2QM4A

Crystal structure of human xlf/cernunnos, a non-homologous end-joining factor
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
232
structure length
232
Chain Sequence
SGMEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human XLF/Cernunnos reveals unexpected differences from XRCC4 with implications for NHEJ.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Recombination
molecule keywords Non-homologous end-joining factor 1
total genus 59
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2qm4A02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 2qm4A01
2QM4A 3II6A 2R9AA 5CJ0A 3RWRD 3RWRA 5CHXA 3MUDA 1M5IA 1FU1A 5CJ4A 3SR2A 4XA4A 3SR2C 1IK9A 1KU9A
chains in the Genus database with same CATH superfamily
1U97A 1L1FA 3K79A 3B2EE 4JGSA 4FM2A 3E8BA 3SJQC 3TGUH 2DWEC 4DV6B 1HWYA 2GHYA 1QQCA 2DYSB 3LNMB 4PA3A 1NQTA 2CUGA 3HKBA 3WB1A 1B04A 4JI7B 4DV6O 3AK3A 3ZJZA 4WCEV 1NTZH 2NN4A 1BQ0A 3ZRSA 1PL0A 1OZ0A 1JOYA 3CMAV 2CDYA 3W7UA 4DK0A 3CS5A 4J11A 1MG1A 4G2KA 3WG7C 1K33A 3OM3B 4O4HB 1XILA 3B40A 3X2QB 2QTSA 1JPXA 2R70A 2EIKC 1A32A 1US6A 2XAHA 4OPAA 5JJJB 1SS3A 3OGIB 4P2ZA 2YICA 1VQMV 1YDXA 3SJAC 2ZIMA 3E22A 3CCLV 4IL6Z 2JK5C 4LFBB 1AR4A 3OMAB 1Y67A 1QCEA 2W6IG 5EZYA 2DJVA 1S72V 2PUSA 5B1BC 1ZSPA 3ETQA 3CCEV 3KG2A 2QEXV 1D2DA 3VOUA 4XA4A 3AG4C 3BY6A 1OCCC 3TCUA 4LFCO 3STZC 1Y76A 4YIPA 2D2CB 2XTAA 1HNXO 1AI4A 1AP5A 3JATA 2F1MA 2WLIB 1Q6HA 3AG1B 5C8YA 3IC7A 4UFZA 2Y4UA 1VQ9V 3G67A 4TV9B 1SRYA 4YXWG 3JD2A 4JI4O 3CWBH 3JYCA 1MABG 2IBZH 2ZKOA 4F6EA 2EJ7A 4Z1MG 5IJ0B 1WNSA 2E5LB 3GWOA 4WFFA 2K1EA 1VQ6V 1FAFA 3UKMA 4LNUB 1RM1B 1EFRG 4GT1A 3HKDB 2YI8A 1XL4A 2Q69A 2CGOA 5EK0A 3K57A 3DXRB 3Q4HA 4AILC 2LQTA 4FM0A 2DYRB 4JI2O 4PELA 1D5NA 3CC7V 1H2NA 3K06A 1O9GA 3PYIA 4X89A 3H1IH 1SQQH 2HP8A 1CP9A 5JCOC 1N0NA 1SERA 1ORQC 2DWDC 1K7DA 1BL8A 4YHHB 4LH7A 3DC5A 3W7XA 3GWKC 2PF4E 1S5LZ 2GBOA 2A9HA 4NB5A 4TWKA 3AK2A 4PDLA 5EBMC 4EEQA 3OMNB 3IC9A 1Y4MA 3UM7A 3FB7C 2OIGA 4WFBV 4DR3B 3H1KH 2Z3YA 2LP7A 4B3MO 4PI2A 1YITV 3HPLC 3ZMSA 2WWWA 1IXMA 2P06A 1NVPD 4X1YB 5JJEB 4GX2A 1I94B 4QPJA 4UUJC 2UUCB 3W7WA 4TUYA 1PD3A 1TVKB 1FXKA 2LO1A 2EILC 3CCUV 1NH2D 4NKGB 3F7VC 1XMQO 4EKWA 4H33A 2VQEO 3CRCA 2P22C 2M6YA 2WLNA 4MVQA 4QGPA 1K4DC 5JWPA 5H9CA 1M57B 3H9VA 2JGUA 3FYIB 1LUWA 4X62B 4NXMO 3AK1A 5GTHZ 3G80A 5IYBO 5CN0A 2WLLA 1AILA 1G4YB 1MOFA 2JIZG 2QWNB 3OTOB 1G1XB 3M7MX 4KHPO 2QE7G 5BY1A 2MK3A 3M99B 2AHYA 5BXZA 2UU9O 4O2AA 3CYOA 3APOA 3HKEB 1NZ6A 3SDLA 2JEXA 2ETNA 4UCVA 4WFGA 3SYQA 3KCXA 1S5HC 4LF8B 2CH7B 3JAWA 5EBLC 1W0KG 1EN4A 3MUDA 3CRAA 2P5OA 2Q6AA 4J7ZA 1FU1A 2IH3C 1UJWB 2UXNA 5EIBC 4O4LB 1SQBH 2IH1C 1E1RG 1VIBA 4YJ2B 3L72H 3OTFA 1ZL8A 2YUAA 2ZM6O 2LW7A 3VBBA 4NTYA 4BR6A 4IIJA 1NU1H 5GONA 4JI5B 4OX9B 1IBKB 2ZT9B 1ZAUA 3OT7A 1XREA 4B3TO 5E1AC 3UO3A 2KG7B 4DK1A 3VQWA 4KFMA 3ETGA 3T1HO 1NI8A 1B06A 3NXSA 1ZTEA 5EBWC 4K3AA 1F4NA 2CTQA 2PZSA 1J5EO 2Q68A 4FLTA 5LXTB 1I0HA 1HNXB 1YSCA 3J7AU 1WPXA 3T2MA 4FK5C 4O4HA 4I0XB 2B9ZA 3RVZA 1N32O 5KMGB 3RWRD 5L3BA 4JI3O 4ZI7B 1ZUQA 4RWUA 3E22B 2Y48A 5FNVA 1KECA 2B1GA 5GW7A 4FVMA 4KUMA 1THZA 3ABTA 5EC2C 1D5AA 3W7SA 2QWQB 3B4SA 1V55B 4B7KA 1H2KA 4DO2A 1SQVH 1OCCB 4ZOLB 4LFAB 4LR3A 4YY3B 2WA3A 3ZHRA 3RFRA 3OEHG 1QR8A 1ENVA 1AROP 1OCRB 1GM7A 3HKEA 3SYPA 4FM1A 3ZHQA 3JAMN 4K8XA 1OCZB 4MW3A 4LFBO 1X4TA 3AG4B 5GONB 3K58A 4PV1B 5CBGA 2NR5A 3ZBHA 4EB6B 4FFBA 5KHGA 4XDJA 4PDVA 2CTPA 3JALA 2QJ1A 4X1KA 1AI7A 2QSAA 2QGNA 2HHHB 5E79Z 4JASA 2A3QA 5IY5C 5LA6B 2IM9A 3ASNC 5KAFZ 1PNMA 1OCOC 2X0LA 4DR3O 3MDSA 4UCUA 3F7YC 1BCCH 3D3IA 2RJZA 2ITCC 4GEUA 1GN6A 4NR1A 5J2UA 2DYRC 4LF4O 3G6BA 4YIOA 3JASA 2X7RB 1JQ0A 5KX5B 1VARA 1B6QA 4FFKA 1W2BU 1R6KA 3T1HB 3ZEDA 3F5WC 4DUZB 3B09A 1BSMA 2F93B 2JRIA 3H1JH 4EFBA 2PI4A 4FJCC 5LOVB 1MSDA 1R6NA 4CS3A 1FFXA 1H38A 1KBHA 1KP2A 2EIJC 3OEEG 1F7YA 1SA0A 5BZBA 2WSSG 2ZINA 1YCIA 1BGYH 3X2QC 4ABMA 2B5UA 3ZHVA 4IYIA 4RUEA 3AG3C 1SESA 5CJ0A 1HNZB 2KKWA 3CCRV 3SPIA 2EJRA 1R3LC 1S76D 4O4JA 1N36O 1AI6A 3OW2U 5B1NA 5LYJB 1Z2GA 3D36A 3PN1A 2UU9B 1XOUA 4MVMA 1N33B 4JI0B 1FD9A 2DW4A 4DUYO 2ADQB 4DR2O 4U3JA 3RT3C 2JEUA 1VF7A 1E1QG 3MHHC 3E83A 4NTWA 2RNBA 1QVGU 1JJOA 2AGAA 3QNEA 4DV0O 1Y6XA 4DV3O 4B3SO 1H8HG 2BTQB 4LCUC 4DR6B 2LW1A 3ZMZA 1XNRB 1Y76B 3FAVB 3HKCA 4GX1A 1MNGA 4I50B 1YTFB 2XT9A 5DN6G 4GFCA 3AG1C 2HKOA 5C93A 1MSWD 2W0XA 4OXSA 4AI8A 3ETDA 3JAKB 1IBKO 2WLMA 4KP4A 4NVPA 3MD0A 5JQGA 1RPRA 3JAWB 2EINB 1AVMA 5A2QN 2CK3G 1O9HA 2YXHA 4X8AA 1K34A 1WB7A 5IE9A 4XBFA 2ILMA 1KU9A 2JJ1G 3BAAA 5B3SB 5CJ4A 4DW1A 2E3CA 2LFRA 4JV5O 3QO5A 5CB4B 4GCZA 1N4CA 3CRRA 3T4DA 2ZR3A 3E2EA 1L8DA 1I5XA 1WB8A 3E8HA 1OJHA 4KHPB 2IJHA 3BRCA 3ZS8C 1SF9A 2ZCEA 1AJPA 2H8PC 3S3WA 1VQLV 1XMOO 2JGDA 3T1YB 4A5UB 4R8CA 4N21A 2ZDIA 3L9DA 3RW0A 3A0RA 2OT5A 4I4TA 3FB5C 2XHBA 1BHBA 4LF9B 4X1YA 4UXNA 5EIBD 1VQ5V 5L3GA 1V55C 4RO2A 3CC4V 1YTFD 3ZN1A 4I50A 4DV3B 3RYHA 3C3TA 3K5OA 2Q0OC 2XNDG 4B3RB 3ABKB 2A06H 2KQXA 2XAGA 4X1KB 1OCZC 2YSUB 2CTWA 2XAFA 2HJFC 5IJ9A 4B3RO 4GKKB 4DYLA 3HKBB 3D3QA 3K04A 5J2TA 3U10A 5H6QA 2VQEB 2ZXWB 1Q7YW 3OUSA 3CXHF 4UCRA 3JARA 3LSQA 1H2GA 4J42A 4K0KO 1Q6IA 1BS3A 3CHXA 3WB0A 3DGEA 3GB7C 4HZ3A 4LF9O 3GVMA 1M93A 4HBNA 3WU2Z 3DSQA 1Q8IA 2KB1A 3P3NA 4DV4B 1MZFA 1T5EA 2ZR2A 5LMNB 3FFQA 3RYCA 2IU3A 3CMEV 1TGOA 3ETEA 1E79G 4JTCB 1NR1A 3RYHB 1JCHA 1GTOA 3BFRA 3BHPA 4CS4A 2XOKG 3CEIA 4I9QA 3AG2C 4G79A 3UT5B 1SC5B 1WP8A 5H6RA 5C8YB 3CCVV 3G4SV 4G27B 1K5QA 5BMVA 5IYDO 4PA7A 4JI2B 1WJZA 5KLVH 3U11A 4MTOA 4DV5O 4JV5B 2YIBA 4MT8A 4B08A 4JTAB 4MVRA 3R66A 2CH7A 4QIWF 1QU7A 4X1IA 3SJCC 4E2LA 4JYAO 1V54B 5CMUA 2KG7A 5LMNO 4PA9A 1LR1A 2OCCB 4U7NA 3KCYA 5JVDB 1Y74A 3ABUA 2EIJB 4TV9A 1AB3A 4DW0A 2JS5A 2JJ2G 1K5SA 1SQPH 1PNLA 4D6TH 3ZN0A 3W7TA 3ZHSA 2LJ2A 2F4VB 1KYOF 1DTOA 5L3EA 1GRJA 2WLHA 3A0BZ 3BVOA 2K9PA 2HFEC 3LSSA 1R6TA 3K9SA 4LP8A 4TSFG 3SGIA 5IWAO 4ZHQB 3A2FA 1VQ8V 4UVCA 2IU0A 2OYQA 4BIOA 4BIZA 2ZQMA 2QWPB 4P9PA 3N2GB 1GN4A 4YY3O 3QF7A 4H0LB 3THOA 4Z1VA 2HVKC 4O2BB 2YC0A 5IYZA 2WLKA 4KXRA 1VQKV 1GN2A 2QA4V 4UVAA 3SPJA 4J10A 5LMUO 3CCJV 2DMXA 3JD1A 5A9GA 4DR4O 2N04A 4NXNB 2GSMB 5IY5B 2RMKB 2VQFB 1YXBA 2YS8A 2A79B 2YIAA 1AP6A 2Y0PA 4WFHA 1N32B 2JDIG 1FS0G 3OD4A 3ZHUA 3LDCA 3O9OA 5KHHA 4JYAB 1GMGA 4J9YB 3ABLC 3OE7G 5B3SC 1AR1B 1IBLB 2Q8VA 5CA3A 4FLVA 3RWRA 5IT9N 2FB5A 3K0DA 3RN4A 3RYFA 4LWSA 3RYIA 2UXDB 3EVKA 4X64O 3IGAC 1Q5OA 2NNUA 1Z5VA 5L3DA 5JVDA 1CXZB 5DEDA 1YHQV 4JI5O 4OX9O 1KMIZ 4JI7O 1YJWV 4DV1O 4U3FH 3E35A 1Q86W 3FYEB 4HNAB 3HB3B 4U7OA 2DYSC 4DR1B 2QM7A 2R9IA 2RDCA 3O65A 4JI4B 2P6JA 4I5SA 1KKCA 1M9NA 2P4KA 1DGSA 2QDOA 2F66C 5LGUA 3ZIAG 1P4RA 4LBEC 5GTIZ 5KA5A 1ROPA 1F23A 4RUFA 1P7GA 2VS0A 1HNWB 3L74H 3E89A 3CX5F 3HKDA 1AJQA 3RVYA 4DRXB 4WBNB 5LP6A 1EM1A 4O4LA 1K92A 4JAVA 5JJNB 5K1PA 1HR0O 2QTOA 2ATKC 1QR9A 3G71V 4GLXA 5LP6C 4DXWA 2OIEA 1H2LA 1IZ3A 1HR0B 3CCMV 5L3CA 1NKDA 1MZEA 2FMLA 3AG7A 4MTFA 2P90A 3H1LH 3Q4HB 1GM9A 3CXCU 1IVSA 1VEWA 1KQSU 4BWAA 3EFFK 5KHIA 2ZXWC 2UUAB 2WLIA 1PNKA 4R50A 1K73W 2Q0AA 2YI9A 4U3JB 4OPHA 3IFXA 3CCSV 4JZ2A 4CH6A 2ZNJA 4FIPC 3VQVA 2EULA 3AG2B 1YVWA 1L0LH 2Y0IA 1H8EG 2ITDC 1Q81W 1EZVH 1J95A 2VWKA 2VWJA 3TXSA 4F6RB 4ZOLA 2LGQA 1BQZA 1IBMO 3C3SA 1KP3A 4YHHO 1PM9A 3ASOB 4ASUG 4DV2B 4WF9V 1YJ9V 1NH2B 2EZPA 4X64B 3ZMVA 1N0JA 2XAJA 2Q5ZA 5HFLA 1Q82W 1XDCA 3R65A 4FFBB 4PDRA 1IK9A 4FLXA 3CJHA 4MVUA 1XEQA 4R6ZA 1AI5A 1KKDA 4GFAA 1QBZA 5CA1A 2XASA 1SQXH 5ITZB 1FJGO 1TUEB 3OR6C 1M56B 1H2MA 4X20B 4CH4A 1BE3H 1G8MA 3CCQV 5BR8B 4LC1A 4W4LA 4IHJA 2UUBB 5KUMA 3OGCC 4DR4B 4IT5A 4JI1B 2W0FC 3IJ4A 1XUQA 3ABMB 4MVOA 4PA4A 3JCUZ 2X6AA 3JD3A 2E74B 2AXTZ 2QKSA 3B77A 3E86A 2KSDA 1N8RW 2ZE7A 1LNQA 4IYHA 3ABKC 3BA9A 2M7WA 4QPKA 1QLEC 4O4IB 4F6RA 5B1OA 1AJNA 4GKKO 4PJ0Z 3SR2C 3TJTA 1F51A 2XUMA 2Y69C 1SZTA 4FMTA 4XDKA 1H2SB 4I4TB 2EBOA 4N23A 4JI0O 4O2AB 1DF5A 2ZIOA 1BMFG 3QO8A 4DUYB 1Q43A 1URFA 5LYJA 2YIBD 2H3OA 4PI0A 2IW5A 1XMOB 5EC1C 5J2UB 1P7BA 2Q9LA 3JD4A 4J7KA 4GKJO 1I7FA 2ZE8A 1HNZO 1CEZA 4YJ2A 1GO3F 1K4CC 2QWOB 1XHXA 4UV8A 3DTUB 1TAEA 3ABLB 1JJ2U 5DECA 4QE9A 4HNAA 3PJSK 4I55B 4NTXA 2RQ6A 1P49A 4FLYA 4JI8O 1XL6A 1RM1C 5LHGA 1NBMG 3E8GA 3OFNG 3K0GA 3LDDA 2YXYA 5CA0B 4FLUA 4ZBMA 2ADPA 3KKYA 1TA8A 3RYIB 4TQDA 5LXTA 3SPHA 4Z2WA 3CD6V 5LL6Y 4LF4B 1R3KC 4CC5A 3LNNA 4FZ1A 2UXDO 4Q20A 2ZDIC 4ZI7A 1K3EA 5IJ0A 2A0LA 3SR2A 4GZRB 1GK9A 3L73H 2H94A 2ODMA 4DRXA 4WBNA 4ZIBA 1NTKH 1UPGA 4DV4O 1VQOV 2F95B 1M1KW 2YIDA 2OCCC 4CZZA 2GTSA 3ICXA 2WA4A 1FXVA 4DR6O 2OTJV 1M4UA 5B1AC 3ZRXA 4I0XA 2HHHO 4J80A 4UCTA 3I5DA 4NYKA 1VF6A 1GAXA 3TETA 3LSUA 1XNQB 5LHHA 2X6BA 2EILB 5KX5A 3I55V 4L87A 1JR9A 3J80N 1BHAA 2XAQA 1IURA 2N05A 2ZD9A 3QTCA 1G6UA 3DXRA 1IDSA 2IJIA 3STLC 3G6EV 4TOIA 1RSOB 4WFEA 2BSKA 3JD0A 5IWAB 4UB8Z 1WPBA 2LFSA 4DV7B 5JQGB 3K3WA 2B1IA 3TK1A 1OCRC 3T1CA 5BMVB 4FPPA 2PY5A 2N74A 2W6JG 3JALB 4F4LA 4QJFB 4JI1O 1IXBA 5D5PA 4EFEA 4UV9A 1I08A 2L6LA 4DV5B 5IJ9B 3L75H 1TUBB 1EN5A 4MW8A 4GYCB 2QM8A 1FJGB 3ZMUA 3WB2A 4E4EA 3A8TA 4HAMA 2UUBO 5LHIA 3ASOC 2PYJA 2WLLB 2EIMC 3P30A 4BW5A 5CA1B 4AQYB 4JPRA 2QKAA 2Q4PA 4JYCA 2BSKB 1KD1W 1ZL8B 4X9QA 4W4KA 4D7SA 2YXLA 1GN3A 2EX3A 1NT2B 4JYYA 1SZXA 1S77D 1OV9A 1VQNV 1EN6A 2X6CA 3H1HH 5H2FZ 3K5MA 1M56C 3JARB 5FPRA 1YIJV 2GDSA 4DV2O 4CKNA 5IYZB 3SYOA 4LF5B 4D7TA 3T4ZA 2BE3A 4X66B 3N27A 2WLJA 3K9AA 4H44B 3HR0A 4YJ3B 4ICGA 2QM4A 1Q6UA 1KUQA 3Q0YA 2R9AA 2G38A 2QWRB 2Q7HA 1JX9A 2UXCO 4JYBA 4BAYA 4O4JB 2JVDA 1EBOA 1GH6A 4LFAO 2GV9A 3CRQA 1UFIA 1RPOA 3E8FA 4X65O 1NJIW 3ABMC 2F43G 5FL7G 5KA6A 4LF7O 4DV0B 4WFAV 3SYCA 3TXQA 5LP6B 1WLEA 3CE2A 5K1XA 1CPYA 5H5NA 2Q7EA 4X65B 1FXKC 5D5QA 1QLEB 4JZGA 1SETA 2E75B 1DF4A 1N34B 1WA8B 3P3PA 3JAKA 3ZX6A 2D3OW 2Y69B 1Q3EA 3T1YO 2F23A 3LDEA 2UXBO 3K08A 1V9PA 1TVKA 3FAVA 3FB8C 2RCVA 4LNUA 5HFMA 4LF6O 2DQ3A 5B66Z 1Q90D 3ASNB 4MS2A 2FTKA 4Q6GA 4UCOA 1N33O 4I7ZB 1OCOB 4TQFA 1WP7A 4CC6A 3FD9A 2UUCO 5DM6V 4K8ZA 4MSWC 3P32A 5LGTA 4I9WA 1P84F 2LGWA 4EB6A 4I55A 1NVPB 4MVSA 4DV1B 2DOSA 2OWOA 1KB9F 3H01A 3AEIA 1YF2A 5EZYB 4CS2A 5CA0A 4ZKIA 2BOBC 2CTRA 5J9PC 5CB4A 1KC8W 1R73A 1U96A 3L71H 4JAUA 4PHZA 1F4MA 3MAQA 3FX7A 4FLZA 1W59A 1Y74B 2MW2B 2P67A 1OHHG 4DR1O 1NR7A 3ZHTA 5IDJA 4RQEA 3K5NA 1K8AW 3UO2A 3RGBA 3ML0A 5EYPB 4JF3A 3OTOO 1DLBA 3L70H 5CHXA 4MVZA 2YDEA 4JI8B 1HW7A 2E5LO 1LUVA 5KHKA 3S3XA 3AG3B 2RN9A 4RQFA 1VQ7V 3SPGA 2PGGA 4ZHQA 4GX0A 3B8MA 1WA8A 1EZJA 2YEVB 3CP1A 1S5JA 3WG7B 1HP8A 2A7WA 4IIJB 2ZE6A 4NXNO 1FFTB 1FKAO 1XBLA 4GUNA 1PL4A 2EIKB 5B1AB 2CAZC 2Y3WA 4DR2B 4DR5O 5LOVA 3BCCH 1JFFA 4TV8B 1Z5WA 4RAIA 3SPCA 3VQYA 1XNRO 2Q67A 1PV0A 3N2KB 1XNQO 1JA8A 5FLXN 3OR7C 5LMUB 2CE4A 3I56V 1M90W 1YI2V 2ZE5A 4QE7A 3BABA 4DR5B 1MA1A 1PP9H 3LUTB 3HKCB 3UT5A 4BW9A 1RFYA 3CC2V 1VF5B 5KAIZ 2P4VA 1GKFA 3UCSC 3U0ZA 3EHBB 1N36B 4UB6Z 1XQ8A 4K35A 2EINC 1VQ4V 4OGQB 4IGGA 3ZRWB 4P30A 4DUZO 3OMIB 3K5LA 4C7UA 3RYCB 4X1IB 2Q73A 2BTOA 1J5EB 5FNVB 5CBHA 2IJKA 1M5IA 4P9OA 1XI1A 2DQ0A 2CGNA 4B3TB 1FPOA 4TT3G 2EIMB 3QG5A 3RBZA 3ZRVA 5FPOA 2R9RB 2V4DA 5JH7A 3NR7A 3JASB 1JMKC 1VQPV 2QR4A 4BIUA 1IBLO 1WN7A 4MTGA 1Y66A 1V54C 2JGDB 4G28B 2C2AA 4K0KB 1ZLZA 2Q7GA 1FYJA 4LF6B 3OUFA 3N2GA 5AG2A 4GX5A 4GKJB 4FZ0A 1BT8A 3FKSG 3VQXA 1W0JG 3CJHB 4TUYB 3BA8A 3K59A 1FXKB 4DV7O 1IX9A 4X62O 4NXMB 1SA0B 4GEXA 1PKXA 3M8AA 3DC6A 3ZMTA 4LFCB 3QVNA 4CKPA 1I5YA 2NLJC 1QVFU 4PA6A 1S3JA 5LA6A 2OTLV 4LH6A 4JI3B 1B3QA 4PDMA 2QKCA 2F4VO 2L35A 1QHTA 2JS3A 1L0NH 5B1BB 5KUKA 4O2BA 2E76B 5TISZ 5J2TB 5BR8O 2BCCH 4UCSA 2IJJA 2BOCC 3JSLA 1PPJH 1I94O 1ZWIC 3JATB 2FKXA 5ITZA 3BPZA 4O4IA 4QNHB 3KZIZ 3CRMA 1K97A 4KL1A 4H13B 4X88A 1VP7A 4J41A 2Z0AA 4LF5O 1R1BA 2AZ2A 4MTXA 3IAYA 1BZKA 2WPDG 4X66O 2EZOA 1XHZA 2OCHA 2AZ0A 4DR7B 1IBMB 3EXAA 3Q0XA 2AHZA 3RYFB 2ZM6B 2HVJC 2ARHA 4JI6O 2GTAA 1YJNV 1QLNA 4H37A 1QNMA 1DK1A 4JTDB 4J9ZB 4AHCA 4B7EA 3F5TA 4HYOA 5F2VO 1S0VA 4JI6B 3K03A 2GUZA 2PYLA 1VF6C 3D36C 4DR7O 4IHJB 4AQYO 2HEPA 1MMMA 1RSOA 1ZX3A 1GM8A 3B8NA 4R7CA 5IYCO 2BTQA 3J81N 1HDJA 1YEWA 3BEHA 4TV8A 2HJDA 2DN9A 5EYPA 3OAAG 2FYUH 2PTMA 3UQ8A 3CSXA 2Y3VA 1SKVA 4LF8O 1NTMH 2UXBB 5KMGA 4CH3A 3JSNA 2VQFO 2YEVA 3ZCCA 2UUAO 5LGNA 1TUBA 3A0HZ 2PI5A 1AR5A 1X59A 2HR3A 1SQFA 3SYAA 2P7TC 1XMQB 2V7QG 4FLWA 1YZBA 3II6A 4B3SB 1N34O 1M57C 1K9MW 1JFFB 1FXHA 4XDLA 2O57A 4LF7B 4UVBA 3FB6C 2GUZB 4YJ3A 4PD4F 1NS1A 2V1DA 1HNWO 2ZNIA 3N2KA 3CPWU 1RP3B 3APQA 2VRZA 5L3FA 2Z5UA 4JAAA 4CH5A 4B3MB 1COWG 5B5EZ 2R72A 2WAMA 2UXCB 4L8JA 5LBQA 5CBFA 1R3IC 1JVMA 3CB2A 2UXXA 1SQGA 4CKMA 4CBCA 2HLDG 2AW9A 5KHJA 4J7JA 5JCOA 2FL4A 1R3JC 2HG5C 1VMGA 3D8CA 2DE0X 1WAZA 2Y4TA 5JH7B 3WFVA 3ZRWA 3SJBC 3MHSC 1FFXB 3JCZA 3C90A 3QO7A 4LWSB 4X20A
chains in the Genus database with same CATH topology
4DRXB 4WBNB 5LP6A 3B2EE 1SA0A 4O4LA 5JJNB 5K1PA 4FM2A 4Q6GA 2ZINA 4UCOA 4GLXA 5LP6C 4TQFA 4DV6B 4CC6A 5CJ0A 1HR0B 4K8ZA 1HNZB 1QQCA 2KKWA 3HKBA 4EB6A 3WB1A 4I55A 4O4JA 1B04A 4JI7B 5LYJB 4DV1B 3PN1A 2UU9B 2OWOA 1N33B 4CS2A 5EZYB 5CA0A 4JI0B 4BWAA 4DK0A 5KHIA 2UUAB 5CB4A 4PHZA 3MAQA 2Q0AA 4U3JA 2YI9A 4U3JB 4FLZA 1VF7A 4O4HB 4CH6A 1JJOA 2ZNJA 3K5NA 2R70A 5JJJB 2BTQB 3RGBA 4DR6B 3VQVA 5EYPB 1XNRB 5CHXA 3HKCA 3SJAC 4I50B 2ZIMA 3E22A 4JI8B 1HW7A 2VWKA 4LFBB 2VWJA 4F6RB 4ZOLA 5KHKA 5EZYA 2PUSA 2PGGA 4ZHQA 3ETQA 3JAKB 4XA4A 4NVPA 1S5JA 4DV2B 4IIJB 4X64B 3JAWB 5JQGA 1O9HA 4FFBB 2CAZC 1IK9A 1KU9A 4DR2B 4FLXA 5LOVA 3BAAA 5CJ4A 1JFFA 5CA1A 2E3CA 4TV8B 1Z5WA 5ITZB 3VQYA 3JATA 2F1MA 4X20B 5CB4B 4CH4A 5C8YA 4UFZA 3N2KB 5BR8B 4TV9B 5LMUB 4IHJA 2UUBB 1L8DA 4DR4B 3BABA 4JI1B 4DR5B 5IJ0B 1WNSA 2E5LB 4KHPB 3BRCA 4LNUB 3ZS8C 3HKCB 3UT5A 2ZCEA 2YI8A 3BA9A 3HKDB 4BW9A 4O4IB 3K57A 4F6RA 4AILC 4FM0A 3SR2C 3U0ZA 3T1YB 1N36B 1XQ8A 1O9GA 1H2SB 4I4TA 4I4TB 2XHBA 5JCOC 4O2AB 4LF9B 4X1YA 2ZIOA 5EIBD 4YHHB 3K5LA 4LH7A 3RYCB 4X1IB 4DUYB 1Q43A 5LYJA 2BTOA 2YIBD 4PI0A 1J5EB 4I50A 4DV3B 1XMOB 3RYHA 5J2UB 3K5OA 5FNVB 4EEQA 1I7FA 4B3RB 4DR3B 1M5IA 4YJ2A 4X1KB 1XHXA 1XI1A 1TAEA 4PI2A 4B3TB 5IJ9A 4HNAA 4GKKB 4I55B 3HKBB 2RQ6A 1P49A 3QG5A 4X1YB 5JJEB 1I94B 4FLYA 5FPOA 2UUCB 5J2TA 3U10A 2V4DA 5CA0B 2VQEB 5JH7A 4TUYA 4FLUA 4UCRA 3JARA 3JASB 1JMKC 1TVKB 1TA8A 3CHXA 3WB0A 3RYIB 4TQDA 1WN7A 5LXTA 1M93A 2P22C 4LF4B 4HBNA 4K0KB 4CC5A 3LNNA 2Q7GA 2JGUA 3DSQA 1Q8IA 4ZI7A 4LF6B 5IJ0A 4DV4B 3SR2A 4X62B 3N2GA 4GKJB 1T5EA 5LMNB 3FFQA 3RYCA 3VQXA 1TGOA 4TUYB 4DRXA 4WBNA 4ZIBA 3RYHB 3BA8A 3K59A 4NXMB 1SA0B 2F95B 3BHPA 4LFCB 4CS4A 3ICXA 4I9QA 3OTOB 3UT5B 5C8YB 3M7MX 5LA6A 4LH6A 4JI3B 1M4UA 5BMVA 4O2AA 4JI2B 3HKEB 4UCTA 1QHTA 4UCVA 3U11A 4O2BA 4JV5B 4LF8B 2YIBA 3JAWA 4B08A 5J2TB 1XNQB 3MUDA 4UCSA 2P5OA 3JSLA 5KX5A 4X1IA 3JATB 3SJCC 5ITZA 3BPZA 4O4IA 1FU1A 5EIBC 3QTCA 4O4LB 4KL1A 1G6UA 5JVDB 4TV9A 4TOIA 2JS5A 4YJ2B 3OTFA 5IWAB 1WPBA 3IAYA 4DV7B 4IIJA 5JQGB 5BMVB 1XHZA 2F4VB 5GONA 4JI5B 4DR7B 4OX9B 1IBKB 2PY5A 1IBMB 1ZAUA 2ZM6B 3JALB 3RYFB 4DK1A 3VQWA 3SGIA 4AHCA 4ZHQB 3A2FA 5D5PA 4EFEA 2PZSA 4JI6B 4DV5B 2OYQA 4FLTA 5IJ9B 5LXTB 2PYLA 1HNXB 1TUBB 4GYCB 3N2GB 4O4HA 4IHJB 5KMGB 2HEPA 3QF7A 1FJGB 3RWRD 1RSOA 3THOA 4ZI7B 4O2BB 5IYZA 3WB2A 3E22B 2BTQA 5FNVA 1YEWA 4TV8A 4FVMA 5EYPA 1D5AA 4NXNB 2PYJA 2PTMA 3UQ8A 3CSXA 2VQFB 4ZOLB 4LFAB 2YIAA 1SKVA 4LR3A 5CA1B 4YY3B 4AQYB 1N32B 3RFRA 3HKEA 2UXBB 4D7SA 5KMGA 4FM1A 2YXLA 3JSNA 2EX3A 4CH3A 1NT2B 5KHHA 4K8XA 4JYAB 1IBLB 1X4TA 1TUBA 5GONB 3K58A 1SQFA 4FLVA 1XMQB 3RWRA 3K5MA 4EB6B 4FFBA 3JARB 5KHGA 5FPRA 3JALA 3RYFA 3RYIA 4FLWA 2UXDB 5IYZB 2QJ1A 4X1KA 4LF5B 3II6A 4B3SB 1Q5OA 4D7TA 2HHHB 1Z5VA 1JFFB 4X66B 5JVDA 5LA6B 4LF7B 2IM9A 4YJ3B 1KMIZ 4YJ3A 2QM4A 2R9AA 2ZNIA 3N2KA 2Q7HA 4HNAB 4O4JB 4UCUA 2JVDA 2RJZA 4CH5A 4B3MB 5J2UA 2GV9A 2R72A 4DR1B 2UXCB 4L8JA 4DV0B 4JI4B 3JASA 5LP6B 5KX5B 5K1XA 3CB2A 1DGSA 1SQGA 2Q7EA 4X65B 3T1HB 3ZEDA 5D5QA 5KHJA 4DUZB 2F66C 1N34B 2F93B 3JAKA 5JCOA 4EFBA 5LOVB 1Q3EA 1HNWB 5JH7B 3SJBC 3HKDA 1V9PA 1FFXB 4CS3A 1FFXA 1TVKA 4LNUA 4X20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QM4 A;  3II6 A;  2R9A A;  5CJ0 A;  3RWR D;  3RWR A;  5CHX A;  3MUD A;  1M5I A;  1FU1 A;  5CJ4 A;  3SR2 A;  4XA4 A;  3SR2 C;  1IK9 A;  1KU9 A; 
#chains in the Genus database with same CATH topology
 1U97 A;  1L1F A;  3K79 A;  3B2E E;  4JGS A;  4FM2 A;  3E8B A;  3SJQ C;  3TGU H;  2DWE C;  4DV6 B;  1HWY A;  2GHY A;  1QQC A;  2DYS B;  3LNM B;  4PA3 A;  1NQT A;  2CUG A;  3HKB A;  3WB1 A;  1B04 A;  4JI7 B;  4DV6 O;  3AK3 A;  3ZJZ A;  4WCE V;  1NTZ H;  2NN4 A;  1BQ0 A;  3ZRS A;  1PL0 A;  1OZ0 A;  1JOY A;  3CMA V;  2CDY A;  3W7U A;  4DK0 A;  3CS5 A;  4J11 A;  1MG1 A;  4G2K A;  3WG7 C;  1K33 A;  3OM3 B;  4O4H B;  1XIL A;  3B40 A;  3X2Q B;  2QTS A;  1JPX A;  2R70 A;  2EIK C;  1A32 A;  1US6 A;  2XAH A;  4OPA A;  5JJJ B;  1SS3 A;  3OGI B;  4P2Z A;  2YIC A;  1VQM V;  1YDX A;  3SJA C;  2ZIM A;  3E22 A;  3CCL V;  4IL6 Z;  2JK5 C;  4LFB B;  1AR4 A;  3OMA B;  1Y67 A;  1QCE A;  2W6I G;  5EZY A;  2DJV A;  1S72 V;  2PUS A;  5B1B C;  1ZSP A;  3ETQ A;  3CCE V;  3KG2 A;  2QEX V;  1D2D A;  3VOU A;  4XA4 A;  3AG4 C;  3BY6 A;  1OCC C;  3TCU A;  4LFC O;  3STZ C;  1Y76 A;  4YIP A;  2D2C B;  2XTA A;  1HNX O;  1AI4 A;  1AP5 A;  3JAT A;  2F1M A;  2WLI B;  1Q6H A;  3AG1 B;  5C8Y A;  3IC7 A;  4UFZ A;  2Y4U A;  1VQ9 V;  3G67 A;  4TV9 B;  1SRY A;  4YXW G;  3JD2 A;  4JI4 O;  3CWB H;  3JYC A;  1MAB G;  2IBZ H;  2ZKO A;  4F6E A;  2EJ7 A;  4Z1M G;  5IJ0 B;  1WNS A;  2E5L B;  3GWO A;  4WFF A;  2K1E A;  1VQ6 V;  1FAF A;  3UKM A;  4LNU B;  1RM1 B;  1EFR G;  4GT1 A;  3HKD B;  2YI8 A;  1XL4 A;  2Q69 A;  2CGO A;  5EK0 A;  3K57 A;  3DXR B;  3Q4H A;  4AIL C;  2LQT A;  4FM0 A;  2DYR B;  4JI2 O;  4PEL A;  1D5N A;  3CC7 V;  1H2N A;  3K06 A;  1O9G A;  3PYI A;  4X89 A;  3H1I H;  1SQQ H;  2HP8 A;  1CP9 A;  5JCO C;  1N0N A;  1SER A;  1ORQ C;  2DWD C;  1K7D A;  1BL8 A;  4YHH B;  4LH7 A;  3DC5 A;  3W7X A;  3GWK C;  2PF4 E;  1S5L Z;  2GBO A;  2A9H A;  4NB5 A;  4TWK A;  3AK2 A;  4PDL A;  5EBM C;  4EEQ A;  3OMN B;  3IC9 A;  1Y4M A;  3UM7 A;  3FB7 C;  2OIG A;  4WFB V;  4DR3 B;  3H1K H;  2Z3Y A;  2LP7 A;  4B3M O;  4PI2 A;  1YIT V;  3HPL C;  3ZMS A;  2WWW A;  1IXM A;  2P06 A;  1NVP D;  4X1Y B;  5JJE B;  4GX2 A;  1I94 B;  4QPJ A;  4UUJ C;  2UUC B;  3W7W A;  4TUY A;  1PD3 A;  1TVK B;  1FXK A;  2LO1 A;  2EIL C;  3CCU V;  1NH2 D;  4NKG B;  3F7V C;  1XMQ O;  4EKW A;  4H33 A;  2VQE O;  3CRC A;  2P22 C;  2M6Y A;  2WLN A;  4MVQ A;  4QGP A;  1K4D C;  5JWP A;  5H9C A;  1M57 B;  3H9V A;  2JGU A;  3FYI B;  1LUW A;  4X62 B;  4NXM O;  3AK1 A;  5GTH Z;  3G80 A;  5IYB O;  5CN0 A;  2WLL A;  1AIL A;  1G4Y B;  1MOF A;  2JIZ G;  2QWN B;  3OTO B;  1G1X B;  3M7M X;  4KHP O;  2QE7 G;  5BY1 A;  2MK3 A;  3M99 B;  2AHY A;  5BXZ A;  2UU9 O;  4O2A A;  3CYO A;  3APO A;  3HKE B;  1NZ6 A;  3SDL A;  2JEX A;  2ETN A;  4UCV A;  4WFG A;  3SYQ A;  3KCX A;  1S5H C;  4LF8 B;  2CH7 B;  3JAW A;  5EBL C;  1W0K G;  1EN4 A;  3MUD A;  3CRA A;  2P5O A;  2Q6A A;  4J7Z A;  1FU1 A;  2IH3 C;  1UJW B;  2UXN A;  5EIB C;  4O4L B;  1SQB H;  2IH1 C;  1E1R G;  1VIB A;  4YJ2 B;  3L72 H;  3OTF A;  1ZL8 A;  2YUA A;  2ZM6 O;  2LW7 A;  3VBB A;  4NTY A;  4BR6 A;  4IIJ A;  1NU1 H;  5GON A;  4JI5 B;  4OX9 B;  1IBK B;  2ZT9 B;  1ZAU A;  3OT7 A;  1XRE A;  4B3T O;  5E1A C;  3UO3 A;  2KG7 B;  4DK1 A;  3VQW A;  4KFM A;  3ETG A;  3T1H O;  1NI8 A;  1B06 A;  3NXS A;  1ZTE A;  5EBW C;  4K3A A;  1F4N A;  2CTQ A;  2PZS A;  1J5E O;  2Q68 A;  4FLT A;  5LXT B;  1I0H A;  1HNX B;  1YSC A;  3J7A U;  1WPX A;  3T2M A;  4FK5 C;  4O4H A;  4I0X B;  2B9Z A;  3RVZ A;  1N32 O;  5KMG B;  3RWR D;  5L3B A;  4JI3 O;  4ZI7 B;  1ZUQ A;  4RWU A;  3E22 B;  2Y48 A;  5FNV A;  1KEC A;  2B1G A;  5GW7 A;  4FVM A;  4KUM A;  1THZ A;  3ABT A;  5EC2 C;  1D5A A;  3W7S A;  2QWQ B;  3B4S A;  1V55 B;  4B7K A;  1H2K A;  4DO2 A;  1SQV H;  1OCC B;  4ZOL B;  4LFA B;  4LR3 A;  4YY3 B;  2WA3 A;  3ZHR A;  3RFR A;  3OEH G;  1QR8 A;  1ENV A;  1ARO P;  1OCR B;  1GM7 A;  3HKE A;  3SYP A;  4FM1 A;  3ZHQ A;  3JAM N;  4K8X A;  1OCZ B;  4MW3 A;  4LFB O;  1X4T A;  3AG4 B;  5GON B;  3K58 A;  4PV1 B;  5CBG A;  2NR5 A;  3ZBH A;  4EB6 B;  4FFB A;  5KHG A;  4XDJ A;  4PDV A;  2CTP A;  3JAL A;  2QJ1 A;  4X1K A;  1AI7 A;  2QSA A;  2QGN A;  2HHH B;  5E79 Z;  4JAS A;  2A3Q A;  5IY5 C;  5LA6 B;  2IM9 A;  3ASN C;  5KAF Z;  1PNM A;  1OCO C;  2X0L A;  4DR3 O;  3MDS A;  4UCU A;  3F7Y C;  1BCC H;  3D3I A;  2RJZ A;  2ITC C;  4GEU A;  1GN6 A;  4NR1 A;  5J2U A;  2DYR C;  4LF4 O;  3G6B A;  4YIO A;  3JAS A;  2X7R B;  1JQ0 A;  5KX5 B;  1VAR A;  1B6Q A;  4FFK A;  1W2B U;  1R6K A;  3T1H B;  3ZED A;  3F5W C;  4DUZ B;  3B09 A;  1BSM A;  2F93 B;  2JRI A;  3H1J H;  4EFB A;  2PI4 A;  4FJC C;  5LOV B;  1MSD A;  1R6N A;  4CS3 A;  1FFX A;  1H38 A;  1KBH A;  1KP2 A;  2EIJ C;  3OEE G;  1F7Y A;  1SA0 A;  5BZB A;  2WSS G;  2ZIN A;  1YCI A;  1BGY H;  3X2Q C;  4ABM A;  2B5U A;  3ZHV A;  4IYI A;  4RUE A;  3AG3 C;  1SES A;  5CJ0 A;  1HNZ B;  2KKW A;  3CCR V;  3SPI A;  2EJR A;  1R3L C;  1S76 D;  4O4J A;  1N36 O;  1AI6 A;  3OW2 U;  5B1N A;  5LYJ B;  1Z2G A;  3D36 A;  3PN1 A;  2UU9 B;  1XOU A;  4MVM A;  1N33 B;  4JI0 B;  1FD9 A;  2DW4 A;  4DUY O;  2ADQ B;  4DR2 O;  4U3J A;  3RT3 C;  2JEU A;  1VF7 A;  1E1Q G;  3MHH C;  3E83 A;  4NTW A;  2RNB A;  1QVG U;  1JJO A;  2AGA A;  3QNE A;  4DV0 O;  1Y6X A;  4DV3 O;  4B3S O;  1H8H G;  2BTQ B;  4LCU C;  4DR6 B;  2LW1 A;  3ZMZ A;  1XNR B;  1Y76 B;  3FAV B;  3HKC A;  4GX1 A;  1MNG A;  4I50 B;  1YTF B;  2XT9 A;  5DN6 G;  4GFC A;  3AG1 C;  2HKO A;  5C93 A;  1MSW D;  2W0X A;  4OXS A;  4AI8 A;  3ETD A;  3JAK B;  1IBK O;  2WLM A;  4KP4 A;  4NVP A;  3MD0 A;  5JQG A;  1RPR A;  3JAW B;  2EIN B;  1AVM A;  5A2Q N;  2CK3 G;  1O9H A;  2YXH A;  4X8A A;  1K34 A;  1WB7 A;  5IE9 A;  4XBF A;  2ILM A;  1KU9 A;  2JJ1 G;  3BAA A;  5B3S B;  5CJ4 A;  4DW1 A;  2E3C A;  2LFR A;  4JV5 O;  3QO5 A;  5CB4 B;  4GCZ A;  1N4C A;  3CRR A;  3T4D A;  2ZR3 A;  3E2E A;  1L8D A;  1I5X A;  1WB8 A;  3E8H A;  1OJH A;  4KHP B;  2IJH A;  3BRC A;  3ZS8 C;  1SF9 A;  2ZCE A;  1AJP A;  2H8P C;  3S3W A;  1VQL V;  1XMO O;  2JGD A;  3T1Y B;  4A5U B;  4R8C A;  4N21 A;  2ZDI A;  3L9D A;  3RW0 A;  3A0R A;  2OT5 A;  4I4T A;  3FB5 C;  2XHB A;  1BHB A;  4LF9 B;  4X1Y A;  4UXN A;  5EIB D;  1VQ5 V;  5L3G A;  1V55 C;  4RO2 A;  3CC4 V;  1YTF D;  3ZN1 A;  4I50 A;  4DV3 B;  3RYH A;  3C3T A;  3K5O A;  2Q0O C;  2XND G;  4B3R B;  3ABK B;  2A06 H;  2KQX A;  2XAG A;  4X1K B;  1OCZ C;  2YSU B;  2CTW A;  2XAF A;  2HJF C;  5IJ9 A;  4B3R O;  4GKK B;  4DYL A;  3HKB B;  3D3Q A;  3K04 A;  5J2T A;  3U10 A;  5H6Q A;  2VQE B;  2ZXW B;  1Q7Y W;  3OUS A;  3CXH F;  4UCR A;  3JAR A;  3LSQ A;  1H2G A;  4J42 A;  4K0K O;  1Q6I A;  1BS3 A;  3CHX A;  3WB0 A;  3DGE A;  3GB7 C;  4HZ3 A;  4LF9 O;  3GVM A;  1M93 A;  4HBN A;  3WU2 Z;  3DSQ A;  1Q8I A;  2KB1 A;  3P3N A;  4DV4 B;  1MZF A;  1T5E A;  2ZR2 A;  5LMN B;  3FFQ A;  3RYC A;  2IU3 A;  3CME V;  1TGO A;  3ETE A;  1E79 G;  4JTC B;  1NR1 A;  3RYH B;  1JCH A;  1GTO A;  3BFR A;  3BHP A;  4CS4 A;  2XOK G;  3CEI A;  4I9Q A;  3AG2 C;  4G79 A;  3UT5 B;  1SC5 B;  1WP8 A;  5H6R A;  5C8Y B;  3CCV V;  3G4S V;  4G27 B;  1K5Q A;  5BMV A;  5IYD O;  4PA7 A;  4JI2 B;  1WJZ A;  5KLV H;  3U11 A;  4MTO A;  4DV5 O;  4JV5 B;  2YIB A;  4MT8 A;  4B08 A;  4JTA B;  4MVR A;  3R66 A;  2CH7 A;  4QIW F;  1QU7 A;  4X1I A;  3SJC C;  4E2L A;  4JYA O;  1V54 B;  5CMU A;  2KG7 A;  5LMN O;  4PA9 A;  1LR1 A;  2OCC B;  4U7N A;  3KCY A;  5JVD B;  1Y74 A;  3ABU A;  2EIJ B;  4TV9 A;  1AB3 A;  4DW0 A;  2JS5 A;  2JJ2 G;  1K5S A;  1SQP H;  1PNL A;  4D6T H;  3ZN0 A;  3W7T A;  3ZHS A;  2LJ2 A;  2F4V B;  1KYO F;  1DTO A;  5L3E A;  1GRJ A;  2WLH A;  3A0B Z;  3BVO A;  2K9P A;  2HFE C;  3LSS A;  1R6T A;  3K9S A;  4LP8 A;  4TSF G;  3SGI A;  5IWA O;  4ZHQ B;  3A2F A;  1VQ8 V;  4UVC A;  2IU0 A;  2OYQ A;  4BIO A;  4BIZ A;  2ZQM A;  2QWP B;  4P9P A;  3N2G B;  1GN4 A;  4YY3 O;  3QF7 A;  4H0L B;  3THO A;  4Z1V A;  2HVK C;  4O2B B;  2YC0 A;  5IYZ A;  2WLK A;  4KXR A;  1VQK V;  1GN2 A;  2QA4 V;  4UVA A;  3SPJ A;  4J10 A;  5LMU O;  3CCJ V;  2DMX A;  3JD1 A;  5A9G A;  4DR4 O;  2N04 A;  4NXN B;  2GSM B;  5IY5 B;  2RMK B;  2VQF B;  1YXB A;  2YS8 A;  2A79 B;  2YIA A;  1AP6 A;  2Y0P A;  4WFH A;  1N32 B;  2JDI G;  1FS0 G;  3OD4 A;  3ZHU A;  3LDC A;  3O9O A;  5KHH A;  4JYA B;  1GMG A;  4J9Y B;  3ABL C;  3OE7 G;  5B3S C;  1AR1 B;  1IBL B;  2Q8V A;  5CA3 A;  4FLV A;  3RWR A;  5IT9 N;  2FB5 A;  3K0D A;  3RN4 A;  3RYF A;  4LWS A;  3RYI A;  2UXD B;  3EVK A;  4X64 O;  3IGA C;  1Q5O A;  2NNU A;  1Z5V A;  5L3D A;  5JVD A;  1CXZ B;  5DED A;  1YHQ V;  4JI5 O;  4OX9 O;  1KMI Z;  4JI7 O;  1YJW V;  4DV1 O;  4U3F H;  3E35 A;  1Q86 W;  3FYE B;  4HNA B;  3HB3 B;  4U7O A;  2DYS C;  4DR1 B;  2QM7 A;  2R9I A;  2RDC A;  3O65 A;  4JI4 B;  2P6J A;  4I5S A;  1KKC A;  1M9N A;  2P4K A;  1DGS A;  2QDO A;  2F66 C;  5LGU A;  3ZIA G;  1P4R A;  4LBE C;  5GTI Z;  5KA5 A;  1ROP A;  1F23 A;  4RUF A;  1P7G A;  2VS0 A;  1HNW B;  3L74 H;  3E89 A;  3CX5 F;  3HKD A;  1AJQ A;  3RVY A;  4DRX B;  4WBN B;  5LP6 A;  1EM1 A;  4O4L A;  1K92 A;  4JAV A;  5JJN B;  5K1P A;  1HR0 O;  2QTO A;  2ATK C;  1QR9 A;  3G71 V;  4GLX A;  5LP6 C;  4DXW A;  2OIE A;  1H2L A;  1IZ3 A;  1HR0 B;  3CCM V;  5L3C A;  1NKD A;  1MZE A;  2FML A;  3AG7 A;  4MTF A;  2P90 A;  3H1L H;  3Q4H B;  1GM9 A;  3CXC U;  1IVS A;  1VEW A;  1KQS U;  4BWA A;  3EFF K;  5KHI A;  2ZXW C;  2UUA B;  2WLI A;  1PNK A;  4R50 A;  1K73 W;  2Q0A A;  2YI9 A;  4U3J B;  4OPH A;  3IFX A;  3CCS V;  4JZ2 A;  4CH6 A;  2ZNJ A;  4FIP C;  3VQV A;  2EUL A;  3AG2 B;  1YVW A;  1L0L H;  2Y0I A;  1H8E G;  2ITD C;  1Q81 W;  1EZV H;  1J95 A;  2VWK A;  2VWJ A;  3TXS A;  4F6R B;  4ZOL A;  2LGQ A;  1BQZ A;  1IBM O;  3C3S A;  1KP3 A;  4YHH O;  1PM9 A;  3ASO B;  4ASU G;  4DV2 B;  4WF9 V;  1YJ9 V;  1NH2 B;  2EZP A;  4X64 B;  3ZMV A;  1N0J A;  2XAJ A;  2Q5Z A;  5HFL A;  1Q82 W;  1XDC A;  3R65 A;  4FFB B;  4PDR A;  1IK9 A;  4FLX A;  3CJH A;  4MVU A;  1XEQ A;  4R6Z A;  1AI5 A;  1KKD A;  4GFA A;  1QBZ A;  5CA1 A;  2XAS A;  1SQX H;  5ITZ B;  1FJG O;  1TUE B;  3OR6 C;  1M56 B;  1H2M A;  4X20 B;  4CH4 A;  1BE3 H;  1G8M A;  3CCQ V;  5BR8 B;  4LC1 A;  4W4L A;  4IHJ A;  2UUB B;  5KUM A;  3OGC C;  4DR4 B;  4IT5 A;  4JI1 B;  2W0F C;  3IJ4 A;  1XUQ A;  3ABM B;  4MVO A;  4PA4 A;  3JCU Z;  2X6A A;  3JD3 A;  2E74 B;  2AXT Z;  2QKS A;  3B77 A;  3E86 A;  2KSD A;  1N8R W;  2ZE7 A;  1LNQ A;  4IYH A;  3ABK C;  3BA9 A;  2M7W A;  4QPK A;  1QLE C;  4O4I B;  4F6R A;  5B1O A;  1AJN A;  4GKK O;  4PJ0 Z;  3SR2 C;  3TJT A;  1F51 A;  2XUM A;  2Y69 C;  1SZT A;  4FMT A;  4XDK A;  1H2S B;  4I4T B;  2EBO A;  4N23 A;  4JI0 O;  4O2A B;  1DF5 A;  2ZIO A;  1BMF G;  3QO8 A;  4DUY B;  1Q43 A;  1URF A;  5LYJ A;  2YIB D;  2H3O A;  4PI0 A;  2IW5 A;  1XMO B;  5EC1 C;  5J2U B;  1P7B A;  2Q9L A;  3JD4 A;  4J7K A;  4GKJ O;  1I7F A;  2ZE8 A;  1HNZ O;  1CEZ A;  4YJ2 A;  1GO3 F;  1K4C C;  2QWO B;  1XHX A;  4UV8 A;  3DTU B;  1TAE A;  3ABL B;  1JJ2 U;  5DEC A;  4QE9 A;  4HNA A;  3PJS K;  4I55 B;  4NTX A;  2RQ6 A;  1P49 A;  4FLY A;  4JI8 O;  1XL6 A;  1RM1 C;  5LHG A;  1NBM G;  3E8G A;  3OFN G;  3K0G A;  3LDD A;  2YXY A;  5CA0 B;  4FLU A;  4ZBM A;  2ADP A;  3KKY A;  1TA8 A;  3RYI B;  4TQD A;  5LXT A;  3SPH A;  4Z2W A;  3CD6 V;  5LL6 Y;  4LF4 B;  1R3K C;  4CC5 A;  3LNN A;  4FZ1 A;  2UXD O;  4Q20 A;  2ZDI C;  4ZI7 A;  1K3E A;  5IJ0 A;  2A0L A;  3SR2 A;  4GZR B;  1GK9 A;  3L73 H;  2H94 A;  2ODM A;  4DRX A;  4WBN A;  4ZIB A;  1NTK H;  1UPG A;  4DV4 O;  1VQO V;  2F95 B;  1M1K W;  2YID A;  2OCC C;  4CZZ A;  2GTS A;  3ICX A;  2WA4 A;  1FXV A;  4DR6 O;  2OTJ V;  1M4U A;  5B1A C;  3ZRX A;  4I0X A;  2HHH O;  4J80 A;  4UCT A;  3I5D A;  4NYK A;  1VF6 A;  1GAX A;  3TET A;  3LSU A;  1XNQ B;  5LHH A;  2X6B A;  2EIL B;  5KX5 A;  3I55 V;  4L87 A;  1JR9 A;  3J80 N;  1BHA A;  2XAQ A;  1IUR A;  2N05 A;  2ZD9 A;  3QTC A;  1G6U A;  3DXR A;  1IDS A;  2IJI A;  3STL C;  3G6E V;  4TOI A;  1RSO B;  4WFE A;  2BSK A;  3JD0 A;  5IWA B;  4UB8 Z;  1WPB A;  2LFS A;  4DV7 B;  5JQG B;  3K3W A;  2B1I A;  3TK1 A;  1OCR C;  3T1C A;  5BMV B;  4FPP A;  2PY5 A;  2N74 A;  2W6J G;  3JAL B;  4F4L A;  4QJF B;  4JI1 O;  1IXB A;  5D5P A;  4EFE A;  4UV9 A;  1I08 A;  2L6L A;  4DV5 B;  5IJ9 B;  3L75 H;  1TUB B;  1EN5 A;  4MW8 A;  4GYC B;  2QM8 A;  1FJG B;  3ZMU A;  3WB2 A;  4E4E A;  3A8T A;  4HAM A;  2UUB O;  5LHI A;  3ASO C;  2PYJ A;  2WLL B;  2EIM C;  3P30 A;  4BW5 A;  5CA1 B;  4AQY B;  4JPR A;  2QKA A;  2Q4P A;  4JYC A;  2BSK B;  1KD1 W;  1ZL8 B;  4X9Q A;  4W4K A;  4D7S A;  2YXL A;  1GN3 A;  2EX3 A;  1NT2 B;  4JYY A;  1SZX A;  1S77 D;  1OV9 A;  1VQN V;  1EN6 A;  2X6C A;  3H1H H;  5H2F Z;  3K5M A;  1M56 C;  3JAR B;  5FPR A;  1YIJ V;  2GDS A;  4DV2 O;  4CKN A;  5IYZ B;  3SYO A;  4LF5 B;  4D7T A;  3T4Z A;  2BE3 A;  4X66 B;  3N27 A;  2WLJ A;  3K9A A;  4H44 B;  3HR0 A;  4YJ3 B;  4ICG A;  2QM4 A;  1Q6U A;  1KUQ A;  3Q0Y A;  2R9A A;  2G38 A;  2QWR B;  2Q7H A;  1JX9 A;  2UXC O;  4JYB A;  4BAY A;  4O4J B;  2JVD A;  1EBO A;  1GH6 A;  4LFA O;  2GV9 A;  3CRQ A;  1UFI A;  1RPO A;  3E8F A;  4X65 O;  1NJI W;  3ABM C;  2F43 G;  5FL7 G;  5KA6 A;  4LF7 O;  4DV0 B;  4WFA V;  3SYC A;  3TXQ A;  5LP6 B;  1WLE A;  3CE2 A;  5K1X A;  1CPY A;  5H5N A;  2Q7E A;  4X65 B;  1FXK C;  5D5Q A;  1QLE B;  4JZG A;  1SET A;  2E75 B;  1DF4 A;  1N34 B;  1WA8 B;  3P3P A;  3JAK A;  3ZX6 A;  2D3O W;  2Y69 B;  1Q3E A;  3T1Y O;  2F23 A;  3LDE A;  2UXB O;  3K08 A;  1V9P A;  1TVK A;  3FAV A;  3FB8 C;  2RCV A;  4LNU A;  5HFM A;  4LF6 O;  2DQ3 A;  5B66 Z;  1Q90 D;  3ASN B;  4MS2 A;  2FTK A;  4Q6G A;  4UCO A;  1N33 O;  4I7Z B;  1OCO B;  4TQF A;  1WP7 A;  4CC6 A;  3FD9 A;  2UUC O;  5DM6 V;  4K8Z A;  4MSW C;  3P32 A;  5LGT A;  4I9W A;  1P84 F;  2LGW A;  4EB6 A;  4I55 A;  1NVP B;  4MVS A;  4DV1 B;  2DOS A;  2OWO A;  1KB9 F;  3H01 A;  3AEI A;  1YF2 A;  5EZY B;  4CS2 A;  5CA0 A;  4ZKI A;  2BOB C;  2CTR A;  5J9P C;  5CB4 A;  1KC8 W;  1R73 A;  1U96 A;  3L71 H;  4JAU A;  4PHZ A;  1F4M A;  3MAQ A;  3FX7 A;  4FLZ A;  1W59 A;  1Y74 B;  2MW2 B;  2P67 A;  1OHH G;  4DR1 O;  1NR7 A;  3ZHT A;  5IDJ A;  4RQE A;  3K5N A;  1K8A W;  3UO2 A;  3RGB A;  3ML0 A;  5EYP B;  4JF3 A;  3OTO O;  1DLB A;  3L70 H;  5CHX A;  4MVZ A;  2YDE A;  4JI8 B;  1HW7 A;  2E5L O;  1LUV A;  5KHK A;  3S3X A;  3AG3 B;  2RN9 A;  4RQF A;  1VQ7 V;  3SPG A;  2PGG A;  4ZHQ A;  4GX0 A;  3B8M A;  1WA8 A;  1EZJ A;  2YEV B;  3CP1 A;  1S5J A;  3WG7 B;  1HP8 A;  2A7W A;  4IIJ B;  2ZE6 A;  4NXN O;  1FFT B;  1FKA O;  1XBL A;  4GUN A;  1PL4 A;  2EIK B;  5B1A B;  2CAZ C;  2Y3W A;  4DR2 B;  4DR5 O;  5LOV A;  3BCC H;  1JFF A;  4TV8 B;  1Z5W A;  4RAI A;  3SPC A;  3VQY A;  1XNR O;  2Q67 A;  1PV0 A;  3N2K B;  1XNQ O;  1JA8 A;  5FLX N;  3OR7 C;  5LMU B;  2CE4 A;  3I56 V;  1M90 W;  1YI2 V;  2ZE5 A;  4QE7 A;  3BAB A;  4DR5 B;  1MA1 A;  1PP9 H;  3LUT B;  3HKC B;  3UT5 A;  4BW9 A;  1RFY A;  3CC2 V;  1VF5 B;  5KAI Z;  2P4V A;  1GKF A;  3UCS C;  3U0Z A;  3EHB B;  1N36 B;  4UB6 Z;  1XQ8 A;  4K35 A;  2EIN C;  1VQ4 V;  4OGQ B;  4IGG A;  3ZRW B;  4P30 A;  4DUZ O;  3OMI B;  3K5L A;  4C7U A;  3RYC B;  4X1I B;  2Q73 A;  2BTO A;  1J5E B;  5FNV B;  5CBH A;  2IJK A;  1M5I A;  4P9O A;  1XI1 A;  2DQ0 A;  2CGN A;  4B3T B;  1FPO A;  4TT3 G;  2EIM B;  3QG5 A;  3RBZ A;  3ZRV A;  5FPO A;  2R9R B;  2V4D A;  5JH7 A;  3NR7 A;  3JAS B;  1JMK C;  1VQP V;  2QR4 A;  4BIU A;  1IBL O;  1WN7 A;  4MTG A;  1Y66 A;  1V54 C;  2JGD B;  4G28 B;  2C2A A;  4K0K B;  1ZLZ A;  2Q7G A;  1FYJ A;  4LF6 B;  3OUF A;  3N2G A;  5AG2 A;  4GX5 A;  4GKJ B;  4FZ0 A;  1BT8 A;  3FKS G;  3VQX A;  1W0J G;  3CJH B;  4TUY B;  3BA8 A;  3K59 A;  1FXK B;  4DV7 O;  1IX9 A;  4X62 O;  4NXM B;  1SA0 B;  4GEX A;  1PKX A;  3M8A A;  3DC6 A;  3ZMT A;  4LFC B;  3QVN A;  4CKP A;  1I5Y A;  2NLJ C;  1QVF U;  4PA6 A;  1S3J A;  5LA6 A;  2OTL V;  4LH6 A;  4JI3 B;  1B3Q A;  4PDM A;  2QKC A;  2F4V O;  2L35 A;  1QHT A;  2JS3 A;  1L0N H;  5B1B B;  5KUK A;  4O2B A;  2E76 B;  5TIS Z;  5J2T B;  5BR8 O;  2BCC H;  4UCS A;  2IJJ A;  2BOC C;  3JSL A;  1PPJ H;  1I94 O;  1ZWI C;  3JAT B;  2FKX A;  5ITZ A;  3BPZ A;  4O4I A;  4QNH B;  3KZI Z;  3CRM A;  1K97 A;  4KL1 A;  4H13 B;  4X88 A;  1VP7 A;  4J41 A;  2Z0A A;  4LF5 O;  1R1B A;  2AZ2 A;  4MTX A;  3IAY A;  1BZK A;  2WPD G;  4X66 O;  2EZO A;  1XHZ A;  2OCH A;  2AZ0 A;  4DR7 B;  1IBM B;  3EXA A;  3Q0X A;  2AHZ A;  3RYF B;  2ZM6 B;  2HVJ C;  2ARH A;  4JI6 O;  2GTA A;  1YJN V;  1QLN A;  4H37 A;  1QNM A;  1DK1 A;  4JTD B;  4J9Z B;  4AHC A;  4B7E A;  3F5T A;  4HYO A;  5F2V O;  1S0V A;  4JI6 B;  3K03 A;  2GUZ A;  2PYL A;  1VF6 C;  3D36 C;  4DR7 O;  4IHJ B;  4AQY O;  2HEP A;  1MMM A;  1RSO A;  1ZX3 A;  1GM8 A;  3B8N A;  4R7C A;  5IYC O;  2BTQ A;  3J81 N;  1HDJ A;  1YEW A;  3BEH A;  4TV8 A;  2HJD A;  2DN9 A;  5EYP A;  3OAA G;  2FYU H;  2PTM A;  3UQ8 A;  3CSX A;  2Y3V A;  1SKV A;  4LF8 O;  1NTM H;  2UXB B;  5KMG A;  4CH3 A;  3JSN A;  2VQF O;  2YEV A;  3ZCC A;  2UUA O;  5LGN A;  1TUB A;  3A0H Z;  2PI5 A;  1AR5 A;  1X59 A;  2HR3 A;  1SQF A;  3SYA A;  2P7T C;  1XMQ B;  2V7Q G;  4FLW A;  1YZB A;  3II6 A;  4B3S B;  1N34 O;  1M57 C;  1K9M W;  1JFF B;  1FXH A;  4XDL A;  2O57 A;  4LF7 B;  4UVB A;  3FB6 C;  2GUZ B;  4YJ3 A;  4PD4 F;  1NS1 A;  2V1D A;  1HNW O;  2ZNI A;  3N2K A;  3CPW U;  1RP3 B;  3APQ A;  2VRZ A;  5L3F A;  2Z5U A;  4JAA A;  4CH5 A;  4B3M B;  1COW G;  5B5E Z;  2R72 A;  2WAM A;  2UXC B;  4L8J A;  5LBQ A;  5CBF A;  1R3I C;  1JVM A;  3CB2 A;  2UXX A;  1SQG A;  4CKM A;  4CBC A;  2HLD G;  2AW9 A;  5KHJ A;  4J7J A;  5JCO A;  2FL4 A;  1R3J C;  2HG5 C;  1VMG A;  3D8C A;  2DE0 X;  1WAZ A;  2Y4T A;  5JH7 B;  3WFV A;  3ZRW A;  3SJB C;  3MHS C;  1FFX B;  3JCZ A;  3C90 A;  3QO7 A;  4LWS B;  4X20 A; 
#chains in the Genus database with same CATH homology
 4DRX B;  4WBN B;  5LP6 A;  3B2E E;  1SA0 A;  4O4L A;  5JJN B;  5K1P A;  4FM2 A;  4Q6G A;  2ZIN A;  4UCO A;  4GLX A;  5LP6 C;  4TQF A;  4DV6 B;  4CC6 A;  5CJ0 A;  1HR0 B;  4K8Z A;  1HNZ B;  1QQC A;  2KKW A;  3HKB A;  4EB6 A;  3WB1 A;  4I55 A;  4O4J A;  1B04 A;  4JI7 B;  5LYJ B;  4DV1 B;  3PN1 A;  2UU9 B;  2OWO A;  1N33 B;  4CS2 A;  5EZY B;  5CA0 A;  4JI0 B;  4BWA A;  4DK0 A;  5KHI A;  2UUA B;  5CB4 A;  4PHZ A;  3MAQ A;  2Q0A A;  4U3J A;  2YI9 A;  4U3J B;  4FLZ A;  1VF7 A;  4O4H B;  4CH6 A;  1JJO A;  2ZNJ A;  3K5N A;  2R70 A;  5JJJ B;  2BTQ B;  3RGB A;  4DR6 B;  3VQV A;  5EYP B;  1XNR B;  5CHX A;  3HKC A;  3SJA C;  4I50 B;  2ZIM A;  3E22 A;  4JI8 B;  1HW7 A;  2VWK A;  4LFB B;  2VWJ A;  4F6R B;  4ZOL A;  5KHK A;  5EZY A;  2PUS A;  2PGG A;  4ZHQ A;  3ETQ A;  3JAK B;  4XA4 A;  4NVP A;  1S5J A;  4DV2 B;  4IIJ B;  4X64 B;  3JAW B;  5JQG A;  1O9H A;  4FFB B;  2CAZ C;  1IK9 A;  1KU9 A;  4DR2 B;  4FLX A;  5LOV A;  3BAA A;  5CJ4 A;  1JFF A;  5CA1 A;  2E3C A;  4TV8 B;  1Z5W A;  5ITZ B;  3VQY A;  3JAT A;  2F1M A;  4X20 B;  5CB4 B;  4CH4 A;  5C8Y A;  4UFZ A;  3N2K B;  5BR8 B;  4TV9 B;  5LMU B;  4IHJ A;  2UUB B;  1L8D A;  4DR4 B;  3BAB A;  4JI1 B;  4DR5 B;  5IJ0 B;  1WNS A;  2E5L B;  4KHP B;  3BRC A;  4LNU B;  3ZS8 C;  3HKC B;  3UT5 A;  2ZCE A;  2YI8 A;  3BA9 A;  3HKD B;  4BW9 A;  4O4I B;  3K57 A;  4F6R A;  4AIL C;  4FM0 A;  3SR2 C;  3U0Z A;  3T1Y B;  1N36 B;  1XQ8 A;  1O9G A;  1H2S B;  4I4T A;  4I4T B;  2XHB A;  5JCO C;  4O2A B;  4LF9 B;  4X1Y A;  2ZIO A;  5EIB D;  4YHH B;  3K5L A;  4LH7 A;  3RYC B;  4X1I B;  4DUY B;  1Q43 A;  5LYJ A;  2BTO A;  2YIB D;  4PI0 A;  1J5E B;  4I50 A;  4DV3 B;  1XMO B;  3RYH A;  5J2U B;  3K5O A;  5FNV B;  4EEQ A;  1I7F A;  4B3R B;  4DR3 B;  1M5I A;  4YJ2 A;  4X1K B;  1XHX A;  1XI1 A;  1TAE A;  4PI2 A;  4B3T B;  5IJ9 A;  4HNA A;  4GKK B;  4I55 B;  3HKB B;  2RQ6 A;  1P49 A;  3QG5 A;  4X1Y B;  5JJE B;  1I94 B;  4FLY A;  5FPO A;  2UUC B;  5J2T A;  3U10 A;  2V4D A;  5CA0 B;  2VQE B;  5JH7 A;  4TUY A;  4FLU A;  4UCR A;  3JAR A;  3JAS B;  1JMK C;  1TVK B;  1TA8 A;  3CHX A;  3WB0 A;  3RYI B;  4TQD A;  1WN7 A;  5LXT A;  1M93 A;  2P22 C;  4LF4 B;  4HBN A;  4K0K B;  4CC5 A;  3LNN A;  2Q7G A;  2JGU A;  3DSQ A;  1Q8I A;  4ZI7 A;  4LF6 B;  5IJ0 A;  4DV4 B;  3SR2 A;  4X62 B;  3N2G A;  4GKJ B;  1T5E A;  5LMN B;  3FFQ A;  3RYC A;  3VQX A;  1TGO A;  4TUY B;  4DRX A;  4WBN A;  4ZIB A;  3RYH B;  3BA8 A;  3K59 A;  4NXM B;  1SA0 B;  2F95 B;  3BHP A;  4LFC B;  4CS4 A;  3ICX A;  4I9Q A;  3OTO B;  3UT5 B;  5C8Y B;  3M7M X;  5LA6 A;  4LH6 A;  4JI3 B;  1M4U A;  5BMV A;  4O2A A;  4JI2 B;  3HKE B;  4UCT A;  1QHT A;  4UCV A;  3U11 A;  4O2B A;  4JV5 B;  4LF8 B;  2YIB A;  3JAW A;  4B08 A;  5J2T B;  1XNQ B;  3MUD A;  4UCS A;  2P5O A;  3JSL A;  5KX5 A;  4X1I A;  3JAT B;  3SJC C;  5ITZ A;  3BPZ A;  4O4I A;  1FU1 A;  5EIB C;  3QTC A;  4O4L B;  4KL1 A;  1G6U A;  5JVD B;  4TV9 A;  4TOI A;  2JS5 A;  4YJ2 B;  3OTF A;  5IWA B;  1WPB A;  3IAY A;  4DV7 B;  4IIJ A;  5JQG B;  5BMV B;  1XHZ A;  2F4V B;  5GON A;  4JI5 B;  4DR7 B;  4OX9 B;  1IBK B;  2PY5 A;  1IBM B;  1ZAU A;  2ZM6 B;  3JAL B;  3RYF B;  4DK1 A;  3VQW A;  3SGI A;  4AHC A;  4ZHQ B;  3A2F A;  5D5P A;  4EFE A;  2PZS A;  4JI6 B;  4DV5 B;  2OYQ A;  4FLT A;  5IJ9 B;  5LXT B;  2PYL A;  1HNX B;  1TUB B;  4GYC B;  3N2G B;  4O4H A;  4IHJ B;  5KMG B;  2HEP A;  3QF7 A;  1FJG B;  3RWR D;  1RSO A;  3THO A;  4ZI7 B;  4O2B B;  5IYZ A;  3WB2 A;  3E22 B;  2BTQ A;  5FNV A;  1YEW A;  4TV8 A;  4FVM A;  5EYP A;  1D5A A;  4NXN B;  2PYJ A;  2PTM A;  3UQ8 A;  3CSX A;  2VQF B;  4ZOL B;  4LFA B;  2YIA A;  1SKV A;  4LR3 A;  5CA1 B;  4YY3 B;  4AQY B;  1N32 B;  3RFR A;  3HKE A;  2UXB B;  4D7S A;  5KMG A;  4FM1 A;  2YXL A;  3JSN A;  2EX3 A;  4CH3 A;  1NT2 B;  5KHH A;  4K8X A;  4JYA B;  1IBL B;  1X4T A;  1TUB A;  5GON B;  3K58 A;  1SQF A;  4FLV A;  1XMQ B;  3RWR A;  3K5M A;  4EB6 B;  4FFB A;  3JAR B;  5KHG A;  5FPR A;  3JAL A;  3RYF A;  3RYI A;  4FLW A;  2UXD B;  5IYZ B;  2QJ1 A;  4X1K A;  4LF5 B;  3II6 A;  4B3S B;  1Q5O A;  4D7T A;  2HHH B;  1Z5V A;  1JFF B;  4X66 B;  5JVD A;  5LA6 B;  4LF7 B;  2IM9 A;  4YJ3 B;  1KMI Z;  4YJ3 A;  2QM4 A;  2R9A A;  2ZNI A;  3N2K A;  2Q7H A;  4HNA B;  4O4J B;  4UCU A;  2JVD A;  2RJZ A;  4CH5 A;  4B3M B;  5J2U A;  2GV9 A;  2R72 A;  4DR1 B;  2UXC B;  4L8J A;  4DV0 B;  4JI4 B;  3JAS A;  5LP6 B;  5KX5 B;  5K1X A;  3CB2 A;  1DGS A;  1SQG A;  2Q7E A;  4X65 B;  3T1H B;  3ZED A;  5D5Q A;  5KHJ A;  4DUZ B;  2F66 C;  1N34 B;  2F93 B;  3JAK A;  5JCO A;  4EFB A;  5LOV B;  1Q3E A;  1HNW B;  5JH7 B;  3SJB C;  3HKD A;  1V9P A;  1FFX B;  4CS3 A;  1FFX A;  1TVK A;  4LNU A;  4X20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...