  1JJ4 A;  4EBC A;  1VQK S;  4K0K J;  1YJU A;  2L9W A;  2J9D E;  1HNV A;  4CO1 A;  2ZDP A;  2CWK A;  3LGN A;  3FBE A;  2RRA A;  4F0H A;  1HNI A;  1RAH B;  2DO0 A;  4HH0 A;  5LMU J;  4AFF A;  2MDA A;  4OJG A;  3IS9 A;  3NXZ A;  1N4L A;  2R7U A;  2LP4 A;  1P27 B;  2HVZ A;  4U6P A;  3TUJ C;  3QAU A;  1N32 J;  1Q4R A;  3HKW A;  2XO7 A;  2HHS A;  1RSC A;  5EN1 A;  3IBW A;  2O3D A;  3IXQ A;  1MWZ A;  5IM0 B;  4IH6 A;  4GVL A;  3WHI A;  2R2T A;  1VGY A;  2GIF A;  2RQK A;  6FDR A;  3POT A;  2L3M A;  2OKQ A;  4EZ6 A;  2JLG A;  1SH3 A;  1HWJ A;  3SV3 A;  2YKQ A;  2ZH9 A;  2BAN B;  2OLW A;  1RTI B;  4YHH F;  4OYA A;  2PEH A;  2AX1 A;  3ET6 B;  1NZA A;  5KFI A;  3J81 Y;  1K9M T;  2EVZ A;  2V4J B;  1R8B A;  3Q2T C;  5FDL B;  5AJ3 F;  1KOO A;  4ATN A;  3R7N B;  3KLV A;  1SJQ A;  1J5O B;  3EPG A;  2HYI B;  2IPO B;  4LSN A;  1JLE B;  3KK1 B;  4RUC A;  1CJT A;  4PAB A;  4ZMM A;  2V8G A;  4J91 A;  1F9F A;  4LF6 J;  2IY5 B;  3CMQ A;  1UW9 A;  2NSC A;  1N56 A;  2D7S A;  2CJ9 A;  2VD3 A;  2MLY A;  1R89 A;  3MPU B;  3W2V B;  4LRB A;  2GHV C;  2V5H G;  3IR7 B;  4F4A A;  1SBR A;  3UWT A;  1QVG R;  2BAB A;  5H9E K;  1RK8 A;  4B3O A;  4FS1 A;  3PR4 A;  3IWL A;  4A8O A;  5J2P A;  2QZ8 A;  1O6X A;  4RNO A;  4AXJ A;  1IUJ A;  4DX6 A;  5F9N A;  5KFO A;  2HMI A;  2ADB A;  2R7O A;  2YX1 A;  1TFY A;  3I5A A;  4TU9 A;  2UVU A;  2OEK A;  1PAU B;  4ZJL A;  2W25 A;  4DPX A;  3LA0 A;  2YWH A;  1UA0 A;  1H74 A;  1T3N A;  3TR5 A;  3MWB A;  1WC5 A;  4KO0 A;  4Y34 A;  3HCX A;  1GTH A;  2ASD A;  3V6D B;  3SQG A;  2RKI A;  4DV2 F;  3D4J A;  3UDE A;  2HHH J;  3RBE A;  4TKT A;  2ILZ A;  4ERD A;  3GV7 B;  8ATC B;  3V5R A;  4X66 F;  3CDA A;  4M5L A;  2UZA A;  1YBT A;  2MQN A;  2GJ2 A;  3NRB A;  2CFX A;  3JTN A;  2LKZ A;  4FYV B;  2R7W A;  4CLS A;  2WBM A;  1UVI A;  1V3Z A;  1SH2 A;  5BYR A;  4DFM A;  1YKW A;  2K7J A;  3JSM B;  4J9L A;  2FGO A;  4IO1 A;  1N33 J;  2MY7 A;  1S0N A;  2BJ8 A;  3TVK A;  1Q82 T;  4RW8 A;  1NSQ A;  3HHN B;  4QWD A;  2HRT A;  3Q22 A;  3UPF A;  1FRH A;  1KFS A;  4L74 A;  4DZ6 A;  2ZVS A;  2AEM A;  4OQJ A;  1EP4 A;  5GMD A;  3HD2 A;  4NI2 A;  4U7U D;  5KOW A;  4JI8 F;  4K4Z A;  1YRU A;  2KRB A;  5IV4 A;  1O8B A;  1X8D A;  1FJC A;  3CCU S;  1YTY A;  4ZVU B;  4J90 A;  4K50 A;  1RI7 A;  2H4Y B;  3MR7 A;  2AP6 A;  1PC4 A;  4HLB A;  4MKB A;  5LXR A;  4MKY A;  4JI0 J;  3DCA A;  4ANE A;  4DG1 B;  2E44 A;  3TJ8 A;  4PYD A;  5DLG A;  5JUM A;  4MYU A;  4CO4 A;  2ZJP Q;  1FNO A;  2CUY A;  2DHS A;  4NML A;  3DU6 A;  4RJV A;  3RW6 A;  3BYR A;  3NL0 A;  5KFE A;  2WON B;  4K2J A;  3NS5 A;  3D6T B;  5HJY A;  4OHV A;  3HM9 A;  2B7C B;  1MRO A;  2B8P A;  1MWQ A;  1NKE A;  2E1R A;  3OR1 A;  1S5Z A;  3MR3 A;  3GCX P;  4C7Q A;  2UXC J;  3NNC A;  1NJZ A;  4QW9 A;  4JYA F;  3DRS B;  2O01 C;  3HT3 A;  4GC6 A;  3R5A A;  2YWW A;  3GJR B;  3CJQ A;  2PMZ D;  3CME S;  2H51 B;  3DGV A;  1OWX A;  3RAQ A;  3PNI A;  1S4E A;  2P6T A;  2U1A A;  2ATC B;  1S76 D;  3FRZ A;  2DH9 A;  1L3T A;  1AZS B;  3BGU A;  4FPR A;  3UE2 A;  4F50 A;  1EKR A;  2IBK A;  5GAG I;  3K2Y A;  1W26 A;  2F8E X;  5IC4 B;  1Q7Y T;  1LWE A;  3FZ2 A;  1S1T B;  3DLK A;  1RBO B;  3D68 A;  4OJ1 A;  2VBW A;  2NSB A;  2GCF A;  1FXL A;  4MJK A;  3VTI A;  1X5T A;  4EUV A;  1CJK A;  5HLF A;  4DR5 F;  1W7W A;  3VGU A;  2FJW A;  1HR0 F;  4G1I A;  2ZNZ A;  4KV8 A;  1SJR A;  3I56 S;  4MFB A;  1C0T A;  4KC5 A;  2C2E A;  5HQM A;  3HVA A;  1HNV B;  4QIG A;  2QLJ B;  4OYO A;  2YKM A;  3KK3 B;  3JS9 A;  4LFB J;  2GJI A;  3DDI A;  4DUY J;  1HNI B;  1NSP A;  2MST A;  3ETO A;  3BN4 A;  5D4O A;  4LIR A;  2F7V A;  1RJJ A;  2JZ5 A;  1M90 T;  1NPP A;  3AQO A;  2ZBI A;  4OZ1 A;  2C3Y A;  3R97 A;  2KHD A;  4QPX A;  1N5Y A;  2RDI A;  1LKZ A;  3SQO P;  3RR8 A;  4ZCL A;  1UFK A;  5E3C A;  2CQB A;  3SDE A;  2HVE A;  4O3P A;  1WC1 A;  3FDS A;  3MAQ A;  5A2Q U;  5B0E A;  2XGQ A;  4WCE Q;  2MQM A;  3MUV P;  1GEH A;  1VIX A;  4IH5 A;  2FZC B;  4RW9 A;  2HND A;  3DMJ A;  2AZ1 A;  2CQC A;  5LSL A;  2OPS A;  1E6Y B;  1Q1K A;  1VR6 A;  4NYP A;  3Q8P B;  2KT5 A;  1PBA A;  2NZ4 A;  3MPV A;  1HNW F;  4LFB F;  1CQM A;  4ZPA A;  4KFB A;  1CJT B;  4DUY F;  4QIV A;  2R2U A;  1NHV A;  1WC0 A;  1QSY A;  4OMF G;  1X7V A;  1HQU A;  4YUD A;  1R3N A;  3PFO A;  4TU7 A;  3TA1 A;  4Q44 A;  2UVR A;  3C15 A;  3CO9 A;  1QVF R;  1JLB A;  1NPK A;  2P8I A;  5J2M B;  4DR3 F;  1ULR A;  2DRA A;  4B3O B;  2AJ0 A;  4PXC A;  3MEG A;  4A47 A;  5GAE I;  2LMI A;  3T5K A;  5KFU A;  1SIZ A;  3Q8S B;  3WIU A;  1R7I A;  4LR9 A;  2HQG A;  3NAI A;  4J9V A;  1S6P A;  3RG6 A;  2UUC J;  3SBM A;  3H2V E;  3UN2 A;  3D2W A;  2PA8 D;  3D0I E;  3OJS A;  4PXE A;  3R7S B;  2VV5 A;  2ZUG A;  1PAE X;  4KO0 B;  1UVJ A;  2HBR B;  2UXB J;  2HGN A;  3SQG B;  2KRR A;  3D6H B;  4DV7 F;  5J2Q A;  2RKI B;  2DK2 A;  4G1P A;  4DEZ A;  3LAK A;  2LU1 A;  2BKO A;  2J0Q D;  1HKA A;  1S0V A;  4DV6 J;  5KT4 A;  1IJF B;  4W98 A;  4KH1 B;  1NK5 A;  1DJ0 A;  1TKX B;  4O44 A;  4LFA J;  2DGS A;  2RHQ B;  4C6A A;  4RNH A;  2VA3 A;  2QE5 A;  4JI6 F;  2FDN A;  4W92 B;  4IOB A;  3AA9 A;  2KFZ A;  4PWU A;  2WSF C;  1KD1 T;  3EIC A;  1KNZ A;  4ZP6 A;  2XYH B;  1WUU A;  3AT1 B;  2H5E A;  1YQH A;  2DNG A;  1Q8B A;  3QIP A;  4I68 A;  1FVQ A;  3EVM A;  2V8H A;  2VDH A;  2BQR A;  1U1L A;  1KP6 A;  2Z2M A;  1S1V A;  2R7Q A;  4HTI A;  1NK0 A;  1NKB A;  1I94 J;  2JH3 A;  4NRU A;  3PW7 A;  3OLB A;  3MPD A;  3MMC B;  4NI2 B;  3QFW A;  1R6V A;  1FD2 A;  3DDK A;  1FX2 A;  1TVR A;  4EFA C;  3J81 j;  2G1H A;  1X5O A;  1M0S A;  2XY5 A;  1TKZ B;  2VQE J;  2WB1 D;  1S79 A;  1H2U X;  2B43 A;  4M5G A;  1AUD A;  3IG1 B;  3BQ1 A;  3HHL D;  4FF1 A;  2DNR A;  4ED7 A;  4ID8 A;  1KS2 A;  3KJN B;  5A2Q Y;  3PX6 A;  2ZBC A;  2BM1 A;  2H9Z A;  3B8H A;  4DFK A;  2YH1 A;  1TAU A;  1B0P A;  1TP7 A;  4DN9 A;  4ZA1 A;  4ZIW A;  2OPQ B;  4CWB A;  5LJ5 Y;  3I0R A;  1MRO B;  2CQ1 A;  5HP1 A;  1A7G E;  1U2C A;  3MM5 A;  1XNQ F;  2QO3 A;  3OR1 B;  3ZZT A;  1VMB A;  3OXL A;  1FVS A;  2BJD A;  1SXL A;  3LF0 A;  4JB8 B;  1T9W A;  3OR2 A;  1X5S A;  4K2X A;  4F4W A;  2DNK A;  4KKO A;  2M8D B;  2NXU A;  3D67 A;  4OX9 J;  4CH0 S;  1PJ5 A;  3KUG A;  5I3P A;  2DGT A;  2BOP A;  1WEY A;  5B08 A;  4E98 A;  1JXV A;  3ZTP A;  3N9U C;  1VRT B;  4F26 A;  3PW4 A;  2Y3Y A;  4Q45 A;  4OYB A;  2HFV A;  3SV4 A;  2Q66 A;  5J1E B;  2RIL A;  4DCO B;  4QYZ K;  2X3G A;  3AOB A;  2PA3 A;  4DSK A;  3LAN A;  5KG1 A;  2BJE A;  3U27 A;  3M6V A;  1SKR A;  3MXH P;  2BV3 A;  4IFV A;  4DU7 A;  5GVQ A;  2A10 A;  2ZKU A;  4DV3 F;  1FI4 A;  4ZPC A;  3PY8 A;  3FEY B;  5HVF A;  3QT6 A;  1O51 A;  4C2M A;  2UU9 J;  3EXC X;  1M5V C;  4HR2 A;  5BR8 F;  4DR7 F;  4IG3 A;  2DXD A;  1M5S A;  1PGZ A;  4CT9 A;  2JC1 A;  3PRD A;  1FTR A;  4ID5 A;  1RHU B;  3DGP B;  1DAX A;  5I3Q A;  1TFW A;  1L3U A;  4ECT A;  1UEV A;  1N5Y B;  4B3T F;  1U0S A;  2V50 A;  3G8T A;  3RUB L;  3RW7 A;  4FF4 A;  1FF2 A;  1VLY A;  2LQ9 A;  3CDU A;  5ADZ A;  2GA7 A;  4EU0 A;  3SDE B;  4NLG A;  4ZN3 A;  1P8G A;  2COL A;  3BRE A;  2E5G A;  1DAR A;  1ZAW A;  4NLS A;  5KFR A;  3M2R B;  4FZV A;  2HHQ A;  4O3S A;  1WOR A;  2WCX A;  4RW9 B;  5JMN A;  3DLG A;  2HND B;  3D1Q A;  2I0X A;  2UUA F;  3DRY A;  4CNZ A;  3P5T L;  3J80 Y;  3G6X A;  1XNR F;  2YQ1 A;  1KTV A;  4IQM A;  9ATC B;  2EC2 A;  2EXU A;  3GP9 A;  4CLP A;  1PYS B;  1YJ7 A;  2B6A A;  2VU5 A;  1HQU B;  3PXG a;  1R0A A;  3VAK A;  2ZIT A;  1X4F A;  2E7V A;  4CCH A;  2FTR A;  5D3G B;  2HKE A;  2FIU A;  4CLY A;  2OTL S;  2DCL A;  4ALZ A;  4DHV A;  1L3S A;  2R8G A;  3OVS A;  4TYB A;  5KG3 A;  1JLB B;  3R2C J;  4EK2 A;  2W9C A;  4ZJO A;  2FC8 A;  4C98 A;  4JI2 J;  2BMB A;  3KMS A;  4X64 J;  2KDO A;  3MEG B;  4ED6 A;  2ZWO A;  4DV1 F;  3R9L A;  2DRB A;  2BW2 A;  1U6F A;  2POK A;  5BYQ A;  3BJY A;  2I2Y A;  3OXF A;  1MML A;  2JFD A;  4HAC A;  2IVY A;  4LRD A;  4F0M A;  2YKO A;  3CJT A;  4OZ0 A;  3G8S A;  1RKI A;  1FE4 A;  3VV2 B;  1Y3K A;  1UKU A;  1FK9 A;  4L6V 3;  5K5M A;  3VQT A;  2N3O A;  2XMM A;  2ERR A;  3JSR A;  4Q5V A;  3PCO B;  1PJ6 A;  2ZH6 A;  3IGN A;  2QLW A;  1RAF B;  4OI6 A;  4FDF A;  3W66 A;  4ED2 A;  4NWB A;  3T5L A;  1ITP A;  2LXI A;  4B9L A;  4ES1 A;  3Q8R B;  4DQQ A;  3C66 A;  3BGO P;  2VON A;  1YIT S;  4CH7 A;  2R7T A;  2HW3 A;  3BSC A;  1DLO A;  3M6X A;  4OV6 A;  2XI2 A;  2Z2L A;  1S1X B;  1URR A;  3M2U B;  5L39 A;  3SCI E;  1CVJ A;  3GFZ A;  4KGM A;  2JNJ A;  1VYA A;  3AXK A;  3EZU A;  2AJ2 A;  4WK1 A;  3CE8 A;  4UQT A;  5GAD I;  3VAL A;  3ILO A;  3US5 A;  3B6B A;  3PIO Q;  1ACM B;  3QIP B;  2HVH A;  5DDO C;  3V81 A;  2ASY A;  3W8P A;  2OEM A;  3OTC A;  4EMD A;  3VZI A;  4DPO A;  4JV0 A;  3PEH A;  4J9U E;  3WBZ A;  2O67 A;  3K5N A;  4M8L A;  1TVR B;  1ZOT A;  4YDX A;  3MM6 A;  4JI5 J;  4DBQ A;  1RT7 B;  4QR2 A;  3MR2 A;  1RTH A;  3W64 A;  3UN3 A;  3FGV A;  3KLG A;  3DRR A;  4I2P B;  2CNN B;  2AYG A;  3CSK A;  1NJY A;  3ZZP A;  4I6W A;  4IOC Q;  3BBB A;  4DL4 A;  1SC4 B;  3BSO A;  4UQG A;  3AB2 B;  2MXY A;  2YNG A;  3F73 A;  3J7A 1;  4WK3 A;  2VFT A;  2NUU G;  4ZCK A;  1BQM B;  3M8Q A;  2OFG X;  5HP1 B;  5HJX A;  3IA0 A;  3LWM A;  5AXL A;  3AQP A;  9RUB A;  4Y6I A;  1QAJ A;  3JB9 k;  3W63 A;  4DX7 A;  1PC5 A;  4ZLJ A;  4LF8 F;  2DNZ A;  4LVO P;  3OR2 B;  1XR5 A;  4P6Q A;  4CDI A;  4USV A;  3BGL A;  3KJF B;  2QRR A;  1VC5 A;  4KKO B;  3BBF A;  3ISN D;  4LR7 A;  5IWA F;  1RWU A;  5GAG U;  1VC6 A;  2FVS A;  2OD6 A;  1FWP A;  5F8G A;  3H7H B;  5SZT A;  1ZYQ A;  3CJR A;  1T03 A;  2RNE A;  1UZD A;  4RU9 A;  1TL5 A;  3UFC X;  2R8H A;  4USM A;  3RAM A;  2W9A A;  1TEL A;  2YQ0 A;  4HHH A;  2G0J A;  2FLP A;  3SFU A;  2C2R A;  2AYM A;  3K89 A;  1RAC B;  2XC9 A;  4WFY A;  5I3U A;  2Y1I A;  3PG9 A;  1RDR A;  2W24 A;  2YQ3 A;  4WPA A;  1N8R T;  1NXI A;  4IG3 B;  4JUZ A;  4RBT A;  2MZ1 A;  4Y65 A;  2XSJ B;  1MMD A;  5ETP A;  4ID5 B;  1J2V A;  4A8K A;  2NXN A;  5L1I A;  1ZM2 A;  2CQ2 A;  2JLF A;  3GJQ B;  3JAM U;  4UF4 A;  2G2Z A;  1UWA A;  4JI1 F;  4MAK A;  4ECY A;  4ECZ A;  3MMB A;  1Q5V A;  3HHD A;  2DNY A;  2KVI A;  1MN7 A;  2F1F A;  4B3M J;  1JLF A;  3CCR S;  5HMX A;  1OJ4 A;  2CJY B;  4DLG A;  2CXE A;  2KXN B;  2YPY A;  1S6O A;  3MEE A;  4F4Z A;  4NL5 A;  4A48 A;  5C42 A;  2DO4 A;  3CGI A;  1XMQ F;  4K4V A;  4IUF A;  5KG6 A;  2NCK L;  3CDB A;  3DLG B;  3AA8 A;  3QLH A;  1QTN B;  4HHJ A;  1HWU A;  4RNF A;  3AB4 B;  2CQH A;  2CPY A;  2MZT A;  2APO A;  2B6A B;  1V6H A;  2VBZ A;  3PW5 A;  4ED8 A;  2BVZ A;  3KLI A;  5A0Y A;  1JLG B;  2J0W A;  2QLB B;  4X62 F;  3ZTQ A;  4PR6 A;  1SIW B;  4USW A;  2W9C B;  4RW6 B;  4HL9 A;  4J9Q A;  2QLF B;  2EK1 A;  2UVV A;  5KFH A;  3Q0A A;  5GAE U;  1E6V B;  3FNN A;  5J1N A;  4P73 A;  4I6A A;  4HAC B;  1YIJ S;  3GYN A;  2KH9 A;  3FEZ A;  4LVN P;  2E5L J;  1JMT A;  2VBX A;  1EQ0 A;  2DHX A;  1FK9 B;  1H3D A;  1XMO F;  1B3T A;  2ZOF A;  2JVO A;  5LM7 E;  5CA5 A;  3TJ9 A;  2ZM6 J;  2KT2 A;  1TL3 A;  4MH8 A;  3V4I A;  4H54 A;  4URQ U;  4AYB D;  2DGV A;  3UD4 P;  3HHE A;  4Z7Y A;  5IOL A;  3T6J A;  1DZ5 A;  3K8W A;  4YP3 A;  2GVD A;  1VQ4 S;  1YBA A;  2B8Q A;  5HAO A;  1QSS A;  1DLO B;  3W60 A;  3GLJ A;  4QWE A;  2ZBQ A;  4NCG A;  4WFX A;  3BH7 B;  1WHX A;  1ZBT A;  3NCQ A;  2XTJ P;  3AD7 C;  1LW0 A;  1H7X A;  3DXB A;  3T1A A;  1FJG F;  2Q3P A;  2ROG A;  3I31 A;  1WHW A;  2MQO A;  2R7V A;  2VOO A;  2ZFH A;  1M1G A;  3TO8 A;  2V63 A;  4DQS A;  2B9W A;  4J9R A;  2M9K A;  3V81 B;  2E7X A;  1U1O A;  1H7W A;  1BQX A;  3W2W A;  1NK9 A;  2E9T A;  3VF0 B;  4K5S A;  1FER A;  4NXN F;  3PM9 A;  1LOU A;  2I38 A;  1UFW A;  2XNR A;  1C1C B;  2G1D A;  5FLX U;  1FFS B;  1MLA A;  1UFL A;  2JOQ A;  3K5L A;  3H40 A;  1HBO B;  4DFJ A;  2XHC A;  3PAC A;  3GON A;  1TTH B;  1RTH B;  4EYH B;  3IAS 9;  3KLG B;  4ECX A;  1FES A;  2IAJ A;  3DRR B;  2ATL A;  5KFF A;  2F9J A;  4DR4 F;  2OPR A;  3E3X A;  3HJV A;  4OJH A;  3HDS A;  1Y3J A;  1ZPW X;  2BDP A;  3CWJ A;  1EQM A;  2C2Z B;  2XLK A;  3OT9 A;  4OX6 A;  2DEI A;  2YNG B;  3VGS A;  2IDL A;  4WFB Q;  1WF0 A;  1RBL A;  6FD1 A;  2VG6 A;  1X4D A;  4TLQ A;  1XEZ A;  2C28 A;  4LF7 J;  5D4N A;  4TLR A;  1QE1 A;  1T9V A;  2BKP A;  2GS8 A;  2DNM A;  3RB4 A;  2WAQ D;  2ALZ A;  5HAN A;  2UXD J;  5G4D A;  2M7S A;  1RBA A;  2V2Q A;  2L48 A;  3AD9 C;  4HDH A;  3RJM B;  2PD1 A;  2CQG A;  2HBQ B;  2WVB A;  2PFD A;  3K58 A;  4M5I A;  3K59 A;  4W4M A;  1VQ5 S;  3N5F A;  1JKH A;  3QAE A;  2JL9 A;  3K8V A;  2HNZ A;  4GKK J;  1JLQ B;  5H9F K;  1VQL S;  3Q8Y A;  4LSZ B;  2RRN A;  2EFO A;  1N36 F;  1G2E A;  1B4S A;  1YJN S;  1C2P A;  4X65 J;  4ZPT R;  3T1H J;  3MR6 A;  1KFD A;  3NKY A;  2M2B A;  2EKN A;  5K8M A;  3D0H E;  1VIO A;  3B4D A;  4JI7 J;  4DL0 C;  2ACY A;  3JQK A;  5C24 B;  3F44 A;  4FYD A;  2Z0G A;  3N28 A;  3KMQ A;  2C3M A;  4EEY A;  5F8J A;  4NZ0 A;  1OIA A;  2KXF A;  3PX0 A;  4FBU A;  1WEX A;  1W2B R;  1U48 A;  1HA1 A;  1WHY A;  1FRX A;  3UCZ P;  2D41 A;  4C4W A;  1SKU B;  2UXD F;  5I42 B;  1LK5 A;  2K06 A;  1RWV B;  4Y2I A;  1EHW A;  3TW0 A;  1UVN A;  3DHX A;  1VHI A;  2RVJ A;  5KG4 A;  4RKU C;  2K2P A;  3FCW A;  1PYO B;  1ZM4 A;  3IFE A;  4F2S A;  1VQO S;  5EHH A;  2XCP A;  3MI7 X;  3AJ1 A;  4ZHR B;  4DV5 J;  2Z2Y B;  1TZ0 A;  1PKU A;  3CCJ S;  4WFN Q;  4DV0 F;  4M94 A;  1JLF B;  3GZ7 A;  1HI1 A;  4DUZ J;  5B0G A;  2D1C A;  5AXN A;  2Z30 B;  2OAU A;  1F5B A;  1RP5 A;  1CUL A;  3T1H F;  4D3G A;  1FKO B;  3BR8 A;  3OTO J;  1CJV A;  1YRX A;  1Q16 B;  3T3F A;  1S9E B;  5HAT A;  2AEF A;  2WOM A;  5FLX Y;  2W7O A;  4YR2 A;  2FB0 A;  2VOP A;  3QLH B;  3OL9 A;  4PQU A;  2HQI A;  5IQ6 A;  1OPI A;  2D3O R;  3N79 A;  4P52 A;  3NGT A;  3DXS X;  1Y10 A;  2KM8 C;  3FMW A;  5E3P A;  3HSD A;  4YDD B;  3ILI A;  4BCA A;  1SC3 B;  5AXK A;  3IBC B;  3KLI B;  1ZM3 A;  2IDE A;  5A0Y B;  5EWE A;  2CG4 A;  5CAB A;  2CPH A;  5F3Z A;  4LR8 A;  3I82 A;  1DQ8 A;  4S0M A;  2CWX A;  3THP A;  5JVH Q;  3TP2 A;  1YVF A;  2HBY B;  2YPZ A;  1G4C A;  2LYV A;  3HHK A;  4KIA A;  3UN5 A;  2ZHO A;  2DHG A;  2RML A;  4KHR A;  2QV6 A;  2J5A A;  1PYT A;  1RWO B;  2VFS A;  1H72 C;  1KQG B;  4EI2 A;  2QMW A;  4HHU A;  4WWS A;  1MMN A;  4ANC A;  2DGW A;  2L41 A;  2W7P A;  3GIK A;  1ZAX A;  1B7Y B;  2HQD A;  2IA6 A;  7FD1 A;  4OYZ A;  4ED0 A;  1YX2 A;  1KQK A;  4YR0 A;  4K8R A;  1H73 A;  3MF5 A;  1V9O A;  2HVI A;  2PMH A;  2BR0 A;  1RT2 A;  2R8I A;  3MAA B;  1IBC B;  4JV5 F;  4NXM F;  4NLV A;  4UY8 T;  1I1G A;  4F02 A;  4YFU A;  2GVD B;  4OX8 A;  5E3A A;  3OUY B;  3AOA A;  5RUB A;  2VC0 A;  1K8A T;  3KDN A;  5K14 A;  1D09 B;  2AIR B;  3NGR A;  5B0A A;  4ES2 A;  4B17 A;  1CS4 A;  1RHR B;  1DFD A;  1S7I A;  4TYA A;  5GAD U;  3T5H A;  2OEL A;  3TVY A;  2KT3 A;  1AFI A;  1TL4 A;  3R8Y A;  2OGU A;  4CO5 A;  2BZ2 A;  3PV8 A;  2RHS B;  2EWH A;  1FRI A;  2DXF A;  1FXR A;  1PSD A;  2OMO A;  3L09 A;  1J27 A;  4OJ3 A;  2YNI A;  4X4Q A;  4KH0 B;  4XIU A;  1SV5 A;  3T41 A;  1F3V A;  2HIY A; 
#chains in the Genus database with same CATH homology
 3R6G B;  1F9E B;  3QNW B;  2QL9 B;  3R7S B;  3SIP B;  3R5J B;  2C2Z B;  1I51 B;  2HBR B;  2HBZ B;  1RHQ B;  2QLB B;  3P4U B;  3GJS B;  3D6H B;  4DCJ B;  3P45 B;  1QDU B;  2QLJ B;  1RWK B;  1IBC B;  1I3O B;  2CNL B;  2H4W B;  2QL7 B;  3GJT B;  3NS7 B;  2CNK B;  2C2O B;  3GJQ B;  2QLF B;  2XYG B;  2XZD B;  3KJF B;  2H65 B;  2Y0B B;  2C2K B;  2CNO B;  4ZVR B;  2H5I B;  2XZT B;  4DCO B;  3IBF B;  1RE1 B;  1SC3 B;  3IBC B;  3KJN B;  2FQQ B;  3R7B B;  2H48 B;  3KJQ B;  1RWV B;  2CJX B;  2XYP B;  1RHJ B;  3GJR B;  2CJY B;  2CDR B;  1PYO B;  2H51 B;  1PAU B;  2CNN B;  3RJM B;  1RHR B;  1RWN B;  1GFW B;  2XYH B;  4ZVP B;  4ZVO B;  3EDR B;  2HBQ B;  1ICE B;  2QL5 B;  4ZVT B;  5K20 B;  2HBY B;  1SC4 B;  4DCP B;  1SC1 B;  2H54 B;  2C2M B;  2DKO B;  1RWW B;  5IC6 B;  1BMQ B;  3EDQ B;  1RWP B;  4ZVQ B;  2C1E B;  3R7N B;  2P2C B;  1RHU B;  1RWX B;  1RWO B;  1NME B;  1RWM B;  4ZVU B;  5IC4 B;  1RHM B;  1RHK B;  3R6L B;  2H4Y B;  1QTN B;  4LSZ B;  4JB8 B;  2H5J B;  2Y1L B;  3D6F B;  4ZVS B;  3D6M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...