2QL9B

Crystal structure of caspase-7 with inhibitor ac-dqmd-cho
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 17
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2ql9B00
1PYOB 3NS7B 2H48B 2HBYB 3EDRB 1RWXB 1NMEB 1IBCB 1I51B 2QL9B 1QDUB 2XYHB 2CNNB 3KJFB 3RJMB 4ZVQB 3GJTB 1QTNB 4LSZB 1RHKB 4ZVTB 2HBRB 3R7NB 1SC3B 3EDQB 2Y0BB 4ZVOB 2HBZB 3QNWB 5IC4B 2QLBB 1RWWB 1RHJB 2FQQB 1RWKB 1RHRB 1RWOB 1RWMB 1RHUB 4ZVSB 1RE1B 4DCJB 2C2OB 3P45B 2XYPB 5IC6B 3GJQB 1BMQB 1GFWB 3R6LB 1RWNB 1RWVB 4ZVUB 2C1EB 4DCOB 2XYGB 2QL7B 1RWPB 2QLFB 3R7SB 1I3OB 2H5IB 4ZVRB 2XZTB 3D6FB 3IBCB 1SC1B 1SC4B 3KJQB 4JB8B 2CNKB 1RHMB 2H54B 3D6HB 1ICEB 3R5JB 2H65B 2C2KB 2CNLB 1PAUB 2HBQB 3KJNB 4DCPB 4ZVPB 2CNOB 3SIPB 3R7BB 3GJRB 2H5JB 2H51B 2H4YB 3IBFB 2CJXB 1F9EB 2C2MB 2DKOB 2CDRB 2QLJB 3R6GB 2QL5B 2P2CB 2H4WB 3GJSB 2CJYB 1RHQB 3D6MB 2C2ZB 5K20B 3P4UB 2Y1LB 2XZDB
chains in the Genus database with same CATH superfamily
5F8NA 3G6XA 2B9WA 2UV8A 4DBQA 1QUVA 3GPAA 4DV0F 2BJEA 4ID5A 3CCRS 2DT9A 2VBYA 3SFGA 4ZVTB 2Y0BB 3DRSB 3BPDA 3NOGA 2D3UA 1HMVB 3PG9A 4JI5F 2A18A 1TL7A 3HF5A 2KZMA 1FXLA 5JVGQ 4GMKA 4C48A 2R9LA 1HNIB 3BO4A 2HFNA 1P9YA 1S7HA 2ALZA 1HIYA 1PGZA 2AX1A 2LQ8A 3CMQA 3BO3A 2JFKA 3C46A 3BM7A 4TKTA 4AXJA 4CLZA 1Z1ZA 3OTBA 3SYZA 1HW9A 1ZAWA 3MM8A 4P6QA 4W92B 4B3OA 5A2QY 2DVIA 3KJNB 2DR5A 1LK5A 4Y2KA 3CCZA 2RRAA 1UZHA 3KNGA 1XBWA 2P2CB 2U1AA 2PGCA 4HEA9 3UR3C 2BX6A 3PM9A 1RHQB 2OAUA 4JOUA 1Q79A 2GGPA 1OY8A 3D9BA 4O4GA 3OT9A 2AYEA 3MAAB 4UY8T 3JYTA 2HYIB 4NEYA 2CZVC 2J9EA 3M2VB 4DFPA 3SDEB 1OY6A 2FZKB 1Q8BA 1MU2A 4FF2A 5DQIA 4ED2A 3T41A 3CIZA 5F8MA 3K0JA 3AB2B 4C8NA 2VB6A 4ECWA 5D77A 3VCDA 4EFAC 1T9WA 3PW0A 1PYSB 1FDDA 2NXNA 1QSLA 4ZOSA 2B8QA 3TJAA 3WBZA 3NLCA 1HWLA 5AJ3F 2RQ4A 3MUTP 3ADAC 4Y2IA 4DR1J 3C3LA 2OPPA 2X3DA 1CJKA 1D8YA 4MK8A 2A6MA 2A1BA 2YWWA 3PX0A 4IOBA 5B0BA 3OHAA 3RZAA 2DIUA 3CVKA 1F9EB 2CJ9A 3GFXA 4ZIVA 1M5SA 4LRCA 3MTJA 3CCVS 4HLBA 1KNZA 4KAIA 1KQFB 3AA8A 1U2CA 2MZRA 4KBIA 3H20A 1G3OA 3HZEA 3RRKA 1KC8T 1QM9A 4LSLB 5M2PA 4J9PA 5AE2A 4NA3A 1J5OB 2FLOA 3D1OA 2AEMA 3T1AA 3MEGB 3ILJA 5ETNA 9RUBA 5CD4H 3BJYA 3MURP 2UP1A 1T05B 1X4EA 1CJVA 2QSWA 2DISA 1TKTA 3TR5A 1NM2A 2GHPA 1IWGA 4O0NA 5IQ6A 1R0BG 1FD2A 3TZYA 1RTJB 4RU2A 1HA1A 3B54A 4DCOB 4KFBA 4F2SA 1U2RA 2ASJA 1HR0J 4V19X 3P3DA 4JV0A 3TZXA 3JQJA 1WDTA 2XSFA 3SCKE 4JV1A 5CXTA 1LK7A 3MCOA 2KRBA 3N01A 4L72B 2VODA 4NEZA 2RDJA 4UOFA 1TV6A 4PG8A 2KJWA 6FD1A 3PJ9A 2A10A 2YNFA 2EEYA 3W2VB 2MQQA 1NK0A 2LU1A 2ACYA 3KUEA 1VQ8S 2YNGB 2GHWA 2YH1A 1XEZA 4CT9A 2J9DA 2BVZA 1Q86T 3LALA 2BQRA 3SZ2A 5C25B 2WVBA 4M95A 4MTPA 3DI6A 2RS8A 3CJ0A 2HLTA 3RBEA 2DRBA 3LWLA 1XN9A 1JX4A 3OLBA 4HVZA 2E5LJ 3R7SB 2UXCJ 3NEKA 2Q6CA 1GXTA 1JLFB 2M52A 1OYEA 5HATA 1SXLA 4I6YA 3D6HB 3QFWA 3HKZD 2DGQA 2E7XA 1VDHA 2J0XA 3RW7A 3GP9A 2GC8A 1S6QA 1H2UX 1QE1A 3B6BA 4KR0B 4NLPA 2XMMA 2OSQA 4DSKA 3AFGA 1FKOB 2O3DA 3VGVA 3W2WA 2FD2A 3RAMA 2QTWA 3KWMA 2VC0A 3CJKB 2CA9A 2NUUG 3M1VA 4RKUC 4Q45A 4CH1A 3T6JA 4DQRA 1NK5A 1RK8A 3KHLA 1NNDA 2FUG9 4F4WA 1VK8A 1RKJA 1RTIA 2KO1A 1W7WA 2I0XA 1WSVA 1WWHA 3EPGA 3CW2C 3HK2A 3HJVA 4C4WA 3MM6B 1GXLA 2NSCA 4JI4F 1LWCA 2VBWA 3OL9A 1WC0A 3OPKA 1B0PA 4TQRA 3FEZA 1JLGA 2Y3YA 4G3IA 4FXDA 4ID5B 2KH9A 4LRFA 4A8XA 3DDKA 4PRFA 1QSSA 2XZTB 3MAQA 5CD4A 4NL5A 1QY7A 2HMIA 1RAJA 2BM0A 2XMVA 2CDRB 2QL5B 4OZ0A 2H3EB 1PYTA 1E6YA 3PJWA 1BE4A 2VQFJ 2EKNA 2KB2A 3DC2A 5T7LA 3M30B 3GQCA 4YB5A 4B3OB 1YIJS 5L39A 3H98A 2HBRB 2GV1A 4OV1A 2OPSA 1M5HA 5JVHQ 3OTOF 3EXYA 1HKAA 3BGOP 2GGPB 4O4GB 1S4EA 1AB8A 3C15A 4XAKA 1BMQB 3CT9A 3FQKA 3M8RA 1FESA 2MQMA 3ZTQA 4MKBA 1ROFA 1CS4A 7FD1A 2NXJA 3THVA 5KTQA 1MU2B 2DGXA 2ROGA 1AUSL 2DH8A 3GYGA 3A8EA 1AYEA 1OO0B 2WVDA 1PAEX 2UUBF 3K7RA 4WKRA 4ZA1A 1QTMA 2COLA 1WHWA 4DS5A 4GO7X 2HWTA 4U95A 1S9GA 4P52A 4KKOA 5ETSA 2MQOA 2AJ2A 4J91A 2QG9B 4K4SA 3VHQA 2C3OA 4H4KA 5BXIA 3I0RB 4YHHJ 1QD1A 2ZOMA 2OPPB 2BRKA 1CJKB 4DV5J 3AT1B 1NEEA 3AJDA 4J9LA 3G82A 1SJQA 2Z58B 1ZTTA 4F3OA 2K7KA 4X64F 1D8ZA 4UUXA 4YP3A 1VISA 1YQHA 1YITS 1HW8A 2HFOA 2RS2A 3PX4A 2VPZB 3LP0A 4ICLA 3RG6A 2KG0A 2XMJA 3T19A 2ZH9A 2FTRA 4RW6A 4IFVA 4F02A 2SXLA 2ATLA 1CQNA 5KFDA 3BBCA 1QUPA 1MN9A 2WHOA 3E3XA 1FDBA 4B3SJ 1TKTB 2RMLA 1XMBA 3T5HA 1F9FA 5HP1A 5F8JA 2J76E 1FXRA 2H4YB 1KHWA 5I3QA 2AJFE 1R89A 3BGUA 3OTEA 1VBKA 2ZNZA 4KFBB 3Q8YA 3DGVA 1VR6A 4J90A 2KDOA 2HQGA 2YNHA 1T3NA 1RB0A 2AGOA 1RT4A 3TVYA 3RU0A 2IRXA 4F4ZA 2MPUA 2WTFA 2BRLA 2WB4A 3VAGA 5L46A 4I64A 2W7OA 1TV6B 2DNYA 3TZWA 2HRYA 3LWMA 1HR0F 1TFYA 2KYZA 3BH6B 2ADBA 1TK0A 4P75A 4ED1A 4LRBA 1NH7A 3AQPA 4PWWA 4R0EA 1VCTA 1NSAA 3I5CA 1REGX 5L1IA 2YNFB 3TEHB 5DM7Q 4P7TA 2MZSA 3AA9A 1T9XA 5FIIA 1F2GA 1GFWB 1ZYQA 2P9CA 1VBXA 3R97A 2CQCA 3LUYA 2WSCC 5F9NA 3ZZZA 3DLGA 4DV7J 1M5VC 3OTDA 2VA2A 1U09A 2ZUAA 3NOCA 2D1CA 2PI4A 4NMXA 1NPPA 1Q5YA 1N56A 3SFUA 4PWDB 1FT8A 2F4FA 3Q8UA 4HH0A 3SBMA 5KFYA 3DI6B 4C0HA 3O44A 3M2UA 1RADB 2RF2A 1UKUA 1QLNA 3HJFA 4C8YA 4DV3J 3AH6A 2FB0A 2EWHA 1AUDA 3D66A 4B9MA 3KG4A 2A6OA 1LW2A 1S6QB 1QE1B 2QA4S 2RUGA 2E5LF 1V6HA 2CWKA 2MLZA 4F8RA 1BQMA 2LDYA 1JJ2R 5CYMA 2JC1A 2XHWA 2DR7A 3K89A 3W2WB 3NWGA 3FRZA 3GZ7A 2WB1D 3M1VB 2J8AA 3D0IE 3CTRA 4ILLA 3R6LB 5LMNJ 1JLQA 2QEXS 4ZVUB 2DK2A 2LXUA 4RW8A 5E33A 4IO1A 4F4XA 1JMTA 4CLFA 3ET6A 4MAKA 3A12A 4USVA 5D0RA 4RU9A 4MH8A 4BBYA 4IG0A 1ZPVA 2HBQB 3ZTPA 1UA0A 6AT1B 4TVAB 2W9CA 2QX0A 3O5TB 1LWEA 2FHOB 3EZUA 2MZTA 3PRVA 5FLXU 5RUBA 1S0MA 1VC5A 1GAOA 3BREA 2Y1LB 2XZDB 1AFJA 4B9NA 1H3DA 1VYAA 3M32A 2XQCA 3H0PA 3CCUS 1NMEB 4P72A 4RW7A 2HMIB 1ZA2B 4K5RA 3OXFA 5ETVA 2JLFA 3DYAA 2OEKA 2RB7A 2B9XA 3D6TB 1E6YB 1T94A 2YX4A 3HLUA 1OPZA 5T7LB 5B0GA 1RWNB 2OGUA 4DUYF 4USHA 4LF6F 2XLIA 3TANA 2AP6A 2WVEA 2MKJA 3P49B 4B3MF 1SBRA 2VQFF 2BACA 2AMCB 1HYSA 3U1NA 1VIXA 4LF1A 4QIWD 2DY1A 2BE9B 3GR0A 1UEUA 2H51B 1Y4ZB 3C15B 1Y00A 1N5VA 2B8PA 4I69A 2DPIA 3M8PB 2HQDA 2L08A 1HBOA 1WF1A 1LWXA 2MB0B 3KXDA 4NLUA 1CS4B 5JUMA 8AT1B 3NGKA 2RSQA 3F41A 2C28A 3KNAA 3FSXA 1L3VA 1WUUA 4WTOB 1PO6A 1RT3A 3HKWA 3GV8B 3S01A 1RUSA 1IBCB 1FEEA 5D0EA 1S57A 3IR6B 3HT3A 3C6TA 1VQYA 3TUZC 1S9GB 4KKOB 1RT1A 2XHCA 3NGUA 1SKSA 3W5XA 4FNIA 3QPIA 5CZXA 3RGIA 3TAMA 3MR7A 2DHHA 2KU7A 2OKQA 5AE1A 4LIRA 3G82B 2Z2LA 5EDWA 1RTZA 2CNKB 4OX9J 1X8DA 2AGQA 1BUXA 5F0UA 1VS3A 4DV5F 3AJ1A 3LP0B 2NYIA 4ICLB 1N0UA 4CLKA 3TO8A 4RW6B 4KTQA 2RE1A 4IFVB 3KK2A 3OQ2A 2C3UA 1DBDA 4C97A 3BKFA 3VALA 1S6OA 2F5GA 2YBVA 1HBNA 4JI8F 3RB6A 2CQBA 5LT5A 3MDFA 2MZ1A 5C7PA 5KT3A 1X4AA 1K1QA 1O0PA 2EK1A 1Y3KA 1AZSB 3CDAA 3BV8A 4FKXA 4JYAF 4MK9A 2XSJA 5E3RA 3MCNA 5DG7A 4ZVFA 4Y34A 1U24A 2IM3A 2HK3A 1YZ7A 1RT4B 3IM8A 4PEOA 3KFWX 2W24A 4GKKJ 2DCLA 3W65A 4K4ZA 3ICLA 1ZBTA 2YKPA 3H5XA 5ETTA 1SC1B 1C1CA 3EZ5A 3CJ3A 1GMVA 3R5JB 3RAXA 3OLAA 2GJIA 3LPEA 2ZVSA 3IFEA 4Y6IA 1Y5LB 4Z7YA 1NRKA 4Q5VA 4Y65A 1TAUA 1I94F 5C24B 5J2NA 1SQEA 4LRAA 3DLGB 4WP8A 2MKSA 1XIQA 1O8BA 3DOLA 3OXGA 1OYDA 2CPIA 2OI2A 4X84A 3KLFB 3AJ2A 4LF4F 3HZGA 3M4XA 5J2PA 4EBEA 2RF2B 3MMJA 2AJ4A 4FF4A 2WAQD 2CVIA 3UNYA 2AKWB 3WX4A 2C42A 3G9CA 1EJ7L 4AQYF 2GJ2A 2HHHF 2RQKA 1LW2B 2JLGA 2QC3A 1AROP 2FJAB 1IQTA 4TYBA 1BQMB 1NSPA 2K8GA 2DGTA 3UPFA 4B9SA 4IDKA 4DCPB 4QIVA 2V2ZA 2E1CA 3IP0A 3PJXA 3U1MA 1CC8A 1RU2A 3TAQA 1FRMA 3CE8A 3NCQA 5GVQA 1JLQB 4NX9A 2C2NA 5U47A 4I56A 3BSNA 4RW8B 2VDIA 4KY3A 5J1PA 3CULA 3MECB 4EO8A 5KFKA 4IRKA 4ZVHA 4PPZA 3W63A 5LMNF 1U02A 4IG0B 4KQZA 5C2GA 2J0SD 5DGBA 3P6YC 1PSDA 5KT6A 3TW0A 1LWEB 2DRDA 4XDCA 1FKPA 4OFZA 4OYBA 2HVEA 4Q2MA 2ZH7A 4N47A 1L3KA 1RHUB 5LOQA 1UA1A 1SB6A 3EYZA 2CWXA 2UUTA 3KHRA 2HZVA 1KBRA 4CCHA 2VIHA 3X3UA 4RW7B 1UWAA 2E29A 2HVZA 3DYAB 5IXUA 1VIOA 2RHSB 4AYBD 2VICA 1S79A 4ZVGA 3DRRB 1U6FA 3CDBA 1JLEB 2QE5A 3N5FA 4M5HA 1TVRA 4X4NA 5KG0A 3OR2A 2UXDJ 2HSEB 3NGDA 2W4DA 4OV6A 3BR9A 2V4RA 1WG1A 3EMTA 2W2OP 2XMWA 3UFCX 1Y9OA 3IMQJ 1FX2A 4QJVA 3AOAA 1HYSB 2XGQA 4DR7J 2VONA 2HHVA 4DR5J 1QSYA 1RBAA 3HXMA 3GJTB 3JTPA 3CGIA 2DGSA 4OJ1A 5L1KA 2AW0A 2VL1A 1HBOB 4WWSA 5IT9U 5CYJA 1RWKB 1S1UA 4I0WA 5I3PA 2GX8A 1VLYA 3B4MA 1IBLJ 3BSAA 4USJC 3DGPA 1RT3B 4QOTA 1RQ0A 1UZDA 2H5IB 3KKFA 3BPSP 5KFOA 5K14A 1T7PA 3C6TB 1NCLA 3R1HA 4PUOA 3M6XA 4DF4A 2RQMA 4LFBF 1DAXA 1RT1B 4DL5A 4CLYA 1B64A 3HI9A 3TAMB 3ISNC 1TP7A 2CJBA 2AWZA 4LF8J 3QBCA 2AD9A 2B0GA 1X5PA 4OZ5A 4OYIA 3NGTA 5EN1A 4RW4A 2BEFA 3OXLA 2HNDA 1E6VA 4ZP7A 1S6UA 5A2QU 3MXHP 4IOCQ 1LEOA 2XYHB 2YNIA 2P6TA 1J5EF 1DQAA 3LP1A 2RH3A 3WIUA 3PDNA 4WTYA 2C2DA 1S1VA 1FDNA 1EP4A 4M8LA 4OX9F 4DV4J 3KK2B 1RHRB 4N5SA 4JI3J 1NK9A 4RUBA 4FBUA 1HARA 2M8DB 1XERA 3RR8A 2FLPA 1U45A 2YWFA 1OPIA 4WCEQ 5GAHU 2R2UA 1S1TA 4PXCA 1BHNA 4DL2A 3QRPA 2J5AA 2J6UA 3KUHA 5DJBA 4DG1B 1KSPA 1NB7A 3GLJA 3L95X 2IJNA 4U96A 2XSJB 2CPJA 2F8EX 2J9DE 1SQFA 3FQLA 3Q22A 2D3O1 3I96A 5HQLA 1ELOA 4QW8A 4Q8EA 4K2XA 1NUEA 1D1UA 5SUHA 4Q44A 3UCUP 1P8GA 3OL8A 2QFJA 3R5CA 3OFHA 2IJFA 1QDUB 4MFBA 5HROB 4OHVA 3W62A 1KFSA 2OLWA 4GKKF 3GB0A 3VGTA 2ZFHA 1EETA 1SPBP 1M5OC 3IRWP 2H9ZA 1DLOB 5J2NB 4RNOA 1HBMA 2MKHA 3OUYB 3G8QA 3DOLB 1ZM3A 2RU9A 2G0CA 2OD4A 4EBCA 1R8AA 4C7QA 4OJHA 5DZ7A 4A47A 3CCES 2MHEA 2DBBA 1H7XA 3MD1A 3M8QA 5J2PB 4RBVA 3JSYA 2AQ4A 5LSRA 3RB0A 2V8GA 4PG4A 2UZAA 3QJLA 4M5MA 1NB2A 2DH9A 4URSA 2D69A 2R42A 2HNYA 2BJ7A 2ZDOA 3VAKA 2XLKA 2L9NA 2A0FB 1MMNA 3D6MB 4NLDA 3VZHA 1FWPA 3TA2A 3J7A1 3GCXP 1VQNS 3IRXA 2ZUGA 3I5AA 1K44A 4H4MB 5A0YA 2DGOA 4IDKB 3GFZA 1X9WA 4WF9Q 4X65F 2DGUA 1HL6A 3DN9A 4ILMA 4YQWA 2HS3A 1CULA 4NLYA 4BS2A 4WFBQ 1S0NA 1Q0NA 4PCQA 3NCRA 2DNQA 4KGZB 4P2XA 2CQ4A 1RAEB 2C2OB 1CC7A 2F65A 2DNZA 4QW9A 2NUHA 4FYVB 4CP5A 2WOMA 1MLAA 2VFUA 3C14A 4ZVRB 1S77D 4LBHA 1FJ7A 4DQSA 1IN0A 3H40A 3Q8RB 1FKPB 4LFAF 3I9V9 1FVQA 4K2JA 5B0CA 4MKAA 4D3HA 5BR8J 2VV5A 2JWNA 1X4CA 4NLRA 2CFXA 1F5AA 1Q8LA 1NKCA 2ZE2B 1V9OA 2YWEA 1KFDA 3I87A 3MPUB 3T9ZA 2RQCA 5KFUA 3H2LA 4NZ6A 3VAMA 1R43A 2O5DA 3GCWP 2VG7A 2QYCA 3A3NB 3UN3A 5LXRA 4DSLA 4KRWA 1VBYA 1W2BR 1GH8A 4UUWA 4OI4A 4DR3F 2G9OA 1M1HA 4KH0B 4TU9A 1EZZB 5D6GA 1TVRB 3OR2B 3MPVA 5JJBA 1KQSR 2ZOGA 3V4IA 2XMKA 2DR9A 1U1MA 4LQ3A 2J8SA 2KXNB 1WC1A 3T1HJ 1VQLS 2BQUA 4QWEA 2ZH4A 2KHDA 5F8HA 5HK4A 4NE9C 1OQ3A 4B08A 4JP8A 1YBAA 2QV6A 2WBRA 4OHWA 2HIQA 3G6YA 1RAOA 2ZBIA 2Q66A 1UJ4A 2JLEA 2OPRA 4OI3A 4HYKA 1TZ0A 2EFQA 1S1UB 4KPYA 3MD3A 4L6V3 1Y0HA 3FSIA 2H5JB 5KG3A 4QR1A 1AT1B 2ZH3A 2MTLA 3DGPB 3CC4S 5L9NA 3I6PA 2HVDA 4WYLA 4V19J 1ZH5A 4LF5J 1FE0A 2MSSA 2BE7D 3Q8QB 3AQOA 1YBTA 2IDEA 5C2CA 2LEPA 2GS8A 4PUOB 1VQOS 4HTIA 3MOJB 1I51B 3OTCA 5DG8A 4X62J 3MM7A 3RRGA 2J6TA 2IYIA 1HQEA 1Q78A 1HI1A 2ZBPA 4J9VA 4Z7CA 5K5MA 4A8FA 2OMOA 4UOGA 3Q8PB 1YJNS 1C0TA 4FKYA 2HNDB 9ATCB 4HTJA 4USWA 5AXKA 2RIJA 3CO0P 4LF8F 1Z2LA 5F0WA 2YNIB 1NXIA 1BC6A 2RKIB 3LP1B 1KQGB 1YRUA 1VLOA 1XR6A 2Z8QA 1S1VB 1DJ0A 1EP4B 3OVAA 3EVMA 3P8BB 1FRLA 5DDQC 2ZNYA 2B7BB 3F56A 1HWJA 3A3PB 3ZZRA 3M2RA 3DDIA 4K50A 2UU9J 1FI4A 4UT4A 2VBZA 2PT0A 1HQUB 3MFHA 3ILIA 1B3TA 2XMTA 1S1TB 2OEJA 3JTNA 2CPXA 1IVZA 3DOMB 4TY9A 2Q3PA 2DHGA 2ABYA 5LMUJ 1TUVA 4LSNA 4M94A 2E9ZA 1X4BA 2N3OA 4DL3A 2UVWA 4O4RA 5B08A 2R7OA 2XCPA 1X7VA 3OFFA 4KHPJ 1Q16B 3EUNA 3AOCA 5KFPA 5GADU 2Z57B 2RD5C 4K5SA 1FRJA 3U27A 4DXLA 1EETB 3T5LA 1C1BA 2XMAA 3MOZA 4G1IA 3LH2S 4Y2AA 4YMEA 2WK4A 4RL1A 3WC0A 1HBMB 1YZ6A 2ZWOA 1NAQA 1NPKA 2M4MA 1W25A 1Y7PA 2QLJB 4ZS6A 4GRSA 5CQGA 3D68A 2CQ1A 4X4SA 3JXOA 5HMXA 5KT5A 3CDEA 2FHJA 1JNZB 2XY6A 3UR0A 1QVFR 1NK6A 3M8QB 3K17A 1EIYB 1FX4A 3BDPA 4HHUA 5KG6A 5BYSA 2ZH5A 4IQXA 3FSYA 2UUWA 4LSZB 2WW8A 5DDRC 4B9LA 2F4VJ 2OFGX 3O6QA 2HNYB 1MMLA 3KOAA 1U47A 4A8QA 1RBLA 2BJ8A 3HM9A 2J7WA 2GMLA 3KHHA 2HQ3A 4DCJB 1S1XA 5ETMA 2KVQE 2HS4A 3IRXB 4P9SA 3HVAA 2FZCB 4HHHA 4C11A 3UE2A 2BJ9A 5GMEA 5A0YB 1EB0A 3PR4A 2X7IA 1N48A 4KV8B 3OJSA 5FDLB 2OP5A 1RT2A 3QJPA 3HHLB 4QWCA 2NLWA 4KC5A 3NS6A 1CULB 1N32J 3N9UC 3TYTA 4M5IA 1KTQA 4NYOA 4N56A 2CJYB 4CLSA 4UOHA 3EGVA 1ACMB 4A8MP 1A6LA 2WOMB 3C14B 4B3TF 3CNQP 3K5NA 5D8HB 1UEVA 1SKUB 3DHWC 5A76A 2VQEJ 4Q7AA 4CLTA 4J9OA 3S6EA 1F9HA 4ANDA 3ENWA 4ZKAA 1LNQA 1R7IA 1UVIA 3D4JA 2VG7B 3V6DA 3PHTA 3MPWA 3NKYA 4RWXA 3MFIA 3DRSA 3FDSA 1O6XA 4OLPA 3J7Z5 5GAGU 3V4IB 3CXCR 2GO9A 4ZVPB 3NBPA 4EYIB 1TKDA 2YKNA 2XULA 3KLVA 2BXJA 1U1PA 3PW2A 1UFWA 2GCFA 2UV8G 2KN4A 2M9KA 1JNRB 1VMBA 2D41A 4E0DA 2VPXB 1JQGA 2GA7A 1U1LA 3EWGA 4OHYA 3P4UB 2VBXA 3I5BA 2VPWB 3ZNUA 3K57A 4X4PA 4Y00A 1DURA 1T02A 4TN2A 1IBMJ 3T1HF 1VQ7S 4DWIA 3JAMY 3PYFA 3DLEA 5KFXA 1V3SA 4DPXA 1DTTA 4K0KJ 5DQHA 3TUPA 2OJ3A 4A8OA 2ACMA 4HR2A 4A4JA 3KLEA 3V6JA 2EFVA 3MAAA 2NR0A 4G1PA 3BN4A 4YR3A 1D3WA 2WSEC 4LVOP 4DN9A 2R2RA 2DGWA 4U7CA 4P71A 1RSCA 2JOQA 1SI9A 2QT7A 3SV4A 4LF7F 1HQEB 5CA5A 5KFEA 5KFGA 1LKZA 3VQSA 4X62F 4BC9A 3W61A 1C0TB 2Y8YA 1OJ4A 3C66A 4DUZF 4DR2F 2VFTA 2GIQA 2DYAA 3LP2A 4NI2B 2GVDA 1K1SA 4GC7A 1H2TZ 2KXFA 2E1PA 3ZZUA 2KRRA 1BGXT 3D5MA 2HFUA 4A8SA 1FF2A 3M2RB 4GKJJ 4ZPDA 2G0JA 1XNQJ 2FHJD 4RNFA 3MUMP 2LA6A 2BOAA 5A8RB 1T3OA 1VQKS 4P73A 1X31C 3MR5A 4JI1J 2LP4A 4C98A 1J5OA 1NSQA 4LSNB 3N6LA 1Q7LB 3MCMA 5D4LA 4LR9A 2XBPA 4PZVA 1REVA 4HACA 1Z2ZA 3TX8A 2VDHA 3N6NA 2IM0A 4XPEA 5LMUF 3QFHA 2YWKA 3HSZA 2E9TA 4C9DA 4F67A 5KFHA 2C2MB 3X1LB 2N4CA 4J9KA 2I1RA 3PCOB 3AD7C 3CDWA 5I42B 4MYTA 4NCAA 2C2EA 5D4PA 2V4QA 4USIA 3VAIA 2QLXA 2MQPA 5E7OB 1C1BB 2IA6A 4QIFA 4KHPF 4P10A 3G6VA 3FCVA 5CYQB 4QR2A 5KFMA 1FJCA 3L4BC 5A6PA 3W2VA 3HD2A 4GVLA 1UL3A 1SH2A 4NPOA 4PQUB 2QYGA 3HDSA 4BLGA 4QWBA 2W7AA 1L3UA 1XTZA 5AT1B 2UVRA 1C0UB 1TR0A 1YRXA 4OX7A 2IVMA 4OZ1A 5B7WA 3LANA 3D6FB 4EZ6A 2FC8A 1L3SA 3ENVA 1IR0A 5J2QA 3H59A 1S1XB 1S9EB 4C11B 1LFPA 2F4VF 4JV2A 2L9WA 5LL6d 1O5JA 1RT2B 1K0TA 4CM2A 3BBFA 2MGZA 2UUCJ 3HO1A 4CRJA 3BH7B 1R8CA 1HBUA 4FYWB 5DDPC 4PXEA 1UMJA 4RLEA 3W9JA 5IWAF 1NH8A 4LBPA 4ER8A 3PW4A 2ZJRQ 2YPYA 3W1YC 4E2FB 2K1RA 2X1BA 3G96A 5IOLA 3N0VA 1LXJA 3GSDA 3KMSA 4J9MA 4FYDA 2Z56B 3H42A 4N7TA 2Y1JA 1FVSA 1N0VC 1IJFB 3EICA 5GAEU 4LIWA 3C16A 2XNQA 1WOPA 3SQGA 1RTHA 2VH7A 1FJGF 2AZ1A 5B0DA 4URQU 2E1MC 2JRSA 3ULHA 1TL3B 4V1Ak 2LQJA 2CKWA 3KLIA 2E5GA 2R7WA 4KJIA 2D9OA 4ZPVR 4DV6J 2FHMA 2O67A 1IM6A 2VA3A 3V6DB 2MDAA 5L9XA 4ZHRB 3GSIA 4O44A 2VZ9A 4ZP9A 2CJAA 3DRPA 1CSJA 5K20B 2EI5A 1RACB 3HSDA 4DPTA 2WSFC 1WF2A 3DFEA 2JEIA 1N34J 1DZ5A 1SKRA 3I4PA 2XCAA 4LRDA 4OYPA 4DR6J 4LFCF 3KG1A 3NBPB 1IKXB 2EK6A 1PC5A 1D09B 2YKNB 2DXFA 3HFZB 4WFAQ 2GMJA 5EWEA 1WTFA 2M0GB 3V81A 3Q86A 2W9AA 2DITA 3M30A 2HHWA 2NZCA 1ZM9A 2EBGA 3D3CJ 3GIKA 2RVJA 3FKBA 4QQBA 3DLLQ 4DMZA 3THTA 1PILA 2LA4A 3SQOP 3AXKA 5HI7A 4DX6A 2L48A 3DLEB 4DFMA 3BYPA 2HGLA 1DTTB 1JIHA 2GHVC 2M88A 3TVZA 1ICEB 2RDIA 3L7UA 6FDRA 1IBMF 3KLEB 1SJ4P 4ZPWR 2V5HG 3W5YA 1LQ9A 2NXCA 2D3ZA 1K47A 3KYLA 2ZDPA 2XZWA 1Q7YT 3H2UB 1PBAA 1OIAA 1Q1KA 1GXUA 4CO5A 1XNRF 2W4PA 1PC4A 1C2PA 5KG7A 2DEJA 3OBIA 4WFXA 4DU8A 4HT7A 2QL9B 3R27A 2YKAA 2IVFB 3DHXA 3T1YF 2YQ0A 3DCAA 3I55S 3VAFA 1T9UA 2ZWPA 1JKHA 4PQAA 1DHMA 2IA0A 4C8LA 2BV3A 1F3VA 3NMAA 3I0RA 1VQ5S 2N82B 2YKMB 3VVUA 2VOOA 3LP2B 2GVDB 4BCAA 1UTAA 2XYPB 3BEGB 4YS2A 4KPCA 2KJVA 5KAKA 4IYQA 2HGMA 4HDHA 3OL6A 4ILRA 1FRXA 2C2RA 2ZKUA 4OYMA 5GMKa 2NXEA 2Z30B 3S8SA 4F04B 1TK5A 2HAIA 2E5HA 5CHCB 4MYUA 2AYGA 3QIDA 1KRPA 4FF1A 3GYXB 2KT3A 3MMCA 1AW0A 1SH0A 2V94A 1H2VZ 4L75A 1GX6A 2V4JA 4AL7A 2KXHA 4ECRA 5KG2A 3I4HX 4UTGA 3E8OA 4P7VA 2ZBQA 3Q83A 3SSRA 3GONA 3PYGA 2CAJA 1ULRA 3QAUA 1WC5A 2V63A 4CI0B 3W8PA 4NA2A 4ZK7M 4FS2A 5EUHA 3HFKA 2XMUA 4ECXA 4W98A 2DCUB 1SJRA 3KTQA 4RNMA 1REVB 3D1QA 2JVRA 2JSXA 4HACB 3OR1A 3NNCA 1RU1A 5J2MA 2GIRA 3WC2A 3UCZP 4JI2J 5B09A 4DSJA 4W90B 2OIHA 4K4YA 1TKXA 3PY8A 4RNHA 4A48A 3QSYB 4UOCA 3RTVA 2B51A 2JH3A 3FJ2A 3W7BA 2FVCA 5KFSA 1KN6A 3H2VE 3QT8A 3Q8VA 2IM1A 3HPOA 1X5SA 3WHIA 4I7FA 4LR7A 4LR8A 3N6MA 2HK2A 3TQ1A 4YB7A 4YY3F 3PVXA 2CUYA 4NXNF 1R27B 3MAHA 4M5NA 4PXDA 3EM1A 4DPUA 1D0EA 3RBZA 1IBKJ 4JBCA 3J81U 3AD8C 3SIPB 5A8KA 1U6BA 1S0VA 3R5DA 1JXVA 2R2TA 2EXUA 4ECSA 4OHXA 4YDDB 3Q89A 2UUAJ 1X4FA 2VG5A 4PWDA 4Y3CA 2M3DA 3PFEA 5LM7E 3LF0A 2LEBA 4JI6J 5J2QB 3RB3A 4TLRA 3S1TA 2HNZB 2NREA 2X3GA 3R1LA 4WK1A 3PO4A 3HVWA 4X4RA 2NS1B 3K8VA 4OZ3A 1HNXJ 5HJYA 1F5CA 3LPYA 2YVSA 5KG5A 1NHUA 1T95A 2MGZB 5L8RC 1TUWA 1HBUB 1Q8KA 3EPIA 2Q1LA 4KSEB 5HQMA 2L9DA 1SV5A 3HMJG 5K9FA 1ZPWX 4FYYB 2K1RB 2JL9A 1B99A 2C2KB 2UUCF 1URRA 2VJUA 3GJRB 4DV1F 2LMIA 3PO5A 1WACA 3SMZA 2V2VA 5IT0A 1HNWF 1U8WA 4X66J 3C16B 3CD5A 1RA7A 3SQGB 1RTHB 5FJ4A 3PX6A 3MWBA 1WNEA 3ITHA 3BYRA 2QA1A 2B4UA 3KLIB 1RDRA 2VHGA 2Z0GA 4M5KA 3NGRA 2CG4A 3TAPA 2GO8A 3DU6A 3VZIA 1N33F 4JV5F 4LF2A 2F63A 1ZZNA 4MK7A 1YJTA 4O44B 3DRPB 3TP2A 1RT5A 3A4TA 4DU7A 3P45B 2ROEA 2AYMA 2AX0A 1PIEA 1P1LA 4F7VA 4Z2XA 4KH1B 2QL7B 3MR3A 4IRCA 5E3PA 2PMWA 1Z4UA 1KKHA 1FNXH 4EMDA 1U7LA 2I38A 4EYHB 4AXIA 5E3QA 3B8HA 4DZDA 3RYLA 1UETA 2ZBCA 1PAUB 2HFVA 1RKIA 4MIBA 3UDCA 3V81B 2G2YA 5ETLA 4J9QA 3NGSA 1NLKL 4FF3A 2J0QD 4HKQA 2JZ5A 2VC1A 3PZPA 2W2NP 3JTOA 3CWJA 2B43A 3VQTA 3OL7A 2APOA 4LF9J 2OMLA 3UD4P 1A0OB 4M5LA 4C8OA 3CD7A 3NP5A 4DX5A 2AT1B 2LVWA 4ZCMA 3ZZYA 1I6JA 2HEKA 4Q8FA 2KM8B 4NXMJ 1F3FA 2RT3A 4X4VA 3M8PA 1YJWS 2QSFA 3Q24A 2IFXA 2OH2A 4FDFA 4GC6A 4DFJA 3IGVA 5BYQA 2FJVA 5HVGA 3T5JA 5KFTA 3GV7B 4NASA 8ATCB 1F0XA 5GMDA 3US5A 3T3FA 4NYPA 4QYRA 1HI0P 2GMHA 2N7YA 1JKHB 4OI6A 2OEMA 3BDEA 3I31A 1KP6A 1JJ4A 1NHVA 2HRUA 3KK3A 4DV0J 4WIIA 3UNGC 3E2EA 2PA8D 4OYXA 5DS7A 2ZHBA 2FVRA 5HVHA 4JI5J 1N88A 4YN3B 4DHVA 2H5EA 3QT7A 1MNEA 4IH7A 3J7ZT 4ZLLA 4K8RA 1SC6A 4PG6A 4CTAB 2W7PA 4DR1F 3MMCB 3GG1A 1N6QA 4Y0FA 2V4JB 4AE5A 2RNEA 3NWRA 2W01A 1DTQA 1X60A 2IC3B 1VBZA 3W9HA 3TJ8A 4E98A 4IFYB 2FHKA 4M63A 4C0BA 1H98A 2R7VA 2OTLS 3LAMA 1UWBA 3MEKA 3SSQA 1F2HA 3PYEA 4CNYA 2R7TA 4FXVA 1VQ6S 1VC6A 3OR1B 1WORA 3QQCD 4ED8A 3M8WA 5J2MB 3TWZA 3KLGA 1AZSA 4K4WA 3QGGA 1TKXB 2WVCA 1BQXA 4ATNA 4I2QB 2ZBRA 1EQMA 2VF3A 2K06A 2E1RA 1RT7A 2PFFB 1SUQA 1JJCB 2M8HA 4M5DA 1IKYA 1F5BA 4I7FB 2E1AA 2L41A 2V8PA 3VV2B 3CCSS 4I2PA 5KG1A 5HSPA 1OMSA 3JSBA 4GVBB 5KFZA 4WFNQ 2R7XA 4FYXB 1J27A 1JLCA 2POKA 1ZZFA 5KFLA 3HHDA 3QAEA 2I5JA 4NMLA 2FC9A 5AJ3J 4RW9A 4KYZA 1C4AA 5A8KB 5C24A 4I68A 3QRRA 4EZ9A 1R31A 3IR7B 2CQHA 4CT8A 3EGWB 2CQGA 2VG5B 2V2KA 1WJ9A 1KQKA 3QSIA 5DDOC 2VU5A 3KLFA 3VF0B 2XO6A 2QIFA 3HHNB 3NMRA 2HIYA 2WONB 4Y2CA 3IWXA 1VQSA 3ILOA 1SL1A 4FS1A 4WXWA 2HHQA 2UUAF 3CUNA 4Y28C 4YFUA 3N5BA 2HPUA 1Y10A 1BQNA 4CM0A 4PPDA 3LW5C 1S99A 4K4VA 3N28A 1LWFA 4WXOA 1YJ7A 2UXCF 4B9VA 2FJWA 2HVIA 4YR0A 4J5OA 3ZZOA 1SV5B 3UO0A 3HSGA 2V68A 4TYAA 4PXBA 4R0JA 2Q79A 4N8NA 1U49A 4WBFA 1R6VA 4CZCA 5HN0A 1RISA 1T9VA 1S97A 1Y5NB 5HMWA 3MECA 4G6VB 4R25A 2LFVA 1FFWB 3TRGA 1LW0B 2B6AA 3IXQA 3ITHB 4L73A 4BHQA 1OY9A 4XPCA 1YJUA 1V5VA 3ELHA 1VQPS 4TQSA 3TQEA 4X66F 4XTTA 1TK8A 3G71S 4JB8B 4CNZA 4NRTA 3VAHA 4ZN3A 4OJGA 4H4KC 2O66A 1RT5B 3KG0A 4C0OC 4WU2A 2GFFA 2HWHA 2DIVA 2QA2A 2KTQA 5M2UA 2QRRA 1JWWA 3QLHB 2EVZA 5LJ3Y 3BGLA 2W8KA 1HPZA 2V69A 3IAM9 1A7GE 3D1HA 3H8YA 4YUDA 2CDQA 2HBYB 1KLNA 3OVBA 3DRRA 4G1QA 1JLEA 3UVJA 4WP9A 4N41A 4MMOA 5L1JA 3ZTSA 3GIJA 4U6PA 1WC6A 1FCAA 2DNKA 1FFGB 1N36J 2Q6BA 1S4FA 2W8LA 1SIWB 2LXFA 3ZO7A 1RWOB 1RWMB 2PC6A 4TY8A 5IC6B 3TEGA 1VJWA 4ZCKA 2XI2A 2CIMA 4URGA 5EGYA 2QN6B 4R5PB 5AE3A 3IGNA 2GZOA 2AV5A 4FPIA 3NG8A 5KFBA 5B0EA 2ZITA 4UZBA 1B7FA 2V0NA 1D9AA 4DF8A 3K59A 2AJ0A 5LXYA 3FBBA 5F8LA 3KLHB 2ZD1A 2CPZA 2AHOB 3FMBA 5L38A 1WHXA 2XTJP 2KYXA 1KHVA 4TLQA 3BQ0A 1LV5A 2ASDA 1WF0A 5CABA 1TTHB 2ZH2A 4KGVB 2RAQA 4QYZJ 3KK3B 2JVOA 1U8SA 4WK3A 2CPDA 5F8GA 2LQ9A 4DJBA 1RAAB 4DN0A 4NLSA 3DXBA 4ECYA 2Y0SD 4NA1A 4ED4A 3W9IA 3CJTA 3E01A 5ADZA 1RE1B 2OUGA 1B4SA 3K5PA 2HHXA 5JXSA 4YHHF 3UI3A 3JAMU 1CEZA 2IRUA 3O2IA 1N6QB 3PIPQ 2XYGB 4RNNA 1DTQB 1UJ5A 3KMQA 1NJYA 4DEZA 1IJEB 3LGMA 3NNAA 4ERDA 3KJQB 2H54B 1J2VA 4ZN1A 4NLTA 1AFIA 1UWBB 4ZIWA 1X5OA 1R0CB 1RJJA 1ZOTA 1EX8A 2E66A 3OTOJ 2MY8A 3QO9B 1WOOA 1Q8IA 3KLGB 1G4CA 1NU4A 4DG1A 3TX0A 5A8WA 4B3SF 5J1NA 1IKVA 3FNNA 4DI6A 3SCLE 1WKLA 5ITHA 2D74B 1QTNB 1TL1A 1RT7B 1SUQB 4PR6A 4LVNP 4M5DB 1IKYB 1CG2A 4DSEA 2NSBA 2IDLA 2UUBJ 1FRHA 5DM6Q 3R8YA 2K2PA 2MQ8A 4I2PB 5E3CA 3MM9A 1ZM2A 2LECA 3PW7A 1JLCB 2CJKA 5D4NA 4E8UA 3KJVB 5HROA 4IUFA 4UQGA 2I5JB 1FTCA 3EE3A 2BYCA 3RBDA 4RW9B 3VAJA 2V67A 1RAIB 1PJ6A 3D28A 1DLOA 4KGXB 2IHR1 2ALYB 3JQMA 3OUYA 3FBEA 1ZS6A 2EFOA 3BQ2A 4ETXA 2BMBA 5H9FJ 1S9FA 5KT7A 3PHEA 3U1LA 4DL6A 1F6TA 4F0MA 3CJSA 4X64J 1SVDA 5IT4A 4I6AA 4DV7F 2ZOFA 3LQVA 2D9PA 4F3QA 2E7WA 3HVTA 2GQQA 1GQEA 3W64A 2HFSA 4QPXA 1RCXB 3CD0A 3FUYA 1ZA1B 2Y1RI 1RYSA 3W66A 1BQNB 3NRBA 2DXEA 2MKIA 4EI2A 1UJ6A 4DV3F 4C3LA 5IC4B 1LWFB 3F0NA 3G6ES 5KG4A 3HHKA 1YWXA 4IKAA 1RZMA 3RB4A 2NCKL 3GJQB 4H4MA 5LSOA 3A3OB 1GK8A 1NZAA 3NY0A 1KOHA 4CO0A 4NOHA 1UFKA 3JQKA 5KOWA 4J9UE 3GU0A 1UPPA 3EVWA 2P9GA 1YK9A 2CNLB 2GQ2A 5ETOA 2HAFA 3D0HE 4PWUA 2IM2A 3BGRA 1U1RA 2B6AB 3QT6A 4FVMA 1DQ9A 2H4WB 2WBMA 2C2ZB 3L3CA 3FC9A 4K7QA 4JUZA 4B17A 4KGMA 2ZE2A 3BB5A 3SXLA 3HT0A 3QNWB 2ATCB 2X1GA 1XR5A 3M7VA 1HPZB 1Y11A 4WE1A 5G4DA 1KTVA 1R8BA 3WZ0A 1BWEA 1MROA 3GFYA 3FMWA 2PIIA 4G1QB 1MMDA 2ZEJA 3UVJB 4USTA 3DOKA 4MKYA 3LOUA 3W60A 1U26A 2QLWA 3BS9A 3MMAA 2N7CA 3PFOA 1VGYA 2KVIA 5HJXA 5C5JA 2PI5A 4TY8B 2RHQB 1HWUA 4F26A 2B56A 1EARA 2DKOB 3GYNA 2C3MA 1UPMB 4F50A 2OSRA 4ED7A 4LUBA 1MWZA 1HD1A 1N36F 3J80Y 3K2YA 1Q95G 5BJRA 5KFAA 5E5NA 1T11A 2DHAA 2MQNA 1WKJA 1LXNA 2L3MA 2WVFA 2XEXA 2R8JA 4PAAA 1JB0C 2ZD1B 2HW3A 2BBEA 5DLGA 4RX6A 3U02A 2V8HA 4OX8A 1ZETA 2FJXA 1SQGA 2W2QP 2MYFA 1UCNA 2LYVA 1RXOB 2BW7A 2AEJA 2DEIA 2RJZA 3SI8A 4OZJA 3G87A 1S1WA 2DD8S 3ZXWA 5K8MA 4ZVEA 4OJ3A 4NLQA 1UVMA 4U67Q 1NDLA 1T0TV 1RAHB 2YPZA 3E01B 4X4TA 2XY5A 1A9NB 2VASA 4NYZA 4QCLA 4Q0BA 2HURA 1H74A 4DV2J 2RKIA 1SL0A 2ERRA 2VUGA 1LFWA 3MHYA 3GG0A 2MKYA 4CWBA 2G2ZA 1SIZA 2WCXA 1TL7B 2HHUA 5IZHA 1XJWB 1O51A 3P5TL 4DUYJ 4LF6J 1NDCA 2F40A 3UCGA 2CVEA 3RJMB 2XB2D 3I32A 4B3MJ 1TAQA 1HQUA 2R8KA 3TUIC 1U4BA 4MT1A 3FEYB 1YDLA 4CH7A 4DUTA 1I1GA 2DNGA 4DS4A 1UVJA 5CAAA 1S76D 3DOMA 4NWBA 3MM8B 4WZQA 4NZ0A 1U25A 5A8WB 4HHJA 4XIUA 3A8KA 1FEHA 2FGCA 2R7QA 2PN6A 1IKVB 2JJ4D 4MKVA 2BR0A 5EWFA 1TL1B 5DO2A 2DY9A 2YX7A 3C8YA 5BYRA 3JYTB 1CQMA 1KD1T 1UVKA 2QO3A 3DRXA 4R8UA 2OFHX 8RUCA 1LOUA 3MM9B 3OW2R 1BLUA 3EX7B 1F1BB 1F60B 2ZH8A 1VHIA 5HL7Q 3HHEA 1MW7A 2D7SA 2RDDA 1FJEB 1RWXB 3TVKA 4O0IA 3QT5A 2Z2MA 3UN5A 3CIMA 1WI6A 3TOQA 2DXDA 5MAOA 4YB6A 1SKWA 1WDDA 4USUA 3WX8A 5H9EJ 3FCHA 2BJ1A 2YQ3A 3C19A 3HVTB 1D9FA 3CJ5A 4C8MA 3DLJA 1PJ5A 1G7CB 3T6BA 2LKZA 4WZMA 1I3OB 1QJHA 3TUJC 1XMQJ 1VQMS 3MPDA 3M9OB 4O3QA 2BM1A 3GFHA 4JI8J 2M5YA 1NKEA 3BKTA 2XI3A 1WEXA 2YY3A 3N4WA 1M1KT 3PKYA 2AZ3A 1MG7A 4QZVB 5KOXA 4CLLA 3GTYX 4KV8A 1R8HA 5FDLA 2FY1A 2PSZA 4JYAJ 3M6WA 1CJVB 5HO4A 3G8TA 1KOOA 3HHLA 1HFEL 1R0AA 3CCQS 2BKOA 1EQ0A 3OV7A 3JS9A 1R6YA 2DNMA 3BN7A 2UVUA 4FZVA 4MJKA 4MIAA 3BGRB 1YTYA 3MR6A 4DLEA 2BJ3A 3HFVA 1FWKA 3I82A 1T9YA 1V3RA 2DNPA 2HVHA 1NDPA 4K4UA 2QMWA 3MPYA 4OI1A 4AT1B 1RWVB 2MKKA 1I94J 1WELA 1UW9A 2NQPA 2CZ4A 4JI0J 2NPFA 2V50A 4QIGA 4F0KA 4LF4J 2CJXB 2VFVA 4WE1B 4F0HA 1MROB 2BJDA 4BDPA 2BABA 2R7SA 1VQ9S 2KG1A 1RYRA 3DOKB 4AQYJ 3NAHA 5F41A 2HHHJ 1N5YA 3OJUA 5D3GA 4QR0A 3AOBA 1VFJA 3MMAB 2R3VA 2B9EA 2RUSA 4ANCA 3HSJA 5DQGA 3ZNJ1 1CJTA 1L3TA 3UWTA 1U1QA 3R7NB 1JLAA 4NRUA 2UXDF 1FFSB 5D0GA 1S72S 1MWYA 3M9NB 3QZ7A 1YG0A 1H73A 2BA9A 4F2RA 2MJNA 5AXNA 4DZ6A 4QU7A 3TJ9A 2N3LA 3CCLS 3CJQA 4WYWA 3ZC4A 1KONA 3OFEA 2EPIA 2W9BA 4DR7F 4DR5F 3P5BP 1TU0B 3CC2S 2WW4A 3W8GA 2LXIA 2BQ3A 2P8IA 5T14A 4B9UA 3V6HA 3H5SA 4PYDA 1HD0A 4KO0A 3UN2A 3OHBA 4NCBA 1KLMA 1H38A 3J7YI 1IBLF 2FVPA 3LAKA 3GJSB 2AEFA 5K8OA 5KT2A 2Z2YB 4Q43A 2FJEB 2J6SA 3R2DJ 1RTIB 2A2CA 2V2QA 4K4XA 1KWMA 2FDNA 2K3KA 2F9JA 7AT1B 2D3OR 1S1WB 5HMZA 2YH0A 1LWCB 3ETOA 3GIIA 1BY9A 1JLGB 5KFIA 2ILYA 2KFYA 4P2FA 2M2BA 3ZFVA 4ENOA 1M90T 4Q0BB 2DO0A 3C2PA 1WI8A 3W5ZA 4KB7A 2QLBB 4NI2A 3AAWB 1RCOB 2MEWA 3K5LA 3NL0A 4M5GA 1EHWA 2MZJA 1NK8A 4ECTA 1NPRA 4J9SA 1SJ3P 3UDEA 1U0SA 4DV2F 1DFDA 1K73T 5A8RA 1N8RT 3D54A 2DTJA 4DV4F 2K7JA 4N8OA 2ZJPQ 1FTRA 4JI3F 4DSFA 4CIOA 1G6BA 3R2CJ 1YGYA 4DOZA 3NCPA 3CCMS 4YR2A 4ALZA 3V5RA 3D67A 3OD2A 3HHLC 2OPSB 3DDNA 2QA4G 4DPOA 2A3JA 4OYAA 4ES2A 4IR9A 3O1LA 4FVCA 1U2FA 3M6VA 1N52B 2YXLA 4OYZA 4R8UB 5CZVA 2CQ0A 1EAYC 3HULA 5I42A 3HHLD 2HGNA 1K8AT 3B4DA 4LFBJ 1GTHA 2B7CB 3B82A 3AD9C 3CCJS 5IM0A 1NK7A 5F9LA 1X0PA 4ZPCA 2KFZA 2CRLA 5E0OA 2CQDA 3PTWA 1HLWA 4XK8C 5KFNA 1HNZJ 2IMOA 1HQ2A 5CYQA 1WEZA 4KIAA 5C42A 2R8GA 4J9NA 1FA0A 2LLZA 1Q53A 3HVRA 2PMHA 3DMJA 2BANA 4OI2A 2BZ2A 4PQUA 2ZC4A 1J5EJ 3J81j 4OYWA 2NXUA 1C0UA 3IR5B 4PABA 4ED5A 4C2MA 2DH7A 2F8MA 4WFZA 1WHVA 3AB4B 3IS9A 2G0IA 3DXSX 5DZ6A 2G13A 3CO9A 2AYBA 2DPJA 3BBBA 2MQLA 4QU6A 1UVNA 2CXEA 4Z37A 2MY7A 3FEXB 1S9EA 2EFGA 2IBOA 2LQBA 2CNNB 2DNRA 1RP5A 3ZZ0A 2YKOA 2J9CA 3UW1A 3L9ZA 3N79A 1XMQF 3L09A 2I6WA 2FJDB 4ITSA 1T9TA 1U6ZA 3NAIA 1UAWA 1YKWA 1X4HA 2GQCA 1R0AB 5K8NA 2E7VA 1OWXA 1TUGB 5HP1B 2ZZMA 1IM4A 4LQ9A 3FRYA 5GAHI 4HDGA 3K5OA 1RWPB 4B02A 2XS2A 2YNHB 3LO3A 4QYZK 4UF4A 4HI1A 3K8WA 5MLCV 3QRQA 4RBUA 1Y3JA 1TMMA 2CPYA 5D78A 5D15A 1AXQA 1X9MA 1RAFB 3IBFB 3QZ8A 4DL4A 1S5ZA 1K0VA 4CLWA 4X4QA 3MEDA 3WQPA 3IWNC 1NK4A 4DPWA 1K9MT 3H5UA 2R2SA 1TL3A 1B7YB 4NZ7A 2YQ1A 5L1LA 2YX1A 2IPOB 3EDRB 4RJVA 1KVIA 1RT6A 2AU0A 1FRIA 1NKBA 5BR8F 2QGFB 4ZVQB 3Q23A 1QAXA 3TA0A 3BF4A 4ZHRA 4ZPBA 3ISZA 2H1YA 3O3LA 1N5QA 5ETRA 2HWIA 1YSJA 2QJ3A 4JI0F 2LU2A 1FKAF 3PRBA 1N5YB 2IY5B 1M0SA 3M2UB 4F4YA 4LT6A 5D3GB 4CH0S 2VFRA 3C6UA 1HHTP 1IKXA 2MMYA 3MM5A 3POTA 1CJTB 1X4DA 1JLAB 4ANEA 3EZOA 1H0HB 2LEAA 1BWVA 1L5UA 1H72C 2AF6A 1PJ7A 2PEBA 2CNOB 4ELVA 2MSTA 4A8YA 2F8HA 4ETZA 4X65J 3FGVA 2W9BB 3QWUA 1MN7A 3OSPA 2V34A 5LJ5Y 2V9WA 5CYMB 3UDLA 4H4OA 3M9MB 3PACA 5IFMA 4TXSA 1TL5A 4DX7A 3J7YU 4LREA 1QAIA 4C6AA 4A8WA 1GMUA 3LGHA 4KO0B 2RU3A 5E41A 1KLMB 3Q8SB 1H6KX 2QZ8A 2EG2A 3H4DA 4L76A 3ET6B 4UZCA 4LF5F 4LFAJ 5H9FK 3VTIA 4I6WA 1FD8A 2DHXA 2JC0A 1TL4A 3SCIE 5ETPA 2ZHOA 2FPHX 4QWAA 3I56S 2KT5A 4OZNA 3GIMA 2W9CB 3CJ8A 2XNRA 2MLXA 2QLFB 4OI0A 1PBUA 1KVJA 1NZ8A 1XWLA 1WD6A 5H1SV 1SC4B 4CQ1A 4IG3A 3MGJA 3G4SS 4QIEA 3M32B 3UQSA 2YKMA 1YHQS 7FDRA 1VJQA 4ZJLA 3RAQA 1R3NA 4DR3J 2I8EA 4UW2A 3IC1A 3K58A 3A8JA 2YTCA 4FPRA 4USKA 3ENAA 3I0SA 3ILLA 3MMBA 3KK1A 4EU0A 3IA0A 2DO4A 3NXZA 1RBOB 2Y1IA 4WP3A 2KKHA 4PG5A 3GILA 4ELTA 3EGNA 2UU9F 5K8PA 3AHPA 3FZBA 2JNJA 3R5AA 3MEEA 4YB1P 1OS5A 4EGLA 1XMOJ 2VFSA 2IBKA 4U9RA 1QAYA 3CC7S 3VR1A 1SH3A 2R8IA 3QGHA 3PRDA 1GEHA 4D3GA 1UP1A 1IQZA 3A1YG 4J37A 4CDIA 1IKWA 2M7SA 2OHDA 4PKDB 2LCWA 4C3KA 4FBTA 2GAGC 2R7UA 1NSKL 4DR4J 5IM0B 3EGZA 2XG8A 3R6GB 4YEAA 3A13A 5F8IA 3IG1A 2YWGA 2Z2ZA 4FN5A 2PMZD 2VOPA 5C42B 4BWJA 3GR1A 3ZZTA 1P6TA 3EXCX 4F4KA 1P27B 1Q5VA 3DMJB 1BXNA 2BANB 1HNZF 2CQPA 3H25A 5KFRA 1VOMA 4DPYA 2XS7A 2MXYA 1NJIT 2B4VA 3KHGA 2M70A 4JI7J 1URNA 4X4UA 1HI8A 3ISND 3VWSA 1RAGB 3HP6A 2BKNA 3IS9B 4CYUA 3H7HB 1IUJA 4I4BA 4X4OA 1VRQC 4FXWA 4USMA 4ZLNA 4H54A 2HNZA 1TKZA 1X5TA 5HQ8A 3J81Y 2VKZG 1VQ4S 1WG5A 2XGPA 5I3UA 2OPQA 1HBNB 3GE9A 1KDNA 2XY7A 4U8VA 4ES1A 2U2FA 3VGUA 1IXKA 2PA3A 4YOEA 2Z4PA 4O3NA 1X4GA 4NLVA 1SCJB 2R8HA 3DLBA 2B4OA 1KVKA 3CMAS 3GIRA 1VRUA 3S7RA 2FGOA 3QATA 2AGPA 4CO4A 4WFYA 1JK9B 1N32F 2FIUA 3WIVA 3KJFB 3MTKA 1VRTA 4EUVA 3FZ2A 2HKEA 4ZVOB 3MEDB 5HMYA 5D0HA 3M8ZA 5I4MA 1C1CB 4NLXA 4F3MA 3BQ1A 1YBUA 2FVSA 2KHCA 1RT6B 2NZ4A 4WIQA 1FO1A 4B9TA 3ENQA 4ZITA 3TARA 5GADI 2VQEF 2W2PP 3IBCB 1UVLA 2MJUA 1WSRA 4DL0C 2LQ5A 3PNIA 1G2EA 1S6PA 4IOAQ 3A8IA 4RWWA 3PR5B 3FBFA 1KS2A 1ZAVA 3AXMA 4CO2A 1C4CA 2FY8A 5AXLA 5KT4A 3ONQA 2I2YA 3CDUA 4NLWA 2J0WA 4ZLPA 3C6UB 4NCGA 1U1OA 1U0HA 3MM5B 3POTB 5A6WA 2E9RX 1TQLA 3SV3A 2ZM6J 1SJFA 2DNOA 1DY3A 2WRMA 4F4AA 4A8KA 5J1EA 2ZKTA 3MZIA 1JXLA 5DLFA 1NJXA 1CJUA 1X0FA 2IAJA 4EWTA 3QGIA 1G1XA 2EKYA 5CCMA 1RWUA 4DFKA 4TNOA 3G8SA 4OQJA 4H4OB 2BDPA 3DLKA 2HLUA 2ASLA 1RGVA 2ZH1A 2JEFA 2C3PA 4TU7A 1CPZA 4IR1A 4B3TJ 4K0KF 3R9LA 2EFPA 2ZC3A 2E5IA 2DB1A 2CG8A 2DGVA 4UY85 4F25A 3RRHA 2JX2A 3JSMA 4OIXA 3AY0A 1S0OA 4RUAA 4ZLJA 4WJBA 4CLPA 1U1NA 3CD6S 2UVVA 2VG6A 3TI0A 1RTDA 5H9EK 3MUVP 2GNKA 3Q2SC 3Q2TC 3P96A 5AXMA 3I9ZA 3DNCA 3SCJE 1S48A 2EFNA 4IG3B 2OELA 1B0VA 1YRTA 5LSLA 1PCAA 2W1BA 1NO8A 3EDQB 5IV3A 1VI7A 1HHSA 2G4BA 4DL7A 3J80U 4IH5A 1GNKA 4KT0C 3I0SB 4RZRA 2HQCA 3MMBB 1JJHA 3CCWA 4CTAA 4ZVSB 4I67A 3KK1B 2ZZNA 3VVTA 2AJ1A 4ELUA 4OZ2A 4PG7A 3QYYA 4RBTA 4OMFG 2IC3A 4GKJF 4ED3A 1WG4A 1IR2A 1U1KA 4IFYA 3BSCA 1XNQF 3PXGa 3MEEB 3M6UA 2Q43A 4EO6A 5GAGI 3QJJA 2O01C 4WKYA 3R7BB 3MR2A 2IRYA 3R3TA 4JI1F 3B78A 3E51A 4O3OA 4KHMA 3RUBL 3DM2A 4ID8A 2B5JA 1R8PA 1XMOF 2DRAA 3OSNA 4XDDA 3PYDA 1NJWA 3H4BA 1H7WA 4I2QA 1IKWB 2ZJQQ 1N54B 1RLDA 2DNHA 5JMNA 2IYGA 2C22A 4FP9A 3K5MA 4XO0A 3UD3P 1XC9A 1S59A 2FJBB 2DHSA 2HRTA 4J7CA 4EEYA 2P6SA 2YKQA 2F9DA 4LF7J 5K14B 3IWLA 3IG1B 1M1GA 4GO5X 4QPTA 4GVBA 2VJVA 3CJRA 2NYHA 1GMWA 2BE2A 1T03A 4YDXA 4DR4F 2BW2A 3HX9A 5CCLA 2HHPA 2ILZA 2ZH6A 2G2OA 2ZZTA 2B4PA 4DUZJ 4DR2J 1ZTWA 1APSA 3W3SA 3V4MA 3PIOQ 1TELA 4ES3A 4HT5A 2H65B 4RW4B 1WKKA 1FK9A 2XWYA 1E6VB 3IN5A 4DQQA 5HAOA 2CPHA 2MZQA 2QMUB 1S10A 1D9DA 1NDKA 2CADA 2VD3A 4CYUB 1N5TA 3PEHA 1N5SA 3IAS9 3F44A 1N4LA 2WONA 4JI7F 1DARA 4KHRA 2FLLA 4BC7A 1RLCL 1FDAA 5FD1A 3DU5A 1TKZB 3BGFA 3KDNA 2WZ1A 4W4MA 5I3UB 2OPQB 3NNHA 2ADCA 1X9SA 3O8WA 5KFVA 2V6AA 3H90A 5E2QA 1FERA 1Q4RA 4KE5A 2HFZA 1QAJA 2ASYA 1OSCA 3U7JA 1JLBA 1UFLA 5M2RA 5KFQA 1VRUB 2F1FA 2W2MP 3QIPA 5KFFA 3CCTA 1FWLA 2KM8C 5KFWA 4B3RJ 1W26A 3BKUA 3ZTOA 4ZP6A 4IO9Q 3VGSA 1YJVA 1VRTB 3PV8A 3CSKA 2UXBJ 5EWGA 4L74A 1OSDA 1HNVA 2GAHC 1LW0A 2PDAA 2CZ9A 2CQ3A 4MFBB 4EK2A 3V6KA 2BUNA 1B0TA 3PW5A 4RUCA 3QMQA 5B0FA 3R5BA 5HBMA 2HHTA 3CF5Q 3EVOA 2NPIA 2EG1A 4ZCIA 2LDIA 3MCSA 4NLGA 2FLNA 2W25A 4RPFA 2JHEA 1S6PB 1HWIA 3PEJA 4DV6F 2CYYA 3M8YA 5E3AA 4U7UK 3QLHA 1TFWA 3GWCA 2JFDA 2E5JA 4NCGB 4ZPTR 2HZAA 4NLOA 3FFIA 3CJ4A 5CH7B 4OYOA 1U0HB 4HL9A 1T8EA 5EX3A 2Y9HA 1N34F 1Y5IB 2EC0A 4X2BA 1FHTA 3TNVA 5J1EB 2XC9A 4DR6F 5FLXY 4ZJQA 3T9NA 1CJUB 2IAJB 3BSOA 2EBEA 4ZJOA 2GVZA 2ZM6F 4S0MA 1FE4A 4CO1A 4G65A 1CVJA 3DKDA 5G0RA 4OX6A 2CQ2A 5IWAJ 2PD1A 2GW8A 4R5PA 3DLKB 1ZAXA 3HD1A 2BOPA 4ECUA 2OO4A 5KFJA 4P74A 5IV4A 1NJZA 1EKRA 3NS7B 4C3MA 2H48B 4Y2MA 3M05A 4ED0A 2N4DA 1Q81T 2ROPA 2W4CA 3KLHA 3JSMB 2ZHAA 4ZMMA 3LTOA 5ETQA 5HLFA 3SEOA 3G2XA 5HVFA 1FJGJ 1AA1B 1IR1A 1KR4A 2P5VA 4LJMA 2VG6B 2XO7A 4LMZA 4CO3A 3DLHA 3T5KA 4K59A 4BWMA 1RTDB 2E44A 3FBCA 4ECVA 1YI2S 1WOSA 2DNLA 4MIWA 1CLFA 1XK8A 3WDOA 3LGNA 1V3ZA 1TMJA 2YWHA 2J7KA 4RUHA 1MSWD 1VHFA 2QMXA 5GAEI 1RABB 4DSIA 4HI2A 2F3JA 1P9QC 3J7AN 2KT2A 1GMWD 2GJFA 3D3BJ 1VK3A 3M8SA 1KEKA 2HZCA 3CPWR 4RO0A 4ECZA 3JB9k 4LFCJ 1NHKL 2DR8A 5DGAA 4O23A 4I1TA 2R7RA 2HG4A 4L3KA 1GT8A 1HMVA 2B3TB 4IRDA 4FNHA 1S7IA 2XLJA 2Y8WA 3EJMA 3AODA 1PYOB 1HNIA 3PKMA 4HH1A 1W2IA 2OD6A 3GMGA 4UQTA 3ETMA 5SZTA 2EW9A 3QO9A 4ZP8A 3DM2B 4LBIA 2X51A 1RWWB 1RHJB 2OPRB 3OVSA 2B5JB 3MF5A 2J7UA 1FRKA 1XR7A 4U8YA 1GX5A 2V9KA 2HS0A 1WEYA 4AFFA 4QWDA 4JI2F 2A2DA 3OFGA 2DNNA 2EC2A 4C8ZA 3DRYA 3Q0AA 2CQIA 1XNRJ 5ETKA 2KI2A 2V8DA 2JEJA 1GTEA 1PKUA 2IIHA 3M2VA 3SDEA 2X1AA 4QBUA 5IS2A 2KL8A 3T1YJ 2BE2B 2PFDA 1T03B 4AL6A 2VKRA 3KJVA 3ZTRA 4P2SA 3MM7B 4IH6A 1WC4A 2GIFA 4M5JA 3IBWA 4DLGA 2IJRA 1FXDA 1UEKA 3BZQA 1B70B 2R4FA 4J9RA 3UDVA 3TZZA 2XM3A 1IBKF 3QWPA 4N76A 1HHQA 1FK9B 3HCXA 2I9SA 1U48A 2HQFA 4F36A 3BR8A 2AJQA 1Q82T 4AUKA 2IVYA 1S12A 5F3TA 4OHZA 3V2UC 2G1HA 4PYAA 2KFNA 2VPYB 4WPAA 2PO4A 5DRKA 2FZGB 3UD5A 4JI6F 1YX2A 3QGPA 3CB4A 1CBKA 1RI7A 4C8KA 1YVFA 3KUGA 2JDJA 3JSRA 3H5YA 4CLUA 4LSLA 4L3NA 3G86A 2FYXA 3CMES 3MI7X 3D2WA 1JLBB 4ZCLA 1HNXF 3MEGA 3QIPB 1T05A 4IQMA 4DQPA 1JXEA 2HQIA 2DJWA 3SSSA 4K4TA 2FVQA 4ZDNA 4O3PA 2MHNA 5DG9A 3F73A 5IQQA 1FNOA 1RTJA 2AIRB 1SJ1A 3RR7A 1XQIA 3CJ2A 3L7PA 4B3RF 1HNVB 2QFIA 2RRBA 4YY3J 4NXNJ 4A46A 5F3ZA 1SC3B 3TA1A 1QVGR 4AL5A 5HBMB 2XS5A 4P2MA 2UXBF 1SL2A 2KZZA 1S49A 2C1EB 1BD6A 2PE8A 1V5IB 4DQIA 1MWQA 1YJRA 3THPA 3RW6A 1ITPA 4Q2LA 2PEHA 5KFCA 4ED6A 2YNGA 4TU8A 1DQ8A 1FNMA 3BO2A 1WC3A 3D0GE 4ECQA 3FFIB 4N77A 3D7SB 3NS5A 2IMWP 5EHHA 4KGKA 3FVYA 5D4OA 1PG5B 1WHYA 2V8VA 3L7OA 1RA6A 1ZM4A 5EX0A 2HHSA 5C25A 2BKPA 1EKSA 5B0AA 5THWA 1M5KC 4M1KA 3GV5B 2O1PA 2B9YA 2OTJS 5T41A 2GVZB 1YLXA 1NBEB 3KDOA 3IO1A 4O3RA 3RBXA 5G0RB 1WTBA 1RHKB 2MKCA 1JLFA 3ZZPA 1VC0A 2RRNA 3FCWA 2HBZB 1UW4A 2FQQB 3FK4A 2P9EA 4EBDA 1OQ6A 4LF9F 3LA0A 4WU3A 4OZLA 4OLOA 1IWAA 4DV1J 1YJ9S 5HANA 1HNWJ 1FKOA 2ZVIA 3R5GA 4O3SA 1P1TA 1I5OB 3CJKA 4NXMF 4DDFA 5HLFB 1RHMB 2XWXA 2C3YA 2F7VA 4ZPAA 2RILA 4JI4J 4RR5A 4U7UD 2K3IA 1HWKA 3CEDA 4DX8H 1M5PC 4OL8A 4AD6A 2CJQA 2X1FA 1N33J 1DRZA 4JV5J 2CPEA 5DETA 3IM9A 2JEGA 2MLYA 3MM6A 5IT9Y 2G1DA 2CPFA 2DR6A
chains in the Genus database with same CATH topology
1PYOB 3NS7B 2H48B 2HBYB 3EDRB 1RWXB 1NMEB 1IBCB 1I51B 2QL9B 1QDUB 2XYHB 2CNNB 3KJFB 3RJMB 4ZVQB 3GJTB 1QTNB 4LSZB 1RHKB 4ZVTB 2HBRB 3R7NB 1SC3B 3EDQB 2Y0BB 4ZVOB 2HBZB 3QNWB 5IC4B 2QLBB 1RWWB 1RHJB 2FQQB 1RWKB 1RHRB 1RWOB 1RWMB 1RHUB 4ZVSB 1RE1B 4DCJB 2C2OB 3P45B 2XYPB 5IC6B 3GJQB 1BMQB 1GFWB 3R6LB 1RWNB 1RWVB 4ZVUB 2C1EB 4DCOB 2XYGB 2QL7B 1RWPB 2QLFB 3R7SB 1I3OB 2H5IB 4ZVRB 2XZTB 3D6FB 3IBCB 1SC1B 1SC4B 3KJQB 4JB8B 2CNKB 1RHMB 2H54B 3D6HB 1ICEB 3R5JB 2H65B 2C2KB 2CNLB 1PAUB 2HBQB 3KJNB 4DCPB 4ZVPB 2CNOB 3SIPB 3R7BB 3GJRB 2H5JB 2H51B 2H4YB 3IBFB 2CJXB 1F9EB 2C2MB 2DKOB 2CDRB 2QLJB 3R6GB 2QL5B 2P2CB 2H4WB 3GJSB 2CJYB 1RHQB 3D6MB 2C2ZB 5K20B 3P4UB 2Y1LB 2XZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYO B;  3NS7 B;  2H48 B;  2HBY B;  3EDR B;  1RWX B;  1NME B;  1IBC B;  1I51 B;  2QL9 B;  1QDU B;  2XYH B;  2CNN B;  3KJF B;  3RJM B;  4ZVQ B;  3GJT B;  1QTN B;  4LSZ B;  1RHK B;  4ZVT B;  2HBR B;  3R7N B;  1SC3 B;  3EDQ B;  2Y0B B;  4ZVO B;  2HBZ B;  3QNW B;  5IC4 B;  2QLB B;  1RWW B;  1RHJ B;  2FQQ B;  1RWK B;  1RHR B;  1RWO B;  1RWM B;  1RHU B;  4ZVS B;  1RE1 B;  4DCJ B;  2C2O B;  3P45 B;  2XYP B;  5IC6 B;  3GJQ B;  1BMQ B;  1GFW B;  3R6L B;  1RWN B;  1RWV B;  4ZVU B;  2C1E B;  4DCO B;  2XYG B;  2QL7 B;  1RWP B;  2QLF B;  3R7S B;  1I3O B;  2H5I B;  4ZVR B;  2XZT B;  3D6F B;  3IBC B;  1SC1 B;  1SC4 B;  3KJQ B;  4JB8 B;  2CNK B;  1RHM B;  2H54 B;  3D6H B;  1ICE B;  3R5J B;  2H65 B;  2C2K B;  2CNL B;  1PAU B;  2HBQ B;  3KJN B;  4DCP B;  4ZVP B;  2CNO B;  3SIP B;  3R7B B;  3GJR B;  2H5J B;  2H51 B;  2H4Y B;  3IBF B;  2CJX B;  1F9E B;  2C2M B;  2DKO B;  2CDR B;  2QLJ B;  3R6G B;  2QL5 B;  2P2C B;  2H4W B;  3GJS B;  2CJY B;  1RHQ B;  3D6M B;  2C2Z B;  5K20 B;  3P4U B;  2Y1L B;  2XZD B; 
#chains in the Genus database with same CATH topology
 5F8N A;  3G6X A;  2B9W A;  2UV8 A;  4DBQ A;  1QUV A;  3GPA A;  4DV0 F;  2BJE A;  4ID5 A;  3CCR S;  2DT9 A;  2VBY A;  3SFG A;  4ZVT B;  2Y0B B;  3DRS B;  3BPD A;  3NOG A;  2D3U A;  1HMV B;  3PG9 A;  4JI5 F;  2A18 A;  1TL7 A;  3HF5 A;  2KZM A;  1FXL A;  5JVG Q;  4GMK A;  4C48 A;  2R9L A;  1HNI B;  3BO4 A;  2HFN A;  1P9Y A;  1S7H A;  2ALZ A;  1HIY A;  1PGZ A;  2AX1 A;  2LQ8 A;  3CMQ A;  3BO3 A;  2JFK A;  3C46 A;  3BM7 A;  4TKT A;  4AXJ A;  4CLZ A;  1Z1Z A;  3OTB A;  3SYZ A;  1HW9 A;  1ZAW A;  3MM8 A;  4P6Q A;  4W92 B;  4B3O A;  5A2Q Y;  2DVI A;  3KJN B;  2DR5 A;  1LK5 A;  4Y2K A;  3CCZ A;  2RRA A;  1UZH A;  3KNG A;  1XBW A;  2P2C B;  2U1A A;  2PGC A;  4HEA 9;  3UR3 C;  2BX6 A;  3PM9 A;  1RHQ B;  2OAU A;  4JOU A;  1Q79 A;  2GGP A;  1OY8 A;  3D9B A;  4O4G A;  3OT9 A;  2AYE A;  3MAA B;  4UY8 T;  3JYT A;  2HYI B;  4NEY A;  2CZV C;  2J9E A;  3M2V B;  4DFP A;  3SDE B;  1OY6 A;  2FZK B;  1Q8B A;  1MU2 A;  4FF2 A;  5DQI A;  4ED2 A;  3T41 A;  3CIZ A;  5F8M A;  3K0J A;  3AB2 B;  4C8N A;  2VB6 A;  4ECW A;  5D77 A;  3VCD A;  4EFA C;  1T9W A;  3PW0 A;  1PYS B;  1FDD A;  2NXN A;  1QSL A;  4ZOS A;  2B8Q A;  3TJA A;  3WBZ A;  3NLC A;  1HWL A;  5AJ3 F;  2RQ4 A;  3MUT P;  3ADA C;  4Y2I A;  4DR1 J;  3C3L A;  2OPP A;  2X3D A;  1CJK A;  1D8Y A;  4MK8 A;  2A6M A;  2A1B A;  2YWW A;  3PX0 A;  4IOB A;  5B0B A;  3OHA A;  3RZA A;  2DIU A;  3CVK A;  1F9E B;  2CJ9 A;  3GFX A;  4ZIV A;  1M5S A;  4LRC A;  3MTJ A;  3CCV S;  4HLB A;  1KNZ A;  4KAI A;  1KQF B;  3AA8 A;  1U2C A;  2MZR A;  4KBI A;  3H20 A;  1G3O A;  3HZE A;  3RRK A;  1KC8 T;  1QM9 A;  4LSL B;  5M2P A;  4J9P A;  5AE2 A;  4NA3 A;  1J5O B;  2FLO A;  3D1O A;  2AEM A;  3T1A A;  3MEG B;  3ILJ A;  5ETN A;  9RUB A;  5CD4 H;  3BJY A;  3MUR P;  2UP1 A;  1T05 B;  1X4E A;  1CJV A;  2QSW A;  2DIS A;  1TKT A;  3TR5 A;  1NM2 A;  2GHP A;  1IWG A;  4O0N A;  5IQ6 A;  1R0B G;  1FD2 A;  3TZY A;  1RTJ B;  4RU2 A;  1HA1 A;  3B54 A;  4DCO B;  4KFB A;  4F2S A;  1U2R A;  2ASJ A;  1HR0 J;  4V19 X;  3P3D A;  4JV0 A;  3TZX A;  3JQJ A;  1WDT A;  2XSF A;  3SCK E;  4JV1 A;  5CXT A;  1LK7 A;  3MCO A;  2KRB A;  3N01 A;  4L72 B;  2VOD A;  4NEZ A;  2RDJ A;  4UOF A;  1TV6 A;  4PG8 A;  2KJW A;  6FD1 A;  3PJ9 A;  2A10 A;  2YNF A;  2EEY A;  3W2V B;  2MQQ A;  1NK0 A;  2LU1 A;  2ACY A;  3KUE A;  1VQ8 S;  2YNG B;  2GHW A;  2YH1 A;  1XEZ A;  4CT9 A;  2J9D A;  2BVZ A;  1Q86 T;  3LAL A;  2BQR A;  3SZ2 A;  5C25 B;  2WVB A;  4M95 A;  4MTP A;  3DI6 A;  2RS8 A;  3CJ0 A;  2HLT A;  3RBE A;  2DRB A;  3LWL A;  1XN9 A;  1JX4 A;  3OLB A;  4HVZ A;  2E5L J;  3R7S B;  2UXC J;  3NEK A;  2Q6C A;  1GXT A;  1JLF B;  2M52 A;  1OYE A;  5HAT A;  1SXL A;  4I6Y A;  3D6H B;  3QFW A;  3HKZ D;  2DGQ A;  2E7X A;  1VDH A;  2J0X A;  3RW7 A;  3GP9 A;  2GC8 A;  1S6Q A;  1H2U X;  1QE1 A;  3B6B A;  4KR0 B;  4NLP A;  2XMM A;  2OSQ A;  4DSK A;  3AFG A;  1FKO B;  2O3D A;  3VGV A;  3W2W A;  2FD2 A;  3RAM A;  2QTW A;  3KWM A;  2VC0 A;  3CJK B;  2CA9 A;  2NUU G;  3M1V A;  4RKU C;  4Q45 A;  4CH1 A;  3T6J A;  4DQR A;  1NK5 A;  1RK8 A;  3KHL A;  1NND A;  2FUG 9;  4F4W A;  1VK8 A;  1RKJ A;  1RTI A;  2KO1 A;  1W7W A;  2I0X A;  1WSV A;  1WWH A;  3EPG A;  3CW2 C;  3HK2 A;  3HJV A;  4C4W A;  3MM6 B;  1GXL A;  2NSC A;  4JI4 F;  1LWC A;  2VBW A;  3OL9 A;  1WC0 A;  3OPK A;  1B0P A;  4TQR A;  3FEZ A;  1JLG A;  2Y3Y A;  4G3I A;  4FXD A;  4ID5 B;  2KH9 A;  4LRF A;  4A8X A;  3DDK A;  4PRF A;  1QSS A;  2XZT B;  3MAQ A;  5CD4 A;  4NL5 A;  1QY7 A;  2HMI A;  1RAJ A;  2BM0 A;  2XMV A;  2CDR B;  2QL5 B;  4OZ0 A;  2H3E B;  1PYT A;  1E6Y A;  3PJW A;  1BE4 A;  2VQF J;  2EKN A;  2KB2 A;  3DC2 A;  5T7L A;  3M30 B;  3GQC A;  4YB5 A;  4B3O B;  1YIJ S;  5L39 A;  3H98 A;  2HBR B;  2GV1 A;  4OV1 A;  2OPS A;  1M5H A;  5JVH Q;  3OTO F;  3EXY A;  1HKA A;  3BGO P;  2GGP B;  4O4G B;  1S4E A;  1AB8 A;  3C15 A;  4XAK A;  1BMQ B;  3CT9 A;  3FQK A;  3M8R A;  1FES A;  2MQM A;  3ZTQ A;  4MKB A;  1ROF A;  1CS4 A;  7FD1 A;  2NXJ A;  3THV A;  5KTQ A;  1MU2 B;  2DGX A;  2ROG A;  1AUS L;  2DH8 A;  3GYG A;  3A8E A;  1AYE A;  1OO0 B;  2WVD A;  1PAE X;  2UUB F;  3K7R A;  4WKR A;  4ZA1 A;  1QTM A;  2COL A;  1WHW A;  4DS5 A;  4GO7 X;  2HWT A;  4U95 A;  1S9G A;  4P52 A;  4KKO A;  5ETS A;  2MQO A;  2AJ2 A;  4J91 A;  2QG9 B;  4K4S A;  3VHQ A;  2C3O A;  4H4K A;  5BXI A;  3I0R B;  4YHH J;  1QD1 A;  2ZOM A;  2OPP B;  2BRK A;  1CJK B;  4DV5 J;  3AT1 B;  1NEE A;  3AJD A;  4J9L A;  3G82 A;  1SJQ A;  2Z58 B;  1ZTT A;  4F3O A;  2K7K A;  4X64 F;  1D8Z A;  4UUX A;  4YP3 A;  1VIS A;  1YQH A;  1YIT S;  1HW8 A;  2HFO A;  2RS2 A;  3PX4 A;  2VPZ B;  3LP0 A;  4ICL A;  3RG6 A;  2KG0 A;  2XMJ A;  3T19 A;  2ZH9 A;  2FTR A;  4RW6 A;  4IFV A;  4F02 A;  2SXL A;  2ATL A;  1CQN A;  5KFD A;  3BBC A;  1QUP A;  1MN9 A;  2WHO A;  3E3X A;  1FDB A;  4B3S J;  1TKT B;  2RML A;  1XMB A;  3T5H A;  1F9F A;  5HP1 A;  5F8J A;  2J76 E;  1FXR A;  2H4Y B;  1KHW A;  5I3Q A;  2AJF E;  1R89 A;  3BGU A;  3OTE A;  1VBK A;  2ZNZ A;  4KFB B;  3Q8Y A;  3DGV A;  1VR6 A;  4J90 A;  2KDO A;  2HQG A;  2YNH A;  1T3N A;  1RB0 A;  2AGO A;  1RT4 A;  3TVY A;  3RU0 A;  2IRX A;  4F4Z A;  2MPU A;  2WTF A;  2BRL A;  2WB4 A;  3VAG A;  5L46 A;  4I64 A;  2W7O A;  1TV6 B;  2DNY A;  3TZW A;  2HRY A;  3LWM A;  1HR0 F;  1TFY A;  2KYZ A;  3BH6 B;  2ADB A;  1TK0 A;  4P75 A;  4ED1 A;  4LRB A;  1NH7 A;  3AQP A;  4PWW A;  4R0E A;  1VCT A;  1NSA A;  3I5C A;  1REG X;  5L1I A;  2YNF B;  3TEH B;  5DM7 Q;  4P7T A;  2MZS A;  3AA9 A;  1T9X A;  5FII A;  1F2G A;  1GFW B;  1ZYQ A;  2P9C A;  1VBX A;  3R97 A;  2CQC A;  3LUY A;  2WSC C;  5F9N A;  3ZZZ A;  3DLG A;  4DV7 J;  1M5V C;  3OTD A;  2VA2 A;  1U09 A;  2ZUA A;  3NOC A;  2D1C A;  2PI4 A;  4NMX A;  1NPP A;  1Q5Y A;  1N56 A;  3SFU A;  4PWD B;  1FT8 A;  2F4F A;  3Q8U A;  4HH0 A;  3SBM A;  5KFY A;  3DI6 B;  4C0H A;  3O44 A;  3M2U A;  1RAD B;  2RF2 A;  1UKU A;  1QLN A;  3HJF A;  4C8Y A;  4DV3 J;  3AH6 A;  2FB0 A;  2EWH A;  1AUD A;  3D66 A;  4B9M A;  3KG4 A;  2A6O A;  1LW2 A;  1S6Q B;  1QE1 B;  2QA4 S;  2RUG A;  2E5L F;  1V6H A;  2CWK A;  2MLZ A;  4F8R A;  1BQM A;  2LDY A;  1JJ2 R;  5CYM A;  2JC1 A;  2XHW A;  2DR7 A;  3K89 A;  3W2W B;  3NWG A;  3FRZ A;  3GZ7 A;  2WB1 D;  3M1V B;  2J8A A;  3D0I E;  3CTR A;  4ILL A;  3R6L B;  5LMN J;  1JLQ A;  2QEX S;  4ZVU B;  2DK2 A;  2LXU A;  4RW8 A;  5E33 A;  4IO1 A;  4F4X A;  1JMT A;  4CLF A;  3ET6 A;  4MAK A;  3A12 A;  4USV A;  5D0R A;  4RU9 A;  4MH8 A;  4BBY A;  4IG0 A;  1ZPV A;  2HBQ B;  3ZTP A;  1UA0 A;  6AT1 B;  4TVA B;  2W9C A;  2QX0 A;  3O5T B;  1LWE A;  2FHO B;  3EZU A;  2MZT A;  3PRV A;  5FLX U;  5RUB A;  1S0M A;  1VC5 A;  1GAO A;  3BRE A;  2Y1L B;  2XZD B;  1AFJ A;  4B9N A;  1H3D A;  1VYA A;  3M32 A;  2XQC A;  3H0P A;  3CCU S;  1NME B;  4P72 A;  4RW7 A;  2HMI B;  1ZA2 B;  4K5R A;  3OXF A;  5ETV A;  2JLF A;  3DYA A;  2OEK A;  2RB7 A;  2B9X A;  3D6T B;  1E6Y B;  1T94 A;  2YX4 A;  3HLU A;  1OPZ A;  5T7L B;  5B0G A;  1RWN B;  2OGU A;  4DUY F;  4USH A;  4LF6 F;  2XLI A;  3TAN A;  2AP6 A;  2WVE A;  2MKJ A;  3P49 B;  4B3M F;  1SBR A;  2VQF F;  2BAC A;  2AMC B;  1HYS A;  3U1N A;  1VIX A;  4LF1 A;  4QIW D;  2DY1 A;  2BE9 B;  3GR0 A;  1UEU A;  2H51 B;  1Y4Z B;  3C15 B;  1Y00 A;  1N5V A;  2B8P A;  4I69 A;  2DPI A;  3M8P B;  2HQD A;  2L08 A;  1HBO A;  1WF1 A;  1LWX A;  2MB0 B;  3KXD A;  4NLU A;  1CS4 B;  5JUM A;  8AT1 B;  3NGK A;  2RSQ A;  3F41 A;  2C28 A;  3KNA A;  3FSX A;  1L3V A;  1WUU A;  4WTO B;  1PO6 A;  1RT3 A;  3HKW A;  3GV8 B;  3S01 A;  1RUS A;  1IBC B;  1FEE A;  5D0E A;  1S57 A;  3IR6 B;  3HT3 A;  3C6T A;  1VQY A;  3TUZ C;  1S9G B;  4KKO B;  1RT1 A;  2XHC A;  3NGU A;  1SKS A;  3W5X A;  4FNI A;  3QPI A;  5CZX A;  3RGI A;  3TAM A;  3MR7 A;  2DHH A;  2KU7 A;  2OKQ A;  5AE1 A;  4LIR A;  3G82 B;  2Z2L A;  5EDW A;  1RTZ A;  2CNK B;  4OX9 J;  1X8D A;  2AGQ A;  1BUX A;  5F0U A;  1VS3 A;  4DV5 F;  3AJ1 A;  3LP0 B;  2NYI A;  4ICL B;  1N0U A;  4CLK A;  3TO8 A;  4RW6 B;  4KTQ A;  2RE1 A;  4IFV B;  3KK2 A;  3OQ2 A;  2C3U A;  1DBD A;  4C97 A;  3BKF A;  3VAL A;  1S6O A;  2F5G A;  2YBV A;  1HBN A;  4JI8 F;  3RB6 A;  2CQB A;  5LT5 A;  3MDF A;  2MZ1 A;  5C7P A;  5KT3 A;  1X4A A;  1K1Q A;  1O0P A;  2EK1 A;  1Y3K A;  1AZS B;  3CDA A;  3BV8 A;  4FKX A;  4JYA F;  4MK9 A;  2XSJ A;  5E3R A;  3MCN A;  5DG7 A;  4ZVF A;  4Y34 A;  1U24 A;  2IM3 A;  2HK3 A;  1YZ7 A;  1RT4 B;  3IM8 A;  4PEO A;  3KFW X;  2W24 A;  4GKK J;  2DCL A;  3W65 A;  4K4Z A;  3ICL A;  1ZBT A;  2YKP A;  3H5X A;  5ETT A;  1SC1 B;  1C1C A;  3EZ5 A;  3CJ3 A;  1GMV A;  3R5J B;  3RAX A;  3OLA A;  2GJI A;  3LPE A;  2ZVS A;  3IFE A;  4Y6I A;  1Y5L B;  4Z7Y A;  1NRK A;  4Q5V A;  4Y65 A;  1TAU A;  1I94 F;  5C24 B;  5J2N A;  1SQE A;  4LRA A;  3DLG B;  4WP8 A;  2MKS A;  1XIQ A;  1O8B A;  3DOL A;  3OXG A;  1OYD A;  2CPI A;  2OI2 A;  4X84 A;  3KLF B;  3AJ2 A;  4LF4 F;  3HZG A;  3M4X A;  5J2P A;  4EBE A;  2RF2 B;  3MMJ A;  2AJ4 A;  4FF4 A;  2WAQ D;  2CVI A;  3UNY A;  2AKW B;  3WX4 A;  2C42 A;  3G9C A;  1EJ7 L;  4AQY F;  2GJ2 A;  2HHH F;  2RQK A;  1LW2 B;  2JLG A;  2QC3 A;  1ARO P;  2FJA B;  1IQT A;  4TYB A;  1BQM B;  1NSP A;  2K8G A;  2DGT A;  3UPF A;  4B9S A;  4IDK A;  4DCP B;  4QIV A;  2V2Z A;  2E1C A;  3IP0 A;  3PJX A;  3U1M A;  1CC8 A;  1RU2 A;  3TAQ A;  1FRM A;  3CE8 A;  3NCQ A;  5GVQ A;  1JLQ B;  4NX9 A;  2C2N A;  5U47 A;  4I56 A;  3BSN A;  4RW8 B;  2VDI A;  4KY3 A;  5J1P A;  3CUL A;  3MEC B;  4EO8 A;  5KFK A;  4IRK A;  4ZVH A;  4PPZ A;  3W63 A;  5LMN F;  1U02 A;  4IG0 B;  4KQZ A;  5C2G A;  2J0S D;  5DGB A;  3P6Y C;  1PSD A;  5KT6 A;  3TW0 A;  1LWE B;  2DRD A;  4XDC A;  1FKP A;  4OFZ A;  4OYB A;  2HVE A;  4Q2M A;  2ZH7 A;  4N47 A;  1L3K A;  1RHU B;  5LOQ A;  1UA1 A;  1SB6 A;  3EYZ A;  2CWX A;  2UUT A;  3KHR A;  2HZV A;  1KBR A;  4CCH A;  2VIH A;  3X3U A;  4RW7 B;  1UWA A;  2E29 A;  2HVZ A;  3DYA B;  5IXU A;  1VIO A;  2RHS B;  4AYB D;  2VIC A;  1S79 A;  4ZVG A;  3DRR B;  1U6F A;  3CDB A;  1JLE B;  2QE5 A;  3N5F A;  4M5H A;  1TVR A;  4X4N A;  5KG0 A;  3OR2 A;  2UXD J;  2HSE B;  3NGD A;  2W4D A;  4OV6 A;  3BR9 A;  2V4R A;  1WG1 A;  3EMT A;  2W2O P;  2XMW A;  3UFC X;  1Y9O A;  3IMQ J;  1FX2 A;  4QJV A;  3AOA A;  1HYS B;  2XGQ A;  4DR7 J;  2VON A;  2HHV A;  4DR5 J;  1QSY A;  1RBA A;  3HXM A;  3GJT B;  3JTP A;  3CGI A;  2DGS A;  4OJ1 A;  5L1K A;  2AW0 A;  2VL1 A;  1HBO B;  4WWS A;  5IT9 U;  5CYJ A;  1RWK B;  1S1U A;  4I0W A;  5I3P A;  2GX8 A;  1VLY A;  3B4M A;  1IBL J;  3BSA A;  4USJ C;  3DGP A;  1RT3 B;  4QOT A;  1RQ0 A;  1UZD A;  2H5I B;  3KKF A;  3BPS P;  5KFO A;  5K14 A;  1T7P A;  3C6T B;  1NCL A;  3R1H A;  4PUO A;  3M6X A;  4DF4 A;  2RQM A;  4LFB F;  1DAX A;  1RT1 B;  4DL5 A;  4CLY A;  1B64 A;  3HI9 A;  3TAM B;  3ISN C;  1TP7 A;  2CJB A;  2AWZ A;  4LF8 J;  3QBC A;  2AD9 A;  2B0G A;  1X5P A;  4OZ5 A;  4OYI A;  3NGT A;  5EN1 A;  4RW4 A;  2BEF A;  3OXL A;  2HND A;  1E6V A;  4ZP7 A;  1S6U A;  5A2Q U;  3MXH P;  4IOC Q;  1LEO A;  2XYH B;  2YNI A;  2P6T A;  1J5E F;  1DQA A;  3LP1 A;  2RH3 A;  3WIU A;  3PDN A;  4WTY A;  2C2D A;  1S1V A;  1FDN A;  1EP4 A;  4M8L A;  4OX9 F;  4DV4 J;  3KK2 B;  1RHR B;  4N5S A;  4JI3 J;  1NK9 A;  4RUB A;  4FBU A;  1HAR A;  2M8D B;  1XER A;  3RR8 A;  2FLP A;  1U45 A;  2YWF A;  1OPI A;  4WCE Q;  5GAH U;  2R2U A;  1S1T A;  4PXC A;  1BHN A;  4DL2 A;  3QRP A;  2J5A A;  2J6U A;  3KUH A;  5DJB A;  4DG1 B;  1KSP A;  1NB7 A;  3GLJ A;  3L95 X;  2IJN A;  4U96 A;  2XSJ B;  2CPJ A;  2F8E X;  2J9D E;  1SQF A;  3FQL A;  3Q22 A;  2D3O 1;  3I96 A;  5HQL A;  1ELO A;  4QW8 A;  4Q8E A;  4K2X A;  1NUE A;  1D1U A;  5SUH A;  4Q44 A;  3UCU P;  1P8G A;  3OL8 A;  2QFJ A;  3R5C A;  3OFH A;  2IJF A;  1QDU B;  4MFB A;  5HRO B;  4OHV A;  3W62 A;  1KFS A;  2OLW A;  4GKK F;  3GB0 A;  3VGT A;  2ZFH A;  1EET A;  1SPB P;  1M5O C;  3IRW P;  2H9Z A;  1DLO B;  5J2N B;  4RNO A;  1HBM A;  2MKH A;  3OUY B;  3G8Q A;  3DOL B;  1ZM3 A;  2RU9 A;  2G0C A;  2OD4 A;  4EBC A;  1R8A A;  4C7Q A;  4OJH A;  5DZ7 A;  4A47 A;  3CCE S;  2MHE A;  2DBB A;  1H7X A;  3MD1 A;  3M8Q A;  5J2P B;  4RBV A;  3JSY A;  2AQ4 A;  5LSR A;  3RB0 A;  2V8G A;  4PG4 A;  2UZA A;  3QJL A;  4M5M A;  1NB2 A;  2DH9 A;  4URS A;  2D69 A;  2R42 A;  2HNY A;  2BJ7 A;  2ZDO A;  3VAK A;  2XLK A;  2L9N A;  2A0F B;  1MMN A;  3D6M B;  4NLD A;  3VZH A;  1FWP A;  3TA2 A;  3J7A 1;  3GCX P;  1VQN S;  3IRX A;  2ZUG A;  3I5A A;  1K44 A;  4H4M B;  5A0Y A;  2DGO A;  4IDK B;  3GFZ A;  1X9W A;  4WF9 Q;  4X65 F;  2DGU A;  1HL6 A;  3DN9 A;  4ILM A;  4YQW A;  2HS3 A;  1CUL A;  4NLY A;  4BS2 A;  4WFB Q;  1S0N A;  1Q0N A;  4PCQ A;  3NCR A;  2DNQ A;  4KGZ B;  4P2X A;  2CQ4 A;  1RAE B;  2C2O B;  1CC7 A;  2F65 A;  2DNZ A;  4QW9 A;  2NUH A;  4FYV B;  4CP5 A;  2WOM A;  1MLA A;  2VFU A;  3C14 A;  4ZVR B;  1S77 D;  4LBH A;  1FJ7 A;  4DQS A;  1IN0 A;  3H40 A;  3Q8R B;  1FKP B;  4LFA F;  3I9V 9;  1FVQ A;  4K2J A;  5B0C A;  4MKA A;  4D3H A;  5BR8 J;  2VV5 A;  2JWN A;  1X4C A;  4NLR A;  2CFX A;  1F5A A;  1Q8L A;  1NKC A;  2ZE2 B;  1V9O A;  2YWE A;  1KFD A;  3I87 A;  3MPU B;  3T9Z A;  2RQC A;  5KFU A;  3H2L A;  4NZ6 A;  3VAM A;  1R43 A;  2O5D A;  3GCW P;  2VG7 A;  2QYC A;  3A3N B;  3UN3 A;  5LXR A;  4DSL A;  4KRW A;  1VBY A;  1W2B R;  1GH8 A;  4UUW A;  4OI4 A;  4DR3 F;  2G9O A;  1M1H A;  4KH0 B;  4TU9 A;  1EZZ B;  5D6G A;  1TVR B;  3OR2 B;  3MPV A;  5JJB A;  1KQS R;  2ZOG A;  3V4I A;  2XMK A;  2DR9 A;  1U1M A;  4LQ3 A;  2J8S A;  2KXN B;  1WC1 A;  3T1H J;  1VQL S;  2BQU A;  4QWE A;  2ZH4 A;  2KHD A;  5F8H A;  5HK4 A;  4NE9 C;  1OQ3 A;  4B08 A;  4JP8 A;  1YBA A;  2QV6 A;  2WBR A;  4OHW A;  2HIQ A;  3G6Y A;  1RAO A;  2ZBI A;  2Q66 A;  1UJ4 A;  2JLE A;  2OPR A;  4OI3 A;  4HYK A;  1TZ0 A;  2EFQ A;  1S1U B;  4KPY A;  3MD3 A;  4L6V 3;  1Y0H A;  3FSI A;  2H5J B;  5KG3 A;  4QR1 A;  1AT1 B;  2ZH3 A;  2MTL A;  3DGP B;  3CC4 S;  5L9N A;  3I6P A;  2HVD A;  4WYL A;  4V19 J;  1ZH5 A;  4LF5 J;  1FE0 A;  2MSS A;  2BE7 D;  3Q8Q B;  3AQO A;  1YBT A;  2IDE A;  5C2C A;  2LEP A;  2GS8 A;  4PUO B;  1VQO S;  4HTI A;  3MOJ B;  1I51 B;  3OTC A;  5DG8 A;  4X62 J;  3MM7 A;  3RRG A;  2J6T A;  2IYI A;  1HQE A;  1Q78 A;  1HI1 A;  2ZBP A;  4J9V A;  4Z7C A;  5K5M A;  4A8F A;  2OMO A;  4UOG A;  3Q8P B;  1YJN S;  1C0T A;  4FKY A;  2HND B;  9ATC B;  4HTJ A;  4USW A;  5AXK A;  2RIJ A;  3CO0 P;  4LF8 F;  1Z2L A;  5F0W A;  2YNI B;  1NXI A;  1BC6 A;  2RKI B;  3LP1 B;  1KQG B;  1YRU A;  1VLO A;  1XR6 A;  2Z8Q A;  1S1V B;  1DJ0 A;  1EP4 B;  3OVA A;  3EVM A;  3P8B B;  1FRL A;  5DDQ C;  2ZNY A;  2B7B B;  3F56 A;  1HWJ A;  3A3P B;  3ZZR A;  3M2R A;  3DDI A;  4K50 A;  2UU9 J;  1FI4 A;  4UT4 A;  2VBZ A;  2PT0 A;  1HQU B;  3MFH A;  3ILI A;  1B3T A;  2XMT A;  1S1T B;  2OEJ A;  3JTN A;  2CPX A;  1IVZ A;  3DOM B;  4TY9 A;  2Q3P A;  2DHG A;  2ABY A;  5LMU J;  1TUV A;  4LSN A;  4M94 A;  2E9Z A;  1X4B A;  2N3O A;  4DL3 A;  2UVW A;  4O4R A;  5B08 A;  2R7O A;  2XCP A;  1X7V A;  3OFF A;  4KHP J;  1Q16 B;  3EUN A;  3AOC A;  5KFP A;  5GAD U;  2Z57 B;  2RD5 C;  4K5S A;  1FRJ A;  3U27 A;  4DXL A;  1EET B;  3T5L A;  1C1B A;  2XMA A;  3MOZ A;  4G1I A;  3LH2 S;  4Y2A A;  4YME A;  2WK4 A;  4RL1 A;  3WC0 A;  1HBM B;  1YZ6 A;  2ZWO A;  1NAQ A;  1NPK A;  2M4M A;  1W25 A;  1Y7P A;  2QLJ B;  4ZS6 A;  4GRS A;  5CQG A;  3D68 A;  2CQ1 A;  4X4S A;  3JXO A;  5HMX A;  5KT5 A;  3CDE A;  2FHJ A;  1JNZ B;  2XY6 A;  3UR0 A;  1QVF R;  1NK6 A;  3M8Q B;  3K17 A;  1EIY B;  1FX4 A;  3BDP A;  4HHU A;  5KG6 A;  5BYS A;  2ZH5 A;  4IQX A;  3FSY A;  2UUW A;  4LSZ B;  2WW8 A;  5DDR C;  4B9L A;  2F4V J;  2OFG X;  3O6Q A;  2HNY B;  1MML A;  3KOA A;  1U47 A;  4A8Q A;  1RBL A;  2BJ8 A;  3HM9 A;  2J7W A;  2GML A;  3KHH A;  2HQ3 A;  4DCJ B;  1S1X A;  5ETM A;  2KVQ E;  2HS4 A;  3IRX B;  4P9S A;  3HVA A;  2FZC B;  4HHH A;  4C11 A;  3UE2 A;  2BJ9 A;  5GME A;  5A0Y B;  1EB0 A;  3PR4 A;  2X7I A;  1N48 A;  4KV8 B;  3OJS A;  5FDL B;  2OP5 A;  1RT2 A;  3QJP A;  3HHL B;  4QWC A;  2NLW A;  4KC5 A;  3NS6 A;  1CUL B;  1N32 J;  3N9U C;  3TYT A;  4M5I A;  1KTQ A;  4NYO A;  4N56 A;  2CJY B;  4CLS A;  4UOH A;  3EGV A;  1ACM B;  4A8M P;  1A6L A;  2WOM B;  3C14 B;  4B3T F;  3CNQ P;  3K5N A;  5D8H B;  1UEV A;  1SKU B;  3DHW C;  5A76 A;  2VQE J;  4Q7A A;  4CLT A;  4J9O A;  3S6E A;  1F9H A;  4AND A;  3ENW A;  4ZKA A;  1LNQ A;  1R7I A;  1UVI A;  3D4J A;  2VG7 B;  3V6D A;  3PHT A;  3MPW A;  3NKY A;  4RWX A;  3MFI A;  3DRS A;  3FDS A;  1O6X A;  4OLP A;  3J7Z 5;  5GAG U;  3V4I B;  3CXC R;  2GO9 A;  4ZVP B;  3NBP A;  4EYI B;  1TKD A;  2YKN A;  2XUL A;  3KLV A;  2BXJ A;  1U1P A;  3PW2 A;  1UFW A;  2GCF A;  2UV8 G;  2KN4 A;  2M9K A;  1JNR B;  1VMB A;  2D41 A;  4E0D A;  2VPX B;  1JQG A;  2GA7 A;  1U1L A;  3EWG A;  4OHY A;  3P4U B;  2VBX A;  3I5B A;  2VPW B;  3ZNU A;  3K57 A;  4X4P A;  4Y00 A;  1DUR A;  1T02 A;  4TN2 A;  1IBM J;  3T1H F;  1VQ7 S;  4DWI A;  3JAM Y;  3PYF A;  3DLE A;  5KFX A;  1V3S A;  4DPX A;  1DTT A;  4K0K J;  5DQH A;  3TUP A;  2OJ3 A;  4A8O A;  2ACM A;  4HR2 A;  4A4J A;  3KLE A;  3V6J A;  2EFV A;  3MAA A;  2NR0 A;  4G1P A;  3BN4 A;  4YR3 A;  1D3W A;  2WSE C;  4LVO P;  4DN9 A;  2R2R A;  2DGW A;  4U7C A;  4P71 A;  1RSC A;  2JOQ A;  1SI9 A;  2QT7 A;  3SV4 A;  4LF7 F;  1HQE B;  5CA5 A;  5KFE A;  5KFG A;  1LKZ A;  3VQS A;  4X62 F;  4BC9 A;  3W61 A;  1C0T B;  2Y8Y A;  1OJ4 A;  3C66 A;  4DUZ F;  4DR2 F;  2VFT A;  2GIQ A;  2DYA A;  3LP2 A;  4NI2 B;  2GVD A;  1K1S A;  4GC7 A;  1H2T Z;  2KXF A;  2E1P A;  3ZZU A;  2KRR A;  1BGX T;  3D5M A;  2HFU A;  4A8S A;  1FF2 A;  3M2R B;  4GKJ J;  4ZPD A;  2G0J A;  1XNQ J;  2FHJ D;  4RNF A;  3MUM P;  2LA6 A;  2BOA A;  5A8R B;  1T3O A;  1VQK S;  4P73 A;  1X31 C;  3MR5 A;  4JI1 J;  2LP4 A;  4C98 A;  1J5O A;  1NSQ A;  4LSN B;  3N6L A;  1Q7L B;  3MCM A;  5D4L A;  4LR9 A;  2XBP A;  4PZV A;  1REV A;  4HAC A;  1Z2Z A;  3TX8 A;  2VDH A;  3N6N A;  2IM0 A;  4XPE A;  5LMU F;  3QFH A;  2YWK A;  3HSZ A;  2E9T A;  4C9D A;  4F67 A;  5KFH A;  2C2M B;  3X1L B;  2N4C A;  4J9K A;  2I1R A;  3PCO B;  3AD7 C;  3CDW A;  5I42 B;  4MYT A;  4NCA A;  2C2E A;  5D4P A;  2V4Q A;  4USI A;  3VAI A;  2QLX A;  2MQP A;  5E7O B;  1C1B B;  2IA6 A;  4QIF A;  4KHP F;  4P10 A;  3G6V A;  3FCV A;  5CYQ B;  4QR2 A;  5KFM A;  1FJC A;  3L4B C;  5A6P A;  3W2V A;  3HD2 A;  4GVL A;  1UL3 A;  1SH2 A;  4NPO A;  4PQU B;  2QYG A;  3HDS A;  4BLG A;  4QWB A;  2W7A A;  1L3U A;  1XTZ A;  5AT1 B;  2UVR A;  1C0U B;  1TR0 A;  1YRX A;  4OX7 A;  2IVM A;  4OZ1 A;  5B7W A;  3LAN A;  3D6F B;  4EZ6 A;  2FC8 A;  1L3S A;  3ENV A;  1IR0 A;  5J2Q A;  3H59 A;  1S1X B;  1S9E B;  4C11 B;  1LFP A;  2F4V F;  4JV2 A;  2L9W A;  5LL6 d;  1O5J A;  1RT2 B;  1K0T A;  4CM2 A;  3BBF A;  2MGZ A;  2UUC J;  3HO1 A;  4CRJ A;  3BH7 B;  1R8C A;  1HBU A;  4FYW B;  5DDP C;  4PXE A;  1UMJ A;  4RLE A;  3W9J A;  5IWA F;  1NH8 A;  4LBP A;  4ER8 A;  3PW4 A;  2ZJR Q;  2YPY A;  3W1Y C;  4E2F B;  2K1R A;  2X1B A;  3G96 A;  5IOL A;  3N0V A;  1LXJ A;  3GSD A;  3KMS A;  4J9M A;  4FYD A;  2Z56 B;  3H42 A;  4N7T A;  2Y1J A;  1FVS A;  1N0V C;  1IJF B;  3EIC A;  5GAE U;  4LIW A;  3C16 A;  2XNQ A;  1WOP A;  3SQG A;  1RTH A;  2VH7 A;  1FJG F;  2AZ1 A;  5B0D A;  4URQ U;  2E1M C;  2JRS A;  3ULH A;  1TL3 B;  4V1A k;  2LQJ A;  2CKW A;  3KLI A;  2E5G A;  2R7W A;  4KJI A;  2D9O A;  4ZPV R;  4DV6 J;  2FHM A;  2O67 A;  1IM6 A;  2VA3 A;  3V6D B;  2MDA A;  5L9X A;  4ZHR B;  3GSI A;  4O44 A;  2VZ9 A;  4ZP9 A;  2CJA A;  3DRP A;  1CSJ A;  5K20 B;  2EI5 A;  1RAC B;  3HSD A;  4DPT A;  2WSF C;  1WF2 A;  3DFE A;  2JEI A;  1N34 J;  1DZ5 A;  1SKR A;  3I4P A;  2XCA A;  4LRD A;  4OYP A;  4DR6 J;  4LFC F;  3KG1 A;  3NBP B;  1IKX B;  2EK6 A;  1PC5 A;  1D09 B;  2YKN B;  2DXF A;  3HFZ B;  4WFA Q;  2GMJ A;  5EWE A;  1WTF A;  2M0G B;  3V81 A;  3Q86 A;  2W9A A;  2DIT A;  3M30 A;  2HHW A;  2NZC A;  1ZM9 A;  2EBG A;  3D3C J;  3GIK A;  2RVJ A;  3FKB A;  4QQB A;  3DLL Q;  4DMZ A;  3THT A;  1PIL A;  2LA4 A;  3SQO P;  3AXK A;  5HI7 A;  4DX6 A;  2L48 A;  3DLE B;  4DFM A;  3BYP A;  2HGL A;  1DTT B;  1JIH A;  2GHV C;  2M88 A;  3TVZ A;  1ICE B;  2RDI A;  3L7U A;  6FDR A;  1IBM F;  3KLE B;  1SJ4 P;  4ZPW R;  2V5H G;  3W5Y A;  1LQ9 A;  2NXC A;  2D3Z A;  1K47 A;  3KYL A;  2ZDP A;  2XZW A;  1Q7Y T;  3H2U B;  1PBA A;  1OIA A;  1Q1K A;  1GXU A;  4CO5 A;  1XNR F;  2W4P A;  1PC4 A;  1C2P A;  5KG7 A;  2DEJ A;  3OBI A;  4WFX A;  4DU8 A;  4HT7 A;  2QL9 B;  3R27 A;  2YKA A;  2IVF B;  3DHX A;  3T1Y F;  2YQ0 A;  3DCA A;  3I55 S;  3VAF A;  1T9U A;  2ZWP A;  1JKH A;  4PQA A;  1DHM A;  2IA0 A;  4C8L A;  2BV3 A;  1F3V A;  3NMA A;  3I0R A;  1VQ5 S;  2N82 B;  2YKM B;  3VVU A;  2VOO A;  3LP2 B;  2GVD B;  4BCA A;  1UTA A;  2XYP B;  3BEG B;  4YS2 A;  4KPC A;  2KJV A;  5KAK A;  4IYQ A;  2HGM A;  4HDH A;  3OL6 A;  4ILR A;  1FRX A;  2C2R A;  2ZKU A;  4OYM A;  5GMK a;  2NXE A;  2Z30 B;  3S8S A;  4F04 B;  1TK5 A;  2HAI A;  2E5H A;  5CHC B;  4MYU A;  2AYG A;  3QID A;  1KRP A;  4FF1 A;  3GYX B;  2KT3 A;  3MMC A;  1AW0 A;  1SH0 A;  2V94 A;  1H2V Z;  4L75 A;  1GX6 A;  2V4J A;  4AL7 A;  2KXH A;  4ECR A;  5KG2 A;  3I4H X;  4UTG A;  3E8O A;  4P7V A;  2ZBQ A;  3Q83 A;  3SSR A;  3GON A;  3PYG A;  2CAJ A;  1ULR A;  3QAU A;  1WC5 A;  2V63 A;  4CI0 B;  3W8P A;  4NA2 A;  4ZK7 M;  4FS2 A;  5EUH A;  3HFK A;  2XMU A;  4ECX A;  4W98 A;  2DCU B;  1SJR A;  3KTQ A;  4RNM A;  1REV B;  3D1Q A;  2JVR A;  2JSX A;  4HAC B;  3OR1 A;  3NNC A;  1RU1 A;  5J2M A;  2GIR A;  3WC2 A;  3UCZ P;  4JI2 J;  5B09 A;  4DSJ A;  4W90 B;  2OIH A;  4K4Y A;  1TKX A;  3PY8 A;  4RNH A;  4A48 A;  3QSY B;  4UOC A;  3RTV A;  2B51 A;  2JH3 A;  3FJ2 A;  3W7B A;  2FVC A;  5KFS A;  1KN6 A;  3H2V E;  3QT8 A;  3Q8V A;  2IM1 A;  3HPO A;  1X5S A;  3WHI A;  4I7F A;  4LR7 A;  4LR8 A;  3N6M A;  2HK2 A;  3TQ1 A;  4YB7 A;  4YY3 F;  3PVX A;  2CUY A;  4NXN F;  1R27 B;  3MAH A;  4M5N A;  4PXD A;  3EM1 A;  4DPU A;  1D0E A;  3RBZ A;  1IBK J;  4JBC A;  3J81 U;  3AD8 C;  3SIP B;  5A8K A;  1U6B A;  1S0V A;  3R5D A;  1JXV A;  2R2T A;  2EXU A;  4ECS A;  4OHX A;  4YDD B;  3Q89 A;  2UUA J;  1X4F A;  2VG5 A;  4PWD A;  4Y3C A;  2M3D A;  3PFE A;  5LM7 E;  3LF0 A;  2LEB A;  4JI6 J;  5J2Q B;  3RB3 A;  4TLR A;  3S1T A;  2HNZ B;  2NRE A;  2X3G A;  3R1L A;  4WK1 A;  3PO4 A;  3HVW A;  4X4R A;  2NS1 B;  3K8V A;  4OZ3 A;  1HNX J;  5HJY A;  1F5C A;  3LPY A;  2YVS A;  5KG5 A;  1NHU A;  1T95 A;  2MGZ B;  5L8R C;  1TUW A;  1HBU B;  1Q8K A;  3EPI A;  2Q1L A;  4KSE B;  5HQM A;  2L9D A;  1SV5 A;  3HMJ G;  5K9F A;  1ZPW X;  4FYY B;  2K1R B;  2JL9 A;  1B99 A;  2C2K B;  2UUC F;  1URR A;  2VJU A;  3GJR B;  4DV1 F;  2LMI A;  3PO5 A;  1WAC A;  3SMZ A;  2V2V A;  5IT0 A;  1HNW F;  1U8W A;  4X66 J;  3C16 B;  3CD5 A;  1RA7 A;  3SQG B;  1RTH B;  5FJ4 A;  3PX6 A;  3MWB A;  1WNE A;  3ITH A;  3BYR A;  2QA1 A;  2B4U A;  3KLI B;  1RDR A;  2VHG A;  2Z0G A;  4M5K A;  3NGR A;  2CG4 A;  3TAP A;  2GO8 A;  3DU6 A;  3VZI A;  1N33 F;  4JV5 F;  4LF2 A;  2F63 A;  1ZZN A;  4MK7 A;  1YJT A;  4O44 B;  3DRP B;  3TP2 A;  1RT5 A;  3A4T A;  4DU7 A;  3P45 B;  2ROE A;  2AYM A;  2AX0 A;  1PIE A;  1P1L A;  4F7V A;  4Z2X A;  4KH1 B;  2QL7 B;  3MR3 A;  4IRC A;  5E3P A;  2PMW A;  1Z4U A;  1KKH A;  1FNX H;  4EMD A;  1U7L A;  2I38 A;  4EYH B;  4AXI A;  5E3Q A;  3B8H A;  4DZD A;  3RYL A;  1UET A;  2ZBC A;  1PAU B;  2HFV A;  1RKI A;  4MIB A;  3UDC A;  3V81 B;  2G2Y A;  5ETL A;  4J9Q A;  3NGS A;  1NLK L;  4FF3 A;  2J0Q D;  4HKQ A;  2JZ5 A;  2VC1 A;  3PZP A;  2W2N P;  3JTO A;  3CWJ A;  2B43 A;  3VQT A;  3OL7 A;  2APO A;  4LF9 J;  2OML A;  3UD4 P;  1A0O B;  4M5L A;  4C8O A;  3CD7 A;  3NP5 A;  4DX5 A;  2AT1 B;  2LVW A;  4ZCM A;  3ZZY A;  1I6J A;  2HEK A;  4Q8F A;  2KM8 B;  4NXM J;  1F3F A;  2RT3 A;  4X4V A;  3M8P A;  1YJW S;  2QSF A;  3Q24 A;  2IFX A;  2OH2 A;  4FDF A;  4GC6 A;  4DFJ A;  3IGV A;  5BYQ A;  2FJV A;  5HVG A;  3T5J A;  5KFT A;  3GV7 B;  4NAS A;  8ATC B;  1F0X A;  5GMD A;  3US5 A;  3T3F A;  4NYP A;  4QYR A;  1HI0 P;  2GMH A;  2N7Y A;  1JKH B;  4OI6 A;  2OEM A;  3BDE A;  3I31 A;  1KP6 A;  1JJ4 A;  1NHV A;  2HRU A;  3KK3 A;  4DV0 J;  4WII A;  3UNG C;  3E2E A;  2PA8 D;  4OYX A;  5DS7 A;  2ZHB A;  2FVR A;  5HVH A;  4JI5 J;  1N88 A;  4YN3 B;  4DHV A;  2H5E A;  3QT7 A;  1MNE A;  4IH7 A;  3J7Z T;  4ZLL A;  4K8R A;  1SC6 A;  4PG6 A;  4CTA B;  2W7P A;  4DR1 F;  3MMC B;  3GG1 A;  1N6Q A;  4Y0F A;  2V4J B;  4AE5 A;  2RNE A;  3NWR A;  2W01 A;  1DTQ A;  1X60 A;  2IC3 B;  1VBZ A;  3W9H A;  3TJ8 A;  4E98 A;  4IFY B;  2FHK A;  4M63 A;  4C0B A;  1H98 A;  2R7V A;  2OTL S;  3LAM A;  1UWB A;  3MEK A;  3SSQ A;  1F2H A;  3PYE A;  4CNY A;  2R7T A;  4FXV A;  1VQ6 S;  1VC6 A;  3OR1 B;  1WOR A;  3QQC D;  4ED8 A;  3M8W A;  5J2M B;  3TWZ A;  3KLG A;  1AZS A;  4K4W A;  3QGG A;  1TKX B;  2WVC A;  1BQX A;  4ATN A;  4I2Q B;  2ZBR A;  1EQM A;  2VF3 A;  2K06 A;  2E1R A;  1RT7 A;  2PFF B;  1SUQ A;  1JJC B;  2M8H A;  4M5D A;  1IKY A;  1F5B A;  4I7F B;  2E1A A;  2L41 A;  2V8P A;  3VV2 B;  3CCS S;  4I2P A;  5KG1 A;  5HSP A;  1OMS A;  3JSB A;  4GVB B;  5KFZ A;  4WFN Q;  2R7X A;  4FYX B;  1J27 A;  1JLC A;  2POK A;  1ZZF A;  5KFL A;  3HHD A;  3QAE A;  2I5J A;  4NML A;  2FC9 A;  5AJ3 J;  4RW9 A;  4KYZ A;  1C4A A;  5A8K B;  5C24 A;  4I68 A;  3QRR A;  4EZ9 A;  1R31 A;  3IR7 B;  2CQH A;  4CT8 A;  3EGW B;  2CQG A;  2VG5 B;  2V2K A;  1WJ9 A;  1KQK A;  3QSI A;  5DDO C;  2VU5 A;  3KLF A;  3VF0 B;  2XO6 A;  2QIF A;  3HHN B;  3NMR A;  2HIY A;  2WON B;  4Y2C A;  3IWX A;  1VQS A;  3ILO A;  1SL1 A;  4FS1 A;  4WXW A;  2HHQ A;  2UUA F;  3CUN A;  4Y28 C;  4YFU A;  3N5B A;  2HPU A;  1Y10 A;  1BQN A;  4CM0 A;  4PPD A;  3LW5 C;  1S99 A;  4K4V A;  3N28 A;  1LWF A;  4WXO A;  1YJ7 A;  2UXC F;  4B9V A;  2FJW A;  2HVI A;  4YR0 A;  4J5O A;  3ZZO A;  1SV5 B;  3UO0 A;  3HSG A;  2V68 A;  4TYA A;  4PXB A;  4R0J A;  2Q79 A;  4N8N A;  1U49 A;  4WBF A;  1R6V A;  4CZC A;  5HN0 A;  1RIS A;  1T9V A;  1S97 A;  1Y5N B;  5HMW A;  3MEC A;  4G6V B;  4R25 A;  2LFV A;  1FFW B;  3TRG A;  1LW0 B;  2B6A A;  3IXQ A;  3ITH B;  4L73 A;  4BHQ A;  1OY9 A;  4XPC A;  1YJU A;  1V5V A;  3ELH A;  1VQP S;  4TQS A;  3TQE A;  4X66 F;  4XTT A;  1TK8 A;  3G71 S;  4JB8 B;  4CNZ A;  4NRT A;  3VAH A;  4ZN3 A;  4OJG A;  4H4K C;  2O66 A;  1RT5 B;  3KG0 A;  4C0O C;  4WU2 A;  2GFF A;  2HWH A;  2DIV A;  2QA2 A;  2KTQ A;  5M2U A;  2QRR A;  1JWW A;  3QLH B;  2EVZ A;  5LJ3 Y;  3BGL A;  2W8K A;  1HPZ A;  2V69 A;  3IAM 9;  1A7G E;  3D1H A;  3H8Y A;  4YUD A;  2CDQ A;  2HBY B;  1KLN A;  3OVB A;  3DRR A;  4G1Q A;  1JLE A;  3UVJ A;  4WP9 A;  4N41 A;  4MMO A;  5L1J A;  3ZTS A;  3GIJ A;  4U6P A;  1WC6 A;  1FCA A;  2DNK A;  1FFG B;  1N36 J;  2Q6B A;  1S4F A;  2W8L A;  1SIW B;  2LXF A;  3ZO7 A;  1RWO B;  1RWM B;  2PC6 A;  4TY8 A;  5IC6 B;  3TEG A;  1VJW A;  4ZCK A;  2XI2 A;  2CIM A;  4URG A;  5EGY A;  2QN6 B;  4R5P B;  5AE3 A;  3IGN A;  2GZO A;  2AV5 A;  4FPI A;  3NG8 A;  5KFB A;  5B0E A;  2ZIT A;  4UZB A;  1B7F A;  2V0N A;  1D9A A;  4DF8 A;  3K59 A;  2AJ0 A;  5LXY A;  3FBB A;  5F8L A;  3KLH B;  2ZD1 A;  2CPZ A;  2AHO B;  3FMB A;  5L38 A;  1WHX A;  2XTJ P;  2KYX A;  1KHV A;  4TLQ A;  3BQ0 A;  1LV5 A;  2ASD A;  1WF0 A;  5CAB A;  1TTH B;  2ZH2 A;  4KGV B;  2RAQ A;  4QYZ J;  3KK3 B;  2JVO A;  1U8S A;  4WK3 A;  2CPD A;  5F8G A;  2LQ9 A;  4DJB A;  1RAA B;  4DN0 A;  4NLS A;  3DXB A;  4ECY A;  2Y0S D;  4NA1 A;  4ED4 A;  3W9I A;  3CJT A;  3E01 A;  5ADZ A;  1RE1 B;  2OUG A;  1B4S A;  3K5P A;  2HHX A;  5JXS A;  4YHH F;  3UI3 A;  3JAM U;  1CEZ A;  2IRU A;  3O2I A;  1N6Q B;  3PIP Q;  2XYG B;  4RNN A;  1DTQ B;  1UJ5 A;  3KMQ A;  1NJY A;  4DEZ A;  1IJE B;  3LGM A;  3NNA A;  4ERD A;  3KJQ B;  2H54 B;  1J2V A;  4ZN1 A;  4NLT A;  1AFI A;  1UWB B;  4ZIW A;  1X5O A;  1R0C B;  1RJJ A;  1ZOT A;  1EX8 A;  2E66 A;  3OTO J;  2MY8 A;  3QO9 B;  1WOO A;  1Q8I A;  3KLG B;  1G4C A;  1NU4 A;  4DG1 A;  3TX0 A;  5A8W A;  4B3S F;  5J1N A;  1IKV A;  3FNN A;  4DI6 A;  3SCL E;  1WKL A;  5ITH A;  2D74 B;  1QTN B;  1TL1 A;  1RT7 B;  1SUQ B;  4PR6 A;  4LVN P;  4M5D B;  1IKY B;  1CG2 A;  4DSE A;  2NSB A;  2IDL A;  2UUB J;  1FRH A;  5DM6 Q;  3R8Y A;  2K2P A;  2MQ8 A;  4I2P B;  5E3C A;  3MM9 A;  1ZM2 A;  2LEC A;  3PW7 A;  1JLC B;  2CJK A;  5D4N A;  4E8U A;  3KJV B;  5HRO A;  4IUF A;  4UQG A;  2I5J B;  1FTC A;  3EE3 A;  2BYC A;  3RBD A;  4RW9 B;  3VAJ A;  2V67 A;  1RAI B;  1PJ6 A;  3D28 A;  1DLO A;  4KGX B;  2IHR 1;  2ALY B;  3JQM A;  3OUY A;  3FBE A;  1ZS6 A;  2EFO A;  3BQ2 A;  4ETX A;  2BMB A;  5H9F J;  1S9F A;  5KT7 A;  3PHE A;  3U1L A;  4DL6 A;  1F6T A;  4F0M A;  3CJS A;  4X64 J;  1SVD A;  5IT4 A;  4I6A A;  4DV7 F;  2ZOF A;  3LQV A;  2D9P A;  4F3Q A;  2E7W A;  3HVT A;  2GQQ A;  1GQE A;  3W64 A;  2HFS A;  4QPX A;  1RCX B;  3CD0 A;  3FUY A;  1ZA1 B;  2Y1R I;  1RYS A;  3W66 A;  1BQN B;  3NRB A;  2DXE A;  2MKI A;  4EI2 A;  1UJ6 A;  4DV3 F;  4C3L A;  5IC4 B;  1LWF B;  3F0N A;  3G6E S;  5KG4 A;  3HHK A;  1YWX A;  4IKA A;  1RZM A;  3RB4 A;  2NCK L;  3GJQ B;  4H4M A;  5LSO A;  3A3O B;  1GK8 A;  1NZA A;  3NY0 A;  1KOH A;  4CO0 A;  4NOH A;  1UFK A;  3JQK A;  5KOW A;  4J9U E;  3GU0 A;  1UPP A;  3EVW A;  2P9G A;  1YK9 A;  2CNL B;  2GQ2 A;  5ETO A;  2HAF A;  3D0H E;  4PWU A;  2IM2 A;  3BGR A;  1U1R A;  2B6A B;  3QT6 A;  4FVM A;  1DQ9 A;  2H4W B;  2WBM A;  2C2Z B;  3L3C A;  3FC9 A;  4K7Q A;  4JUZ A;  4B17 A;  4KGM A;  2ZE2 A;  3BB5 A;  3SXL A;  3HT0 A;  3QNW B;  2ATC B;  2X1G A;  1XR5 A;  3M7V A;  1HPZ B;  1Y11 A;  4WE1 A;  5G4D A;  1KTV A;  1R8B A;  3WZ0 A;  1BWE A;  1MRO A;  3GFY A;  3FMW A;  2PII A;  4G1Q B;  1MMD A;  2ZEJ A;  3UVJ B;  4UST A;  3DOK A;  4MKY A;  3LOU A;  3W60 A;  1U26 A;  2QLW A;  3BS9 A;  3MMA A;  2N7C A;  3PFO A;  1VGY A;  2KVI A;  5HJX A;  5C5J A;  2PI5 A;  4TY8 B;  2RHQ B;  1HWU A;  4F26 A;  2B56 A;  1EAR A;  2DKO B;  3GYN A;  2C3M A;  1UPM B;  4F50 A;  2OSR A;  4ED7 A;  4LUB A;  1MWZ A;  1HD1 A;  1N36 F;  3J80 Y;  3K2Y A;  1Q95 G;  5BJR A;  5KFA A;  5E5N A;  1T11 A;  2DHA A;  2MQN A;  1WKJ A;  1LXN A;  2L3M A;  2WVF A;  2XEX A;  2R8J A;  4PAA A;  1JB0 C;  2ZD1 B;  2HW3 A;  2BBE A;  5DLG A;  4RX6 A;  3U02 A;  2V8H A;  4OX8 A;  1ZET A;  2FJX A;  1SQG A;  2W2Q P;  2MYF A;  1UCN A;  2LYV A;  1RXO B;  2BW7 A;  2AEJ A;  2DEI A;  2RJZ A;  3SI8 A;  4OZJ A;  3G87 A;  1S1W A;  2DD8 S;  3ZXW A;  5K8M A;  4ZVE A;  4OJ3 A;  4NLQ A;  1UVM A;  4U67 Q;  1NDL A;  1T0T V;  1RAH B;  2YPZ A;  3E01 B;  4X4T A;  2XY5 A;  1A9N B;  2VAS A;  4NYZ A;  4QCL A;  4Q0B A;  2HUR A;  1H74 A;  4DV2 J;  2RKI A;  1SL0 A;  2ERR A;  2VUG A;  1LFW A;  3MHY A;  3GG0 A;  2MKY A;  4CWB A;  2G2Z A;  1SIZ A;  2WCX A;  1TL7 B;  2HHU A;  5IZH A;  1XJW B;  1O51 A;  3P5T L;  4DUY J;  4LF6 J;  1NDC A;  2F40 A;  3UCG A;  2CVE A;  3RJM B;  2XB2 D;  3I32 A;  4B3M J;  1TAQ A;  1HQU A;  2R8K A;  3TUI C;  1U4B A;  4MT1 A;  3FEY B;  1YDL A;  4CH7 A;  4DUT A;  1I1G A;  2DNG A;  4DS4 A;  1UVJ A;  5CAA A;  1S76 D;  3DOM A;  4NWB A;  3MM8 B;  4WZQ A;  4NZ0 A;  1U25 A;  5A8W B;  4HHJ A;  4XIU A;  3A8K A;  1FEH A;  2FGC A;  2R7Q A;  2PN6 A;  1IKV B;  2JJ4 D;  4MKV A;  2BR0 A;  5EWF A;  1TL1 B;  5DO2 A;  2DY9 A;  2YX7 A;  3C8Y A;  5BYR A;  3JYT B;  1CQM A;  1KD1 T;  1UVK A;  2QO3 A;  3DRX A;  4R8U A;  2OFH X;  8RUC A;  1LOU A;  3MM9 B;  3OW2 R;  1BLU A;  3EX7 B;  1F1B B;  1F60 B;  2ZH8 A;  1VHI A;  5HL7 Q;  3HHE A;  1MW7 A;  2D7S A;  2RDD A;  1FJE B;  1RWX B;  3TVK A;  4O0I A;  3QT5 A;  2Z2M A;  3UN5 A;  3CIM A;  1WI6 A;  3TOQ A;  2DXD A;  5MAO A;  4YB6 A;  1SKW A;  1WDD A;  4USU A;  3WX8 A;  5H9E J;  3FCH A;  2BJ1 A;  2YQ3 A;  3C19 A;  3HVT B;  1D9F A;  3CJ5 A;  4C8M A;  3DLJ A;  1PJ5 A;  1G7C B;  3T6B A;  2LKZ A;  4WZM A;  1I3O B;  1QJH A;  3TUJ C;  1XMQ J;  1VQM S;  3MPD A;  3M9O B;  4O3Q A;  2BM1 A;  3GFH A;  4JI8 J;  2M5Y A;  1NKE A;  3BKT A;  2XI3 A;  1WEX A;  2YY3 A;  3N4W A;  1M1K T;  3PKY A;  2AZ3 A;  1MG7 A;  4QZV B;  5KOX A;  4CLL A;  3GTY X;  4KV8 A;  1R8H A;  5FDL A;  2FY1 A;  2PSZ A;  4JYA J;  3M6W A;  1CJV B;  5HO4 A;  3G8T A;  1KOO A;  3HHL A;  1HFE L;  1R0A A;  3CCQ S;  2BKO A;  1EQ0 A;  3OV7 A;  3JS9 A;  1R6Y A;  2DNM A;  3BN7 A;  2UVU A;  4FZV A;  4MJK A;  4MIA A;  3BGR B;  1YTY A;  3MR6 A;  4DLE A;  2BJ3 A;  3HFV A;  1FWK A;  3I82 A;  1T9Y A;  1V3R A;  2DNP A;  2HVH A;  1NDP A;  4K4U A;  2QMW A;  3MPY A;  4OI1 A;  4AT1 B;  1RWV B;  2MKK A;  1I94 J;  1WEL A;  1UW9 A;  2NQP A;  2CZ4 A;  4JI0 J;  2NPF A;  2V50 A;  4QIG A;  4F0K A;  4LF4 J;  2CJX B;  2VFV A;  4WE1 B;  4F0H A;  1MRO B;  2BJD A;  4BDP A;  2BAB A;  2R7S A;  1VQ9 S;  2KG1 A;  1RYR A;  3DOK B;  4AQY J;  3NAH A;  5F41 A;  2HHH J;  1N5Y A;  3OJU A;  5D3G A;  4QR0 A;  3AOB A;  1VFJ A;  3MMA B;  2R3V A;  2B9E A;  2RUS A;  4ANC A;  3HSJ A;  5DQG A;  3ZNJ 1;  1CJT A;  1L3T A;  3UWT A;  1U1Q A;  3R7N B;  1JLA A;  4NRU A;  2UXD F;  1FFS B;  5D0G A;  1S72 S;  1MWY A;  3M9N B;  3QZ7 A;  1YG0 A;  1H73 A;  2BA9 A;  4F2R A;  2MJN A;  5AXN A;  4DZ6 A;  4QU7 A;  3TJ9 A;  2N3L A;  3CCL S;  3CJQ A;  4WYW A;  3ZC4 A;  1KON A;  3OFE A;  2EPI A;  2W9B A;  4DR7 F;  4DR5 F;  3P5B P;  1TU0 B;  3CC2 S;  2WW4 A;  3W8G A;  2LXI A;  2BQ3 A;  2P8I A;  5T14 A;  4B9U A;  3V6H A;  3H5S A;  4PYD A;  1HD0 A;  4KO0 A;  3UN2 A;  3OHB A;  4NCB A;  1KLM A;  1H38 A;  3J7Y I;  1IBL F;  2FVP A;  3LAK A;  3GJS B;  2AEF A;  5K8O A;  5KT2 A;  2Z2Y B;  4Q43 A;  2FJE B;  2J6S A;  3R2D J;  1RTI B;  2A2C A;  2V2Q A;  4K4X A;  1KWM A;  2FDN A;  2K3K A;  2F9J A;  7AT1 B;  2D3O R;  1S1W B;  5HMZ A;  2YH0 A;  1LWC B;  3ETO A;  3GII A;  1BY9 A;  1JLG B;  5KFI A;  2ILY A;  2KFY A;  4P2F A;  2M2B A;  3ZFV A;  4ENO A;  1M90 T;  4Q0B B;  2DO0 A;  3C2P A;  1WI8 A;  3W5Z A;  4KB7 A;  2QLB B;  4NI2 A;  3AAW B;  1RCO B;  2MEW A;  3K5L A;  3NL0 A;  4M5G A;  1EHW A;  2MZJ A;  1NK8 A;  4ECT A;  1NPR A;  4J9S A;  1SJ3 P;  3UDE A;  1U0S A;  4DV2 F;  1DFD A;  1K73 T;  5A8R A;  1N8R T;  3D54 A;  2DTJ A;  4DV4 F;  2K7J A;  4N8O A;  2ZJP Q;  1FTR A;  4JI3 F;  4DSF A;  4CIO A;  1G6B A;  3R2C J;  1YGY A;  4DOZ A;  3NCP A;  3CCM S;  4YR2 A;  4ALZ A;  3V5R A;  3D67 A;  3OD2 A;  3HHL C;  2OPS B;  3DDN A;  2QA4 G;  4DPO A;  2A3J A;  4OYA A;  4ES2 A;  4IR9 A;  3O1L A;  4FVC A;  1U2F A;  3M6V A;  1N52 B;  2YXL A;  4OYZ A;  4R8U B;  5CZV A;  2CQ0 A;  1EAY C;  3HUL A;  5I42 A;  3HHL D;  2HGN A;  1K8A T;  3B4D A;  4LFB J;  1GTH A;  2B7C B;  3B82 A;  3AD9 C;  3CCJ S;  5IM0 A;  1NK7 A;  5F9L A;  1X0P A;  4ZPC A;  2KFZ A;  2CRL A;  5E0O A;  2CQD A;  3PTW A;  1HLW A;  4XK8 C;  5KFN A;  1HNZ J;  2IMO A;  1HQ2 A;  5CYQ A;  1WEZ A;  4KIA A;  5C42 A;  2R8G A;  4J9N A;  1FA0 A;  2LLZ A;  1Q53 A;  3HVR A;  2PMH A;  3DMJ A;  2BAN A;  4OI2 A;  2BZ2 A;  4PQU A;  2ZC4 A;  1J5E J;  3J81 j;  4OYW A;  2NXU A;  1C0U A;  3IR5 B;  4PAB A;  4ED5 A;  4C2M A;  2DH7 A;  2F8M A;  4WFZ A;  1WHV A;  3AB4 B;  3IS9 A;  2G0I A;  3DXS X;  5DZ6 A;  2G13 A;  3CO9 A;  2AYB A;  2DPJ A;  3BBB A;  2MQL A;  4QU6 A;  1UVN A;  2CXE A;  4Z37 A;  2MY7 A;  3FEX B;  1S9E A;  2EFG A;  2IBO A;  2LQB A;  2CNN B;  2DNR A;  1RP5 A;  3ZZ0 A;  2YKO A;  2J9C A;  3UW1 A;  3L9Z A;  3N79 A;  1XMQ F;  3L09 A;  2I6W A;  2FJD B;  4ITS A;  1T9T A;  1U6Z A;  3NAI A;  1UAW A;  1YKW A;  1X4H A;  2GQC A;  1R0A B;  5K8N A;  2E7V A;  1OWX A;  1TUG B;  5HP1 B;  2ZZM A;  1IM4 A;  4LQ9 A;  3FRY A;  5GAH I;  4HDG A;  3K5O A;  1RWP B;  4B02 A;  2XS2 A;  2YNH B;  3LO3 A;  4QYZ K;  4UF4 A;  4HI1 A;  3K8W A;  5MLC V;  3QRQ A;  4RBU A;  1Y3J A;  1TMM A;  2CPY A;  5D78 A;  5D15 A;  1AXQ A;  1X9M A;  1RAF B;  3IBF B;  3QZ8 A;  4DL4 A;  1S5Z A;  1K0V A;  4CLW A;  4X4Q A;  3MED A;  3WQP A;  3IWN C;  1NK4 A;  4DPW A;  1K9M T;  3H5U A;  2R2S A;  1TL3 A;  1B7Y B;  4NZ7 A;  2YQ1 A;  5L1L A;  2YX1 A;  2IPO B;  3EDR B;  4RJV A;  1KVI A;  1RT6 A;  2AU0 A;  1FRI A;  1NKB A;  5BR8 F;  2QGF B;  4ZVQ B;  3Q23 A;  1QAX A;  3TA0 A;  3BF4 A;  4ZHR A;  4ZPB A;  3ISZ A;  2H1Y A;  3O3L A;  1N5Q A;  5ETR A;  2HWI A;  1YSJ A;  2QJ3 A;  4JI0 F;  2LU2 A;  1FKA F;  3PRB A;  1N5Y B;  2IY5 B;  1M0S A;  3M2U B;  4F4Y A;  4LT6 A;  5D3G B;  4CH0 S;  2VFR A;  3C6U A;  1HHT P;  1IKX A;  2MMY A;  3MM5 A;  3POT A;  1CJT B;  1X4D A;  1JLA B;  4ANE A;  3EZO A;  1H0H B;  2LEA A;  1BWV A;  1L5U A;  1H72 C;  2AF6 A;  1PJ7 A;  2PEB A;  2CNO B;  4ELV A;  2MST A;  4A8Y A;  2F8H A;  4ETZ A;  4X65 J;  3FGV A;  2W9B B;  3QWU A;  1MN7 A;  3OSP A;  2V34 A;  5LJ5 Y;  2V9W A;  5CYM B;  3UDL A;  4H4O A;  3M9M B;  3PAC A;  5IFM A;  4TXS A;  1TL5 A;  4DX7 A;  3J7Y U;  4LRE A;  1QAI A;  4C6A A;  4A8W A;  1GMU A;  3LGH A;  4KO0 B;  2RU3 A;  5E41 A;  1KLM B;  3Q8S B;  1H6K X;  2QZ8 A;  2EG2 A;  3H4D A;  4L76 A;  3ET6 B;  4UZC A;  4LF5 F;  4LFA J;  5H9F K;  3VTI A;  4I6W A;  1FD8 A;  2DHX A;  2JC0 A;  1TL4 A;  3SCI E;  5ETP A;  2ZHO A;  2FPH X;  4QWA A;  3I56 S;  2KT5 A;  4OZN A;  3GIM A;  2W9C B;  3CJ8 A;  2XNR A;  2MLX A;  2QLF B;  4OI0 A;  1PBU A;  1KVJ A;  1NZ8 A;  1XWL A;  1WD6 A;  5H1S V;  1SC4 B;  4CQ1 A;  4IG3 A;  3MGJ A;  3G4S S;  4QIE A;  3M32 B;  3UQS A;  2YKM A;  1YHQ S;  7FDR A;  1VJQ A;  4ZJL A;  3RAQ A;  1R3N A;  4DR3 J;  2I8E A;  4UW2 A;  3IC1 A;  3K58 A;  3A8J A;  2YTC A;  4FPR A;  4USK A;  3ENA A;  3I0S A;  3ILL A;  3MMB A;  3KK1 A;  4EU0 A;  3IA0 A;  2DO4 A;  3NXZ A;  1RBO B;  2Y1I A;  4WP3 A;  2KKH A;  4PG5 A;  3GIL A;  4ELT A;  3EGN A;  2UU9 F;  5K8P A;  3AHP A;  3FZB A;  2JNJ A;  3R5A A;  3MEE A;  4YB1 P;  1OS5 A;  4EGL A;  1XMO J;  2VFS A;  2IBK A;  4U9R A;  1QAY A;  3CC7 S;  3VR1 A;  1SH3 A;  2R8I A;  3QGH A;  3PRD A;  1GEH A;  4D3G A;  1UP1 A;  1IQZ A;  3A1Y G;  4J37 A;  4CDI A;  1IKW A;  2M7S A;  2OHD A;  4PKD B;  2LCW A;  4C3K A;  4FBT A;  2GAG C;  2R7U A;  1NSK L;  4DR4 J;  5IM0 B;  3EGZ A;  2XG8 A;  3R6G B;  4YEA A;  3A13 A;  5F8I A;  3IG1 A;  2YWG A;  2Z2Z A;  4FN5 A;  2PMZ D;  2VOP A;  5C42 B;  4BWJ A;  3GR1 A;  3ZZT A;  1P6T A;  3EXC X;  4F4K A;  1P27 B;  1Q5V A;  3DMJ B;  1BXN A;  2BAN B;  1HNZ F;  2CQP A;  3H25 A;  5KFR A;  1VOM A;  4DPY A;  2XS7 A;  2MXY A;  1NJI T;  2B4V A;  3KHG A;  2M70 A;  4JI7 J;  1URN A;  4X4U A;  1HI8 A;  3ISN D;  3VWS A;  1RAG B;  3HP6 A;  2BKN A;  3IS9 B;  4CYU A;  3H7H B;  1IUJ A;  4I4B A;  4X4O A;  1VRQ C;  4FXW A;  4USM A;  4ZLN A;  4H54 A;  2HNZ A;  1TKZ A;  1X5T A;  5HQ8 A;  3J81 Y;  2VKZ G;  1VQ4 S;  1WG5 A;  2XGP A;  5I3U A;  2OPQ A;  1HBN B;  3GE9 A;  1KDN A;  2XY7 A;  4U8V A;  4ES1 A;  2U2F A;  3VGU A;  1IXK A;  2PA3 A;  4YOE A;  2Z4P A;  4O3N A;  1X4G A;  4NLV A;  1SCJ B;  2R8H A;  3DLB A;  2B4O A;  1KVK A;  3CMA S;  3GIR A;  1VRU A;  3S7R A;  2FGO A;  3QAT A;  2AGP A;  4CO4 A;  4WFY A;  1JK9 B;  1N32 F;  2FIU A;  3WIV A;  3KJF B;  3MTK A;  1VRT A;  4EUV A;  3FZ2 A;  2HKE A;  4ZVO B;  3MED B;  5HMY A;  5D0H A;  3M8Z A;  5I4M A;  1C1C B;  4NLX A;  4F3M A;  3BQ1 A;  1YBU A;  2FVS A;  2KHC A;  1RT6 B;  2NZ4 A;  4WIQ A;  1FO1 A;  4B9T A;  3ENQ A;  4ZIT A;  3TAR A;  5GAD I;  2VQE F;  2W2P P;  3IBC B;  1UVL A;  2MJU A;  1WSR A;  4DL0 C;  2LQ5 A;  3PNI A;  1G2E A;  1S6P A;  4IOA Q;  3A8I A;  4RWW A;  3PR5 B;  3FBF A;  1KS2 A;  1ZAV A;  3AXM A;  4CO2 A;  1C4C A;  2FY8 A;  5AXL A;  5KT4 A;  3ONQ A;  2I2Y A;  3CDU A;  4NLW A;  2J0W A;  4ZLP A;  3C6U B;  4NCG A;  1U1O A;  1U0H A;  3MM5 B;  3POT B;  5A6W A;  2E9R X;  1TQL A;  3SV3 A;  2ZM6 J;  1SJF A;  2DNO A;  1DY3 A;  2WRM A;  4F4A A;  4A8K A;  5J1E A;  2ZKT A;  3MZI A;  1JXL A;  5DLF A;  1NJX A;  1CJU A;  1X0F A;  2IAJ A;  4EWT A;  3QGI A;  1G1X A;  2EKY A;  5CCM A;  1RWU A;  4DFK A;  4TNO A;  3G8S A;  4OQJ A;  4H4O B;  2BDP A;  3DLK A;  2HLU A;  2ASL A;  1RGV A;  2ZH1 A;  2JEF A;  2C3P A;  4TU7 A;  1CPZ A;  4IR1 A;  4B3T J;  4K0K F;  3R9L A;  2EFP A;  2ZC3 A;  2E5I A;  2DB1 A;  2CG8 A;  2DGV A;  4UY8 5;  4F25 A;  3RRH A;  2JX2 A;  3JSM A;  4OIX A;  3AY0 A;  1S0O A;  4RUA A;  4ZLJ A;  4WJB A;  4CLP A;  1U1N A;  3CD6 S;  2UVV A;  2VG6 A;  3TI0 A;  1RTD A;  5H9E K;  3MUV P;  2GNK A;  3Q2S C;  3Q2T C;  3P96 A;  5AXM A;  3I9Z A;  3DNC A;  3SCJ E;  1S48 A;  2EFN A;  4IG3 B;  2OEL A;  1B0V A;  1YRT A;  5LSL A;  1PCA A;  2W1B A;  1NO8 A;  3EDQ B;  5IV3 A;  1VI7 A;  1HHS A;  2G4B A;  4DL7 A;  3J80 U;  4IH5 A;  1GNK A;  4KT0 C;  3I0S B;  4RZR A;  2HQC A;  3MMB B;  1JJH A;  3CCW A;  4CTA A;  4ZVS B;  4I67 A;  3KK1 B;  2ZZN A;  3VVT A;  2AJ1 A;  4ELU A;  4OZ2 A;  4PG7 A;  3QYY A;  4RBT A;  4OMF G;  2IC3 A;  4GKJ F;  4ED3 A;  1WG4 A;  1IR2 A;  1U1K A;  4IFY A;  3BSC A;  1XNQ F;  3PXG a;  3MEE B;  3M6U A;  2Q43 A;  4EO6 A;  5GAG I;  3QJJ A;  2O01 C;  4WKY A;  3R7B B;  3MR2 A;  2IRY A;  3R3T A;  4JI1 F;  3B78 A;  3E51 A;  4O3O A;  4KHM A;  3RUB L;  3DM2 A;  4ID8 A;  2B5J A;  1R8P A;  1XMO F;  2DRA A;  3OSN A;  4XDD A;  3PYD A;  1NJW A;  3H4B A;  1H7W A;  4I2Q A;  1IKW B;  2ZJQ Q;  1N54 B;  1RLD A;  2DNH A;  5JMN A;  2IYG A;  2C22 A;  4FP9 A;  3K5M A;  4XO0 A;  3UD3 P;  1XC9 A;  1S59 A;  2FJB B;  2DHS A;  2HRT A;  4J7C A;  4EEY A;  2P6S A;  2YKQ A;  2F9D A;  4LF7 J;  5K14 B;  3IWL A;  3IG1 B;  1M1G A;  4GO5 X;  4QPT A;  4GVB A;  2VJV A;  3CJR A;  2NYH A;  1GMW A;  2BE2 A;  1T03 A;  4YDX A;  4DR4 F;  2BW2 A;  3HX9 A;  5CCL A;  2HHP A;  2ILZ A;  2ZH6 A;  2G2O A;  2ZZT A;  2B4P A;  4DUZ J;  4DR2 J;  1ZTW A;  1APS A;  3W3S A;  3V4M A;  3PIO Q;  1TEL A;  4ES3 A;  4HT5 A;  2H65 B;  4RW4 B;  1WKK A;  1FK9 A;  2XWY A;  1E6V B;  3IN5 A;  4DQQ A;  5HAO A;  2CPH A;  2MZQ A;  2QMU B;  1S10 A;  1D9D A;  1NDK A;  2CAD A;  2VD3 A;  4CYU B;  1N5T A;  3PEH A;  1N5S A;  3IAS 9;  3F44 A;  1N4L A;  2WON A;  4JI7 F;  1DAR A;  4KHR A;  2FLL A;  4BC7 A;  1RLC L;  1FDA A;  5FD1 A;  3DU5 A;  1TKZ B;  3BGF A;  3KDN A;  2WZ1 A;  4W4M A;  5I3U B;  2OPQ B;  3NNH A;  2ADC A;  1X9S A;  3O8W A;  5KFV A;  2V6A A;  3H90 A;  5E2Q A;  1FER A;  1Q4R A;  4KE5 A;  2HFZ A;  1QAJ A;  2ASY A;  1OSC A;  3U7J A;  1JLB A;  1UFL A;  5M2R A;  5KFQ A;  1VRU B;  2F1F A;  2W2M P;  3QIP A;  5KFF A;  3CCT A;  1FWL A;  2KM8 C;  5KFW A;  4B3R J;  1W26 A;  3BKU A;  3ZTO A;  4ZP6 A;  4IO9 Q;  3VGS A;  1YJV A;  1VRT B;  3PV8 A;  3CSK A;  2UXB J;  5EWG A;  4L74 A;  1OSD A;  1HNV A;  2GAH C;  1LW0 A;  2PDA A;  2CZ9 A;  2CQ3 A;  4MFB B;  4EK2 A;  3V6K A;  2BUN A;  1B0T A;  3PW5 A;  4RUC A;  3QMQ A;  5B0F A;  3R5B A;  5HBM A;  2HHT A;  3CF5 Q;  3EVO A;  2NPI A;  2EG1 A;  4ZCI A;  2LDI A;  3MCS A;  4NLG A;  2FLN A;  2W25 A;  4RPF A;  2JHE A;  1S6P B;  1HWI A;  3PEJ A;  4DV6 F;  2CYY A;  3M8Y A;  5E3A A;  4U7U K;  3QLH A;  1TFW A;  3GWC A;  2JFD A;  2E5J A;  4NCG B;  4ZPT R;  2HZA A;  4NLO A;  3FFI A;  3CJ4 A;  5CH7 B;  4OYO A;  1U0H B;  4HL9 A;  1T8E A;  5EX3 A;  2Y9H A;  1N34 F;  1Y5I B;  2EC0 A;  4X2B A;  1FHT A;  3TNV A;  5J1E B;  2XC9 A;  4DR6 F;  5FLX Y;  4ZJQ A;  3T9N A;  1CJU B;  2IAJ B;  3BSO A;  2EBE A;  4ZJO A;  2GVZ A;  2ZM6 F;  4S0M A;  1FE4 A;  4CO1 A;  4G65 A;  1CVJ A;  3DKD A;  5G0R A;  4OX6 A;  2CQ2 A;  5IWA J;  2PD1 A;  2GW8 A;  4R5P A;  3DLK B;  1ZAX A;  3HD1 A;  2BOP A;  4ECU A;  2OO4 A;  5KFJ A;  4P74 A;  5IV4 A;  1NJZ A;  1EKR A;  3NS7 B;  4C3M A;  2H48 B;  4Y2M A;  3M05 A;  4ED0 A;  2N4D A;  1Q81 T;  2ROP A;  2W4C A;  3KLH A;  3JSM B;  2ZHA A;  4ZMM A;  3LTO A;  5ETQ A;  5HLF A;  3SEO A;  3G2X A;  5HVF A;  1FJG J;  1AA1 B;  1IR1 A;  1KR4 A;  2P5V A;  4LJM A;  2VG6 B;  2XO7 A;  4LMZ A;  4CO3 A;  3DLH A;  3T5K A;  4K59 A;  4BWM A;  1RTD B;  2E44 A;  3FBC A;  4ECV A;  1YI2 S;  1WOS A;  2DNL A;  4MIW A;  1CLF A;  1XK8 A;  3WDO A;  3LGN A;  1V3Z A;  1TMJ A;  2YWH A;  2J7K A;  4RUH A;  1MSW D;  1VHF A;  2QMX A;  5GAE I;  1RAB B;  4DSI A;  4HI2 A;  2F3J A;  1P9Q C;  3J7A N;  2KT2 A;  1GMW D;  2GJF A;  3D3B J;  1VK3 A;  3M8S A;  1KEK A;  2HZC A;  3CPW R;  4RO0 A;  4ECZ A;  3JB9 k;  4LFC J;  1NHK L;  2DR8 A;  5DGA A;  4O23 A;  4I1T A;  2R7R A;  2HG4 A;  4L3K A;  1GT8 A;  1HMV A;  2B3T B;  4IRD A;  4FNH A;  1S7I A;  2XLJ A;  2Y8W A;  3EJM A;  3AOD A;  1PYO B;  1HNI A;  3PKM A;  4HH1 A;  1W2I A;  2OD6 A;  3GMG A;  4UQT A;  3ETM A;  5SZT A;  2EW9 A;  3QO9 A;  4ZP8 A;  3DM2 B;  4LBI A;  2X51 A;  1RWW B;  1RHJ B;  2OPR B;  3OVS A;  2B5J B;  3MF5 A;  2J7U A;  1FRK A;  1XR7 A;  4U8Y A;  1GX5 A;  2V9K A;  2HS0 A;  1WEY A;  4AFF A;  4QWD A;  4JI2 F;  2A2D A;  3OFG A;  2DNN A;  2EC2 A;  4C8Z A;  3DRY A;  3Q0A A;  2CQI A;  1XNR J;  5ETK A;  2KI2 A;  2V8D A;  2JEJ A;  1GTE A;  1PKU A;  2IIH A;  3M2V A;  3SDE A;  2X1A A;  4QBU A;  5IS2 A;  2KL8 A;  3T1Y J;  2BE2 B;  2PFD A;  1T03 B;  4AL6 A;  2VKR A;  3KJV A;  3ZTR A;  4P2S A;  3MM7 B;  4IH6 A;  1WC4 A;  2GIF A;  4M5J A;  3IBW A;  4DLG A;  2IJR A;  1FXD A;  1UEK A;  3BZQ A;  1B70 B;  2R4F A;  4J9R A;  3UDV A;  3TZZ A;  2XM3 A;  1IBK F;  3QWP A;  4N76 A;  1HHQ A;  1FK9 B;  3HCX A;  2I9S A;  1U48 A;  2HQF A;  4F36 A;  3BR8 A;  2AJQ A;  1Q82 T;  4AUK A;  2IVY A;  1S12 A;  5F3T A;  4OHZ A;  3V2U C;  2G1H A;  4PYA A;  2KFN A;  2VPY B;  4WPA A;  2PO4 A;  5DRK A;  2FZG B;  3UD5 A;  4JI6 F;  1YX2 A;  3QGP A;  3CB4 A;  1CBK A;  1RI7 A;  4C8K A;  1YVF A;  3KUG A;  2JDJ A;  3JSR A;  3H5Y A;  4CLU A;  4LSL A;  4L3N A;  3G86 A;  2FYX A;  3CME S;  3MI7 X;  3D2W A;  1JLB B;  4ZCL A;  1HNX F;  3MEG A;  3QIP B;  1T05 A;  4IQM A;  4DQP A;  1JXE A;  2HQI A;  2DJW A;  3SSS A;  4K4T A;  2FVQ A;  4ZDN A;  4O3P A;  2MHN A;  5DG9 A;  3F73 A;  5IQQ A;  1FNO A;  1RTJ A;  2AIR B;  1SJ1 A;  3RR7 A;  1XQI A;  3CJ2 A;  3L7P A;  4B3R F;  1HNV B;  2QFI A;  2RRB A;  4YY3 J;  4NXN J;  4A46 A;  5F3Z A;  1SC3 B;  3TA1 A;  1QVG R;  4AL5 A;  5HBM B;  2XS5 A;  4P2M A;  2UXB F;  1SL2 A;  2KZZ A;  1S49 A;  2C1E B;  1BD6 A;  2PE8 A;  1V5I B;  4DQI A;  1MWQ A;  1YJR A;  3THP A;  3RW6 A;  1ITP A;  4Q2L A;  2PEH A;  5KFC A;  4ED6 A;  2YNG A;  4TU8 A;  1DQ8 A;  1FNM A;  3BO2 A;  1WC3 A;  3D0G E;  4ECQ A;  3FFI B;  4N77 A;  3D7S B;  3NS5 A;  2IMW P;  5EHH A;  4KGK A;  3FVY A;  5D4O A;  1PG5 B;  1WHY A;  2V8V A;  3L7O A;  1RA6 A;  1ZM4 A;  5EX0 A;  2HHS A;  5C25 A;  2BKP A;  1EKS A;  5B0A A;  5THW A;  1M5K C;  4M1K A;  3GV5 B;  2O1P A;  2B9Y A;  2OTJ S;  5T41 A;  2GVZ B;  1YLX A;  1NBE B;  3KDO A;  3IO1 A;  4O3R A;  3RBX A;  5G0R B;  1WTB A;  1RHK B;  2MKC A;  1JLF A;  3ZZP A;  1VC0 A;  2RRN A;  3FCW A;  2HBZ B;  1UW4 A;  2FQQ B;  3FK4 A;  2P9E A;  4EBD A;  1OQ6 A;  4LF9 F;  3LA0 A;  4WU3 A;  4OZL A;  4OLO A;  1IWA A;  4DV1 J;  1YJ9 S;  5HAN A;  1HNW J;  1FKO A;  2ZVI A;  3R5G A;  4O3S A;  1P1T A;  1I5O B;  3CJK A;  4NXM F;  4DDF A;  5HLF B;  1RHM B;  2XWX A;  2C3Y A;  2F7V A;  4ZPA A;  2RIL A;  4JI4 J;  4RR5 A;  4U7U D;  2K3I A;  1HWK A;  3CED A;  4DX8 H;  1M5P C;  4OL8 A;  4AD6 A;  2CJQ A;  2X1F A;  1N33 J;  1DRZ A;  4JV5 J;  2CPE A;  5DET A;  3IM9 A;  2JEG A;  2MLY A;  3MM6 A;  5IT9 Y;  2G1D A;  2CPF A;  2DR6 A; 
#chains in the Genus database with same CATH homology
 1PYO B;  3NS7 B;  2H48 B;  2HBY B;  3EDR B;  1RWX B;  1NME B;  1IBC B;  1I51 B;  2QL9 B;  1QDU B;  2XYH B;  2CNN B;  3KJF B;  3RJM B;  4ZVQ B;  3GJT B;  1QTN B;  4LSZ B;  1RHK B;  4ZVT B;  2HBR B;  3R7N B;  1SC3 B;  3EDQ B;  2Y0B B;  4ZVO B;  2HBZ B;  3QNW B;  5IC4 B;  2QLB B;  1RWW B;  1RHJ B;  2FQQ B;  1RWK B;  1RHR B;  1RWO B;  1RWM B;  1RHU B;  4ZVS B;  1RE1 B;  4DCJ B;  2C2O B;  3P45 B;  2XYP B;  5IC6 B;  3GJQ B;  1BMQ B;  1GFW B;  3R6L B;  1RWN B;  1RWV B;  4ZVU B;  2C1E B;  4DCO B;  2XYG B;  2QL7 B;  1RWP B;  2QLF B;  3R7S B;  1I3O B;  2H5I B;  4ZVR B;  2XZT B;  3D6F B;  3IBC B;  1SC1 B;  1SC4 B;  3KJQ B;  4JB8 B;  2CNK B;  1RHM B;  2H54 B;  3D6H B;  1ICE B;  3R5J B;  2H65 B;  2C2K B;  2CNL B;  1PAU B;  2HBQ B;  3KJN B;  4DCP B;  4ZVP B;  2CNO B;  3SIP B;  3R7B B;  3GJR B;  2H5J B;  2H51 B;  2H4Y B;  3IBF B;  2CJX B;  1F9E B;  2C2M B;  2DKO B;  2CDR B;  2QLJ B;  3R6G B;  2QL5 B;  2P2C B;  2H4W B;  3GJS B;  2CJY B;  1RHQ B;  3D6M B;  2C2Z B;  5K20 B;  3P4U B;  2Y1L B;  2XZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...