2QLHA

Mplum i65l mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
214
Chain Sequence
EVIKEFMRFKEHMEGSVNGHEFEIEGEGEGRPYEGTQTARLKVTKGGPLPFAWDILSPQLSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKVRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEMKMRLRLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluorescent protein plum
publication title Structural Studies of Far-Red Emission in mPlum, a Monomeric Red Fluorescent Protein
rcsb
source organism Discosoma sp. lw-2004
molecule tags Fluorescent protein
total genus 65
structure length 214
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2qlhA00
2AWJA 4J8AA 5DPHA 4GOBA 1UISA 3SG5A 1GFLA 3SVDA 1F0BA 3VHTA 4JRBA 1Q4CA 5DTYA 4W6IA 2B3PA 5EHUA 2PXWA 3VICA 3EK7A 5AQBB 4KF5A 4ZFSA 2HCGA 4XOWA 2DUGA 1EMFA 5HZSA 3PJ7A 4R6BA 4OHSA 2QLGB 2YDZA 1CV7A 3WCKA 3U0MA 4DXIA 4W6TA 2ZMUA 1G7KA 3EKHA 2OTEA 3SSKA 4XGYA 2A48A 4Q7RA 2FWQA 4W6KA 4NWSA 3I19A 4XOVA 5KTGA 5DRGA 2A56B 2G16B 3BXBA 4HQ9A 3O77A 5BTTA 3EVVA 3SG2A 4DXOA 1Q4DA 4PPKA 2C9IA 1BFPA 5EB7A 3SSVA 1GGXA 2DUEA 3GB3A 3P28A 4W7RA 2EMOA 3IR8A 2JADA 4DXNA 4GF6B 4W6UA 2AHAA 2PXSA 2HGYA 1KYPA 5J2OA 3OSQA 4KW8A 5DTXA 2QLHA 3CFFA 4W74A 4U2VA 3ST2A 2OKYA 5EJUA 4H47A 5LTQA 4B5YA 3UG0A 2QLIA 5LTPA 3CD9A 3GL4A 3LF3A 1XAEA 3ST0A 4Z4KA 3SSTA 1KYRA 4ORNA 1EMKA 2HQKA 3BXCA 5HZOA 2OGRA 3E5VA 3AKOA 3DQ6A 3EVUA 1Z1PA 1KP5A 4KPIA 4KF5C 3DQUA 3SVEA 3BXAA 1QXTA 4Q9XA 5EB6A 4W6MA 3EK8A 3V3DA 4LQTA 3DQ4A 3SSPA 3DQDA 5HW9A 4LJDA 3DQ1A 3EVPA 3UFZA 3PIBA 4W77A 4ZF5A 4AS8A 2DUFA 2Q57A 4AR7A 2WHTA 5F9GA 5BT0A 2DDDA 3M24A 3DQKA 4W6OA 1W7TA 3RWAA 3NT9A 4ZF4A 2VAEA 3SS0A 1QY3A 2ZO6A 4KEXA 4JEOA 3DQJA 4JGEA 2HFCA 3PJBA 5EXBA 5BQLA 4OQWA 5LTRA 4LJBA 2IE2A 2ARLA 2VADA 3DPXA 4Q9WA 3U8AA 2G3OA 3DQ9A 3SSYA 3EK4A 5LK4A 3DQ5A 4HVFA 5EBJA 1JC1A 2V4EB 4PFEA 1OXDA 4H3LA 4IK5A 4W6HA 2AWMA 4ZB1A 3LF4B 2G6EA 2RH7A 4HQCA 1JC0A 4KAGA 3ZUJA 4W7DA 4EDOA 4UTSA 4EMQA 4H48A 3LS3A 5DPGA 5BTTB 1EMGA 5DY6A 1C4FA 2H5OA 1JBZA 2DUIA 3SVBA 4N3DA 2H5RA 4W73A 3ED8A 1Z1QA 2WSOA 4ZIOA 2VVIA 1YHHA 2IB6A 3SG6A 3ZULA 2A54B 2DDCA 4W69A 3DQCA 3AI4A 4DKNA 2A47A 2AH8A 1B9CA 4W6CA 2QU1A 4P76A 2BTJA 2G6XA 4W75A 2C9JA 4LJDC 3SRYA 4W6PA 2A50B 2O29A 3CFAA 3NEDA 1EMMA 2HRSA 2GW3A 2QLGA 3IP2A 2A53B 2Y0GA 5DTLA 4GESB 3OGOA 4PPJA 1JBYA 1OXFA 4W6RA 5HGEA 4IK8A 3W1DA 3NT3A 4W7FA 2O2BA 3OSRA 2QT2A 4LW5A 3SG4A 4PPLA 5DQMA 4DXMA 3DQEA 1KYSA 1QYOA 4I2YA 3AI5A 4LJCA 4DKMA 4EDSA 5DQBA 1ZGQA 4OJ0A 3SSHA 2YE1A 4JFGA 1XQMA 4J89A 2P4MA 2Z1OA 1RM9A 2QLEA 1RMOA 5HZTA 3M22A 2Z6YA 3SVCA 3SG3A 2VVHA 2Q6PA 1Q73A 2H6VA 1HUYA 2WURA 3DQ7A 5T3IA 4B30A 4KW4A 4IK3A 4W72A 3ZTFA 2VVJA 4J88A 2H5QA 5FVFA 5DU0A 2Z6ZA 4TZGA 3VHTB 1F09A 3ADFA 3O78A 3DQFA 2EMDA 2DD7A 4W7CA 4W6JA 4HQ8A 4OGSA 1Q4EA 4W76A 5H89A 1XSSA 2OKWA 3MGFA 4Q7UA 4KA9A 4JF9A 3NF0A 3NEZA 4LQUA 5FHVA 3RWTA 1XMZA 4IK9A 1MYWA 3WLCA 3CB9A 4R6DA 1EMEA 5HBDA 3U0KA 3E5TA 2FZUA 4OY4A 2B3QA 1MOVA 3DQIA 4KW9A 1EMCA 3LVAA 2VZXA 2HJOA 5DTZA 1GL4A 4L13A 3DQHA 2WIQA 2G5ZB 1Q4BA 1H4UA 1RMPA 2POXA 3LVDA 3U0LA 4XVPA 3U8PA 3KCSA 2QRFA 2G3DB 4W7XA 4W7AA 3DPWA 2AWKA 1YHIA 3DPZA 3E5WA 3KCTA 5DRFA 3TMRA 4DXQA 4Z4MA 2GX0A 3DQAA 1YZWA 3WLDA 2V4EA 3A8SA 3GJ1A 2G2SB 2A52B 4RYWA 3ST4A 1YJFA 4IK4A 3ZUFA 4KGEA 4RYSA 4H3MA 1RMMA 1EMAA 2AWLA 5EXCI 4W7EA 1MOUA 3VK1A 2IOVA 1QYQA 3CBEA 1H6RA 3DQ3A 1QYFA 1XA9A 2H9WA 1YFPA 4JC2A 1Q4AA 2EMNA 3DQLA 2WSNA 4HE4A 3DQNA 4RTCA 5H87A 3SVRA 4ANJA 2WHSA 5EXUA 3CFHA 1YJ2A 2WISA 4Q7TA 1HCJA 3EVRA 4W6AA 4EULA 3GEXA 4XL5A 5FVGA 2OJKA 4DXPA 4L1IA 3SSLA 4ZINA 3SVUA 3BX9A 2A46A 3DQOA 3CGLA 4B30B 3SVNA 4W6FA 4IZNA 3W1CA 4P1QA 3DQMA 1OXEA 2YE0A 4W6NA 3SVOA 2O24A 5DPIA 3SG7A 3PJ5A 2FL1A 3LSAA 1YHGA 3LA1A 3DQ2A 2HQZA 4W6LA 3H1RA 3U8CA 3LVCA 2ZO7A 4W6GA 2HGDA 2DD9A 2DUHA 1RRXA 3G9AA 3U0NA 1ZGPA 4L12A 2GW4B 4BDUA 4EN1A 3S05A 2WHUA 1ZGOA 4IK1A 1EMBA 2ICRA 4ZBLA 2OTBA 1S6ZA 3GJ2A 2V4EC 3ST3A 1EMLA 4TZAA 3SV5A 4W6BA 2H5PA 4KGFA 2G6YA 2H8QA 5FVIA 2YFPA 3CD1A 5HZUA 3EKJA 3TMTA 2Z6XA 2HPWA 2ZMWA 4ZF3A 3DQ8A 2GX2A 4W6SA 5DPJA 1ZUXA 5H88A 2IB5A 3SVSA 3K1KA 3P8UA 4H3NA 2QZ0A 3H1OA 1W7UA 4W6DA 4KF4A 1W7SA
chains in the Genus database with same CATH superfamily
2AWJA 4J8AA 5DPHA 4GOBA 1UISA 3SG5A 1GFLA 3SVDA 1F0BA 3VHTA 4JRBA 1Q4CA 5DTYA 4W6IA 2B3PA 5EHUA 2PXWA 3VICA 3EK7A 5AQBB 4KF5A 4ZFSA 2HCGA 4XOWA 2DUGA 1EMFA 5HZSA 3PJ7A 4R6BA 4OHSA 2QLGB 2YDZA 1CV7A 3WCKA 3U0MA 4DXIA 4W6TA 2ZMUA 1G7KA 3EKHA 2OTEA 3SSKA 4XGYA 2A48A 4Q7RA 2FWQA 4W6KA 4NWSA 3I19A 4XOVA 5KTGA 5DRGA 2A56B 2G16B 3BXBA 4HQ9A 3O77A 5BTTA 3EVVA 3SG2A 4DXOA 1Q4DA 4PPKA 2C9IA 1BFPA 5EB7A 3SSVA 1GGXA 2DUEA 3GB3A 3P28A 4W7RA 2EMOA 3IR8A 2JADA 4DXNA 4GF6B 4W6UA 2AHAA 2PXSA 2HGYA 1KYPA 5J2OA 3OSQA 4KW8A 5DTXA 2QLHA 3CFFA 4W74A 4U2VA 3ST2A 2OKYA 5EJUA 4H47A 5LTQA 4B5YA 3UG0A 2QLIA 5LTPA 3CD9A 3GL4A 3LF3A 1XAEA 3ST0A 4Z4KA 3SSTA 1KYRA 4ORNA 1EMKA 2HQKA 3BXCA 5HZOA 2OGRA 3E5VA 3AKOA 3DQ6A 3EVUA 1Z1PA 1KP5A 4KPIA 4KF5C 3DQUA 3SVEA 3BXAA 1QXTA 4Q9XA 5EB6A 4W6MA 3EK8A 3V3DA 4LQTA 3DQ4A 3SSPA 3DQDA 5HW9A 4LJDA 3DQ1A 3EVPA 3UFZA 3PIBA 4W77A 4ZF5A 4AS8A 2DUFA 2Q57A 4AR7A 2WHTA 5F9GA 5BT0A 2DDDA 3M24A 3DQKA 4W6OA 1W7TA 3RWAA 3NT9A 4ZF4A 2VAEA 3SS0A 1QY3A 2ZO6A 4KEXA 4JEOA 3DQJA 4JGEA 2HFCA 3PJBA 5EXBA 5BQLA 4OQWA 5LTRA 4LJBA 2IE2A 2ARLA 2VADA 3DPXA 4Q9WA 3U8AA 2G3OA 3DQ9A 3SSYA 3EK4A 5LK4A 3DQ5A 4HVFA 5EBJA 1JC1A 2V4EB 4PFEA 1OXDA 4H3LA 4IK5A 4W6HA 2AWMA 4ZB1A 3LF4B 2G6EA 2RH7A 4HQCA 1JC0A 4KAGA 3ZUJA 4W7DA 4EDOA 4UTSA 4EMQA 4H48A 3LS3A 5DPGA 5BTTB 1EMGA 5DY6A 1C4FA 2H5OA 1JBZA 2DUIA 3SVBA 4N3DA 2H5RA 4W73A 3ED8A 1Z1QA 2WSOA 4ZIOA 2VVIA 1YHHA 2IB6A 3SG6A 3ZULA 2A54B 2DDCA 4W69A 3DQCA 3AI4A 4DKNA 2A47A 2AH8A 1B9CA 4W6CA 2QU1A 4P76A 2BTJA 2G6XA 4W75A 2C9JA 4LJDC 3SRYA 4W6PA 2A50B 2O29A 3CFAA 3NEDA 1EMMA 2HRSA 2GW3A 2QLGA 3IP2A 2A53B 2Y0GA 5DTLA 4GESB 3OGOA 4PPJA 1JBYA 1OXFA 4W6RA 5HGEA 4IK8A 3W1DA 3NT3A 4W7FA 2O2BA 3OSRA 2QT2A 4LW5A 3SG4A 4PPLA 5DQMA 4DXMA 3DQEA 1KYSA 1QYOA 4I2YA 3AI5A 4LJCA 4DKMA 4EDSA 5DQBA 1ZGQA 4OJ0A 3SSHA 2YE1A 4JFGA 1XQMA 4J89A 2P4MA 2Z1OA 1RM9A 2QLEA 1RMOA 5HZTA 3M22A 2Z6YA 3SVCA 3SG3A 2VVHA 2Q6PA 1Q73A 2H6VA 1HUYA 2WURA 3DQ7A 5T3IA 4B30A 4KW4A 4IK3A 4W72A 3ZTFA 2VVJA 4J88A 2H5QA 5FVFA 5DU0A 2Z6ZA 4TZGA 3VHTB 1F09A 3ADFA 3O78A 3DQFA 2EMDA 2DD7A 4W7CA 4W6JA 4HQ8A 4OGSA 1Q4EA 4W76A 5H89A 1XSSA 2OKWA 3MGFA 4Q7UA 4KA9A 4JF9A 3NF0A 3NEZA 4LQUA 5FHVA 3RWTA 1XMZA 4IK9A 1MYWA 3WLCA 3CB9A 4R6DA 1EMEA 5HBDA 3U0KA 3E5TA 2FZUA 4OY4A 2B3QA 1MOVA 3DQIA 4KW9A 1EMCA 3LVAA 2VZXA 2HJOA 5DTZA 1GL4A 4L13A 3DQHA 2WIQA 2G5ZB 1Q4BA 1H4UA 1RMPA 2POXA 3LVDA 3U0LA 4XVPA 3U8PA 3KCSA 2QRFA 2G3DB 4W7XA 4W7AA 3DPWA 2AWKA 1YHIA 3DPZA 3E5WA 3KCTA 5DRFA 3TMRA 4DXQA 4Z4MA 2GX0A 3DQAA 1YZWA 3WLDA 2V4EA 3A8SA 3GJ1A 2G2SB 2A52B 4RYWA 3ST4A 1YJFA 4IK4A 3ZUFA 4KGEA 4RYSA 4H3MA 1RMMA 1EMAA 2AWLA 5EXCI 4W7EA 1MOUA 3VK1A 2IOVA 1QYQA 3CBEA 1H6RA 3DQ3A 1QYFA 1XA9A 2H9WA 1YFPA 4JC2A 1Q4AA 2EMNA 3DQLA 2WSNA 4HE4A 3DQNA 4RTCA 5H87A 3SVRA 4ANJA 2WHSA 5EXUA 3CFHA 1YJ2A 2WISA 4Q7TA 1HCJA 3EVRA 4W6AA 4EULA 3GEXA 4XL5A 5FVGA 2OJKA 4DXPA 4L1IA 3SSLA 4ZINA 3SVUA 3BX9A 2A46A 3DQOA 3CGLA 4B30B 3SVNA 4W6FA 4IZNA 3W1CA 4P1QA 3DQMA 1OXEA 2YE0A 4W6NA 3SVOA 2O24A 5DPIA 3SG7A 3PJ5A 2FL1A 3LSAA 1YHGA 3LA1A 3DQ2A 2HQZA 4W6LA 3H1RA 3U8CA 3LVCA 2ZO7A 4W6GA 2HGDA 2DD9A 2DUHA 1RRXA 3G9AA 3U0NA 1ZGPA 4L12A 2GW4B 4BDUA 4EN1A 3S05A 2WHUA 1ZGOA 4IK1A 1EMBA 2ICRA 4ZBLA 2OTBA 1S6ZA 3GJ2A 2V4EC 3ST3A 1EMLA 4TZAA 3SV5A 4W6BA 2H5PA 4KGFA 2G6YA 2H8QA 5FVIA 2YFPA 3CD1A 5HZUA 3EKJA 3TMTA 2Z6XA 2HPWA 2ZMWA 4ZF3A 3DQ8A 2GX2A 4W6SA 5DPJA 1ZUXA 5H88A 2IB5A 3SVSA 3K1KA 3P8UA 4H3NA 2QZ0A 3H1OA 1W7UA 4W6DA 4KF4A 1W7SA
chains in the Genus database with same CATH topology
2AWJA 4J8AA 5DPHA 4GOBA 1UISA 3SG5A 1GFLA 3SVDA 1F0BA 3VHTA 4JRBA 1Q4CA 5DTYA 4W6IA 2B3PA 5EHUA 2PXWA 3VICA 3EK7A 5AQBB 4KF5A 4ZFSA 2HCGA 4XOWA 2DUGA 1EMFA 5HZSA 3PJ7A 4R6BA 4OHSA 2QLGB 2YDZA 1CV7A 3WCKA 3U0MA 4DXIA 4W6TA 2ZMUA 1G7KA 3EKHA 2OTEA 3SSKA 4XGYA 2A48A 4Q7RA 2FWQA 4W6KA 4NWSA 3I19A 4XOVA 5KTGA 5DRGA 2A56B 2G16B 3BXBA 4HQ9A 3O77A 5BTTA 3EVVA 3SG2A 4DXOA 1Q4DA 4PPKA 2C9IA 1BFPA 5EB7A 3SSVA 1GGXA 2DUEA 3GB3A 3P28A 4W7RA 2EMOA 3IR8A 2JADA 4DXNA 4GF6B 4W6UA 2AHAA 2PXSA 2HGYA 1KYPA 5J2OA 3OSQA 4KW8A 5DTXA 2QLHA 3CFFA 4W74A 4U2VA 3ST2A 2OKYA 5EJUA 4H47A 5LTQA 4B5YA 3UG0A 2QLIA 5LTPA 3CD9A 3GL4A 3LF3A 1XAEA 3ST0A 4Z4KA 3SSTA 1KYRA 4ORNA 1EMKA 2HQKA 3BXCA 5HZOA 2OGRA 3E5VA 3AKOA 3DQ6A 3EVUA 1Z1PA 1KP5A 4KPIA 4KF5C 3DQUA 3SVEA 3BXAA 1QXTA 4Q9XA 5EB6A 4W6MA 3EK8A 3V3DA 4LQTA 3DQ4A 3SSPA 3DQDA 5HW9A 4LJDA 3DQ1A 3EVPA 3UFZA 3PIBA 4W77A 4ZF5A 4AS8A 2DUFA 2Q57A 4AR7A 2WHTA 5F9GA 5BT0A 2DDDA 3M24A 3DQKA 4W6OA 1W7TA 3RWAA 3NT9A 4ZF4A 2VAEA 3SS0A 1QY3A 2ZO6A 4KEXA 4JEOA 3DQJA 4JGEA 2HFCA 3PJBA 5EXBA 5BQLA 4OQWA 5LTRA 4LJBA 2IE2A 2ARLA 2VADA 3DPXA 4Q9WA 3U8AA 2G3OA 3DQ9A 3SSYA 3EK4A 5LK4A 3DQ5A 4HVFA 5EBJA 1JC1A 2V4EB 4PFEA 1OXDA 4H3LA 4IK5A 4W6HA 2AWMA 4ZB1A 3LF4B 2G6EA 2RH7A 4HQCA 1JC0A 4KAGA 3ZUJA 4W7DA 4EDOA 4UTSA 4EMQA 4H48A 3LS3A 5DPGA 5BTTB 1EMGA 5DY6A 1C4FA 2H5OA 1JBZA 2DUIA 3SVBA 4N3DA 2H5RA 4W73A 3ED8A 1Z1QA 2WSOA 4ZIOA 2VVIA 1YHHA 2IB6A 3SG6A 3ZULA 2A54B 2DDCA 4W69A 3DQCA 3AI4A 4DKNA 2A47A 2AH8A 1B9CA 4W6CA 2QU1A 4P76A 2BTJA 2G6XA 4W75A 2C9JA 4LJDC 3SRYA 4W6PA 2A50B 2O29A 3CFAA 3NEDA 1EMMA 2HRSA 2GW3A 2QLGA 3IP2A 2A53B 2Y0GA 5DTLA 4GESB 3OGOA 4PPJA 1JBYA 1OXFA 4W6RA 5HGEA 4IK8A 3W1DA 3NT3A 4W7FA 2O2BA 3OSRA 2QT2A 4LW5A 3SG4A 4PPLA 5DQMA 4DXMA 3DQEA 1KYSA 1QYOA 4I2YA 3AI5A 4LJCA 4DKMA 4EDSA 5DQBA 1ZGQA 4OJ0A 3SSHA 2YE1A 4JFGA 1XQMA 4J89A 2P4MA 2Z1OA 1RM9A 2QLEA 1RMOA 5HZTA 3M22A 2Z6YA 3SVCA 3SG3A 2VVHA 2Q6PA 1Q73A 2H6VA 1HUYA 2WURA 3DQ7A 5T3IA 4B30A 4KW4A 4IK3A 4W72A 3ZTFA 2VVJA 4J88A 2H5QA 5FVFA 5DU0A 2Z6ZA 4TZGA 3VHTB 1F09A 3ADFA 3O78A 3DQFA 2EMDA 2DD7A 4W7CA 4W6JA 4HQ8A 4OGSA 1Q4EA 4W76A 5H89A 1XSSA 2OKWA 3MGFA 4Q7UA 4KA9A 4JF9A 3NF0A 3NEZA 4LQUA 5FHVA 3RWTA 1XMZA 4IK9A 1MYWA 3WLCA 3CB9A 4R6DA 1EMEA 5HBDA 3U0KA 3E5TA 2FZUA 4OY4A 2B3QA 1MOVA 3DQIA 4KW9A 1EMCA 3LVAA 2VZXA 2HJOA 5DTZA 1GL4A 4L13A 3DQHA 2WIQA 2G5ZB 1Q4BA 1H4UA 1RMPA 2POXA 3LVDA 3U0LA 4XVPA 3U8PA 3KCSA 2QRFA 2G3DB 4W7XA 4W7AA 3DPWA 2AWKA 1YHIA 3DPZA 3E5WA 3KCTA 5DRFA 3TMRA 4DXQA 4Z4MA 2GX0A 3DQAA 1YZWA 3WLDA 2V4EA 3A8SA 3GJ1A 2G2SB 2A52B 4RYWA 3ST4A 1YJFA 4IK4A 3ZUFA 4KGEA 4RYSA 4H3MA 1RMMA 1EMAA 2AWLA 5EXCI 4W7EA 1MOUA 3VK1A 2IOVA 1QYQA 3CBEA 1H6RA 3DQ3A 1QYFA 1XA9A 2H9WA 1YFPA 4JC2A 1Q4AA 2EMNA 3DQLA 2WSNA 4HE4A 3DQNA 4RTCA 5H87A 3SVRA 4ANJA 2WHSA 5EXUA 3CFHA 1YJ2A 2WISA 4Q7TA 1HCJA 3EVRA 4W6AA 4EULA 3GEXA 4XL5A 5FVGA 2OJKA 4DXPA 4L1IA 3SSLA 4ZINA 3SVUA 3BX9A 2A46A 3DQOA 3CGLA 4B30B 3SVNA 4W6FA 4IZNA 3W1CA 4P1QA 3DQMA 1OXEA 2YE0A 4W6NA 3SVOA 2O24A 5DPIA 3SG7A 3PJ5A 2FL1A 3LSAA 1YHGA 3LA1A 3DQ2A 2HQZA 4W6LA 3H1RA 3U8CA 3LVCA 2ZO7A 4W6GA 2HGDA 2DD9A 2DUHA 1RRXA 3G9AA 3U0NA 1ZGPA 4L12A 2GW4B 4BDUA 4EN1A 3S05A 2WHUA 1ZGOA 4IK1A 1EMBA 2ICRA 4ZBLA 2OTBA 1S6ZA 3GJ2A 2V4EC 3ST3A 1EMLA 4TZAA 3SV5A 4W6BA 2H5PA 4KGFA 2G6YA 2H8QA 5FVIA 2YFPA 3CD1A 5HZUA 3EKJA 3TMTA 2Z6XA 2HPWA 2ZMWA 4ZF3A 3DQ8A 2GX2A 4W6SA 5DPJA 1ZUXA 5H88A 2IB5A 3SVSA 3K1KA 3P8UA 4H3NA 2QZ0A 3H1OA 1W7UA 4W6DA 4KF4A 1W7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWJ A;  4J8A A;  5DPH A;  4GOB A;  1UIS A;  3SG5 A;  1GFL A;  3SVD A;  1F0B A;  3VHT A;  4JRB A;  1Q4C A;  5DTY A;  4W6I A;  2B3P A;  5EHU A;  2PXW A;  3VIC A;  3EK7 A;  5AQB B;  4KF5 A;  4ZFS A;  2HCG A;  4XOW A;  2DUG A;  1EMF A;  5HZS A;  3PJ7 A;  4R6B A;  4OHS A;  2QLG B;  2YDZ A;  1CV7 A;  3WCK A;  3U0M A;  4DXI A;  4W6T A;  2ZMU A;  1G7K A;  3EKH A;  2OTE A;  3SSK A;  4XGY A;  2A48 A;  4Q7R A;  2FWQ A;  4W6K A;  4NWS A;  3I19 A;  4XOV A;  5KTG A;  5DRG A;  2A56 B;  2G16 B;  3BXB A;  4HQ9 A;  3O77 A;  5BTT A;  3EVV A;  3SG2 A;  4DXO A;  1Q4D A;  4PPK A;  2C9I A;  1BFP A;  5EB7 A;  3SSV A;  1GGX A;  2DUE A;  3GB3 A;  3P28 A;  4W7R A;  2EMO A;  3IR8 A;  2JAD A;  4DXN A;  4GF6 B;  4W6U A;  2AHA A;  2PXS A;  2HGY A;  1KYP A;  5J2O A;  3OSQ A;  4KW8 A;  5DTX A;  2QLH A;  3CFF A;  4W74 A;  4U2V A;  3ST2 A;  2OKY A;  5EJU A;  4H47 A;  5LTQ A;  4B5Y A;  3UG0 A;  2QLI A;  5LTP A;  3CD9 A;  3GL4 A;  3LF3 A;  1XAE A;  3ST0 A;  4Z4K A;  3SST A;  1KYR A;  4ORN A;  1EMK A;  2HQK A;  3BXC A;  5HZO A;  2OGR A;  3E5V A;  3AKO A;  3DQ6 A;  3EVU A;  1Z1P A;  1KP5 A;  4KPI A;  4KF5 C;  3DQU A;  3SVE A;  3BXA A;  1QXT A;  4Q9X A;  5EB6 A;  4W6M A;  3EK8 A;  3V3D A;  4LQT A;  3DQ4 A;  3SSP A;  3DQD A;  5HW9 A;  4LJD A;  3DQ1 A;  3EVP A;  3UFZ A;  3PIB A;  4W77 A;  4ZF5 A;  4AS8 A;  2DUF A;  2Q57 A;  4AR7 A;  2WHT A;  5F9G A;  5BT0 A;  2DDD A;  3M24 A;  3DQK A;  4W6O A;  1W7T A;  3RWA A;  3NT9 A;  4ZF4 A;  2VAE A;  3SS0 A;  1QY3 A;  2ZO6 A;  4KEX A;  4JEO A;  3DQJ A;  4JGE A;  2HFC A;  3PJB A;  5EXB A;  5BQL A;  4OQW A;  5LTR A;  4LJB A;  2IE2 A;  2ARL A;  2VAD A;  3DPX A;  4Q9W A;  3U8A A;  2G3O A;  3DQ9 A;  3SSY A;  3EK4 A;  5LK4 A;  3DQ5 A;  4HVF A;  5EBJ A;  1JC1 A;  2V4E B;  4PFE A;  1OXD A;  4H3L A;  4IK5 A;  4W6H A;  2AWM A;  4ZB1 A;  3LF4 B;  2G6E A;  2RH7 A;  4HQC A;  1JC0 A;  4KAG A;  3ZUJ A;  4W7D A;  4EDO A;  4UTS A;  4EMQ A;  4H48 A;  3LS3 A;  5DPG A;  5BTT B;  1EMG A;  5DY6 A;  1C4F A;  2H5O A;  1JBZ A;  2DUI A;  3SVB A;  4N3D A;  2H5R A;  4W73 A;  3ED8 A;  1Z1Q A;  2WSO A;  4ZIO A;  2VVI A;  1YHH A;  2IB6 A;  3SG6 A;  3ZUL A;  2A54 B;  2DDC A;  4W69 A;  3DQC A;  3AI4 A;  4DKN A;  2A47 A;  2AH8 A;  1B9C A;  4W6C A;  2QU1 A;  4P76 A;  2BTJ A;  2G6X A;  4W75 A;  2C9J A;  4LJD C;  3SRY A;  4W6P A;  2A50 B;  2O29 A;  3CFA A;  3NED A;  1EMM A;  2HRS A;  2GW3 A;  2QLG A;  3IP2 A;  2A53 B;  2Y0G A;  5DTL A;  4GES B;  3OGO A;  4PPJ A;  1JBY A;  1OXF A;  4W6R A;  5HGE A;  4IK8 A;  3W1D A;  3NT3 A;  4W7F A;  2O2B A;  3OSR A;  2QT2 A;  4LW5 A;  3SG4 A;  4PPL A;  5DQM A;  4DXM A;  3DQE A;  1KYS A;  1QYO A;  4I2Y A;  3AI5 A;  4LJC A;  4DKM A;  4EDS A;  5DQB A;  1ZGQ A;  4OJ0 A;  3SSH A;  2YE1 A;  4JFG A;  1XQM A;  4J89 A;  2P4M A;  2Z1O A;  1RM9 A;  2QLE A;  1RMO A;  5HZT A;  3M22 A;  2Z6Y A;  3SVC A;  3SG3 A;  2VVH A;  2Q6P A;  1Q73 A;  2H6V A;  1HUY A;  2WUR A;  3DQ7 A;  5T3I A;  4B30 A;  4KW4 A;  4IK3 A;  4W72 A;  3ZTF A;  2VVJ A;  4J88 A;  2H5Q A;  5FVF A;  5DU0 A;  2Z6Z A;  4TZG A;  3VHT B;  1F09 A;  3ADF A;  3O78 A;  3DQF A;  2EMD A;  2DD7 A;  4W7C A;  4W6J A;  4HQ8 A;  4OGS A;  1Q4E A;  4W76 A;  5H89 A;  1XSS A;  2OKW A;  3MGF A;  4Q7U A;  4KA9 A;  4JF9 A;  3NF0 A;  3NEZ A;  4LQU A;  5FHV A;  3RWT A;  1XMZ A;  4IK9 A;  1MYW A;  3WLC A;  3CB9 A;  4R6D A;  1EME A;  5HBD A;  3U0K A;  3E5T A;  2FZU A;  4OY4 A;  2B3Q A;  1MOV A;  3DQI A;  4KW9 A;  1EMC A;  3LVA A;  2VZX A;  2HJO A;  5DTZ A;  1GL4 A;  4L13 A;  3DQH A;  2WIQ A;  2G5Z B;  1Q4B A;  1H4U A;  1RMP A;  2POX A;  3LVD A;  3U0L A;  4XVP A;  3U8P A;  3KCS A;  2QRF A;  2G3D B;  4W7X A;  4W7A A;  3DPW A;  2AWK A;  1YHI A;  3DPZ A;  3E5W A;  3KCT A;  5DRF A;  3TMR A;  4DXQ A;  4Z4M A;  2GX0 A;  3DQA A;  1YZW A;  3WLD A;  2V4E A;  3A8S A;  3GJ1 A;  2G2S B;  2A52 B;  4RYW A;  3ST4 A;  1YJF A;  4IK4 A;  3ZUF A;  4KGE A;  4RYS A;  4H3M A;  1RMM A;  1EMA A;  2AWL A;  5EXC I;  4W7E A;  1MOU A;  3VK1 A;  2IOV A;  1QYQ A;  3CBE A;  1H6R A;  3DQ3 A;  1QYF A;  1XA9 A;  2H9W A;  1YFP A;  4JC2 A;  1Q4A A;  2EMN A;  3DQL A;  2WSN A;  4HE4 A;  3DQN A;  4RTC A;  5H87 A;  3SVR A;  4ANJ A;  2WHS A;  5EXU A;  3CFH A;  1YJ2 A;  2WIS A;  4Q7T A;  1HCJ A;  3EVR A;  4W6A A;  4EUL A;  3GEX A;  4XL5 A;  5FVG A;  2OJK A;  4DXP A;  4L1I A;  3SSL A;  4ZIN A;  3SVU A;  3BX9 A;  2A46 A;  3DQO A;  3CGL A;  4B30 B;  3SVN A;  4W6F A;  4IZN A;  3W1C A;  4P1Q A;  3DQM A;  1OXE A;  2YE0 A;  4W6N A;  3SVO A;  2O24 A;  5DPI A;  3SG7 A;  3PJ5 A;  2FL1 A;  3LSA A;  1YHG A;  3LA1 A;  3DQ2 A;  2HQZ A;  4W6L A;  3H1R A;  3U8C A;  3LVC A;  2ZO7 A;  4W6G A;  2HGD A;  2DD9 A;  2DUH A;  1RRX A;  3G9A A;  3U0N A;  1ZGP A;  4L12 A;  2GW4 B;  4BDU A;  4EN1 A;  3S05 A;  2WHU A;  1ZGO A;  4IK1 A;  1EMB A;  2ICR A;  4ZBL A;  2OTB A;  1S6Z A;  3GJ2 A;  2V4E C;  3ST3 A;  1EML A;  4TZA A;  3SV5 A;  4W6B A;  2H5P A;  4KGF A;  2G6Y A;  2H8Q A;  5FVI A;  2YFP A;  3CD1 A;  5HZU A;  3EKJ A;  3TMT A;  2Z6X A;  2HPW A;  2ZMW A;  4ZF3 A;  3DQ8 A;  2GX2 A;  4W6S A;  5DPJ A;  1ZUX A;  5H88 A;  2IB5 A;  3SVS A;  3K1K A;  3P8U A;  4H3N A;  2QZ0 A;  3H1O A;  1W7U A;  4W6D A;  4KF4 A;  1W7S A; 
#chains in the Genus database with same CATH topology
 2AWJ A;  4J8A A;  5DPH A;  4GOB A;  1UIS A;  3SG5 A;  1GFL A;  3SVD A;  1F0B A;  3VHT A;  4JRB A;  1Q4C A;  5DTY A;  4W6I A;  2B3P A;  5EHU A;  2PXW A;  3VIC A;  3EK7 A;  5AQB B;  4KF5 A;  4ZFS A;  2HCG A;  4XOW A;  2DUG A;  1EMF A;  5HZS A;  3PJ7 A;  4R6B A;  4OHS A;  2QLG B;  2YDZ A;  1CV7 A;  3WCK A;  3U0M A;  4DXI A;  4W6T A;  2ZMU A;  1G7K A;  3EKH A;  2OTE A;  3SSK A;  4XGY A;  2A48 A;  4Q7R A;  2FWQ A;  4W6K A;  4NWS A;  3I19 A;  4XOV A;  5KTG A;  5DRG A;  2A56 B;  2G16 B;  3BXB A;  4HQ9 A;  3O77 A;  5BTT A;  3EVV A;  3SG2 A;  4DXO A;  1Q4D A;  4PPK A;  2C9I A;  1BFP A;  5EB7 A;  3SSV A;  1GGX A;  2DUE A;  3GB3 A;  3P28 A;  4W7R A;  2EMO A;  3IR8 A;  2JAD A;  4DXN A;  4GF6 B;  4W6U A;  2AHA A;  2PXS A;  2HGY A;  1KYP A;  5J2O A;  3OSQ A;  4KW8 A;  5DTX A;  2QLH A;  3CFF A;  4W74 A;  4U2V A;  3ST2 A;  2OKY A;  5EJU A;  4H47 A;  5LTQ A;  4B5Y A;  3UG0 A;  2QLI A;  5LTP A;  3CD9 A;  3GL4 A;  3LF3 A;  1XAE A;  3ST0 A;  4Z4K A;  3SST A;  1KYR A;  4ORN A;  1EMK A;  2HQK A;  3BXC A;  5HZO A;  2OGR A;  3E5V A;  3AKO A;  3DQ6 A;  3EVU A;  1Z1P A;  1KP5 A;  4KPI A;  4KF5 C;  3DQU A;  3SVE A;  3BXA A;  1QXT A;  4Q9X A;  5EB6 A;  4W6M A;  3EK8 A;  3V3D A;  4LQT A;  3DQ4 A;  3SSP A;  3DQD A;  5HW9 A;  4LJD A;  3DQ1 A;  3EVP A;  3UFZ A;  3PIB A;  4W77 A;  4ZF5 A;  4AS8 A;  2DUF A;  2Q57 A;  4AR7 A;  2WHT A;  5F9G A;  5BT0 A;  2DDD A;  3M24 A;  3DQK A;  4W6O A;  1W7T A;  3RWA A;  3NT9 A;  4ZF4 A;  2VAE A;  3SS0 A;  1QY3 A;  2ZO6 A;  4KEX A;  4JEO A;  3DQJ A;  4JGE A;  2HFC A;  3PJB A;  5EXB A;  5BQL A;  4OQW A;  5LTR A;  4LJB A;  2IE2 A;  2ARL A;  2VAD A;  3DPX A;  4Q9W A;  3U8A A;  2G3O A;  3DQ9 A;  3SSY A;  3EK4 A;  5LK4 A;  3DQ5 A;  4HVF A;  5EBJ A;  1JC1 A;  2V4E B;  4PFE A;  1OXD A;  4H3L A;  4IK5 A;  4W6H A;  2AWM A;  4ZB1 A;  3LF4 B;  2G6E A;  2RH7 A;  4HQC A;  1JC0 A;  4KAG A;  3ZUJ A;  4W7D A;  4EDO A;  4UTS A;  4EMQ A;  4H48 A;  3LS3 A;  5DPG A;  5BTT B;  1EMG A;  5DY6 A;  1C4F A;  2H5O A;  1JBZ A;  2DUI A;  3SVB A;  4N3D A;  2H5R A;  4W73 A;  3ED8 A;  1Z1Q A;  2WSO A;  4ZIO A;  2VVI A;  1YHH A;  2IB6 A;  3SG6 A;  3ZUL A;  2A54 B;  2DDC A;  4W69 A;  3DQC A;  3AI4 A;  4DKN A;  2A47 A;  2AH8 A;  1B9C A;  4W6C A;  2QU1 A;  4P76 A;  2BTJ A;  2G6X A;  4W75 A;  2C9J A;  4LJD C;  3SRY A;  4W6P A;  2A50 B;  2O29 A;  3CFA A;  3NED A;  1EMM A;  2HRS A;  2GW3 A;  2QLG A;  3IP2 A;  2A53 B;  2Y0G A;  5DTL A;  4GES B;  3OGO A;  4PPJ A;  1JBY A;  1OXF A;  4W6R A;  5HGE A;  4IK8 A;  3W1D A;  3NT3 A;  4W7F A;  2O2B A;  3OSR A;  2QT2 A;  4LW5 A;  3SG4 A;  4PPL A;  5DQM A;  4DXM A;  3DQE A;  1KYS A;  1QYO A;  4I2Y A;  3AI5 A;  4LJC A;  4DKM A;  4EDS A;  5DQB A;  1ZGQ A;  4OJ0 A;  3SSH A;  2YE1 A;  4JFG A;  1XQM A;  4J89 A;  2P4M A;  2Z1O A;  1RM9 A;  2QLE A;  1RMO A;  5HZT A;  3M22 A;  2Z6Y A;  3SVC A;  3SG3 A;  2VVH A;  2Q6P A;  1Q73 A;  2H6V A;  1HUY A;  2WUR A;  3DQ7 A;  5T3I A;  4B30 A;  4KW4 A;  4IK3 A;  4W72 A;  3ZTF A;  2VVJ A;  4J88 A;  2H5Q A;  5FVF A;  5DU0 A;  2Z6Z A;  4TZG A;  3VHT B;  1F09 A;  3ADF A;  3O78 A;  3DQF A;  2EMD A;  2DD7 A;  4W7C A;  4W6J A;  4HQ8 A;  4OGS A;  1Q4E A;  4W76 A;  5H89 A;  1XSS A;  2OKW A;  3MGF A;  4Q7U A;  4KA9 A;  4JF9 A;  3NF0 A;  3NEZ A;  4LQU A;  5FHV A;  3RWT A;  1XMZ A;  4IK9 A;  1MYW A;  3WLC A;  3CB9 A;  4R6D A;  1EME A;  5HBD A;  3U0K A;  3E5T A;  2FZU A;  4OY4 A;  2B3Q A;  1MOV A;  3DQI A;  4KW9 A;  1EMC A;  3LVA A;  2VZX A;  2HJO A;  5DTZ A;  1GL4 A;  4L13 A;  3DQH A;  2WIQ A;  2G5Z B;  1Q4B A;  1H4U A;  1RMP A;  2POX A;  3LVD A;  3U0L A;  4XVP A;  3U8P A;  3KCS A;  2QRF A;  2G3D B;  4W7X A;  4W7A A;  3DPW A;  2AWK A;  1YHI A;  3DPZ A;  3E5W A;  3KCT A;  5DRF A;  3TMR A;  4DXQ A;  4Z4M A;  2GX0 A;  3DQA A;  1YZW A;  3WLD A;  2V4E A;  3A8S A;  3GJ1 A;  2G2S B;  2A52 B;  4RYW A;  3ST4 A;  1YJF A;  4IK4 A;  3ZUF A;  4KGE A;  4RYS A;  4H3M A;  1RMM A;  1EMA A;  2AWL A;  5EXC I;  4W7E A;  1MOU A;  3VK1 A;  2IOV A;  1QYQ A;  3CBE A;  1H6R A;  3DQ3 A;  1QYF A;  1XA9 A;  2H9W A;  1YFP A;  4JC2 A;  1Q4A A;  2EMN A;  3DQL A;  2WSN A;  4HE4 A;  3DQN A;  4RTC A;  5H87 A;  3SVR A;  4ANJ A;  2WHS A;  5EXU A;  3CFH A;  1YJ2 A;  2WIS A;  4Q7T A;  1HCJ A;  3EVR A;  4W6A A;  4EUL A;  3GEX A;  4XL5 A;  5FVG A;  2OJK A;  4DXP A;  4L1I A;  3SSL A;  4ZIN A;  3SVU A;  3BX9 A;  2A46 A;  3DQO A;  3CGL A;  4B30 B;  3SVN A;  4W6F A;  4IZN A;  3W1C A;  4P1Q A;  3DQM A;  1OXE A;  2YE0 A;  4W6N A;  3SVO A;  2O24 A;  5DPI A;  3SG7 A;  3PJ5 A;  2FL1 A;  3LSA A;  1YHG A;  3LA1 A;  3DQ2 A;  2HQZ A;  4W6L A;  3H1R A;  3U8C A;  3LVC A;  2ZO7 A;  4W6G A;  2HGD A;  2DD9 A;  2DUH A;  1RRX A;  3G9A A;  3U0N A;  1ZGP A;  4L12 A;  2GW4 B;  4BDU A;  4EN1 A;  3S05 A;  2WHU A;  1ZGO A;  4IK1 A;  1EMB A;  2ICR A;  4ZBL A;  2OTB A;  1S6Z A;  3GJ2 A;  2V4E C;  3ST3 A;  1EML A;  4TZA A;  3SV5 A;  4W6B A;  2H5P A;  4KGF A;  2G6Y A;  2H8Q A;  5FVI A;  2YFP A;  3CD1 A;  5HZU A;  3EKJ A;  3TMT A;  2Z6X A;  2HPW A;  2ZMW A;  4ZF3 A;  3DQ8 A;  2GX2 A;  4W6S A;  5DPJ A;  1ZUX A;  5H88 A;  2IB5 A;  3SVS A;  3K1K A;  3P8U A;  4H3N A;  2QZ0 A;  3H1O A;  1W7U A;  4W6D A;  4KF4 A;  1W7S A; 
#chains in the Genus database with same CATH homology
 2AWJ A;  4J8A A;  5DPH A;  4GOB A;  1UIS A;  3SG5 A;  1GFL A;  3SVD A;  1F0B A;  3VHT A;  4JRB A;  1Q4C A;  5DTY A;  4W6I A;  2B3P A;  5EHU A;  2PXW A;  3VIC A;  3EK7 A;  5AQB B;  4KF5 A;  4ZFS A;  2HCG A;  4XOW A;  2DUG A;  1EMF A;  5HZS A;  3PJ7 A;  4R6B A;  4OHS A;  2QLG B;  2YDZ A;  1CV7 A;  3WCK A;  3U0M A;  4DXI A;  4W6T A;  2ZMU A;  1G7K A;  3EKH A;  2OTE A;  3SSK A;  4XGY A;  2A48 A;  4Q7R A;  2FWQ A;  4W6K A;  4NWS A;  3I19 A;  4XOV A;  5KTG A;  5DRG A;  2A56 B;  2G16 B;  3BXB A;  4HQ9 A;  3O77 A;  5BTT A;  3EVV A;  3SG2 A;  4DXO A;  1Q4D A;  4PPK A;  2C9I A;  1BFP A;  5EB7 A;  3SSV A;  1GGX A;  2DUE A;  3GB3 A;  3P28 A;  4W7R A;  2EMO A;  3IR8 A;  2JAD A;  4DXN A;  4GF6 B;  4W6U A;  2AHA A;  2PXS A;  2HGY A;  1KYP A;  5J2O A;  3OSQ A;  4KW8 A;  5DTX A;  2QLH A;  3CFF A;  4W74 A;  4U2V A;  3ST2 A;  2OKY A;  5EJU A;  4H47 A;  5LTQ A;  4B5Y A;  3UG0 A;  2QLI A;  5LTP A;  3CD9 A;  3GL4 A;  3LF3 A;  1XAE A;  3ST0 A;  4Z4K A;  3SST A;  1KYR A;  4ORN A;  1EMK A;  2HQK A;  3BXC A;  5HZO A;  2OGR A;  3E5V A;  3AKO A;  3DQ6 A;  3EVU A;  1Z1P A;  1KP5 A;  4KPI A;  4KF5 C;  3DQU A;  3SVE A;  3BXA A;  1QXT A;  4Q9X A;  5EB6 A;  4W6M A;  3EK8 A;  3V3D A;  4LQT A;  3DQ4 A;  3SSP A;  3DQD A;  5HW9 A;  4LJD A;  3DQ1 A;  3EVP A;  3UFZ A;  3PIB A;  4W77 A;  4ZF5 A;  4AS8 A;  2DUF A;  2Q57 A;  4AR7 A;  2WHT A;  5F9G A;  5BT0 A;  2DDD A;  3M24 A;  3DQK A;  4W6O A;  1W7T A;  3RWA A;  3NT9 A;  4ZF4 A;  2VAE A;  3SS0 A;  1QY3 A;  2ZO6 A;  4KEX A;  4JEO A;  3DQJ A;  4JGE A;  2HFC A;  3PJB A;  5EXB A;  5BQL A;  4OQW A;  5LTR A;  4LJB A;  2IE2 A;  2ARL A;  2VAD A;  3DPX A;  4Q9W A;  3U8A A;  2G3O A;  3DQ9 A;  3SSY A;  3EK4 A;  5LK4 A;  3DQ5 A;  4HVF A;  5EBJ A;  1JC1 A;  2V4E B;  4PFE A;  1OXD A;  4H3L A;  4IK5 A;  4W6H A;  2AWM A;  4ZB1 A;  3LF4 B;  2G6E A;  2RH7 A;  4HQC A;  1JC0 A;  4KAG A;  3ZUJ A;  4W7D A;  4EDO A;  4UTS A;  4EMQ A;  4H48 A;  3LS3 A;  5DPG A;  5BTT B;  1EMG A;  5DY6 A;  1C4F A;  2H5O A;  1JBZ A;  2DUI A;  3SVB A;  4N3D A;  2H5R A;  4W73 A;  3ED8 A;  1Z1Q A;  2WSO A;  4ZIO A;  2VVI A;  1YHH A;  2IB6 A;  3SG6 A;  3ZUL A;  2A54 B;  2DDC A;  4W69 A;  3DQC A;  3AI4 A;  4DKN A;  2A47 A;  2AH8 A;  1B9C A;  4W6C A;  2QU1 A;  4P76 A;  2BTJ A;  2G6X A;  4W75 A;  2C9J A;  4LJD C;  3SRY A;  4W6P A;  2A50 B;  2O29 A;  3CFA A;  3NED A;  1EMM A;  2HRS A;  2GW3 A;  2QLG A;  3IP2 A;  2A53 B;  2Y0G A;  5DTL A;  4GES B;  3OGO A;  4PPJ A;  1JBY A;  1OXF A;  4W6R A;  5HGE A;  4IK8 A;  3W1D A;  3NT3 A;  4W7F A;  2O2B A;  3OSR A;  2QT2 A;  4LW5 A;  3SG4 A;  4PPL A;  5DQM A;  4DXM A;  3DQE A;  1KYS A;  1QYO A;  4I2Y A;  3AI5 A;  4LJC A;  4DKM A;  4EDS A;  5DQB A;  1ZGQ A;  4OJ0 A;  3SSH A;  2YE1 A;  4JFG A;  1XQM A;  4J89 A;  2P4M A;  2Z1O A;  1RM9 A;  2QLE A;  1RMO A;  5HZT A;  3M22 A;  2Z6Y A;  3SVC A;  3SG3 A;  2VVH A;  2Q6P A;  1Q73 A;  2H6V A;  1HUY A;  2WUR A;  3DQ7 A;  5T3I A;  4B30 A;  4KW4 A;  4IK3 A;  4W72 A;  3ZTF A;  2VVJ A;  4J88 A;  2H5Q A;  5FVF A;  5DU0 A;  2Z6Z A;  4TZG A;  3VHT B;  1F09 A;  3ADF A;  3O78 A;  3DQF A;  2EMD A;  2DD7 A;  4W7C A;  4W6J A;  4HQ8 A;  4OGS A;  1Q4E A;  4W76 A;  5H89 A;  1XSS A;  2OKW A;  3MGF A;  4Q7U A;  4KA9 A;  4JF9 A;  3NF0 A;  3NEZ A;  4LQU A;  5FHV A;  3RWT A;  1XMZ A;  4IK9 A;  1MYW A;  3WLC A;  3CB9 A;  4R6D A;  1EME A;  5HBD A;  3U0K A;  3E5T A;  2FZU A;  4OY4 A;  2B3Q A;  1MOV A;  3DQI A;  4KW9 A;  1EMC A;  3LVA A;  2VZX A;  2HJO A;  5DTZ A;  1GL4 A;  4L13 A;  3DQH A;  2WIQ A;  2G5Z B;  1Q4B A;  1H4U A;  1RMP A;  2POX A;  3LVD A;  3U0L A;  4XVP A;  3U8P A;  3KCS A;  2QRF A;  2G3D B;  4W7X A;  4W7A A;  3DPW A;  2AWK A;  1YHI A;  3DPZ A;  3E5W A;  3KCT A;  5DRF A;  3TMR A;  4DXQ A;  4Z4M A;  2GX0 A;  3DQA A;  1YZW A;  3WLD A;  2V4E A;  3A8S A;  3GJ1 A;  2G2S B;  2A52 B;  4RYW A;  3ST4 A;  1YJF A;  4IK4 A;  3ZUF A;  4KGE A;  4RYS A;  4H3M A;  1RMM A;  1EMA A;  2AWL A;  5EXC I;  4W7E A;  1MOU A;  3VK1 A;  2IOV A;  1QYQ A;  3CBE A;  1H6R A;  3DQ3 A;  1QYF A;  1XA9 A;  2H9W A;  1YFP A;  4JC2 A;  1Q4A A;  2EMN A;  3DQL A;  2WSN A;  4HE4 A;  3DQN A;  4RTC A;  5H87 A;  3SVR A;  4ANJ A;  2WHS A;  5EXU A;  3CFH A;  1YJ2 A;  2WIS A;  4Q7T A;  1HCJ A;  3EVR A;  4W6A A;  4EUL A;  3GEX A;  4XL5 A;  5FVG A;  2OJK A;  4DXP A;  4L1I A;  3SSL A;  4ZIN A;  3SVU A;  3BX9 A;  2A46 A;  3DQO A;  3CGL A;  4B30 B;  3SVN A;  4W6F A;  4IZN A;  3W1C A;  4P1Q A;  3DQM A;  1OXE A;  2YE0 A;  4W6N A;  3SVO A;  2O24 A;  5DPI A;  3SG7 A;  3PJ5 A;  2FL1 A;  3LSA A;  1YHG A;  3LA1 A;  3DQ2 A;  2HQZ A;  4W6L A;  3H1R A;  3U8C A;  3LVC A;  2ZO7 A;  4W6G A;  2HGD A;  2DD9 A;  2DUH A;  1RRX A;  3G9A A;  3U0N A;  1ZGP A;  4L12 A;  2GW4 B;  4BDU A;  4EN1 A;  3S05 A;  2WHU A;  1ZGO A;  4IK1 A;  1EMB A;  2ICR A;  4ZBL A;  2OTB A;  1S6Z A;  3GJ2 A;  2V4E C;  3ST3 A;  1EML A;  4TZA A;  3SV5 A;  4W6B A;  2H5P A;  4KGF A;  2G6Y A;  2H8Q A;  5FVI A;  2YFP A;  3CD1 A;  5HZU A;  3EKJ A;  3TMT A;  2Z6X A;  2HPW A;  2ZMW A;  4ZF3 A;  3DQ8 A;  2GX2 A;  4W6S A;  5DPJ A;  1ZUX A;  5H88 A;  2IB5 A;  3SVS A;  3K1K A;  3P8U A;  4H3N A;  2QZ0 A;  3H1O A;  1W7U A;  4W6D A;  4KF4 A;  1W7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...