2QM1A

Crystal structure of glucokinase from enterococcus faecalis
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
324
structure length
324
Chain Sequence
SNAMDKKIIGIDLGGTTIKFAILTTDGVVQQKWSIETNILEDGKHIVPSIIESIRHRIDLYNMKKEDFVGIGMGTPGSVDIEKGTVVGAYNLNWTTVQPVKEQIESALGIPFALDNDANVAALGERWKGAGENNPDVIFITLGTGVGGGIVAAGKLLHGVAGCAGEVGHVTVDPNGFDCTCGKRGCLETVSSATGVVRVARHLSEEFAGDSELKQAIDDGQDVSSKDVFEFAEKGDHFALMVVDRVCFYLGLATGNLGNTLNPDSVVIGGGVSAAGEFLRSRVEKYFQEFTFPQVRNSTKIKLAELGNEAGVIGAASLALQFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucokinase
publication title Crystal Structure of Glucokinase from Enterococcus faecalis.
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 104
structure length 324
sequence length 324
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2qm1A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2qm1A02
1H1VA 1HUXA 4JD2B 3CI5A 4JN4A 4BROA 5BR9A 1KAYA 1IG8A 1QQOA 3O80A 2FLOA 4KBOA 1XUPO 2QWMA 3GL1A 3DXMA 5AQHA 3UKRA 2QW9A 3CJ1A 3QICA 4B1YB 1R59O 2FSJA 4BRHA 4H5NA 2A42A 2P9KA 5I9EB 4QS7A 4A2AA 3MMVA 5FPEA 1ATSA 1OKJA 5FPNA 3W0LA 4CBWA 1QQMA 2ZWHA 4PL7A 1QHAA 3KVGA 4IO8A 3MN6A 5ELZA 2FSNA 1X3MA 3ZEUA 1MWMA 5B8HA 3CQYA 2P9UB 2ASMA 1TYQB 2A40A 4H0PA 3JXUA 4BGAA 1J6ZA 2IVPA 4O8KA 3RSEB 2Q0RA 1ATNA 4B1ZA 1NGGA 2P9NA 1LCUA 2ZF5O 4FOIA 5BN8A 4BQZA 3P4IA 5AQWA 1BG3A 3ZX2A 1XQSC 3VENA 1S22A 4JD2A 1G99A 1JCFA 2Q0UA 2UYTA 4HWIA 5FPMA 4I6MA 4QS9A 5AQPA 5EXWA 1QZ6A 3VGKA 1NM1A 3LDLA 3WQUA 3H1QA 3LL3A 2P9LB 3A5OC 2CGJA 1Z6RA 3U9ZA 5AQUA 4A62A 3CJBA 3O8MA 5BRDA 1HPMA 4ISGA 4CZLA 2FF3B 3SMPA 1NGCA 2VCPA 4M7XA 3QDKA 4CI6A 2D4WA 2E1YA 1GLCG 4FWNA 3CHWA 1XC3A 1E4GT 5BREA 3A5MC 5AFUH 1NGDA 3DAWA 4EHUA 2P9UA 3LDQA 4BRKA 2HOEA 1TUYA 2F9TA 4BGBA 1TYQA 3QB0A 3FFKB 2Q1NA 2QM1A 5AQTA 4YDUC 4BRLA 3RSEA 3H1VX 4BC5A 3ZX3A 1JCGA 4FPBA 3A5NC 1BDGA 2BUPA 3QFUA 3VEOA 4BQLA 3EKSA 3H3NO 1NGEA 5AZIB 3SJHA 3VEVA 2IIRA 3FE1A 4PL8A 4DQ8A 1U2VB 2P9IB 1RGIA 3M6GA 3TU5A 3ATUA 3VGMA 2GEMA 1BU6O 3LDNA 2I7NA 3EN9A 3VEZA 3HTVA 3C7NB 3TPQA 3WXIA 2P9LA 1HX1A 1HJOA 3VEWA 1SZ2A 5JLFA 4H0TB 2YI1A 3WT0A 3ULEA 3VF2A 3GE1A 2A6AA 2EWSA 4FWQA 1GLDG 2FXUA 4FPAA 3UB5A 3FZHA 3LDPA 5AQIA 1BA0A 5AQNA 3GBTA 3IFRA 5FPDA 4FWOA 3WQTA 1NGAA 4BRCA 3GOIA 5AQFA 2NRHA 4Z94A 2CGLA 2V7YA 4B1VA 5LJVA 1RDWX 4H5WA 2H3GX 1BWFO 4BR0A 1MDUB 2AA4A 3DJCA 4FWLA 3UE5A 3CETA 2GELA 3ATVA 3J8AA 2HF3A 2V51B 3O6WA 3A0IX 5AZIA 4ISEA 1U6ZA 3W3DA 2V7ZA 1DGKN 1BOTO 3O08A 4PKHA 4YDUA 2V52B 2P9IA 3KHYA 3EZWA 5EVZA 3UKUB 1NGBA 2FSKA 1YUWA 3OHRA 3QBXA 2I7PA 3FGUA 2AP1A 4XEIA 3R8EA 4B9QA 2YHWA 4CZJA 2PAVA 3C7NA 4C23A 2QWLA 4H0XB 4BR7A 1V4SA 5KQDA 3GG4A 5AQRA 3VEXA 4H0OA 4CZHA 3FZMA 4CZMA 3ZETB 4J8FA 5JLHA 1NGFA 4H0YB 4IWVA 3HZ6A 1HKCA 5EOYA 4BRDA 5F2RA 1T44A 4FWSA 5ADXH 3FLCO 2E8AA 1NBWA 2OANA 2D1KA 1E4FT 1HLUA 1V4TA 3L6QA 4WQ5C 4M63C 5LJWA 3QBWA 4K42A 3FR0A 1ZXOA 3L0QA 1P8ZA 3AY9A 3VESA 3CERA 4JAXA 1NMDA 4BRAA 5AQOA 1SAZA 2E1ZA 3MDQA 4MO4A 2ASOA 4B1WB 2YJEA 4K41A 1GLJO 2D0PA 2GTDA 3BUZB 3BF3A 3WXKA 1SQKA 3D2EB 3VGLA 4LC9B 1HKBA 4BG9A 3UKUA 2A3ZA 2HMPA 3BF1A 4F9OA 3DXKB 3AAQA 5AQZA 2ITMA 4IJAA 5ADXA 2IVOA 5AZJB 5AQSA 3SMSA 4FWPA 5AQYA 5BN9A 4B1UB 3LDOA 3EKUA 3JS6A 3VETA 4BRIA 4BRPA 5JMVA 5KPTA 3G25A 1QZ5A 4XH4A 3ZETA 4IXCA 2QXLA 3D7EO 4BC2A 5CE3A 1NGIA 5KPZA 2NZTA 1WUAA 4WQ4C 4CZIA 5BRHA 3DWLA 2W40A 3KZBA 2E2QA 3CJ9A 2GWJA 4MLEA 3ENHA 1GLBG 2QWRA 3WUHA 4CBXA 1Q18A 2IVNA 4NB4A 4EHTA 3BEXA 2P9PB 2E88A 4IJNA 4CJ7A 1BO5O 5AQMA 4PKIA 2YHYA 2YCHA 4H5VA 4FWKA 5AQJA 1X9JA 4K43A 5KPRA 3D2FB 3D2EA 1S3XA 3C0BA 4MLHA 1YVNA 4FOEA 3DXKA 1GLFO 2Q97A 3MK6A 3WXLA 4BRQA 4CZGA 3LM9A 4Y0WA 3ID8A 2CH6A 3VF6A 5AZJA 3ZEUB 3SK3A 2D0OA 5JICA 4O5FA 4BR9A 4BRFA 3CJ7A 3O5BA 3VOVA 2GWKA 1JCEA 5AQLA 5BPLA 2E2OA 3H3OB 4BVPA 2VWBA 4A61A 3R6MA 2QWNA 1TUUA 2DPNA 2YJFA 1Y64A 2ASPA 2E20A 5TKYA 2E2PA 2VYPA 4IZ9A 5BRFA 5KQ8A 1D4XA 1K8KB 1U2VA 3I33A 3MN5A 3ZX0A 5AQXA 4CD3A 4XH5A 1ZBSA 4I6MB 3A8YA 2P9PA 4E1JA 4PKGA 4WQ4A 4BVOA 4JHDB 2E2NA 3HSCA 3VEYA 4CD1A 4FO0A 4EFHA 3M3ZA 1C0FA 2QWQA 2KHOA 5BPNA 3IUCA 2Q31A 1KAZA 3D2FA 2P9SB 3GDQA 3CIPA 1MWKA 4RCHA 5EY4A 3MCPA 3R9PA 1C0GA 4M7YA 1WOQA 3AARA 1DKGD 1NGHA 3ENOA 4EAHD 4BRMA 5BPMA 3U4LA 1YAGA 4H03B 3U8XA 3EL2A 2A41A 2QWPA 1GLAG 4NO7A 5AQVA 3O1BA 1ATRA 1RFQA 3CJCA 1YXQA 4BR2A 3HBTA 4BC4A 2J4RA 2CH5A 3F9MA 4K25A 1GLLO 3I8BA 4FL9A 4CZFA 2FF6A 4CBUA 3B8AX 3L4IA 3MN7A 1K8KA 3CQXA 5AQGA 5E26A 3IMXA 4HTLA 1EQYA 3WXJA 4A2BA 4L3QA 3M1FA 5LY3A 4BC3A 4JHDA 2Q36A 3WEEB 3O4WA 4DB3A 1Z05A 1X3NA 3ULEB 3EO3A 2BTFA 2P9SA 4GNIA 4XH1A 1ZC6A 5AQKA 3FZKA 4ISFA 3QMLA 4AM7A 4BG8A 1HKGA 1T6CA 5EX5A 5F0XA 4RWTA 1IJJA 4MO5A 4CZKA 3MN9A 3VERA 3VPZA 2HF4A 1NLVA 4CZEA 3IDHA 2CGKA 5AQQA 2NLXA 2QWOA 4RTFD 1LOTB 3AAPA 2Q2RA 2YHXA 3DXMB 3HM8A 2GUPA 3LM2A 3UKRB 1ESVA 2ZGYA 3FZLA 5AR0A 4DHYA 1BUPA 1DEJA 3H46O 4FWMA 4BR5A 5E84A 2WUSA 1KXPA 4WQ5A 3U9DA 2PBDA 4FSVA 3O1WA 4JNEA 4AM6A 1GLEG 2P9KB 1CZAN 4B1XB 3A5LC 1NWKA 4QS8A 2ZGZA 4BRNA 2W41A 3H6EA 4GY2B 1KAXA 1MA9B 4BR4A 3CJAA 3HI0A 4FWRA 4H5TA 3S41A 3H45C 4H5RA 2F9WA 1BA1A 4H0VB 4BREA 3QFPA 3WEEA 5AFUA 4BRGA 1T6DA 2A5XA 3FZFA 1QQNA 3VF4A 3SLCA 2P9NB 4DCHA 1NGJA 5F1XA 3BP8A 4WYBA 4EIAA
chains in the Genus database with same CATH superfamily
4M3WA 4FW1A 2G8IA 4BROA 4CGFA 1QQOA 5KI6A 2FLOA 1XUPO 4BE1A 3IAYA 3HL8A 5AQHA 3C6TA 4JS5A 3F2KA 3QICA 4JV5K 1WNSA 3BZCA 3CM5A 3MCAB 2KZZA 1IKYA 3MMVA 1ATSA 4YHHK 2HHXA 1A5VA 1YITN 4XIUA 3CPWM 2ZWHA 3V9UA 4PL7A 1QHAA 3KVGA 3AVJA 4G9ZA 1LAWA 3OYAA 3HOSA 1UAXA 2P9UB 4JKEA 1TYQB 2A40A 3T1AA 3KK3A 3CCVN 2UUBK 2P1JA 3NMUA 1ZYQA 1VQPN 3P4IA 5AQWA 1VQLN 1LV5A 1S22A 4FK4A 4JKHA 1VSFA 1VQMN 2UYTA 2Z1IA 4DV7K 2IC3A 3F5TA 5J2NA 2G8UA 3ZT3A 1QZ6A 3THXB 1YJWN 3LDLA 3WQUA 3H1QA 2O4IA 3TAFA 4M42A 5AQUA 4JKBA 5GAGP 3CJBA 3O8MA 3CCSN 5BRDA 3PSIA 1HPMA 4KTZA 4M45A 2FF3B 3U3GA 2VG7A 2VCPA 1VQON 3NH0A 1L5UA 1GLCG 4CJRA 4FWNA 5J1EA 1E4GT 1OVYA 4FW2A 2W42A 2HOEA 3NF6A 3RMDA 1TUYA 2F9TA 4NXNK 4CF1A 2Q1NA 4B9LA 5IWAK 1ZBIA 2JLEA 3S3NA 3H1VX 1S5JA 3CCQN 5C42A 4BC5A 2HHQA 1CLQA 1Q7YO 3A5NC 3P39A 5CYMA 3DLRA 3QFUA 4CJFA 3CFOA 3SJHA 4JKGA 3OTOK 4I2QA 1VAZA 1HR0K 2PYLA 4AHUA 2QXFA 3M6GA 3K5OA 3LDNA 4C1NK 2ZJQL 1Q86O 3EN9A 2X74A 3WXIA 1N8RO 4LY7A 1HX1A 4H0TB 1BI4B 4DTNA 4AHCA 2A6AA 4O0JA 1GLDG 2VWKA 4IKFA 2X6NA 2D0AA 5AQNA 2Y1JA 4FWOA 5AQFA 2NRHA 3V9XA 1BCMA 1J53A 2BE2A 4CGHA 3C95A 4Z4HA 1IO2A 4LFCK 4CIGA 1BISA 1N32K 1O13A 3CETA 3L2WA 2YNGA 5AZIA 2V51B 3S9HA 4QCLA 2RF2A 4JI2K 1DGKN 2V52B 3KHYA 3EZWA 4WFBL 3OHRA 1YUWA 4R79A 1HNVA 3PX6A 3N4QA 1KVBA 2AP1A 4EP4A 2YHWA 5GAEP 4H0XB 3G0ZA 1C1CA 2ITGA 4BR7A 3OJSA 4AILC 3VEXA 4H0OA 4E1NA 3VA0A 4F2SA 2RPIA 4DLGA 4CZMA 2ATQA 4IWVA 4Q5VA 3SPYA 4BRDA 3OYFA 1XMOK 3ZSOA 4LFBK 4FWSA 2E8AA 4FM0A 4DR1K 5C0YA 1VQ7N 1V4TA 3L6QA 4IFEA 1R0AA 4DTXA 1CXUA 3FR0A 4IEIA 4JS4A 4JI3K 3OA9A 1P8ZA 1S1TA 1O1WA 1W97L 4JAXA 1X9SA 4BRAA 5AQOA 3HM9A 4MO4A 3NFAA 4AHSA 3TABA 4HUEA 3BY5A 2D0PA 3BUZB 3OBWA 4MDAA 3WXKA 4PQUA 4LC9B 3UKUA 3AVKA 3S3OA 5DM6L 2HMPA 1SV5A 5AQZA 2ITMA 3ASMA 3RR7A 5ADXA 3SMSA 5MLCQ 3TAQA 4DR6K 3LDOA 3T7ZA 3VETA 3LZJA 3KTQA 3VQQA 1L3UA 4FJ9A 3ZETA 4IXCA 1J54A 3S3MA 1OH5A 2YV0X 3HVRA 2IOCA 2QK9A 1NGIA 4OPKA 1NK9A 4B9MA 1RBRA 4CZIA 4O8UA 3OVNA 3NVKA 1WN7A 2E2QA 1VQ8N 1YTUA 4JEPA 3ENHA 1WAFA 2HHUA 1N36K 3WUHA 4M3ZA 1KFDA 4W5QA 1IBLK 2A1RA 4EHTA 1P90A 4ILHA 3K58A 2P9PB 1VSHA 1BO5O 2Q3SA 2KW4A 2WONA 2YCHA 5CY4A 1JLGA 2RN2A 5KPRA 1L3TA 4FYDA 1S1WA 3KLEA 3D2EA 2WOMA 1WSIA 3AVBA 2W6KA 3DXKA 2Q97A 3MK6A 4FOEA 3ZSVA 2E6LA 5TKWA 4C1NI 3VF6A 5AZJA 5GIPA 4DUZK 1TK0A 2D0OA 4OJRA 4KH5A 5JICA 4O5FA 3C6AA 4BRFA 5A2QO 3RRHA 3CJ7A 4YOXA 2HB5A 5BPLA 4EP5A 3H3OB 1CZBA 2VWBA 4CEFA 1KLNA 4A61A 3CG7A 2QWNA 3JSMA 1A5XA 3HP6A 1TUUA 3OJUA 3IS9A 3HPHA 1SKRA 4FJMA 5BRFA 3O3GA 4GVMA 1ASUA 1U2VA 4QOZB 1YT3A 3ZX0A 4DTJA 5AQXA 1XHXA 1X9MA 4I6MB 4CHOA 1SS6A 3C6HA 1SL2A 3E01A 1LWEA 2E2NA 3HSCA 3VEYA 3SI6A 1HNZK 4DSFA 1VQ4N 1NNEA 5IT9O 1W0HA 4PHTX 3RTVA 2PZSA 4W5NA 3SCXA 1IH7A 4CEQA 1KAZA 1B9DA 4DR5K 4CJ3A 1NKEA 4ZTJA 1S1XA 1SKWA 2O8FB 4DUYK 4M7YA 1GOCA 3ENOA 3OYLA 3MXJA 4HTUA 1WB9A 4FK2A 5GIOA 3TR8A 3K5LA 3HBTA 3AVMA 3SNNA 3DLEA 4DV0K 5FLXO 1BQMA 3TSUA 3F9KA 4DSEA 3QEPA 4IOCL 1G15A 1WLJA 4CJVA 3L4IA 1YIJN 2B5JA 3CQXA 4DTUA 3VQ9A 3CCLN 3IMXA 2F4VK 1KTQA 4A2BA 1IBMK 4JHDA 4M3UA 1TGOA 3OS1A 4V19S 3P1GA 3VQPA 3VQ8A 1GOAA 3I0RA 3WEEB 4LFAK 2HBKA 1X3NA 2JWLA 3TTFA 3OS0A 3THVA 4B9NA 2P9SA 4KHPK 5AQKA 3RVCA 4J2AA 5F0XA 3VERA 1IG9A 3VPZA 1NLVA 3IDHA 2VG6A 2CGKA 3ISNC 4DFPA 4RTFD 2IS3A 1LOTB 3ENBA 3DXMB 1N5YA 3PIOL 3LM2A 3UKRB 1ESVA 5AR0A 1BUPA 4FWMA 1M1KO 5E84A 4YOVA 5I3UA 5M1NA 4WQ5A 1KFSA 2O8DB 4FSVA 1K6YA 4JNEA 2P9KB 3O9TA 4QS8A 4GW6A 4FLYA 2ZGZA 2BH1A 5K14A 1KAXA 4DV5K 1WSFA 1T8EA 4OGCA 1TK8A 2O8EA 3H45C 1KD1O 4H5RA 3BDPA 3TTDA 4B08A 4E7KA 1OVQA 4JI1K 4BREA 4IOAL 2YKNA 2QTDA 4KHQA 1BIUA 3O9UA 4BRGA 2A5XA 1QQNA 5M1PA 2G8HA 4WYBA 4EIAA 1H1VA 3DRRA 2G8KA 4N76A 1U47A 4JN4A 5BR9A 4C8MA 1KAYA 4KBOA 2UU9K 3CCEN 4OPAA 3WNEA 2QA4N 3VQ5A 2VGNA 2QW9A 3TAGA 3E66A 1LWFA 1ZBLA 3SQ1A 3AGRA 4CJWA 3KK2A 3PUFA 4C8LA 2PYJA 4H5NA 3R3LA 2A42A 3EEQA 4QS7A 4A2AA 5I9EB 5FPEA 3HK2A 4ICLA 1S6PA 4IO8A 1VRTA 2ZM6K 1JKHA 3LANA 3ZEUA 4EZ6A 1MWMA 3LP1A 4H8KA 5CHIA 4CGGA 4H0PA 3JXUA 4BGAA 3HO1A 2E4LA 3RSEB 2ZE2A 3CCMN 2ZJPL 3EY1A 2P9NA 4FZYA 4BQZA 1BG3A 3ZX2A 3OYEA 1XQSC 3NCIA 4BDPA 1JLEA 4FZZA 3I55N 3SUPA 2Q0UA 1IKWA 3AA2A 3NGYA 3J81O 4DU3A 3VGKA 5C2DA 4CEBA 2NRRA 3LL3A 2CGJA 1Z6RA 3DLGA 4CK3A 3OYBA 2IDOA 1K9MO 4YOWA 5HOOA 5T7BA 3QDKA 3E1YA 1QHTA 2D4WA 2E1YA 3TI0A 4E3SA 3DLLL 2P9UA 4IO9L 4CJ4A 1TYQA 3N4PA 4DMNA 3OYIA 4DTMA 1DTQA 2QM1A 5AQTA 2FBTA 1S6QA 4FJIA 4O4GA 2OPQA 3ZX3A 4DWIA 3SAGA 1BDGA 4CFDA 4FJNA 2BUPA 1C1BA 3EKSA 3LWMA 3VEVA 4JI6K 4DFMA 4CGDA 3G71N 3FE1A 4DQ8A 2P9IB 3NAEA 1RGIA 4RW9A 3VGMA 2GEMA 3IKMA 3OYCA 3THXA 1RCHA 3ZSQA 3VQAA 3C7NB 2KQ2A 4CFCA 2EX3A 5JLFA 1SZ2A 2YI1A 1BIZA 2FBXA 3WT0A 3GE1A 2EWSA 3DRPA 1XNRK 3RMAA 4LD0A 5AQIA 1XNQK 4O5BA 3CF5L 4OKJA 2Z1JA 3K9KA 3ZSRA 4Z94A 1EXQA 2WC9A 3VQ6A 2CGLA 1Y97A 4HCCA 1U48A 4B3OA 2V7YA 4B1VA 3RWUA 5LJVA 3DOKA 4FJ7A 4KTWA 4H5WA 4Z4EA 1KSPA 1OH7A 5J2QA 2GBZA 4N47A 2G8WA 3LP3A 3J8AA 4CFBA 3A0IX 4ISEA 3W3DA 4Z4CA 3H08A 1BOTO 1QE1A 3KLHA 3KIOA 4DR3K 3AVFA 3NF9A 4XEIA 5HRPA 3R8EA 3SV4A 5FROA 4O55A 1UWBA 4B9QA 4B3TK 2P5GA 2QWLA 4KTQA 1V4SA 2DFEA 1IBKK 3ZSZA 1BI4A 3FZMA 5M1KA 4KRFA 3O3HA 2GUIA 3K5NA 5EOYA 3HYFA 1NU0A 5F2RA 1T44A 2OCEA 2OTLN 2D1KA 1NJYA 4NCAA 1HLUA 5HROA 4L8RB 4Z4GA 2HNDA 1EETA 1RTIA 1ZXOA 3L0QA 2X78A 3LALA 1NMDA 3SQ2A 1K8AO 2E1ZA 1UA0A 1C6VA 3MDQA 3M8RA 4HUFA 4B1WB 4M3YA 3NBPA 1WSHA 4CESA 1VQ5N 2HHSA 2A3ZA 5DMRA 4F9OA 4OLBA 3AVHA 5D3GA 4B9VA 5FDLA 2XO7A 4B1UB 3JS6A 2BANA 4BRPA 5JMVA 1VSKA 3KWGA 3HJFA 3NH2A 4LF4K 4IOXA 4KHWA 2XRIA 5LMNK 2QXLA 1FKOA 1RT5A 2IAJA 2HNYA 1GOBA 3QIOA 1RT7A 3TAEA 4BDYA 4WQ4C 3KLGA 2ZJRL 3DWLA 2W40A 2RE2A 4OVLA 1JLFA 4K0KK 5C2FA 4K8ZA 2QWRA 3SAHA 3THYB 2KTQA 4NB4A 3BEXA 1I94K 1OH8A 1RTHA 2E88A 4IJNA 4BACA 2VG5A 2VQFK 1XMQK 3MXMA 3MEDA 4FWKA 1X9JA 4FJLA 3CC2N 1HYVA 1NK7A 5JS2A 1DTTA 1ASWA 3WXLA 2CH6A 1VRUA 4DV4K 3EZ5A 2O8CB 5HBMA 4BR9A 3LPUA 1IV0A 3O5BA 1NK6A 1HQEA 3O3FA 3KD5E 1DT9A 3Q7CA 4WE1A 4FXDA 3ALYA 1TVRA 1RT2A 1Y64A 2E20A 4C8KA 1TAUA 3NF7A 5KQ8A 1D4XA 4GV9A 1K8KB 4IFYA 3MECA 3MN5A 4CIFA 4XH5A 2OZSA 4N56A 5FRMA 3UIQA 4ID1A 2P9PA 4WQ4A 4PKGA 4BVOA 2W6LA 5GINA 4YY3K 4OPHA 1C0FA 2O8BA 3IUCA 2G8FA 2Q31A 1RDCA 4YOTA 4B9TA 4FLWA 3C6UA 2GV9A 3CIPA 4RCHA 1TAQA 2AJQA 2HBLA 4PUOA 1NK4A 1WOQA 1NGHA 4H4OA 4BRMA 5BPMA 1D8YA 3U4LA 3AO2A 3EL2A 1GLAG 5AQVA 3G4SN 3CJCA 1YXQA 4CHPA 1S1VA 2J4RA 3F9MA 3M8SA 1WBBA 3J7ZO 3HVTA 2O4GA 3CM6A 3NVMA 1HQUA 4OKEA 3CYMA 3OYMA 4FL9A 4YOYA 1IKXA 5H1SQ 5DK5A 1XI1A 1JLQA 4CZFA 4CBUA 4CJQA 1TKZA 3HPGA 4CEDA 4DS5A 5AQGA 5DM7L 3SJJA 3SBGA 2OTJN 4JI4K 1T3VA 1NOZA 3D0PA 4L3QA 3ZCMA 3M1FA 4BC3A 2E6MA 3CCRN 4A5AA 3MAQA 2FBVA 2OPRA 4O0IA 2Q36A 5HRNA 4CEZA 3IRXA 3DLBA 3V4IA 2O8FA 4ISFA 4FZXC 4AM7A 4RWTA 1HKGA 4CHQA 2NRTA 3P38A 3SBTA 4U7BA 5AQQA 4E1MA 2OA8A 2QWOA 3HM8A 5CR4A 1LW0A 2YKMA 2ZGYA 4U67L 3DOLA 1TKDA 1DEJA 3WNGA 3QERA 1ITGA 1N33K 3CMEN 2PBDA 2HSTA 4B1XB 1D9FA 1JLAA 4I9LA 3H6EA 3KKSA 3NF8A 3VQ7A 4FWRA 1EP4A 3HRGA 4H5TA 4IG3A 5JVHL 3EE9A 5FRNA 2DY4A 3IG1A 4IDHA 3I0SA 1QSSA 4Z0UA 1WSJA 3DLKA 4JI0K 1YTAA 3WEEA 1VSEA 4KHYA 1T6DA 3KLIA 3F73A 1D5AA 4JD2B 3CI5A 3PIPL 3EYZA 4DR4K 3O80A 1U49A 1JJ2M 2QWMA 4CK2A 3GL1A 3QNOA 3CCJN 1T03A 3DXMA 3TSQA 3UKRA 3V9ZA 1Q81O 3CJ1A 1HNIA 1OH6A 4RW4A 4B8AB 4DSKA 1R59O 2FSJA 3QETA 4BRHA 2O8DA 4KHUA 2P9KA 3T1HK 1RT1A 2HMIA 3NDKA 1OKJA 3W0LA 1QQMA 3V1QA 3MN6A 3PSFA 3HP9A 3I8DA 2FSNA 3R1XA 5C24A 4WF9L 1CXQA 2ASMA 3OW2M 4FM1A 1ZBFA 4O8KA 1RBSA 5E41A 3K59A 4X64K 4CGIA 2Q0RA 4B1ZA 3M8QA 2ZF5O 4FOIA 1HNWK 4W5OA 3TAPA 4YORA 3NGIA 4GVEA 5GAHP 4HHTA 1TK5A 2HHWA 5FPMA 4QS9A 5AQPA 5EXWA 4X66K 1LW2A 1RDBA 1NM1A 3RR8A 5M1FA 2EHGA 2P9LB 3A5OC 2NRZA 1SL1A 3U9ZA 3J7AP 3SQ4A 4FLZA 3ITHA 1WAJA 4KB1A 4DSIA 5KRTA 1FKPA 4M7XA 2JGUA 3FFIA 2D0BA 4AH9A 3CD6N 3CHWA 3A5MC 5AFUH 3DAWA 4EHUA 4BRKA 3AO4A 1QQCA 3QB0A 1RNHA 3FFKB 4DV2K 1F21A 2XY5A 4YDUC 2P5OA 4HCBA 3RSEA 4CIEA 1NJZA 2YNHA 4OKKA 2HVIA 3VEOA 4BQLA 3H3NO 1NGEA 4ELUA 1XHZA 1KVCA 4PL8A 1U2VB 1EWRA 3TU5A 4CCHA 3ATUA 3E9PA 1BU6O 1U04A 3WXMB 2UXCK 3AO5A 3VEZA 3BGRA 3M5RA 3TPQA 4OO1J 4NCBA 1JL2A 4JKDA 1YF5L 3QIPA 3ULEA 3ULDA 1KLMA 4FWQA 5JS1A 2FXUA 2OYQA 5C12A 4FPAA 4NCGA 4BWMA 4JRQA 3LDPA 1BA0A 4DR7K 1BGXT 3GBTA 3AA4A 1NGAA 4BRCA 3GOIA 4DFKA 3LAKA 4KHSA 3TSPA 5C15A 3QEVA 3E9OA 3LAMA 3OY9A 1U4BA 1RDWX 3THWB 2H3GX 3L8BA 1BWFO 4FLVA 2KLAA 2WBNA 4FJGA 4FK0A 4IDKA 3ATVA 3ZT4A 1VSJA 2HF3A 4DF8A 1U6ZA 2QKKA 4JI7K 4PKHA 4YDUA 2OZMA 2P9IA 2ZD1A 1NGBA 4A57A 2BGGA 4JRPA 1BCOA 4CHNA 3HT3A 2KKZA 3B6OA 2I7PA 3AO1A 4CZJA 2PAVA 3C7NA 4DQPA 3AVIA 3AVNA 5KQDA 4LF8K 5AQRA 2XY7A 4CZHA 3U6FA 1ZBUA 1RBUA 1NKBA 5JLHA 1NGFA 4JKCA 3QLHA 2R7YA 4OLAA 3OBYA 3VA3A 5ADXH 1UOCA 1NBWA 2KFZA 1FK9A 4WFAL 3O9SA 1E4FT 4K8XA 3NHGA 1SUQA 3J7YP 4M63C 3QBWA 4K42A 4CEEA 4CF9A 4BDZA 3NH1A 3VESA 3CERA 5SZTA 4FJHA 1REVA 1Z26A 4JI5K 3AVLA 4E7HA 3HOTA 4CHYA 5SWMA 3AVGA 3QESA 4J2EA 4B8CA 3T3FA 3BF3A 4NXMK 2YHBA 3BF1A 4H4MA 3AAQA 1MU2A 4GKKK 2NNWA 3KJVA 5AQSA 1VQNN 3K5MA 5AQYA 4PA1A 3T1YK 2F7TA 4DSJA 3G25A 1QZ5A 3MWTA 4BC2A 3CFRA 2FC0A 1Q8IA 4RG8A 5KPZA 4DS4A 1WUAA 5BRHA 3CJ9A 2LSNA 4ILGB 4MLEA 1GLBG 3DLHA 4R5PA 3V1RA 4CF8A 1B92A 1Q18A 4CBXA 4GV6A 1KC8O 4CHZA 4B9SA 3KK7A 4CJ7A 3CFPA 5AQMA 4LF9K 4FJ5A 1TKXA 5CYQA 4IG0A 4K43A 3KKRA 4KHNA 3D2FB 1E3MA 4AHVA 4E7JA 1S3XA 4F8RA 1JL1A 4Z4FA 1TL1A 3C0BA 1YVNA 4CJKA 3O9RA 4CZGA 4BRQA 3LM9A 3ID8A 2PFUA 4DTSA 1JXBA 3ZEUB 4AHRA 1BQNA 5AJ3K 3ZSWA 1JCEA 1WBDA 2HBJA 4F3TA 1RDDA 3R6MA 1HYZA 1RDUA 3O9QA 2VGMA 4DTRA 2HBMA 4HVJA 2DPNA 2YJFA 4FLXA 4FLUA 5TKYA 5HL7L 4LSNA 2E2PA 4IZ9A 4A59A 1HYSA 1X1PA 3I33A 3ZT2A 3THYA 3DMJA 1ZBSA 3MEGA 3VN5A 1XWLA 3A8YA 4X62K 4E1JA 4JLHA 4CD1A 2KZMA 3D45A 4EFHA 1VQ9N 3M3ZA 5HRRA 1Q9XA 4YNQA 2QWQA 2KHOA 3MEEA 5BPNA 5C10A 4Y1CA 3PX4A 1MWKA 2JWKA 3P31A 3R9PA 1K73O 3AARA 5HRSA 5HLFA 1NK5A 1RT4A 4EAHD 3MX2A 2O8CA 4LF6K 2A41A 5M1OA 3HPOA 4NO7A 4ZTFA 3O1BA 1ATRA 1RFQA 4BR2A 4Z4IA 3RMBA 4BC4A 4KI6A 4E0DA 4K25A 1GLLO 5BR8K 4CEAA 3CCUN 3L3UA 3SYZA 1W2BM 2F96A 4CF0A 3G10A 3CXCM 1NJWA 3B8AX 3QEIA 4OX9K 4KI4A 3RRGA 1KVAA 1K8KA 5E26A 1JLCA 1EWQA 2HHVA 2DFFA 1VHXA 5KGWA 2NRXA 4IEEA 2NRWA 5LY3A 3HXMA 3PO5A 1VSLA 3O4WA 3HSTB 1A5WA 1QS4A 4CJSA 4N5SA 4CJEA 4CK1A 1KQSM 4O44A 1HMVA 1LAVA 3EO3A 3NGZA 3L2VA 4GNIA 1S9EA 1ZC6A 1LWCA 1YHQN 5CZ1A 3FZKA 3CQ8A 3L2RA 1IJJA 4CZKA 3VQBA 1DLOA 3KK1A 1VSMA 3D6RA 4CZEA 4NLBA 4DTOA 4DQSA 1N6QA 1I3AA 3AAPA 2YHXA 4DR2K 2GUPA 1HRHA 1BHLA 4WFNL 3H46O 4GKJK 1KXPA 3U9DA 3ZT1A 1KCFA 3O1WA 4AM6A 1GLEG 1CZAN 2QKBA 1NWKA 4CECA 3L2UA 4BRNA 4ELVA 1FJGK 4GY2B 1MA9B 3LP0A 1C1AA 4BR4A 3CJAA 4YFUA 1IKVA 2VWJA 3VMFB 4FLTA 1UA1A 4I9QA 1X9WA 1JLBA 3EE8A 4LF5K 3TARA 5AFUA 3FZFA 1NKCA 3VF4A 3DYAA 1NGJA 5KRSA 1Q9YA 1NK0A 2G8VA 4KB0A 3RMCA 4NYNA 1HUXA 4W5RA 4DV3K 1ASVA 1IG8A 2E5LK 1Z25A 3OYHA 4DV6K 4F2RA 2F8TA 1FW6A 2QI2A 1L3SA 4B1YB 3G6EN 4DQIA 3M8PA 3P83D 3AGKA 2IGIA 3CC7N 4ILJA 3TAMA 4W5TA 4JK7A 3TANA 4KKOA 5FPNA 4CBWA 1TV6A 3JYTA 3ZSXA 3LWLA 5ELZA 1X3MA 2UXBK 5B8HA 3SV3A 3CQYA 4J2BA 3K9JA 4JK9A 3MX5A 3PLAA 1J6ZA 2IVPA 4BY9C 2QEXN 1ATNA 5LL6Z 1QSYA 2FBYA 1NGGA 1LCUA 1W9HA 5BN8A 3AV9A 3ZT0A 4KREA 4FVMA 4JKGB 3CPEA 3VENA 4JD2A 1G99A 1JCFA 4DU1A 2BDPA 4X65K 4HWIA 3J80O 4I6MA 1XC9A 3VTIA 1VQ6N 3OYJA 3C65A 3V6DA 4ELTA 4A62A 4DG1A 4ISGA 4LSLA 4C8NA 3SMPA 4CZLA 1NGCA 4CJTA 4CI6A 1D9DA 2NRVA 2A1SA 5C25A 4LH4A 1XC3A 5BREA 3ZLJA 1NGDA 3AA3A 3A2FA 1EKEA 3LDQA 3CMAN 4BGBA 4CFAA 3K0SA 4BRLA 2KFNA 1RT3A 3KD1E 1JCGA 4FPBA 1W7AA 4DSLA 1YJ9N 2ETJA 4KFBA 1RDAA 5AZIB 1NJIO 1QTMA 2HVHA 2IIRA 1I39A 3L2QA 4LH5A 4DLEA 1T05A 3QINA 3V9WA 3PX0A 3BZKA 3E9LA 1T7PA 4LF7K 3P5JA 2YNIA 2I7NA 1RILA 4IBNA 1HJRA 2Z1GA 3SUOA 4JKFA 4DF4A 3HTVA 4BE2A 2P9LA 1BL3A 2WTUA 4B3RK 3VEWA 1HJOA 2O8BB 4FCYA 4B3SK 4J2DA 1YVUA 3V1OA 1RT6A 1SL0A 3VF2A 2X6SA 3UB5A 3FZHA 3IFRA 5FPDA 3WQTA 1N34K 3JAMO 3AVAA 2D0CA 1HNXK 4CEOA 4KV8A 3QEWA 1U45A 4AHTA 1FXXA 3C94A 3QEXA 4BR0A 4MQ3A 1MDUB 4PWDA 2AA4A 3DJCA 3PO4A 4FWLA 3UE5A 2GELA 4DQQA 3O6WA 4UQGA 2V7ZA 4YOUA 3O08A 3WNFA 5EVZA 3UKUB 3OYKA 2FSKA 3QBXA 4KPYA 2Y1IA 3OS2A 3SQ0A 4C8OA 3O4NA 2HHTA 2YX6A 3VQEA 1S9GA 3FGUA 4MDBA 3VTHA 1NJXA 4F3OA 4I2PA 2RKIA 4C23A 4ZHRA 1JXEA 3L3VA 3GG4A 2DTUA 4IFVA 1QSLA 3B6PA 3MWPA 4KH4A 3ZETB 4J8FA 3SPZA 4H0YB 3OYGA 3HZ6A 4CVNE 1HKCA 4CJLA 2UUAK 3T69A 2F8SA 3FLCO 2OANA 4RW7A 4CJUA 3DM2A 4WQ5C 3OYDA 5LJWA 3VQ4A 3PY8A 2OPSA 3AVCA 5EU7A 2I5JA 3AY9A 3THWA 1YI2N 4DQRA 1SAZA 2VQEK 2ASOA 2HNZA 3SUQA 2P51A 2UUCK 4UY8O 2YJEA 4K41A 4RW6A 1GLJO 2GTDA 3WNHA 4N41A 1SQKA 3D2EB 3VGLA 1S1UA 1HKBA 4KH6A 4BG9A 3LDSA 1L3VA 4FVUA 1C0MA 3DXKB 1QVFM 4MFBA 1RBVA 4IJAA 2IVOA 5AZJB 4FWPA 4E19A 5BN9A 3EKUA 4BRIA 5KPTA 4E89A 3OYNA 1NMNA 4EZ9A 4XH4A 3D7EO 3TTCA 3I56N 5CE3A 4DKWA 1KRPA 4B9UA 2NZTA 2NUBA 3KZBA 2GWJA 4CJPA 5M1QA 2IVNA 3VQCA 4JYAK 3QNNA 3K57A 3Q7BA 5CZ2A 1J5OA 4F4KA 4PKIA 2YHYA 4H5VA 2B6AA 1NK8A 5AQJA 2HHHK 1ILYA 1J9AA 4NYFA 5KGXA 4DU4A 2D5RA 1EO1A 2YHAA 5J2PA 4ID5A 4MLHA 3PV8A 1GLFO 4Y0WA 2YNFA 5JVGL 1VSDA 3SK3A 3VOVA 2GWKA 5AQLA 2OPPA 2E2OA 4BVPA 1CZ9A 4KO0A 5I42A 3ID6A 4DFJA 4DV1K 4GV3A 4I7FA 3QO9A 4M3RA 2ASPA 4FJJA 1C0UA 4CW7B 2ZQBA 2VYPA 3LPTA 1RTDA 3T19A 4FM2A 4CD3A 4BE0A 3KWIA 3VQDA 1HPZA 4JHDB 4CERA 4FO0A 3O4QA 2XY6A 2B4JA 4Y1DA 3ZSYA 4A5BA 1WSGA 3D2FA 3LP2A 2P9SB 3GDQA 3TWHA 5EY4A 3LZIA 3MCPA 1J5EK 3SZ2A 1C0GA 3DRSA 1DKGD 1RTJA 1VSIA 4BWJA 1YAGA 4H03B 3KLFA 3U8XA 2QWPA 1WSEA 3SAFA 1VK0A 3V9SA 4M3TA 4KAZA 2CH5A 2UXDK 4NLCA 3I8BA 4JI8K 4G1QA 4OPJA 4M3XA 2FF6A 2DFHA 3AO3A 5LMUK 4JKAA 1TL3A 1SKSA 3MN7A 3V81A 1M90O 3NE6A 2XY8A 4HTLA 1EQYA 4TSXA 3WXJA 4GMJB 2O8EB 1NG9A 3MXIA 4DB3A 4WCEL 1EX4A 1Z05A 2GX9A 3L4QA 2WFBA 4PY5A 1NOYA 3ULEB 4Q0BA 2BTFA 4XH1A 5GADP 1C0TA 1TKTA 3CC4N 3QMLA 3U3YA 4BG8A 1T6CA 5EX5A 3SUNA 4MO5A 3MN9A 1QVGM 3ZYYX 2HF4A 4AF1A 2NLXA 2Q2RA 2RHKA 4OGEA 4HUGA 1S72N 5KTQA 1ZBHA 3FZLA 1RBTA 4DHYA 2PY5A 4FJXA 4RW8A 4BR5A 2WUSA 4M41A 1Q82O 1YJNN 2Z1HA 3A5LC 4CGJA 2HW3A 2W41A 5J2MA 4CJ5A 4AQYK 2XHBA 4QAGA 3DI6A 3HI0A 4B3MK 4CF2A 3K2PA 3S41A 5HP1A 1VQKN 1B9FA 4DTPA 2F9WA 1BA1A 4H0VB 4E7LA 3AA5X 4E7IA 3QFPA 4FJ8A 4CE9A 4JK8A 3SLCA 2P9NB 4DCHA 5F1XA 4FJKA 3BP8A
chains in the Genus database with same CATH topology
1H1VA 1HUXA 4JD2B 3CI5A 4JN4A 4BROA 5BR9A 3PIPL 1KAYA 1IG8A 1QQOA 3O80A 2FLOA 4KBOA 1XUPO 4OPAA 1JJ2M 2QWMA 3CCEN 3GL1A 2QA4N 3CCJN 2VGNA 3DXMA 3TSQA 5AQHA 3UKRA 2QI2A 2QW9A 1Q81O 3E66A 3CJ1A 3F2KA 3QICA 3AGRA 4B1YB 3G6EN 1R59O 2FSJA 4BRHA 3MCAB 4H5NA 3AGKA 3R3LA 2A42A 2P9KA 5I9EB 4ILJA 4QS7A 3MMVA 4A2AA 5FPEA 1ATSA 4JK7A 1OKJA 1YITN 5FPNA 3W0LA 4CBWA 3CPWM 1QQMA 2ZWHA 4PL7A 1QHAA 3KVGA 4IO8A 3MN6A 4G9ZA 5ELZA 2FSNA 1X3MA 3R1XA 3ZEUA 1MWMA 5B8HA 3HOSA 3CQYA 2P9UB 4WF9L 4JKEA 5CHIA 3K9JA 2ASMA 4JK9A 1TYQB 2A40A 3MX5A 4H0PA 3OW2M 3JXUA 4BGAA 3PLAA 1J6ZA 2IVPA 4O8KA 4BY9C 3CCVN 2QEXN 3NMUA 3RSEB 2Q0RA 1ATNA 3CCMN 4B1ZA 2ZJPL 1NGGA 2P9NA 1LCUA 2ZF5O 4FOIA 1VQPN 5BN8A 4BQZA 3P4IA 5AQWA 1VQLN 4JKGB 1BG3A 3CPEA 4YORA 1XQSC 3ZX2A 3VENA 1S22A 4GVEA 4JD2A 1G99A 4JKHA 5GAHP 1VQMN 3I55N 1JCFA 2Q0UA 2UYTA 4HWIA 5FPMA 3F5TA 4I6MA 4QS9A 5AQPA 5EXWA 1QZ6A 3VGKA 1YJWN 5C2DA 1NM1A 3LDLA 3WQUA 3H1QA 2NRRA 5M1FA 3LL3A 2P9LB 3A5OC 2NRZA 2CGJA 3VTIA 1VQ6N 1Z6RA 3C65A 3U9ZA 5AQUA 4JKBA 5GAGP 4A62A 3CJBA 3O8MA 3CCSN 5BRDA 1HPMA 4ISGA 1K9MO 4YOWA 4CZLA 2FF3B 3SMPA 5HOOA 1NGCA 2VCPA 1VQON 4M7XA 3QDKA 3E1YA 4CI6A 2D4WA 2E1YA 2NRVA 1GLCG 4FWNA 3CD6N 3CHWA 1XC3A 1E4GT 1OVYA 3DLLL 5BREA 3A5MC 5AFUH 1NGDA 3DAWA 4EHUA 2P9UA 3LDQA 4BRKA 3CMAN 2HOEA 4IO9L 1TUYA 2F9TA 4BGBA 1TYQA 3N4PA 3QB0A 3FFKB 2Q1NA 2QM1A 5AQTA 4YDUC 4BRLA 3RSEA 3H1VX 3CCQN 4BC5A 3ZX3A 1Q7YO 1JCGA 4FPBA 3SAGA 3A5NC 1BDGA 3P39A 1YJ9N 2BUPA 3QFUA 3VEOA 4BQLA 3EKSA 3H3NO 1NGEA 4JKGA 5AZIB 3SJHA 3VEVA 1NJIO 2IIRA 1VAZA 3G71N 3FE1A 4PL8A 4DQ8A 1U2VB 2P9IB 1RGIA 3E9LA 3M6GA 3TU5A 3ATUA 3E9PA 2GEMA 1BU6O 3LDNA 3VGMA 3WXMB 2I7NA 4C1NK 2ZJQL 1Q86O 3IKMA 3EN9A 4JKFA 3VEZA 3HTVA 3C7NB 3M5RA 3TPQA 2P9LA 3WXIA 1N8RO 4OO1J 1HX1A 1HJOA 3VEWA 1SZ2A 5JLFA 4H0TB 2YI1A 3WT0A 4JKDA 1YF5L 3ULEA 3VF2A 3GE1A 2A6AA 2EWSA 4FWQA 1GLDG 2FXUA 5C12A 4FPAA 3UB5A 3FZHA 3LDPA 5AQIA 1BA0A 5AQNA 3GBTA 3IFRA 5FPDA 3CF5L 4FWOA 3WQTA 1NGAA 4BRCA 3GOIA 3K9KA 2NRHA 5AQFA 4Z94A 2WC9A 2CGLA 3TSPA 5C15A 3E9OA 2V7YA 4B1VA 5LJVA 1RDWX 4H5WA 2H3GX 1BWFO 4BR0A 1MDUB 2AA4A 2KLAA 2WBNA 3DJCA 4FWLA 3UE5A 1O13A 3CETA 2GELA 3ATVA 3J8AA 2HF3A 2V51B 3O6WA 3A0IX 5AZIA 4ISEA 1U6ZA 3W3DA 2V7ZA 4YOUA 1DGKN 1BOTO 3O08A 4PKHA 4YDUA 2V52B 2P9IA 3KHYA 3EZWA 5EVZA 3UKUB 4WFBL 1NGBA 2FSKA 1YUWA 3OHRA 3QBXA 4A57A 4R79A 3N4QA 2YX6A 2KKZA 2I7PA 3FGUA 2AP1A 4XEIA 4MDBA 3R8EA 3VTHA 4B9QA 2YHWA 4CZJA 2PAVA 3C7NA 4C23A 2QWLA 5GAEP 4H0XB 4BR7A 1V4SA 5KQDA 3GG4A 5AQRA 3VEXA 4H0OA 4CZHA 3FZMA 3MWPA 4CZMA 5M1KA 4KH4A 3ZETB 4J8FA 5JLHA 1NGFA 4H0YB 4IWVA 3HZ6A 1HKCA 5EOYA 4BRDA 4JKCA 5F2RA 1T44A 3OBYA 3T69A 4FWSA 5ADXH 2E8AA 3FLCO 1NBWA 2OTLN 5C0YA 2OANA 2D1KA 4WFAL 3O9SA 1E4FT 1HLUA 1VQ7N 1V4TA 3L6QA 4WQ5C 4IFEA 4M63C 5LJWA 3QBWA 4K42A 3FR0A 4IEIA 1ZXOA 3L0QA 3OA9A 1P8ZA 3AY9A 3VESA 3CERA 4JAXA 1W97L 1NMDA 4BRAA 5AQOA 1YI2N 1K8AO 1SAZA 2E1ZA 3MDQA 4MO4A 2ASOA 3HOTA 4B1WB 4UY8O 2YJEA 4K41A 1GLJO 2D0PA 2GTDA 3BUZB 3OBWA 3BF3A 4MDAA 3WXKA 1SQKA 3D2EB 3VGLA 4LC9B 1HKBA 4KH6A 4BG9A 3UKUA 1VQ5N 4FVUA 5DM6L 2A3ZA 2HMPA 3BF1A 4F9OA 3DXKB 3AAQA 5AQZA 1QVFM 2ITMA 2NNWA 4IJAA 5ADXA 2IVOA 5AZJB 5AQSA 3SMSA 4FWPA 1VQNN 5MLCQ 5AQYA 5BN9A 2F7TA 4B1UB 3LDOA 3EKUA 3JS6A 3T7ZA 3VETA 4BRIA 4BRPA 5JMVA 5KPTA 3KWGA 3G25A 1QZ5A 4IOXA 4XH4A 3ZETA 4IXCA 2QXLA 3D7EO 3MWTA 3TTCA 4BC2A 3I56N 5CE3A 1NGIA 4DKWA 5KPZA 2NZTA 1WUAA 4WQ4C 4CZIA 2ZJRL 5BRHA 3DWLA 2W40A 4O8UA 3KZBA 2RE2A 3NVKA 2E2QA 3CJ9A 1VQ8N 4JEPA 2GWJA 4ILGB 4MLEA 3ENHA 1GLBG 5C2FA 2QWRA 3WUHA 5M1QA 3SAHA 4CBXA 1Q18A 2IVNA 4GV6A 1KC8O 4NB4A 4EHTA 1P90A 3BEXA 4ILHA 2P9PB 3KK7A 3Q7BA 2E88A 4IJNA 4CJ7A 1BO5O 5AQMA 4PKIA 2YHYA 2YCHA 4H5VA 4FWKA 5AQJA 1X9JA 3CC2N 4K43A 5KPRA 3CC7N 1ILYA 3D2FB 3D2EA 1S3XA 1EO1A 3C0BA 4MLHA 1YVNA 4FOEA 3DXKA 1GLFO 2Q97A 3MK6A 3O9RA 3WXLA 4BRQA 4CZGA 3LM9A 4Y0WA 3ID8A 5TKWA 4C1NI 2CH6A 2PFUA 3VF6A 5AZJA 5GIPA 5JVGL 3ZEUB 3SK3A 2D0OA 4KH5A 5JICA 4O5FA 3C6AA 4BR9A 4BRFA 3CJ7A 3O5BA 3VOVA 2GWKA 4YOXA 1JCEA 5AQLA 5BPLA 2E2OA 1DT9A 2HBJA 3H3OB 3Q7CA 4BVPA 2VWBA 4A61A 3R6MA 1RDUA 2QWNA 3O9QA 2VGMA 3ID6A 2HBMA 1TUUA 2DPNA 2YJFA 4GV3A 1Y64A 2ASPA 2E20A 5TKYA 5HL7L 4A59A 2E2PA 2VYPA 4IZ9A 5BRFA 5KQ8A 1D4XA 4GV9A 1K8KB 1U2VA 3I33A 3MN5A 3ZX0A 5AQXA 4CD3A 4XH5A 1ZBSA 4I6MB 3KWIA 3A8YA 2P9PA 4E1JA 4PKGA 1SS6A 3C6HA 4JHDB 4WQ4A 4BVOA 2E2NA 3HSCA 3VEYA 4CD1A 1VQ4N 4FO0A 4EFHA 5GINA 4PHTX 1VQ9N 3M3ZA 4OPHA 1C0FA 2QWQA 2KHOA 5BPNA 3IUCA 2Q31A 1KAZA 4A5BA 5C10A 4YOTA 3D2FA 2P9SB 3GDQA 3CIPA 1MWKA 2JWKA 4RCHA 5EY4A 3P31A 3MCPA 3R9PA 1C0GA 2HBLA 4M7YA 1WOQA 1K73O 3AARA 1DKGD 1NGHA 3ENOA 4EAHD 4BRMA 3MX2A 5BPMA 3U4LA 1YAGA 4H03B 3U8XA 3EL2A 2A41A 2QWPA 5M1OA 1GLAG 4NO7A 5GIOA 5AQVA 3O1BA 3SAFA 3G4SN 1ATRA 1RFQA 3CJCA 1YXQA 4BR2A 3HBTA 4BC4A 2J4RA 2CH5A 3F9MA 4K25A 1GLLO 3J7ZO 4NLCA 3I8BA 3NVMA 3TSUA 4FL9A 4YOYA 3CCUN 5H1SQ 4IOCL 1W2BM 4CZFA 2FF6A 4CBUA 3CXCM 3B8AX 3L4IA 4JKAA 3MN7A 1YIJN 1K8KA 1M90O 3CQXA 3CCLN 5AQGA 5E26A 5DM7L 3IMXA 4HTLA 1EQYA 3SBGA 2OTJN 1T3VA 3WXJA 2NRXA 4A2BA 4IEEA 4L3QA 2NRWA 3M1FA 5LY3A 4BC3A 4JHDA 3CCRN 4A5AA 2Q36A 3WEEB 3O4WA 4DB3A 2HBKA 4WCEL 1Z05A 2GX9A 3L4QA 2WFBA 1X3NA 2JWLA 3TTFA 3ULEB 1KQSM 3EO3A 2BTFA 2P9SA 4GNIA 4XH1A 1ZC6A 5AQKA 5GADP 1YHQN 3FZKA 4ISFA 3CC4N 3QMLA 3RVCA 4AM7A 1HKGA 1T6CA 5EX5A 4BG8A 5F0XA 4RWTA 2NRTA 1IJJA 3P38A 4MO5A 4CZKA 3MN9A 3VERA 1QVGM 3VPZA 2HF4A 3ZYYX 4AF1A 1NLVA 3D6RA 3SBTA 3IDHA 4CZEA 4NLBA 2CGKA 4U7BA 5AQQA 2NLXA 2QWOA 4RTFD 1LOTB 3AAPA 3ENBA 2Q2RA 2YHXA 2RHKA 3DXMB 3HM8A 5CR4A 1S72N 3PIOL 2GUPA 3LM2A 3UKRB 1ESVA 2ZGYA 3FZLA 5AR0A 4DHYA 4U67L 4WFNL 1BUPA 1DEJA 3H46O 4FWMA 4BR5A 5E84A 4YOVA 1M1KO 5M1NA 2WUSA 1KXPA 4WQ5A 3CMEN 3U9DA 1Q82O 2PBDA 4FSVA 3O1WA 4JNEA 4AM6A 1GLEG 2HSTA 2P9KB 1CZAN 4B1XB 3A5LC 1NWKA 3O9TA 4QS8A 1YJNN 2ZGZA 2BH1A 4BRNA 2W41A 3H6EA 4GY2B 1KAXA 1MA9B 4BR4A 3CJAA 3HI0A 3HRGA 4FWRA 4H5TA 5JVHL 3EE9A 4IDHA 3S41A 1VQKN 3VMFB 3H45C 1KD1O 4H5RA 2F9WA 1BA1A 4H0VB 3TTDA 3EE8A 4BREA 4IOAL 2QTDA 3QFPA 3WEEA 5AFUA 3O9UA 4BRGA 1T6DA 2A5XA 3FZFA 1QQNA 4JK8A 3VF4A 3SLCA 5M1PA 2P9NB 4DCHA 1NGJA 5F1XA 3BP8A 4WYBA 4EIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H1V A;  1HUX A;  4JD2 B;  3CI5 A;  4JN4 A;  4BRO A;  5BR9 A;  1KAY A;  1IG8 A;  1QQO A;  3O80 A;  2FLO A;  4KBO A;  1XUP O;  2QWM A;  3GL1 A;  3DXM A;  5AQH A;  3UKR A;  2QW9 A;  3CJ1 A;  3QIC A;  4B1Y B;  1R59 O;  2FSJ A;  4BRH A;  4H5N A;  2A42 A;  2P9K A;  5I9E B;  4QS7 A;  4A2A A;  3MMV A;  5FPE A;  1ATS A;  1OKJ A;  5FPN A;  3W0L A;  4CBW A;  1QQM A;  2ZWH A;  4PL7 A;  1QHA A;  3KVG A;  4IO8 A;  3MN6 A;  5ELZ A;  2FSN A;  1X3M A;  3ZEU A;  1MWM A;  5B8H A;  3CQY A;  2P9U B;  2ASM A;  1TYQ B;  2A40 A;  4H0P A;  3JXU A;  4BGA A;  1J6Z A;  2IVP A;  4O8K A;  3RSE B;  2Q0R A;  1ATN A;  4B1Z A;  1NGG A;  2P9N A;  1LCU A;  2ZF5 O;  4FOI A;  5BN8 A;  4BQZ A;  3P4I A;  5AQW A;  1BG3 A;  3ZX2 A;  1XQS C;  3VEN A;  1S22 A;  4JD2 A;  1G99 A;  1JCF A;  2Q0U A;  2UYT A;  4HWI A;  5FPM A;  4I6M A;  4QS9 A;  5AQP A;  5EXW A;  1QZ6 A;  3VGK A;  1NM1 A;  3LDL A;  3WQU A;  3H1Q A;  3LL3 A;  2P9L B;  3A5O C;  2CGJ A;  1Z6R A;  3U9Z A;  5AQU A;  4A62 A;  3CJB A;  3O8M A;  5BRD A;  1HPM A;  4ISG A;  4CZL A;  2FF3 B;  3SMP A;  1NGC A;  2VCP A;  4M7X A;  3QDK A;  4CI6 A;  2D4W A;  2E1Y A;  1GLC G;  4FWN A;  3CHW A;  1XC3 A;  1E4G T;  5BRE A;  3A5M C;  5AFU H;  1NGD A;  3DAW A;  4EHU A;  2P9U A;  3LDQ A;  4BRK A;  2HOE A;  1TUY A;  2F9T A;  4BGB A;  1TYQ A;  3QB0 A;  3FFK B;  2Q1N A;  2QM1 A;  5AQT A;  4YDU C;  4BRL A;  3RSE A;  3H1V X;  4BC5 A;  3ZX3 A;  1JCG A;  4FPB A;  3A5N C;  1BDG A;  2BUP A;  3QFU A;  3VEO A;  4BQL A;  3EKS A;  3H3N O;  1NGE A;  5AZI B;  3SJH A;  3VEV A;  2IIR A;  3FE1 A;  4PL8 A;  4DQ8 A;  1U2V B;  2P9I B;  1RGI A;  3M6G A;  3TU5 A;  3ATU A;  3VGM A;  2GEM A;  1BU6 O;  3LDN A;  2I7N A;  3EN9 A;  3VEZ A;  3HTV A;  3C7N B;  3TPQ A;  3WXI A;  2P9L A;  1HX1 A;  1HJO A;  3VEW A;  1SZ2 A;  5JLF A;  4H0T B;  2YI1 A;  3WT0 A;  3ULE A;  3VF2 A;  3GE1 A;  2A6A A;  2EWS A;  4FWQ A;  1GLD G;  2FXU A;  4FPA A;  3UB5 A;  3FZH A;  3LDP A;  5AQI A;  1BA0 A;  5AQN A;  3GBT A;  3IFR A;  5FPD A;  4FWO A;  3WQT A;  1NGA A;  4BRC A;  3GOI A;  5AQF A;  2NRH A;  4Z94 A;  2CGL A;  2V7Y A;  4B1V A;  5LJV A;  1RDW X;  4H5W A;  2H3G X;  1BWF O;  4BR0 A;  1MDU B;  2AA4 A;  3DJC A;  4FWL A;  3UE5 A;  3CET A;  2GEL A;  3ATV A;  3J8A A;  2HF3 A;  2V51 B;  3O6W A;  3A0I X;  5AZI A;  4ISE A;  1U6Z A;  3W3D A;  2V7Z A;  1DGK N;  1BOT O;  3O08 A;  4PKH A;  4YDU A;  2V52 B;  2P9I A;  3KHY A;  3EZW A;  5EVZ A;  3UKU B;  1NGB A;  2FSK A;  1YUW A;  3OHR A;  3QBX A;  2I7P A;  3FGU A;  2AP1 A;  4XEI A;  3R8E A;  4B9Q A;  2YHW A;  4CZJ A;  2PAV A;  3C7N A;  4C23 A;  2QWL A;  4H0X B;  4BR7 A;  1V4S A;  5KQD A;  3GG4 A;  5AQR A;  3VEX A;  4H0O A;  4CZH A;  3FZM A;  4CZM A;  3ZET B;  4J8F A;  5JLH A;  1NGF A;  4H0Y B;  4IWV A;  3HZ6 A;  1HKC A;  5EOY A;  4BRD A;  5F2R A;  1T44 A;  4FWS A;  5ADX H;  3FLC O;  2E8A A;  1NBW A;  2OAN A;  2D1K A;  1E4F T;  1HLU A;  1V4T A;  3L6Q A;  4WQ5 C;  4M63 C;  5LJW A;  3QBW A;  4K42 A;  3FR0 A;  1ZXO A;  3L0Q A;  1P8Z A;  3AY9 A;  3VES A;  3CER A;  4JAX A;  1NMD A;  4BRA A;  5AQO A;  1SAZ A;  2E1Z A;  3MDQ A;  4MO4 A;  2ASO A;  4B1W B;  2YJE A;  4K41 A;  1GLJ O;  2D0P A;  2GTD A;  3BUZ B;  3BF3 A;  3WXK A;  1SQK A;  3D2E B;  3VGL A;  4LC9 B;  1HKB A;  4BG9 A;  3UKU A;  2A3Z A;  2HMP A;  3BF1 A;  4F9O A;  3DXK B;  3AAQ A;  5AQZ A;  2ITM A;  4IJA A;  5ADX A;  2IVO A;  5AZJ B;  5AQS A;  3SMS A;  4FWP A;  5AQY A;  5BN9 A;  4B1U B;  3LDO A;  3EKU A;  3JS6 A;  3VET A;  4BRI A;  4BRP A;  5JMV A;  5KPT A;  3G25 A;  1QZ5 A;  4XH4 A;  3ZET A;  4IXC A;  2QXL A;  3D7E O;  4BC2 A;  5CE3 A;  1NGI A;  5KPZ A;  2NZT A;  1WUA A;  4WQ4 C;  4CZI A;  5BRH A;  3DWL A;  2W40 A;  3KZB A;  2E2Q A;  3CJ9 A;  2GWJ A;  4MLE A;  3ENH A;  1GLB G;  2QWR A;  3WUH A;  4CBX A;  1Q18 A;  2IVN A;  4NB4 A;  4EHT A;  3BEX A;  2P9P B;  2E88 A;  4IJN A;  4CJ7 A;  1BO5 O;  5AQM A;  4PKI A;  2YHY A;  2YCH A;  4H5V A;  4FWK A;  5AQJ A;  1X9J A;  4K43 A;  5KPR A;  3D2F B;  3D2E A;  1S3X A;  3C0B A;  4MLH A;  1YVN A;  4FOE A;  3DXK A;  1GLF O;  2Q97 A;  3MK6 A;  3WXL A;  4BRQ A;  4CZG A;  3LM9 A;  4Y0W A;  3ID8 A;  2CH6 A;  3VF6 A;  5AZJ A;  3ZEU B;  3SK3 A;  2D0O A;  5JIC A;  4O5F A;  4BR9 A;  4BRF A;  3CJ7 A;  3O5B A;  3VOV A;  2GWK A;  1JCE A;  5AQL A;  5BPL A;  2E2O A;  3H3O B;  4BVP A;  2VWB A;  4A61 A;  3R6M A;  2QWN A;  1TUU A;  2DPN A;  2YJF A;  1Y64 A;  2ASP A;  2E20 A;  5TKY A;  2E2P A;  2VYP A;  4IZ9 A;  5BRF A;  5KQ8 A;  1D4X A;  1K8K B;  1U2V A;  3I33 A;  3MN5 A;  3ZX0 A;  5AQX A;  4CD3 A;  4XH5 A;  1ZBS A;  4I6M B;  3A8Y A;  2P9P A;  4E1J A;  4PKG A;  4WQ4 A;  4BVO A;  4JHD B;  2E2N A;  3HSC A;  3VEY A;  4CD1 A;  4FO0 A;  4EFH A;  3M3Z A;  1C0F A;  2QWQ A;  2KHO A;  5BPN A;  3IUC A;  2Q31 A;  1KAZ A;  3D2F A;  2P9S B;  3GDQ A;  3CIP A;  1MWK A;  4RCH A;  5EY4 A;  3MCP A;  3R9P A;  1C0G A;  4M7Y A;  1WOQ A;  3AAR A;  1DKG D;  1NGH A;  3ENO A;  4EAH D;  4BRM A;  5BPM A;  3U4L A;  1YAG A;  4H03 B;  3U8X A;  3EL2 A;  2A41 A;  2QWP A;  1GLA G;  4NO7 A;  5AQV A;  3O1B A;  1ATR A;  1RFQ A;  3CJC A;  1YXQ A;  4BR2 A;  3HBT A;  4BC4 A;  2J4R A;  2CH5 A;  3F9M A;  4K25 A;  1GLL O;  3I8B A;  4FL9 A;  4CZF A;  2FF6 A;  4CBU A;  3B8A X;  3L4I A;  3MN7 A;  1K8K A;  3CQX A;  5AQG A;  5E26 A;  3IMX A;  4HTL A;  1EQY A;  3WXJ A;  4A2B A;  4L3Q A;  3M1F A;  5LY3 A;  4BC3 A;  4JHD A;  2Q36 A;  3WEE B;  3O4W A;  4DB3 A;  1Z05 A;  1X3N A;  3ULE B;  3EO3 A;  2BTF A;  2P9S A;  4GNI A;  4XH1 A;  1ZC6 A;  5AQK A;  3FZK A;  4ISF A;  3QML A;  4AM7 A;  4BG8 A;  1HKG A;  1T6C A;  5EX5 A;  5F0X A;  4RWT A;  1IJJ A;  4MO5 A;  4CZK A;  3MN9 A;  3VER A;  3VPZ A;  2HF4 A;  1NLV A;  4CZE A;  3IDH A;  2CGK A;  5AQQ A;  2NLX A;  2QWO A;  4RTF D;  1LOT B;  3AAP A;  2Q2R A;  2YHX A;  3DXM B;  3HM8 A;  2GUP A;  3LM2 A;  3UKR B;  1ESV A;  2ZGY A;  3FZL A;  5AR0 A;  4DHY A;  1BUP A;  1DEJ A;  3H46 O;  4FWM A;  4BR5 A;  5E84 A;  2WUS A;  1KXP A;  4WQ5 A;  3U9D A;  2PBD A;  4FSV A;  3O1W A;  4JNE A;  4AM6 A;  1GLE G;  2P9K B;  1CZA N;  4B1X B;  3A5L C;  1NWK A;  4QS8 A;  2ZGZ A;  4BRN A;  2W41 A;  3H6E A;  4GY2 B;  1KAX A;  1MA9 B;  4BR4 A;  3CJA A;  3HI0 A;  4FWR A;  4H5T A;  3S41 A;  3H45 C;  4H5R A;  2F9W A;  1BA1 A;  4H0V B;  4BRE A;  3QFP A;  3WEE A;  5AFU A;  4BRG A;  1T6D A;  2A5X A;  3FZF A;  1QQN A;  3VF4 A;  3SLC A;  2P9N B;  4DCH A;  1NGJ A;  5F1X A;  3BP8 A;  4WYB A;  4EIA A; 
#chains in the Genus database with same CATH topology
 4M3W A;  4FW1 A;  2G8I A;  4BRO A;  4CGF A;  1QQO A;  5KI6 A;  2FLO A;  1XUP O;  4BE1 A;  3IAY A;  3HL8 A;  5AQH A;  3C6T A;  4JS5 A;  3F2K A;  3QIC A;  4JV5 K;  1WNS A;  3BZC A;  3CM5 A;  3MCA B;  2KZZ A;  1IKY A;  3MMV A;  1ATS A;  4YHH K;  2HHX A;  1A5V A;  1YIT N;  4XIU A;  3CPW M;  2ZWH A;  3V9U A;  4PL7 A;  1QHA A;  3KVG A;  3AVJ A;  4G9Z A;  1LAW A;  3OYA A;  3HOS A;  1UAX A;  2P9U B;  4JKE A;  1TYQ B;  2A40 A;  3T1A A;  3KK3 A;  3CCV N;  2UUB K;  2P1J A;  3NMU A;  1ZYQ A;  1VQP N;  3P4I A;  5AQW A;  1VQL N;  1LV5 A;  1S22 A;  4FK4 A;  4JKH A;  1VSF A;  1VQM N;  2UYT A;  2Z1I A;  4DV7 K;  2IC3 A;  3F5T A;  5J2N A;  2G8U A;  3ZT3 A;  1QZ6 A;  3THX B;  1YJW N;  3LDL A;  3WQU A;  3H1Q A;  2O4I A;  3TAF A;  4M42 A;  5AQU A;  4JKB A;  5GAG P;  3CJB A;  3O8M A;  3CCS N;  5BRD A;  3PSI A;  1HPM A;  4KTZ A;  4M45 A;  2FF3 B;  3U3G A;  2VG7 A;  2VCP A;  1VQO N;  3NH0 A;  1L5U A;  1GLC G;  4CJR A;  4FWN A;  5J1E A;  1E4G T;  1OVY A;  4FW2 A;  2W42 A;  2HOE A;  3NF6 A;  3RMD A;  1TUY A;  2F9T A;  4NXN K;  4CF1 A;  2Q1N A;  4B9L A;  5IWA K;  1ZBI A;  2JLE A;  3S3N A;  3H1V X;  1S5J A;  3CCQ N;  5C42 A;  4BC5 A;  2HHQ A;  1CLQ A;  1Q7Y O;  3A5N C;  3P39 A;  5CYM A;  3DLR A;  3QFU A;  4CJF A;  3CFO A;  3SJH A;  4JKG A;  3OTO K;  4I2Q A;  1VAZ A;  1HR0 K;  2PYL A;  4AHU A;  2QXF A;  3M6G A;  3K5O A;  3LDN A;  4C1N K;  2ZJQ L;  1Q86 O;  3EN9 A;  2X74 A;  3WXI A;  1N8R O;  4LY7 A;  1HX1 A;  4H0T B;  1BI4 B;  4DTN A;  4AHC A;  2A6A A;  4O0J A;  1GLD G;  2VWK A;  4IKF A;  2X6N A;  2D0A A;  5AQN A;  2Y1J A;  4FWO A;  5AQF A;  2NRH A;  3V9X A;  1BCM A;  1J53 A;  2BE2 A;  4CGH A;  3C95 A;  4Z4H A;  1IO2 A;  4LFC K;  4CIG A;  1BIS A;  1N32 K;  1O13 A;  3CET A;  3L2W A;  2YNG A;  5AZI A;  2V51 B;  3S9H A;  4QCL A;  2RF2 A;  4JI2 K;  1DGK N;  2V52 B;  3KHY A;  3EZW A;  4WFB L;  3OHR A;  1YUW A;  4R79 A;  1HNV A;  3PX6 A;  3N4Q A;  1KVB A;  2AP1 A;  4EP4 A;  2YHW A;  5GAE P;  4H0X B;  3G0Z A;  1C1C A;  2ITG A;  4BR7 A;  3OJS A;  4AIL C;  3VEX A;  4H0O A;  4E1N A;  3VA0 A;  4F2S A;  2RPI A;  4DLG A;  4CZM A;  2ATQ A;  4IWV A;  4Q5V A;  3SPY A;  4BRD A;  3OYF A;  1XMO K;  3ZSO A;  4LFB K;  4FWS A;  2E8A A;  4FM0 A;  4DR1 K;  5C0Y A;  1VQ7 N;  1V4T A;  3L6Q A;  4IFE A;  1R0A A;  4DTX A;  1CXU A;  3FR0 A;  4IEI A;  4JS4 A;  4JI3 K;  3OA9 A;  1P8Z A;  1S1T A;  1O1W A;  1W97 L;  4JAX A;  1X9S A;  4BRA A;  5AQO A;  3HM9 A;  4MO4 A;  3NFA A;  4AHS A;  3TAB A;  4HUE A;  3BY5 A;  2D0P A;  3BUZ B;  3OBW A;  4MDA A;  3WXK A;  4PQU A;  4LC9 B;  3UKU A;  3AVK A;  3S3O A;  5DM6 L;  2HMP A;  1SV5 A;  5AQZ A;  2ITM A;  3ASM A;  3RR7 A;  5ADX A;  3SMS A;  5MLC Q;  3TAQ A;  4DR6 K;  3LDO A;  3T7Z A;  3VET A;  3LZJ A;  3KTQ A;  3VQQ A;  1L3U A;  4FJ9 A;  3ZET A;  4IXC A;  1J54 A;  3S3M A;  1OH5 A;  2YV0 X;  3HVR A;  2IOC A;  2QK9 A;  1NGI A;  4OPK A;  1NK9 A;  4B9M A;  1RBR A;  4CZI A;  4O8U A;  3OVN A;  3NVK A;  1WN7 A;  2E2Q A;  1VQ8 N;  1YTU A;  4JEP A;  3ENH A;  1WAF A;  2HHU A;  1N36 K;  3WUH A;  4M3Z A;  1KFD A;  4W5Q A;  1IBL K;  2A1R A;  4EHT A;  1P90 A;  4ILH A;  3K58 A;  2P9P B;  1VSH A;  1BO5 O;  2Q3S A;  2KW4 A;  2WON A;  2YCH A;  5CY4 A;  1JLG A;  2RN2 A;  5KPR A;  1L3T A;  4FYD A;  1S1W A;  3KLE A;  3D2E A;  2WOM A;  1WSI A;  3AVB A;  2W6K A;  3DXK A;  2Q97 A;  3MK6 A;  4FOE A;  3ZSV A;  2E6L A;  5TKW A;  4C1N I;  3VF6 A;  5AZJ A;  5GIP A;  4DUZ K;  1TK0 A;  2D0O A;  4OJR A;  4KH5 A;  5JIC A;  4O5F A;  3C6A A;  4BRF A;  5A2Q O;  3RRH A;  3CJ7 A;  4YOX A;  2HB5 A;  5BPL A;  4EP5 A;  3H3O B;  1CZB A;  2VWB A;  4CEF A;  1KLN A;  4A61 A;  3CG7 A;  2QWN A;  3JSM A;  1A5X A;  3HP6 A;  1TUU A;  3OJU A;  3IS9 A;  3HPH A;  1SKR A;  4FJM A;  5BRF A;  3O3G A;  4GVM A;  1ASU A;  1U2V A;  4QOZ B;  1YT3 A;  3ZX0 A;  4DTJ A;  5AQX A;  1XHX A;  1X9M A;  4I6M B;  4CHO A;  1SS6 A;  3C6H A;  1SL2 A;  3E01 A;  1LWE A;  2E2N A;  3HSC A;  3VEY A;  3SI6 A;  1HNZ K;  4DSF A;  1VQ4 N;  1NNE A;  5IT9 O;  1W0H A;  4PHT X;  3RTV A;  2PZS A;  4W5N A;  3SCX A;  1IH7 A;  4CEQ A;  1KAZ A;  1B9D A;  4DR5 K;  4CJ3 A;  1NKE A;  4ZTJ A;  1S1X A;  1SKW A;  2O8F B;  4DUY K;  4M7Y A;  1GOC A;  3ENO A;  3OYL A;  3MXJ A;  4HTU A;  1WB9 A;  4FK2 A;  5GIO A;  3TR8 A;  3K5L A;  3HBT A;  3AVM A;  3SNN A;  3DLE A;  4DV0 K;  5FLX O;  1BQM A;  3TSU A;  3F9K A;  4DSE A;  3QEP A;  4IOC L;  1G15 A;  1WLJ A;  4CJV A;  3L4I A;  1YIJ N;  2B5J A;  3CQX A;  4DTU A;  3VQ9 A;  3CCL N;  3IMX A;  2F4V K;  1KTQ A;  4A2B A;  1IBM K;  4JHD A;  4M3U A;  1TGO A;  3OS1 A;  4V19 S;  3P1G A;  3VQP A;  3VQ8 A;  1GOA A;  3I0R A;  3WEE B;  4LFA K;  2HBK A;  1X3N A;  2JWL A;  3TTF A;  3OS0 A;  3THV A;  4B9N A;  2P9S A;  4KHP K;  5AQK A;  3RVC A;  4J2A A;  5F0X A;  3VER A;  1IG9 A;  3VPZ A;  1NLV A;  3IDH A;  2VG6 A;  2CGK A;  3ISN C;  4DFP A;  4RTF D;  2IS3 A;  1LOT B;  3ENB A;  3DXM B;  1N5Y A;  3PIO L;  3LM2 A;  3UKR B;  1ESV A;  5AR0 A;  1BUP A;  4FWM A;  1M1K O;  5E84 A;  4YOV A;  5I3U A;  5M1N A;  4WQ5 A;  1KFS A;  2O8D B;  4FSV A;  1K6Y A;  4JNE A;  2P9K B;  3O9T A;  4QS8 A;  4GW6 A;  4FLY A;  2ZGZ A;  2BH1 A;  5K14 A;  1KAX A;  4DV5 K;  1WSF A;  1T8E A;  4OGC A;  1TK8 A;  2O8E A;  3H45 C;  1KD1 O;  4H5R A;  3BDP A;  3TTD A;  4B08 A;  4E7K A;  1OVQ A;  4JI1 K;  4BRE A;  4IOA L;  2YKN A;  2QTD A;  4KHQ A;  1BIU A;  3O9U A;  4BRG A;  2A5X A;  1QQN A;  5M1P A;  2G8H A;  4WYB A;  4EIA A;  1H1V A;  3DRR A;  2G8K A;  4N76 A;  1U47 A;  4JN4 A;  5BR9 A;  4C8M A;  1KAY A;  4KBO A;  2UU9 K;  3CCE N;  4OPA A;  3WNE A;  2QA4 N;  3VQ5 A;  2VGN A;  2QW9 A;  3TAG A;  3E66 A;  1LWF A;  1ZBL A;  3SQ1 A;  3AGR A;  4CJW A;  3KK2 A;  3PUF A;  4C8L A;  2PYJ A;  4H5N A;  3R3L A;  2A42 A;  3EEQ A;  4QS7 A;  4A2A A;  5I9E B;  5FPE A;  3HK2 A;  4ICL A;  1S6P A;  4IO8 A;  1VRT A;  2ZM6 K;  1JKH A;  3LAN A;  3ZEU A;  4EZ6 A;  1MWM A;  3LP1 A;  4H8K A;  5CHI A;  4CGG A;  4H0P A;  3JXU A;  4BGA A;  3HO1 A;  2E4L A;  3RSE B;  2ZE2 A;  3CCM N;  2ZJP L;  3EY1 A;  2P9N A;  4FZY A;  4BQZ A;  1BG3 A;  3ZX2 A;  3OYE A;  1XQS C;  3NCI A;  4BDP A;  1JLE A;  4FZZ A;  3I55 N;  3SUP A;  2Q0U A;  1IKW A;  3AA2 A;  3NGY A;  3J81 O;  4DU3 A;  3VGK A;  5C2D A;  4CEB A;  2NRR A;  3LL3 A;  2CGJ A;  1Z6R A;  3DLG A;  4CK3 A;  3OYB A;  2IDO A;  1K9M O;  4YOW A;  5HOO A;  5T7B A;  3QDK A;  3E1Y A;  1QHT A;  2D4W A;  2E1Y A;  3TI0 A;  4E3S A;  3DLL L;  2P9U A;  4IO9 L;  4CJ4 A;  1TYQ A;  3N4P A;  4DMN A;  3OYI A;  4DTM A;  1DTQ A;  2QM1 A;  5AQT A;  2FBT A;  1S6Q A;  4FJI A;  4O4G A;  2OPQ A;  3ZX3 A;  4DWI A;  3SAG A;  1BDG A;  4CFD A;  4FJN A;  2BUP A;  1C1B A;  3EKS A;  3LWM A;  3VEV A;  4JI6 K;  4DFM A;  4CGD A;  3G71 N;  3FE1 A;  4DQ8 A;  2P9I B;  3NAE A;  1RGI A;  4RW9 A;  3VGM A;  2GEM A;  3IKM A;  3OYC A;  3THX A;  1RCH A;  3ZSQ A;  3VQA A;  3C7N B;  2KQ2 A;  4CFC A;  2EX3 A;  5JLF A;  1SZ2 A;  2YI1 A;  1BIZ A;  2FBX A;  3WT0 A;  3GE1 A;  2EWS A;  3DRP A;  1XNR K;  3RMA A;  4LD0 A;  5AQI A;  1XNQ K;  4O5B A;  3CF5 L;  4OKJ A;  2Z1J A;  3K9K A;  3ZSR A;  4Z94 A;  1EXQ A;  2WC9 A;  3VQ6 A;  2CGL A;  1Y97 A;  4HCC A;  1U48 A;  4B3O A;  2V7Y A;  4B1V A;  3RWU A;  5LJV A;  3DOK A;  4FJ7 A;  4KTW A;  4H5W A;  4Z4E A;  1KSP A;  1OH7 A;  5J2Q A;  2GBZ A;  4N47 A;  2G8W A;  3LP3 A;  3J8A A;  4CFB A;  3A0I X;  4ISE A;  3W3D A;  4Z4C A;  3H08 A;  1BOT O;  1QE1 A;  3KLH A;  3KIO A;  4DR3 K;  3AVF A;  3NF9 A;  4XEI A;  5HRP A;  3R8E A;  3SV4 A;  5FRO A;  4O55 A;  1UWB A;  4B9Q A;  4B3T K;  2P5G A;  2QWL A;  4KTQ A;  1V4S A;  2DFE A;  1IBK K;  3ZSZ A;  1BI4 A;  3FZM A;  5M1K A;  4KRF A;  3O3H A;  2GUI A;  3K5N A;  5EOY A;  3HYF A;  1NU0 A;  5F2R A;  1T44 A;  2OCE A;  2OTL N;  2D1K A;  1NJY A;  4NCA A;  1HLU A;  5HRO A;  4L8R B;  4Z4G A;  2HND A;  1EET A;  1RTI A;  1ZXO A;  3L0Q A;  2X78 A;  3LAL A;  1NMD A;  3SQ2 A;  1K8A O;  2E1Z A;  1UA0 A;  1C6V A;  3MDQ A;  3M8R A;  4HUF A;  4B1W B;  4M3Y A;  3NBP A;  1WSH A;  4CES A;  1VQ5 N;  2HHS A;  2A3Z A;  5DMR A;  4F9O A;  4OLB A;  3AVH A;  5D3G A;  4B9V A;  5FDL A;  2XO7 A;  4B1U B;  3JS6 A;  2BAN A;  4BRP A;  5JMV A;  1VSK A;  3KWG A;  3HJF A;  3NH2 A;  4LF4 K;  4IOX A;  4KHW A;  2XRI A;  5LMN K;  2QXL A;  1FKO A;  1RT5 A;  2IAJ A;  2HNY A;  1GOB A;  3QIO A;  1RT7 A;  3TAE A;  4BDY A;  4WQ4 C;  3KLG A;  2ZJR L;  3DWL A;  2W40 A;  2RE2 A;  4OVL A;  1JLF A;  4K0K K;  5C2F A;  4K8Z A;  2QWR A;  3SAH A;  3THY B;  2KTQ A;  4NB4 A;  3BEX A;  1I94 K;  1OH8 A;  1RTH A;  2E88 A;  4IJN A;  4BAC A;  2VG5 A;  2VQF K;  1XMQ K;  3MXM A;  3MED A;  4FWK A;  1X9J A;  4FJL A;  3CC2 N;  1HYV A;  1NK7 A;  5JS2 A;  1DTT A;  1ASW A;  3WXL A;  2CH6 A;  1VRU A;  4DV4 K;  3EZ5 A;  2O8C B;  5HBM A;  4BR9 A;  3LPU A;  1IV0 A;  3O5B A;  1NK6 A;  1HQE A;  3O3F A;  3KD5 E;  1DT9 A;  3Q7C A;  4WE1 A;  4FXD A;  3ALY A;  1TVR A;  1RT2 A;  1Y64 A;  2E20 A;  4C8K A;  1TAU A;  3NF7 A;  5KQ8 A;  1D4X A;  4GV9 A;  1K8K B;  4IFY A;  3MEC A;  3MN5 A;  4CIF A;  4XH5 A;  2OZS A;  4N56 A;  5FRM A;  3UIQ A;  4ID1 A;  2P9P A;  4WQ4 A;  4PKG A;  4BVO A;  2W6L A;  5GIN A;  4YY3 K;  4OPH A;  1C0F A;  2O8B A;  3IUC A;  2G8F A;  2Q31 A;  1RDC A;  4YOT A;  4B9T A;  4FLW A;  3C6U A;  2GV9 A;  3CIP A;  4RCH A;  1TAQ A;  2AJQ A;  2HBL A;  4PUO A;  1NK4 A;  1WOQ A;  1NGH A;  4H4O A;  4BRM A;  5BPM A;  1D8Y A;  3U4L A;  3AO2 A;  3EL2 A;  1GLA G;  5AQV A;  3G4S N;  3CJC A;  1YXQ A;  4CHP A;  1S1V A;  2J4R A;  3F9M A;  3M8S A;  1WBB A;  3J7Z O;  3HVT A;  2O4G A;  3CM6 A;  3NVM A;  1HQU A;  4OKE A;  3CYM A;  3OYM A;  4FL9 A;  4YOY A;  1IKX A;  5H1S Q;  5DK5 A;  1XI1 A;  1JLQ A;  4CZF A;  4CBU A;  4CJQ A;  1TKZ A;  3HPG A;  4CED A;  4DS5 A;  5AQG A;  5DM7 L;  3SJJ A;  3SBG A;  2OTJ N;  4JI4 K;  1T3V A;  1NOZ A;  3D0P A;  4L3Q A;  3ZCM A;  3M1F A;  4BC3 A;  2E6M A;  3CCR N;  4A5A A;  3MAQ A;  2FBV A;  2OPR A;  4O0I A;  2Q36 A;  5HRN A;  4CEZ A;  3IRX A;  3DLB A;  3V4I A;  2O8F A;  4ISF A;  4FZX C;  4AM7 A;  4RWT A;  1HKG A;  4CHQ A;  2NRT A;  3P38 A;  3SBT A;  4U7B A;  5AQQ A;  4E1M A;  2OA8 A;  2QWO A;  3HM8 A;  5CR4 A;  1LW0 A;  2YKM A;  2ZGY A;  4U67 L;  3DOL A;  1TKD A;  1DEJ A;  3WNG A;  3QER A;  1ITG A;  1N33 K;  3CME N;  2PBD A;  2HST A;  4B1X B;  1D9F A;  1JLA A;  4I9L A;  3H6E A;  3KKS A;  3NF8 A;  3VQ7 A;  4FWR A;  1EP4 A;  3HRG A;  4H5T A;  4IG3 A;  5JVH L;  3EE9 A;  5FRN A;  2DY4 A;  3IG1 A;  4IDH A;  3I0S A;  1QSS A;  4Z0U A;  1WSJ A;  3DLK A;  4JI0 K;  1YTA A;  3WEE A;  1VSE A;  4KHY A;  1T6D A;  3KLI A;  3F73 A;  1D5A A;  4JD2 B;  3CI5 A;  3PIP L;  3EYZ A;  4DR4 K;  3O80 A;  1U49 A;  1JJ2 M;  2QWM A;  4CK2 A;  3GL1 A;  3QNO A;  3CCJ N;  1T03 A;  3DXM A;  3TSQ A;  3UKR A;  3V9Z A;  1Q81 O;  3CJ1 A;  1HNI A;  1OH6 A;  4RW4 A;  4B8A B;  4DSK A;  1R59 O;  2FSJ A;  3QET A;  4BRH A;  2O8D A;  4KHU A;  2P9K A;  3T1H K;  1RT1 A;  2HMI A;  3NDK A;  1OKJ A;  3W0L A;  1QQM A;  3V1Q A;  3MN6 A;  3PSF A;  3HP9 A;  3I8D A;  2FSN A;  3R1X A;  5C24 A;  4WF9 L;  1CXQ A;  2ASM A;  3OW2 M;  4FM1 A;  1ZBF A;  4O8K A;  1RBS A;  5E41 A;  3K59 A;  4X64 K;  4CGI A;  2Q0R A;  4B1Z A;  3M8Q A;  2ZF5 O;  4FOI A;  1HNW K;  4W5O A;  3TAP A;  4YOR A;  3NGI A;  4GVE A;  5GAH P;  4HHT A;  1TK5 A;  2HHW A;  5FPM A;  4QS9 A;  5AQP A;  5EXW A;  4X66 K;  1LW2 A;  1RDB A;  1NM1 A;  3RR8 A;  5M1F A;  2EHG A;  2P9L B;  3A5O C;  2NRZ A;  1SL1 A;  3U9Z A;  3J7A P;  3SQ4 A;  4FLZ A;  3ITH A;  1WAJ A;  4KB1 A;  4DSI A;  5KRT A;  1FKP A;  4M7X A;  2JGU A;  3FFI A;  2D0B A;  4AH9 A;  3CD6 N;  3CHW A;  3A5M C;  5AFU H;  3DAW A;  4EHU A;  4BRK A;  3AO4 A;  1QQC A;  3QB0 A;  1RNH A;  3FFK B;  4DV2 K;  1F21 A;  2XY5 A;  4YDU C;  2P5O A;  4HCB A;  3RSE A;  4CIE A;  1NJZ A;  2YNH A;  4OKK A;  2HVI A;  3VEO A;  4BQL A;  3H3N O;  1NGE A;  4ELU A;  1XHZ A;  1KVC A;  4PL8 A;  1U2V B;  1EWR A;  3TU5 A;  4CCH A;  3ATU A;  3E9P A;  1BU6 O;  1U04 A;  3WXM B;  2UXC K;  3AO5 A;  3VEZ A;  3BGR A;  3M5R A;  3TPQ A;  4OO1 J;  4NCB A;  1JL2 A;  4JKD A;  1YF5 L;  3QIP A;  3ULE A;  3ULD A;  1KLM A;  4FWQ A;  5JS1 A;  2FXU A;  2OYQ A;  5C12 A;  4FPA A;  4NCG A;  4BWM A;  4JRQ A;  3LDP A;  1BA0 A;  4DR7 K;  1BGX T;  3GBT A;  3AA4 A;  1NGA A;  4BRC A;  3GOI A;  4DFK A;  3LAK A;  4KHS A;  3TSP A;  5C15 A;  3QEV A;  3E9O A;  3LAM A;  3OY9 A;  1U4B A;  1RDW X;  3THW B;  2H3G X;  3L8B A;  1BWF O;  4FLV A;  2KLA A;  2WBN A;  4FJG A;  4FK0 A;  4IDK A;  3ATV A;  3ZT4 A;  1VSJ A;  2HF3 A;  4DF8 A;  1U6Z A;  2QKK A;  4JI7 K;  4PKH A;  4YDU A;  2OZM A;  2P9I A;  2ZD1 A;  1NGB A;  4A57 A;  2BGG A;  4JRP A;  1BCO A;  4CHN A;  3HT3 A;  2KKZ A;  3B6O A;  2I7P A;  3AO1 A;  4CZJ A;  2PAV A;  3C7N A;  4DQP A;  3AVI A;  3AVN A;  5KQD A;  4LF8 K;  5AQR A;  2XY7 A;  4CZH A;  3U6F A;  1ZBU A;  1RBU A;  1NKB A;  5JLH A;  1NGF A;  4JKC A;  3QLH A;  2R7Y A;  4OLA A;  3OBY A;  3VA3 A;  5ADX H;  1UOC A;  1NBW A;  2KFZ A;  1FK9 A;  4WFA L;  3O9S A;  1E4F T;  4K8X A;  3NHG A;  1SUQ A;  3J7Y P;  4M63 C;  3QBW A;  4K42 A;  4CEE A;  4CF9 A;  4BDZ A;  3NH1 A;  3VES A;  3CER A;  5SZT A;  4FJH A;  1REV A;  1Z26 A;  4JI5 K;  3AVL A;  4E7H A;  3HOT A;  4CHY A;  5SWM A;  3AVG A;  3QES A;  4J2E A;  4B8C A;  3T3F A;  3BF3 A;  4NXM K;  2YHB A;  3BF1 A;  4H4M A;  3AAQ A;  1MU2 A;  4GKK K;  2NNW A;  3KJV A;  5AQS A;  1VQN N;  3K5M A;  5AQY A;  4PA1 A;  3T1Y K;  2F7T A;  4DSJ A;  3G25 A;  1QZ5 A;  3MWT A;  4BC2 A;  3CFR A;  2FC0 A;  1Q8I A;  4RG8 A;  5KPZ A;  4DS4 A;  1WUA A;  5BRH A;  3CJ9 A;  2LSN A;  4ILG B;  4MLE A;  1GLB G;  3DLH A;  4R5P A;  3V1R A;  4CF8 A;  1B92 A;  1Q18 A;  4CBX A;  4GV6 A;  1KC8 O;  4CHZ A;  4B9S A;  3KK7 A;  4CJ7 A;  3CFP A;  5AQM A;  4LF9 K;  4FJ5 A;  1TKX A;  5CYQ A;  4IG0 A;  4K43 A;  3KKR A;  4KHN A;  3D2F B;  1E3M A;  4AHV A;  4E7J A;  1S3X A;  4F8R A;  1JL1 A;  4Z4F A;  1TL1 A;  3C0B A;  1YVN A;  4CJK A;  3O9R A;  4CZG A;  4BRQ A;  3LM9 A;  3ID8 A;  2PFU A;  4DTS A;  1JXB A;  3ZEU B;  4AHR A;  1BQN A;  5AJ3 K;  3ZSW A;  1JCE A;  1WBD A;  2HBJ A;  4F3T A;  1RDD A;  3R6M A;  1HYZ A;  1RDU A;  3O9Q A;  2VGM A;  4DTR A;  2HBM A;  4HVJ A;  2DPN A;  2YJF A;  4FLX A;  4FLU A;  5TKY A;  5HL7 L;  4LSN A;  2E2P A;  4IZ9 A;  4A59 A;  1HYS A;  1X1P A;  3I33 A;  3ZT2 A;  3THY A;  3DMJ A;  1ZBS A;  3MEG A;  3VN5 A;  1XWL A;  3A8Y A;  4X62 K;  4E1J A;  4JLH A;  4CD1 A;  2KZM A;  3D45 A;  4EFH A;  1VQ9 N;  3M3Z A;  5HRR A;  1Q9X A;  4YNQ A;  2QWQ A;  2KHO A;  3MEE A;  5BPN A;  5C10 A;  4Y1C A;  3PX4 A;  1MWK A;  2JWK A;  3P31 A;  3R9P A;  1K73 O;  3AAR A;  5HRS A;  5HLF A;  1NK5 A;  1RT4 A;  4EAH D;  3MX2 A;  2O8C A;  4LF6 K;  2A41 A;  5M1O A;  3HPO A;  4NO7 A;  4ZTF A;  3O1B A;  1ATR A;  1RFQ A;  4BR2 A;  4Z4I A;  3RMB A;  4BC4 A;  4KI6 A;  4E0D A;  4K25 A;  1GLL O;  5BR8 K;  4CEA A;  3CCU N;  3L3U A;  3SYZ A;  1W2B M;  2F96 A;  4CF0 A;  3G10 A;  3CXC M;  1NJW A;  3B8A X;  3QEI A;  4OX9 K;  4KI4 A;  3RRG A;  1KVA A;  1K8K A;  5E26 A;  1JLC A;  1EWQ A;  2HHV A;  2DFF A;  1VHX A;  5KGW A;  2NRX A;  4IEE A;  2NRW A;  5LY3 A;  3HXM A;  3PO5 A;  1VSL A;  3O4W A;  3HST B;  1A5W A;  1QS4 A;  4CJS A;  4N5S A;  4CJE A;  4CK1 A;  1KQS M;  4O44 A;  1HMV A;  1LAV A;  3EO3 A;  3NGZ A;  3L2V A;  4GNI A;  1S9E A;  1ZC6 A;  1LWC A;  1YHQ N;  5CZ1 A;  3FZK A;  3CQ8 A;  3L2R A;  1IJJ A;  4CZK A;  3VQB A;  1DLO A;  3KK1 A;  1VSM A;  3D6R A;  4CZE A;  4NLB A;  4DTO A;  4DQS A;  1N6Q A;  1I3A A;  3AAP A;  2YHX A;  4DR2 K;  2GUP A;  1HRH A;  1BHL A;  4WFN L;  3H46 O;  4GKJ K;  1KXP A;  3U9D A;  3ZT1 A;  1KCF A;  3O1W A;  4AM6 A;  1GLE G;  1CZA N;  2QKB A;  1NWK A;  4CEC A;  3L2U A;  4BRN A;  4ELV A;  1FJG K;  4GY2 B;  1MA9 B;  3LP0 A;  1C1A A;  4BR4 A;  3CJA A;  4YFU A;  1IKV A;  2VWJ A;  3VMF B;  4FLT A;  1UA1 A;  4I9Q A;  1X9W A;  1JLB A;  3EE8 A;  4LF5 K;  3TAR A;  5AFU A;  3FZF A;  1NKC A;  3VF4 A;  3DYA A;  1NGJ A;  5KRS A;  1Q9Y A;  1NK0 A;  2G8V A;  4KB0 A;  3RMC A;  4NYN A;  1HUX A;  4W5R A;  4DV3 K;  1ASV A;  1IG8 A;  2E5L K;  1Z25 A;  3OYH A;  4DV6 K;  4F2R A;  2F8T A;  1FW6 A;  2QI2 A;  1L3S A;  4B1Y B;  3G6E N;  4DQI A;  3M8P A;  3P83 D;  3AGK A;  2IGI A;  3CC7 N;  4ILJ A;  3TAM A;  4W5T A;  4JK7 A;  3TAN A;  4KKO A;  5FPN A;  4CBW A;  1TV6 A;  3JYT A;  3ZSX A;  3LWL A;  5ELZ A;  1X3M A;  2UXB K;  5B8H A;  3SV3 A;  3CQY A;  4J2B A;  3K9J A;  4JK9 A;  3MX5 A;  3PLA A;  1J6Z A;  2IVP A;  4BY9 C;  2QEX N;  1ATN A;  5LL6 Z;  1QSY A;  2FBY A;  1NGG A;  1LCU A;  1W9H A;  5BN8 A;  3AV9 A;  3ZT0 A;  4KRE A;  4FVM A;  4JKG B;  3CPE A;  3VEN A;  4JD2 A;  1G99 A;  1JCF A;  4DU1 A;  2BDP A;  4X65 K;  4HWI A;  3J80 O;  4I6M A;  1XC9 A;  3VTI A;  1VQ6 N;  3OYJ A;  3C65 A;  3V6D A;  4ELT A;  4A62 A;  4DG1 A;  4ISG A;  4LSL A;  4C8N A;  3SMP A;  4CZL A;  1NGC A;  4CJT A;  4CI6 A;  1D9D A;  2NRV A;  2A1S A;  5C25 A;  4LH4 A;  1XC3 A;  5BRE A;  3ZLJ A;  1NGD A;  3AA3 A;  3A2F A;  1EKE A;  3LDQ A;  3CMA N;  4BGB A;  4CFA A;  3K0S A;  4BRL A;  2KFN A;  1RT3 A;  3KD1 E;  1JCG A;  4FPB A;  1W7A A;  4DSL A;  1YJ9 N;  2ETJ A;  4KFB A;  1RDA A;  5AZI B;  1NJI O;  1QTM A;  2HVH A;  2IIR A;  1I39 A;  3L2Q A;  4LH5 A;  4DLE A;  1T05 A;  3QIN A;  3V9W A;  3PX0 A;  3BZK A;  3E9L A;  1T7P A;  4LF7 K;  3P5J A;  2YNI A;  2I7N A;  1RIL A;  4IBN A;  1HJR A;  2Z1G A;  3SUO A;  4JKF A;  4DF4 A;  3HTV A;  4BE2 A;  2P9L A;  1BL3 A;  2WTU A;  4B3R K;  3VEW A;  1HJO A;  2O8B B;  4FCY A;  4B3S K;  4J2D A;  1YVU A;  3V1O A;  1RT6 A;  1SL0 A;  3VF2 A;  2X6S A;  3UB5 A;  3FZH A;  3IFR A;  5FPD A;  3WQT A;  1N34 K;  3JAM O;  3AVA A;  2D0C A;  1HNX K;  4CEO A;  4KV8 A;  3QEW A;  1U45 A;  4AHT A;  1FXX A;  3C94 A;  3QEX A;  4BR0 A;  4MQ3 A;  1MDU B;  4PWD A;  2AA4 A;  3DJC A;  3PO4 A;  4FWL A;  3UE5 A;  2GEL A;  4DQQ A;  3O6W A;  4UQG A;  2V7Z A;  4YOU A;  3O08 A;  3WNF A;  5EVZ A;  3UKU B;  3OYK A;  2FSK A;  3QBX A;  4KPY A;  2Y1I A;  3OS2 A;  3SQ0 A;  4C8O A;  3O4N A;  2HHT A;  2YX6 A;  3VQE A;  1S9G A;  3FGU A;  4MDB A;  3VTH A;  1NJX A;  4F3O A;  4I2P A;  2RKI A;  4C23 A;  4ZHR A;  1JXE A;  3L3V A;  3GG4 A;  2DTU A;  4IFV A;  1QSL A;  3B6P A;  3MWP A;  4KH4 A;  3ZET B;  4J8F A;  3SPZ A;  4H0Y B;  3OYG A;  3HZ6 A;  4CVN E;  1HKC A;  4CJL A;  2UUA K;  3T69 A;  2F8S A;  3FLC O;  2OAN A;  4RW7 A;  4CJU A;  3DM2 A;  4WQ5 C;  3OYD A;  5LJW A;  3VQ4 A;  3PY8 A;  2OPS A;  3AVC A;  5EU7 A;  2I5J A;  3AY9 A;  3THW A;  1YI2 N;  4DQR A;  1SAZ A;  2VQE K;  2ASO A;  2HNZ A;  3SUQ A;  2P51 A;  2UUC K;  4UY8 O;  2YJE A;  4K41 A;  4RW6 A;  1GLJ O;  2GTD A;  3WNH A;  4N41 A;  1SQK A;  3D2E B;  3VGL A;  1S1U A;  1HKB A;  4KH6 A;  4BG9 A;  3LDS A;  1L3V A;  4FVU A;  1C0M A;  3DXK B;  1QVF M;  4MFB A;  1RBV A;  4IJA A;  2IVO A;  5AZJ B;  4FWP A;  4E19 A;  5BN9 A;  3EKU A;  4BRI A;  5KPT A;  4E89 A;  3OYN A;  1NMN A;  4EZ9 A;  4XH4 A;  3D7E O;  3TTC A;  3I56 N;  5CE3 A;  4DKW A;  1KRP A;  4B9U A;  2NZT A;  2NUB A;  3KZB A;  2GWJ A;  4CJP A;  5M1Q A;  2IVN A;  3VQC A;  4JYA K;  3QNN A;  3K57 A;  3Q7B A;  5CZ2 A;  1J5O A;  4F4K A;  4PKI A;  2YHY A;  4H5V A;  2B6A A;  1NK8 A;  5AQJ A;  2HHH K;  1ILY A;  1J9A A;  4NYF A;  5KGX A;  4DU4 A;  2D5R A;  1EO1 A;  2YHA A;  5J2P A;  4ID5 A;  4MLH A;  3PV8 A;  1GLF O;  4Y0W A;  2YNF A;  5JVG L;  1VSD A;  3SK3 A;  3VOV A;  2GWK A;  5AQL A;  2OPP A;  2E2O A;  4BVP A;  1CZ9 A;  4KO0 A;  5I42 A;  3ID6 A;  4DFJ A;  4DV1 K;  4GV3 A;  4I7F A;  3QO9 A;  4M3R A;  2ASP A;  4FJJ A;  1C0U A;  4CW7 B;  2ZQB A;  2VYP A;  3LPT A;  1RTD A;  3T19 A;  4FM2 A;  4CD3 A;  4BE0 A;  3KWI A;  3VQD A;  1HPZ A;  4JHD B;  4CER A;  4FO0 A;  3O4Q A;  2XY6 A;  2B4J A;  4Y1D A;  3ZSY A;  4A5B A;  1WSG A;  3D2F A;  3LP2 A;  2P9S B;  3GDQ A;  3TWH A;  5EY4 A;  3LZI A;  3MCP A;  1J5E K;  3SZ2 A;  1C0G A;  3DRS A;  1DKG D;  1RTJ A;  1VSI A;  4BWJ A;  1YAG A;  4H03 B;  3KLF A;  3U8X A;  2QWP A;  1WSE A;  3SAF A;  1VK0 A;  3V9S A;  4M3T A;  4KAZ A;  2CH5 A;  2UXD K;  4NLC A;  3I8B A;  4JI8 K;  4G1Q A;  4OPJ A;  4M3X A;  2FF6 A;  2DFH A;  3AO3 A;  5LMU K;  4JKA A;  1TL3 A;  1SKS A;  3MN7 A;  3V81 A;  1M90 O;  3NE6 A;  2XY8 A;  4HTL A;  1EQY A;  4TSX A;  3WXJ A;  4GMJ B;  2O8E B;  1NG9 A;  3MXI A;  4DB3 A;  4WCE L;  1EX4 A;  1Z05 A;  2GX9 A;  3L4Q A;  2WFB A;  4PY5 A;  1NOY A;  3ULE B;  4Q0B A;  2BTF A;  4XH1 A;  5GAD P;  1C0T A;  1TKT A;  3CC4 N;  3QML A;  3U3Y A;  4BG8 A;  1T6C A;  5EX5 A;  3SUN A;  4MO5 A;  3MN9 A;  1QVG M;  3ZYY X;  2HF4 A;  4AF1 A;  2NLX A;  2Q2R A;  2RHK A;  4OGE A;  4HUG A;  1S72 N;  5KTQ A;  1ZBH A;  3FZL A;  1RBT A;  4DHY A;  2PY5 A;  4FJX A;  4RW8 A;  4BR5 A;  2WUS A;  4M41 A;  1Q82 O;  1YJN N;  2Z1H A;  3A5L C;  4CGJ A;  2HW3 A;  2W41 A;  5J2M A;  4CJ5 A;  4AQY K;  2XHB A;  4QAG A;  3DI6 A;  3HI0 A;  4B3M K;  4CF2 A;  3K2P A;  3S41 A;  5HP1 A;  1VQK N;  1B9F A;  4DTP A;  2F9W A;  1BA1 A;  4H0V B;  4E7L A;  3AA5 X;  4E7I A;  3QFP A;  4FJ8 A;  4CE9 A;  4JK8 A;  3SLC A;  2P9N B;  4DCH A;  5F1X A;  4FJK A;  3BP8 A; 
#chains in the Genus database with same CATH homology
 1H1V A;  1HUX A;  4JD2 B;  3CI5 A;  4JN4 A;  4BRO A;  5BR9 A;  3PIP L;  1KAY A;  1IG8 A;  1QQO A;  3O80 A;  2FLO A;  4KBO A;  1XUP O;  4OPA A;  1JJ2 M;  2QWM A;  3CCE N;  3GL1 A;  2QA4 N;  3CCJ N;  2VGN A;  3DXM A;  3TSQ A;  5AQH A;  3UKR A;  2QI2 A;  2QW9 A;  1Q81 O;  3E66 A;  3CJ1 A;  3F2K A;  3QIC A;  3AGR A;  4B1Y B;  3G6E N;  1R59 O;  2FSJ A;  4BRH A;  3MCA B;  4H5N A;  3AGK A;  3R3L A;  2A42 A;  2P9K A;  5I9E B;  4ILJ A;  4QS7 A;  3MMV A;  4A2A A;  5FPE A;  1ATS A;  4JK7 A;  1OKJ A;  1YIT N;  5FPN A;  3W0L A;  4CBW A;  3CPW M;  1QQM A;  2ZWH A;  4PL7 A;  1QHA A;  3KVG A;  4IO8 A;  3MN6 A;  4G9Z A;  5ELZ A;  2FSN A;  1X3M A;  3R1X A;  3ZEU A;  1MWM A;  5B8H A;  3HOS A;  3CQY A;  2P9U B;  4WF9 L;  4JKE A;  5CHI A;  3K9J A;  2ASM A;  4JK9 A;  1TYQ B;  2A40 A;  3MX5 A;  4H0P A;  3OW2 M;  3JXU A;  4BGA A;  3PLA A;  1J6Z A;  2IVP A;  4O8K A;  4BY9 C;  3CCV N;  2QEX N;  3NMU A;  3RSE B;  2Q0R A;  1ATN A;  3CCM N;  4B1Z A;  2ZJP L;  1NGG A;  2P9N A;  1LCU A;  2ZF5 O;  4FOI A;  1VQP N;  5BN8 A;  4BQZ A;  3P4I A;  5AQW A;  1VQL N;  4JKG B;  1BG3 A;  3CPE A;  4YOR A;  1XQS C;  3ZX2 A;  3VEN A;  1S22 A;  4GVE A;  4JD2 A;  1G99 A;  4JKH A;  5GAH P;  1VQM N;  3I55 N;  1JCF A;  2Q0U A;  2UYT A;  4HWI A;  5FPM A;  3F5T A;  4I6M A;  4QS9 A;  5AQP A;  5EXW A;  1QZ6 A;  3VGK A;  1YJW N;  5C2D A;  1NM1 A;  3LDL A;  3WQU A;  3H1Q A;  2NRR A;  5M1F A;  3LL3 A;  2P9L B;  3A5O C;  2NRZ A;  2CGJ A;  3VTI A;  1VQ6 N;  1Z6R A;  3C65 A;  3U9Z A;  5AQU A;  4JKB A;  5GAG P;  4A62 A;  3CJB A;  3O8M A;  3CCS N;  5BRD A;  1HPM A;  4ISG A;  1K9M O;  4YOW A;  4CZL A;  2FF3 B;  3SMP A;  5HOO A;  1NGC A;  2VCP A;  1VQO N;  4M7X A;  3QDK A;  3E1Y A;  4CI6 A;  2D4W A;  2E1Y A;  2NRV A;  1GLC G;  4FWN A;  3CD6 N;  3CHW A;  1XC3 A;  1E4G T;  1OVY A;  3DLL L;  5BRE A;  3A5M C;  5AFU H;  1NGD A;  3DAW A;  4EHU A;  2P9U A;  3LDQ A;  4BRK A;  3CMA N;  2HOE A;  4IO9 L;  1TUY A;  2F9T A;  4BGB A;  1TYQ A;  3N4P A;  3QB0 A;  3FFK B;  2Q1N A;  2QM1 A;  5AQT A;  4YDU C;  4BRL A;  3RSE A;  3H1V X;  3CCQ N;  4BC5 A;  3ZX3 A;  1Q7Y O;  1JCG A;  4FPB A;  3SAG A;  3A5N C;  1BDG A;  3P39 A;  1YJ9 N;  2BUP A;  3QFU A;  3VEO A;  4BQL A;  3EKS A;  3H3N O;  1NGE A;  4JKG A;  5AZI B;  3SJH A;  3VEV A;  1NJI O;  2IIR A;  1VAZ A;  3G71 N;  3FE1 A;  4PL8 A;  4DQ8 A;  1U2V B;  2P9I B;  1RGI A;  3E9L A;  3M6G A;  3TU5 A;  3ATU A;  3E9P A;  2GEM A;  1BU6 O;  3LDN A;  3VGM A;  3WXM B;  2I7N A;  4C1N K;  2ZJQ L;  1Q86 O;  3IKM A;  3EN9 A;  4JKF A;  3VEZ A;  3HTV A;  3C7N B;  3M5R A;  3TPQ A;  2P9L A;  3WXI A;  1N8R O;  4OO1 J;  1HX1 A;  1HJO A;  3VEW A;  1SZ2 A;  5JLF A;  4H0T B;  2YI1 A;  3WT0 A;  4JKD A;  1YF5 L;  3ULE A;  3VF2 A;  3GE1 A;  2A6A A;  2EWS A;  4FWQ A;  1GLD G;  2FXU A;  5C12 A;  4FPA A;  3UB5 A;  3FZH A;  3LDP A;  5AQI A;  1BA0 A;  5AQN A;  3GBT A;  3IFR A;  5FPD A;  3CF5 L;  4FWO A;  3WQT A;  1NGA A;  4BRC A;  3GOI A;  3K9K A;  2NRH A;  5AQF A;  4Z94 A;  2WC9 A;  2CGL A;  3TSP A;  5C15 A;  3E9O A;  2V7Y A;  4B1V A;  5LJV A;  1RDW X;  4H5W A;  2H3G X;  1BWF O;  4BR0 A;  1MDU B;  2AA4 A;  2KLA A;  2WBN A;  3DJC A;  4FWL A;  3UE5 A;  1O13 A;  3CET A;  2GEL A;  3ATV A;  3J8A A;  2HF3 A;  2V51 B;  3O6W A;  3A0I X;  5AZI A;  4ISE A;  1U6Z A;  3W3D A;  2V7Z A;  4YOU A;  1DGK N;  1BOT O;  3O08 A;  4PKH A;  4YDU A;  2V52 B;  2P9I A;  3KHY A;  3EZW A;  5EVZ A;  3UKU B;  4WFB L;  1NGB A;  2FSK A;  1YUW A;  3OHR A;  3QBX A;  4A57 A;  4R79 A;  3N4Q A;  2YX6 A;  2KKZ A;  2I7P A;  3FGU A;  2AP1 A;  4XEI A;  4MDB A;  3R8E A;  3VTH A;  4B9Q A;  2YHW A;  4CZJ A;  2PAV A;  3C7N A;  4C23 A;  2QWL A;  5GAE P;  4H0X B;  4BR7 A;  1V4S A;  5KQD A;  3GG4 A;  5AQR A;  3VEX A;  4H0O A;  4CZH A;  3FZM A;  3MWP A;  4CZM A;  5M1K A;  4KH4 A;  3ZET B;  4J8F A;  5JLH A;  1NGF A;  4H0Y B;  4IWV A;  3HZ6 A;  1HKC A;  5EOY A;  4BRD A;  4JKC A;  5F2R A;  1T44 A;  3OBY A;  3T69 A;  4FWS A;  5ADX H;  2E8A A;  3FLC O;  1NBW A;  2OTL N;  5C0Y A;  2OAN A;  2D1K A;  4WFA L;  3O9S A;  1E4F T;  1HLU A;  1VQ7 N;  1V4T A;  3L6Q A;  4WQ5 C;  4IFE A;  4M63 C;  5LJW A;  3QBW A;  4K42 A;  3FR0 A;  4IEI A;  1ZXO A;  3L0Q A;  3OA9 A;  1P8Z A;  3AY9 A;  3VES A;  3CER A;  4JAX A;  1W97 L;  1NMD A;  4BRA A;  5AQO A;  1YI2 N;  1K8A O;  1SAZ A;  2E1Z A;  3MDQ A;  4MO4 A;  2ASO A;  3HOT A;  4B1W B;  4UY8 O;  2YJE A;  4K41 A;  1GLJ O;  2D0P A;  2GTD A;  3BUZ B;  3OBW A;  3BF3 A;  4MDA A;  3WXK A;  1SQK A;  3D2E B;  3VGL A;  4LC9 B;  1HKB A;  4KH6 A;  4BG9 A;  3UKU A;  1VQ5 N;  4FVU A;  5DM6 L;  2A3Z A;  2HMP A;  3BF1 A;  4F9O A;  3DXK B;  3AAQ A;  5AQZ A;  1QVF M;  2ITM A;  2NNW A;  4IJA A;  5ADX A;  2IVO A;  5AZJ B;  5AQS A;  3SMS A;  4FWP A;  1VQN N;  5MLC Q;  5AQY A;  5BN9 A;  2F7T A;  4B1U B;  3LDO A;  3EKU A;  3JS6 A;  3T7Z A;  3VET A;  4BRI A;  4BRP A;  5JMV A;  5KPT A;  3KWG A;  3G25 A;  1QZ5 A;  4IOX A;  4XH4 A;  3ZET A;  4IXC A;  2QXL A;  3D7E O;  3MWT A;  3TTC A;  4BC2 A;  3I56 N;  5CE3 A;  1NGI A;  4DKW A;  5KPZ A;  2NZT A;  1WUA A;  4WQ4 C;  4CZI A;  2ZJR L;  5BRH A;  3DWL A;  2W40 A;  4O8U A;  3KZB A;  2RE2 A;  3NVK A;  2E2Q A;  3CJ9 A;  1VQ8 N;  4JEP A;  2GWJ A;  4ILG B;  4MLE A;  3ENH A;  1GLB G;  5C2F A;  2QWR A;  3WUH A;  5M1Q A;  3SAH A;  4CBX A;  1Q18 A;  2IVN A;  4GV6 A;  1KC8 O;  4NB4 A;  4EHT A;  1P90 A;  3BEX A;  4ILH A;  2P9P B;  3KK7 A;  3Q7B A;  2E88 A;  4IJN A;  4CJ7 A;  1BO5 O;  5AQM A;  4PKI A;  2YHY A;  2YCH A;  4H5V A;  4FWK A;  5AQJ A;  1X9J A;  3CC2 N;  4K43 A;  5KPR A;  3CC7 N;  1ILY A;  3D2F B;  3D2E A;  1S3X A;  1EO1 A;  3C0B A;  4MLH A;  1YVN A;  4FOE A;  3DXK A;  1GLF O;  2Q97 A;  3MK6 A;  3O9R A;  3WXL A;  4BRQ A;  4CZG A;  3LM9 A;  4Y0W A;  3ID8 A;  5TKW A;  4C1N I;  2CH6 A;  2PFU A;  3VF6 A;  5AZJ A;  5GIP A;  5JVG L;  3ZEU B;  3SK3 A;  2D0O A;  4KH5 A;  5JIC A;  4O5F A;  3C6A A;  4BR9 A;  4BRF A;  3CJ7 A;  3O5B A;  3VOV A;  2GWK A;  4YOX A;  1JCE A;  5AQL A;  5BPL A;  2E2O A;  1DT9 A;  2HBJ A;  3H3O B;  3Q7C A;  4BVP A;  2VWB A;  4A61 A;  3R6M A;  1RDU A;  2QWN A;  3O9Q A;  2VGM A;  3ID6 A;  2HBM A;  1TUU A;  2DPN A;  2YJF A;  4GV3 A;  1Y64 A;  2ASP A;  2E20 A;  5TKY A;  5HL7 L;  4A59 A;  2E2P A;  2VYP A;  4IZ9 A;  5BRF A;  5KQ8 A;  1D4X A;  4GV9 A;  1K8K B;  1U2V A;  3I33 A;  3MN5 A;  3ZX0 A;  5AQX A;  4CD3 A;  4XH5 A;  1ZBS A;  4I6M B;  3KWI A;  3A8Y A;  2P9P A;  4E1J A;  4PKG A;  1SS6 A;  3C6H A;  4JHD B;  4WQ4 A;  4BVO A;  2E2N A;  3HSC A;  3VEY A;  4CD1 A;  1VQ4 N;  4FO0 A;  4EFH A;  5GIN A;  4PHT X;  1VQ9 N;  3M3Z A;  4OPH A;  1C0F A;  2QWQ A;  2KHO A;  5BPN A;  3IUC A;  2Q31 A;  1KAZ A;  4A5B A;  5C10 A;  4YOT A;  3D2F A;  2P9S B;  3GDQ A;  3CIP A;  1MWK A;  2JWK A;  4RCH A;  5EY4 A;  3P31 A;  3MCP A;  3R9P A;  1C0G A;  2HBL A;  4M7Y A;  1WOQ A;  1K73 O;  3AAR A;  1DKG D;  1NGH A;  3ENO A;  4EAH D;  4BRM A;  3MX2 A;  5BPM A;  3U4L A;  1YAG A;  4H03 B;  3U8X A;  3EL2 A;  2A41 A;  2QWP A;  5M1O A;  1GLA G;  4NO7 A;  5GIO A;  5AQV A;  3O1B A;  3SAF A;  3G4S N;  1ATR A;  1RFQ A;  3CJC A;  1YXQ A;  4BR2 A;  3HBT A;  4BC4 A;  2J4R A;  2CH5 A;  3F9M A;  4K25 A;  1GLL O;  3J7Z O;  4NLC A;  3I8B A;  3NVM A;  3TSU A;  4FL9 A;  4YOY A;  3CCU N;  5H1S Q;  4IOC L;  1W2B M;  4CZF A;  2FF6 A;  4CBU A;  3CXC M;  3B8A X;  3L4I A;  4JKA A;  3MN7 A;  1YIJ N;  1K8K A;  1M90 O;  3CQX A;  3CCL N;  5AQG A;  5E26 A;  5DM7 L;  3IMX A;  4HTL A;  1EQY A;  3SBG A;  2OTJ N;  1T3V A;  3WXJ A;  2NRX A;  4A2B A;  4IEE A;  4L3Q A;  2NRW A;  3M1F A;  5LY3 A;  4BC3 A;  4JHD A;  3CCR N;  4A5A A;  2Q36 A;  3WEE B;  3O4W A;  4DB3 A;  2HBK A;  4WCE L;  1Z05 A;  2GX9 A;  3L4Q A;  2WFB A;  1X3N A;  2JWL A;  3TTF A;  3ULE B;  1KQS M;  3EO3 A;  2BTF A;  2P9S A;  4GNI A;  4XH1 A;  1ZC6 A;  5AQK A;  5GAD P;  1YHQ N;  3FZK A;  4ISF A;  3CC4 N;  3QML A;  3RVC A;  4AM7 A;  1HKG A;  1T6C A;  5EX5 A;  4BG8 A;  5F0X A;  4RWT A;  2NRT A;  1IJJ A;  3P38 A;  4MO5 A;  4CZK A;  3MN9 A;  3VER A;  1QVG M;  3VPZ A;  2HF4 A;  3ZYY X;  4AF1 A;  1NLV A;  3D6R A;  3SBT A;  3IDH A;  4CZE A;  4NLB A;  2CGK A;  4U7B A;  5AQQ A;  2NLX A;  2QWO A;  4RTF D;  1LOT B;  3AAP A;  3ENB A;  2Q2R A;  2YHX A;  2RHK A;  3DXM B;  3HM8 A;  5CR4 A;  1S72 N;  3PIO L;  2GUP A;  3LM2 A;  3UKR B;  1ESV A;  2ZGY A;  3FZL A;  5AR0 A;  4DHY A;  4U67 L;  4WFN L;  1BUP A;  1DEJ A;  3H46 O;  4FWM A;  4BR5 A;  5E84 A;  4YOV A;  1M1K O;  5M1N A;  2WUS A;  1KXP A;  4WQ5 A;  3CME N;  3U9D A;  1Q82 O;  2PBD A;  4FSV A;  3O1W A;  4JNE A;  4AM6 A;  1GLE G;  2HST A;  2P9K B;  1CZA N;  4B1X B;  3A5L C;  1NWK A;  3O9T A;  4QS8 A;  1YJN N;  2ZGZ A;  2BH1 A;  4BRN A;  2W41 A;  3H6E A;  4GY2 B;  1KAX A;  1MA9 B;  4BR4 A;  3CJA A;  3HI0 A;  3HRG A;  4FWR A;  4H5T A;  5JVH L;  3EE9 A;  4IDH A;  3S41 A;  1VQK N;  3VMF B;  3H45 C;  1KD1 O;  4H5R A;  2F9W A;  1BA1 A;  4H0V B;  3TTD A;  3EE8 A;  4BRE A;  4IOA L;  2QTD A;  3QFP A;  3WEE A;  5AFU A;  3O9U A;  4BRG A;  1T6D A;  2A5X A;  3FZF A;  1QQN A;  4JK8 A;  3VF4 A;  3SLC A;  5M1P A;  2P9N B;  4DCH A;  1NGJ A;  5F1X A;  3BP8 A;  4WYB A;  4EIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...