2QM4A

Crystal structure of human xlf/cernunnos, a non-homologous end-joining factor
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
232
structure length
232
Chain Sequence
SGMEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human XLF/Cernunnos reveals unexpected differences from XRCC4 with implications for NHEJ.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Recombination
molecule keywords Non-homologous end-joining factor 1
total genus 59
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2qm4A02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 2qm4A01
5CJ4A 2R9AA 3MUDA 2QM4A 1FU1A 3RWRD 3SR2A 5CHXA 1IK9A 5CJ0A 3SR2C 3RWRA 3II6A 1KU9A 1M5IA 4XA4A
chains in the Genus database with same CATH superfamily
2QEXV 2EINC 3TJTA 4GKKO 2OCCB 2QM4A 2LGWA 3K03A 4RQEA 3OMAB 3HKCA 2Z5UA 1TA8A 1KU9A 3E8GA 1GM8A 4J7JA 3MAQA 3VQXA 2ZKOA 4X20A 1E1QG 4QGPA 5LBQA 4LFAB 3GVMA 2R9AA 2A0LA 1CPYA 3BHPA 1B6QA 4IYIA 5LHHA 1BMFG 4ZI7B 4DUZO 1N8RW 1PNMA 4NTWA 4CC5A 2Q0AA 3G6BA 3OEEG 4BIUA 2B9ZA 1SQQH 4DR3O 3ABKC 1KP3A 4LF8O 2Y69B 1YVWA 3KCXA 1S5HC 1XNRB 1AR4A 2CTQA 3LDCA 5H5NA 4LF7O 1D5AA 1ZUQA 2DW4A 4X1YB 4XDJA 5EZYA 4ZBMA 4WBNB 1HNXB 3APOA 1M90W 4LH7A 4P9PA 4I9QA 2EZOA 3CCJV 3ZN0A 1FAFA 2CGOA 2UXBB 3K5MA 4LFCB 4LFBO 1OCZB 5JJEB 2JVDA 3E8BA 5B1BB 1NR1A 4J9ZB 5LYJB 1PM9A 3JARB 4AQYB 4JI0B 3FD9A 2ZDIA 3LSUA 1NKDA 3OTOB 4KXRA 3S3XA 1JOYA 2AGAA 3G4SV 3SYOA 4JI4O 4JZGA 1J5EO 1QCEA 2GHYA 1US6A 2DWDC 1B04A 5KHGA 1VQ7V 4MTXA 1JR9A 3ZS8C 4DR6B 2Y3VA 1ZSPA 3EXAA 3JD1A 2D3OW 4X64O 2OWOA 4LFCO 2IBZH 4FVMA 2HR3A 1Q82W 4ZI7A 5AG2A 2QM8A 3PJSK 4GEUA 2KSDA 3C90A 4GKJB 5LHGA 1XQ8A 1KB9F 4DW1A 3PN1A 1BE3H 2UXDB 3MHHC 3E22A 2EBOA 4RQFA 4LF5B 3UT5A 4X62O 3CCUV 1XMOO 1NH2B 2GBOA 1M57C 1XL4A 3IGAC 3TK1A 2EINB 4X8AA 4KUMA 5LGTA 4O4HA 4QE7A 4W4KA 3FKSG 1N36O 5CJ4A 2ITCC 1YTFB 4LF6B 2YI8A 4CS3A 4FLWA 2M6YA 2V1DA 5D5QA 2V4DA 3HPLC 2UUCO 1NS1A 1YJNV 4FLUA 1GRJA 5JVDA 4X65O 4X20B 3IJ4A 5CB4A 1N32B 2AHZA 5J2UB 4DR1B 4DXWA 5CHXA 4GFCA 2HVKC 3ETGA 1TUBB 5CB4B 4WFEA 5LYJA 4I9WA 4QNHB 5D5PA 1RM1C 1R6NA 4LF4O 4PDLA 1SERA 1KUQA 4DR5B 2QM7A 3JALA 4YJ2B 2M7WA 2FB5A 2EULA 4TT3G 1VEWA 3BFRA 5JJJB 4PHZA 2N05A 3OAAG 3K04A 3ZRWB 2PGGA 4TUYA 3ZHQA 1X59A 4CH3A 4X65B 3JSLA 4Z1VA 3ASOB 3STLC 1QLEC 4H37A 1XMQB 4UCUA 1HNXO 3JD0A 1FFXB 1U96A 3TGUH 1A32A 4CKMA 3OFNG 1FXKC 1YI2V 2Q73A 4GZRB 2W6IG 4LFBB 2GV9A 1HNWB 1BHBA 4XA4A 4DO2A 1KKDA 1V54B 1PL4A 1Q6IA 1YF2A 2E3CA 4OPAA 3UO3A 1EZJA 2EJRA 1MOFA 2OCCC 2IU0A 4DR4B 2YIBA 1FXVA 2R9IA 1D5NA 4QJFB 3TXSA 4LR3A 1IBKO 3CCMV 1AI4A 2ZE6A 4B3SB 1XBLA 4K35A 5EYPB 3HKDA 3CB2A 3H1KH 2VQFB 2ZIOA 3TCUA 4XDKA 4LF9O 2FTKA 2VQEB 4MW3A 3CXHF 3U0ZA 4Z2WA 3RT3C 1K92A 2NNUA 2ZCEA 2LQTA 2B1IA 2JEUA 3E86A 1CP9A 1GN2A 1QU7A 4F6EA 3A2FA 1I7FA 5BR8B 2QR4A 2DYSC 1YSCA 5H2FZ 2EX3A 1YITV 2F66C 5KLVH 1XI1A 1MZFA 2RQ6A 3CC4V 2LJ2A 5LMUB 2ZQMA 4DR4O 2Q68A 3ABMC 3H9VA 4X1IB 5EBWC 4JYBA 1FJGO 5GTHZ 4B3SO 3THOA 1I0HA 2WA3A 3SPIA 4X89A 4PA7A 3CD6V 4LF5O 5IYDO 4RUFA 4MVMA 2HJFC 1EBOA 4RUEA 4B7KA 2UXCO 1H2MA 1NTMH 3KZIZ 2HG5C 4NTYA 3W7TA 2VWJA 4CH6A 5J2TB 4G28B 3ZRSA 2PF4E 2ZE5A 4FIPC 3CCVV 4JI0O 5L3BA 1QBZA 1SA0B 5B1BC 1GAXA 3CCQV 4PJ0Z 2MW2B 4LH6A 1AVMA 1SQGA 2FYUH 5JJNB 1VQ5V 1QVGU 1AJQA 2UXXA 1N34O 1JCHA 4GUNA 3E8FA 3T1CA 3SDLA 3ZMSA 2ZE8A 2UUBO 3B40A 2CTWA 5CA1B 5KA6A 4JI8B 2IH3C 3SR2C 2PYJA 2UXCB 3PYIA 4UCOA 3RYIB 2KKWA 2KG7A 3JASA 5A2QN 4AHCA 2YEVA 3OW2U 3BA9A 3ZHUA 4DV0B 1JMKC 4JI6B 4DK1A 1Y67A 2EIMC 4YIPA 3C3SA 3M7MX 3DXRA 3I55V 3ASOC 2QGNA 3N2GB 2JEXA 1L0LH 2KQXA 4JTCB 3CYOA 2GTSA 1AJNA 1FXKB 4JYCA 1FYJA 4JI2B 1J95A 3BAAA 1NT2B 5FL7G 1H2KA 2YXYA 5H6RA 4LC1A 2B1GA 3JD4A 1KKCA 1M57B 4DK0A 4ZIBA 5EYPA 3FB8C 3RVZA 3EHBB 2EZPA 4IIJA 1SZXA 2Q7EA 1K3EA 1N33B 4X1KA 1E79G 2ODMA 2OIEA 1QVFU 3OUFA 5IDJA 4P30A 4JGSA 1WB7A 1DF4A 1U97A 1GKFA 2YUAA 1L8DA 3FFQA 3JCZA 4JPRA 3WB1A 3JAKB 4O4IB 1IBKB 2DE0X 3QF7A 4HYOA 1JA8A 4UVAA 4ZOLA 4CC6A 1XREA 1HP8A 4G79A 3F5TA 1UJWB 1S0VA 4J9YB 3P3NA 2KG7B 1Y66A 4RO2A 5FNVA 1AR5A 1QNMA 4DR7O 1R6KA 1NTKH 3SR2A 2YSUB 1Y6XA 3CC7V 2X7RB 1PV0A 5CMUA 1YHQV 2XNDG 4FFBB 3ZRXA 2W0FC 3VOUA 1Q81W 2A7WA 5H6QA 3MUDA 3TETA 4OX9B 2LO1A 5CA0A 4U3FH 4I4TA 1L1FA 4DV1B 5B5EZ 2F4VB 2QWOB 2BOCC 1Z5WA 5IWAB 3GWOA 1J5EB 4YY3O 4MVSA 1XMQO 3H1IH 4I4TB 1KC8W 3H1HH 2DYSB 3OMIB 2Y0PA 1YJWV 4GEXA 3RYHA 1UFIA 2EIJC 4P2ZA 3RW0A 3ZMZA 4PD4F 2AHYA 3ABLC 5B1NA 3ZHTA 3U11A 2WA4A 2OCHA 3UM7A 1YXBA 4LF7B 5E1AC 2QSAA 2NR5A 1GM7A 3JD3A 3EVKA 1MG1A 3AK1A 4H0LB 1Q6UA 1SF9A 3I5DA 1IURA 3K3WA 4LCUC 4CH5A 1IBMO 1NH2D 1P4RA 4DR2B 4MVUA 5DM6V 2P7TC 1JJ2U 3DTUB 1PNLA 3ETDA 2XAJA 1AILA 2RDCA 2WLLA 2CH7A 1AJPA 3SJCC 4L8JA 2F43G 2YIBD 4NKGB 4UVBA 2DJVA 4AI8A 4UUJC 2Y4TA 4CS2A 1QR8A 4K0KO 3QO5A 3WB2A 3ZBHA 1BZKA 4LP8A 4NXNB 4YHHB 3CJHA 3JAMN 2K1EA 3EFFK 2CTPA 1ZAUA 1WJZA 3CP1A 1QHTA 2WWWA 2N74A 4O2AB 1AI7A 4B3MO 4TOIA 2PYLA 3QO8A 3RYHB 4U3JB 4GX5A 3BEHA 3SPJA 4O2AA 5KHIA 1O9GA 4UB8Z 1R3LC 2ILMA 2NN4A 4GT1A 4CKPA 5EBLC 3CCRV 3L72H 1K97A 3SYQA 4G27B 1HR0O 4MVZA 5CN0A 1OJHA 4B08A 2F1MA 4GKKB 1NTZH 4CS4A 3TXQA 2VWKA 3ETEA 2EILC 5IY5C 1W2BU 1HNZB 4UCSA 3K58A 3F5WC 4IIJB 1N34B 4JI7O 2HFEC 1FS0G 1XUQA 1M93A 5IE9A 4TV9A 3T2MA 3JSNA 2D2CB 2Y4UA 4WFAV 3E8HA 2UUAB 5LOVA 1Y74A 2H3OA 3GB7C 2IM9A 4PELA 4RWUA 2HJDA 3R65A 4CZZA 1HNWO 4GLXA 4X9QA 4FFKA 2Q0OC 5J2UA 1CEZA 2HEPA 3S3WA 1WNSA 3DSQA 2QWPB 3SPCA 2OTJV 4EFBA 3AG1C 2AXTZ 1PKXA 3CJHB 2OT5A 3BRCA 3RBZA 1VQ4V 5KX5A 1LUWA 5LGNA 4O4JA 4E2LA 4ZKIA 5BXZA 4JI7B 1OCRB 2EIMB 4FM1A 1BS3A 1N32O 4Q20A 1V55B 2JGDB 1QLNA 1S76D 3BPZA 1L0NH 1VQLV 4BAYA 1Q86W 3WU2Z 2PY5A 3UKMA 4R50A 3Q0YA 2O57A 1N4CA 5BY1A 1XL6A 4O2BB 4AQYO 1WN7A 2ITDC 3RGBA 1B06A 3A8TA 4JYYA 5J9PC 5ITZB 3K79A 3JAKA 2P67A 2LFRA 1MABG 4JYAB 2CTRA 3DGEA 4YJ3A 2A06H 4H13B 1VF6C 3JAWB 5C8YA 1ZL8B 5LXTA 3LSQA 1XHZA 5IYBO 1IBMB 4BWAA 4DR2O 2E75B 5LGUA 3ZJZA 2IJIA 4MTOA 3ZIAG 3HB3B 1GN4A 3D36C 3W7UA 4DUYO 2RN9A 4U3JA 4ASUG 4X1IA 4K8ZA 1PD3A 4CBCA 1Q8IA 5L3EA 3SYAA 1BSMA 4B3TB 2CUGA 5JH7B 2XAFA 5KHKA 1CXZB 3LSSA 3K57A 1SQFA 3ZN1A 2FKXA 3K06A 1SC5B 1QQCA 3L75H 1YJ9V 3BABA 5JH7A 2BE3A 5BZBA 3B77A 4O4HB 3QNEA 2EILB 5IY5B 2F23A 1NU1H 4WFGA 1EN4A 1Y4MA 1PPJH 5KUMA 4Q6GA 5B66Z 4GX1A 3K59A 4U7OA 1EN5A 2YXLA 3RYFB 4BIOA 3Q4HB 1G1XB 2RMKB 1TAEA 1UPGA 5KAFZ 1JQ0A 1R1BA 4J7KA 1JVMA 1WP8A 4DV7O 3T1YO 4KHPO 3ZHVA 1VQNV 1MMMA 3E89A 3ICXA 2E74B 5DEDA 1JJOA 4K3AA 2ZD9A 5KAIZ 4FZ1A 3ABUA 3G80A 4U7NA 3H1JH 1SQXH 4H44B 4HNAA 1Q5OA 3DXRB 1F7YA 2ZE7A 1K7DA 2GUZB 1KYOF 1WB8A 4HBNA 5LP6A 1N33O 3AEIA 1B3QA 3JALB 2BTQA 5FPOA 1THZA 4JI1O 1OV9A 5LA6A 3CCSV 3E35A 1SZTA 1I94B 3ZHSA 1MNGA 4DRXB 3MHSC 1BQZA 2X0LA 4DV7B 3T1YB 1SETA 1F23A 1VF5B 1V54C 5GW7A 1WA8B 3CRMA 3OE7G 4F4LA 3E2EA 2Q8VA 2HKOA 4TV8A 1MSWD 3L74H 1OCRC 1H2NA 1TVKB 3AK2A 1GO3F 1S5JA 1GTOA 4J42A 4OX9O 4LNUB 2WLIA 2YICA 2Y3WA 3ZMVA 1FFTB 2FMLA 2P90A 3AG1B 5IJ9A 1MA1A 4GX2A 2C2AA 1OCOC 4YY3B 2QTSA 4J80A 3T1HB 2DYRC 2Q6AA 1N0NA 3BA8A 4X1KB 4O4IA 4LF9B 3BY6A 1FKAO 1FU1A 4GCZA 5B1AB 2R9RB 1SQVH 1M9NA 2A79B 2XASA 2UXBO 1BL8A 5L3FA 5K1XA 3CX5F 4UCTA 2JK5C 4RAIA 4DUYB 4PA4A 1SESA 3H1LH 3ABTA 2WLNA 3CEIA 1I5XA 4CH4A 3OTOO 5GTIZ 4F6RA 5LL6Y 3B8NA 3J7AU 3X2QC 1HWYA 3N2GA 1W0JG 3L70H 1S72V 2PI5A 4R7CA 4D7SA 1IVSA 4J41A 1WA8A 5JVDB 5LHIA 4NB5A 3CWBH 5IJ0A 5CJ0A 1SKVA 4TV9B 5F2VO 3SJQC 1NVPD 5J2TA 2CK3G 2YC0A 5K1PA 3BCCH 1PP9H 2XTAA 1S3JA 3CRAA 5LA6B 3KKYA 4JTAB 1TGOA 1WLEA 2A3QA 3APQA 5KA5A 1TVKA 4EKWA 3OM3B 1RPRA 2DMXA 1IX9A 5L3CA 4EFEA 5LXTB 2BTOA 3CMAV 1M1KW 4YHHO 4PI0A 4PDVA 2UXDO 1PL0A 2GSMB 3O9OA 1IBLB 3G6EV 4ABMA 4B3MB 3D3QA 4JI3O 2JRIA 4DV6B 4WF9V 3JD2A 3FX7A 4KHPB 4OGQB 1YZBA 5JQGB 5LMNB 5B3SB 4DV5B 3NR7A 4YJ3B 1YCIA 3OT7A 2LFSA 2XOKG 1W0KG 3JYCA 3UO2A 2P5OA 4LWSB 1JFFA 4BR6A 3FB7C 4BW5A 4R8CA 3A0BZ 2BTQB 4JI1B 4YXWG 1SS3A 5LP6B 4K8XA 2X6CA 1Y76B 1I08A 5JCOA 3HR0A 1DLBA 2ZNJA 4DR6O 3OD4A 4DV2B 3B4SA 1M56C 4NYKA 1O9HA 4DV6O 3ZRVA 3FAVA 3OTFA 4QIWF 1FXKA 3CSXA 2LW7A 1RPOA 1YDXA 1RSOA 1H2SB 1ROPA 5IJ9B 5LMNO 1R73A 5CBFA 1DTOA 5CA0B 3T4ZA 4X88A 3AG4B 4FLZA 3JARA 2H8PC 2OTLV 1Q6HA 1XNQO 2EIKB 4BIZA 2VS0A 3GWKC 2ZXWB 2KB1A 1Y74B 4PA6A 4IL6Z 1IXMA 3B2EE 3IC7A 3RFRA 3CS5A 3AG3B 4QPJA 4MVQA 2PZSA 5C8YB 4ZHQB 4JAVA 4DV2O 5HFMA 4MW8A 2QWQB 1ZL8A 3FB5C 5KX5B 1VF6A 3H01A 5E79Z 3QVNA 1PNKA 3RYCB 3C3TA 1T5EA 1RP3B 1BT8A 3W7SA 5FNVB 4E4EA 2JGUA 4KFMA 4JI6O 3K5OA 4O4LB 2AZ2A 1K5QA 1FFXA 1XOUA 4OPHA 1XNRO 1BCCH 1H2LA 4TSFG 2JS3A 1VQOV 1OHHG 2P4VA 5H9CA 5B1AC 1M5IA 3G67A 1URFA 1X4TA 2UUAO 3Q0XA 2HP8A 1GN6A 4IYHA 3ZRWA 1I5YA 2ZM6O 2WLKA 4A5UB 1IDSA 4I5SA 4DR5O 4FLXA 4EB6B 5BR8O 2YI9A 2RCVA 2YS8A 2P06A 5GONB 5BMVB 3AG7A 2YEVB 1EM1A 4XBFA 3LNNA 3W7WA 3UT5B 1LR1A 3M99B 2IU3A 1IK9A 2GDSA 4I0XA 3J81N 4PA9A 3CCEV 3FAVB 4MTGA 3ZCCA 4FMTA 1NR7A 1OCZC 1HW7A 3HKEB 2Z0AA 3K9SA 2MK3A 2IJKA 4JI3B 2BCCH 5LOVB 2ZM6B 4MT8A 1AROP 3AK3A 3J80N 3SPHA 2JJ2G 1WAZA 3P3PA 2CAZC 4DV3B 5A9GA 3BVOA 4NTXA 4LF8B 3UQ8A 1VP7A 1P49A 3JAWA 4GX0A 4PDRA 3KG2A 2R70A 1K73W 4ZOLB 2JJ1G 4JASA 3LNMB 4QE9A 2A9HA 2QKCA 2F95B 2Y69C 4X66B 2HHHB 4DV1O 1H2GA 2F4VO 2ZNIA 3K0DA 5KHJA 4MVRA 2P22C 3L71H 3JATB 2Q7HA 1K8AW 1WP7A 2PTMA 3MDSA 4X62B 2X6BA 4JAUA 4I55B 1NJIW 4GFAA 2XUMA 1NVPB 2QTOA 4FK5C 4NXMB 5EC2C 4F6RB 4YIOA 4LBEC 3K9AA 4DV0O 3FYEB 1BGYH 4I7ZB 3LDDA 3OEHG 4UVCA 1HDJA 3HKBA 3WG7B 3N2KB 1FXHA 4JF3A 2E76B 1XEQA 5JQGA 2ATKC 4JI2O 5L3GA 1M4UA 1AI6A 1AB3A 2Z3YA 3WFVA 1MZEA 3U10A 1ZTEA 3HKBB 3AG2B 4I50A 2Q9LA 1ZLZA 5EC1C 4DV5O 2W6JG 2DWEC 1R3KC 3K0GA 4C7UA 4IGGA 1F4MA 1M56B 4D6TH 4KL1A 3I56V 1D2DA 2GTAA 3LUTB 1Y76A 3CRCA 5KMGB 2N04A 3HKDB 3HKEA 2VRZA 4HAMA 1VQMV 3AG4C 3UCSC 3VQWA 1LUVA 2PUSA 1P7BA 1JX9A 5CA3A 2QDOA 1ZX3A 5FLXN 1H8EG 2WPDG 3WB0A 2H94A 1DGSA 3FB6C 2WLJA 3CMEV 5TISZ 2YIDA 4PI2A 1K33A 4R6ZA 2R72A 4I55A 2HLDG 4MTFA 3B8MA 3ETQA 4MSWC 1HR0B 1JPXA 4DR3B 1GM9A 1RM1B 1KBHA 1VF7A 4JV5B 4FLYA 1DF5A 5KHHA 4FM2A 2Y0IA 4TWKA 2UU9B 2WSSG 2ZIMA 1H8HG 1HNZO 2UUCB 3L9DA 3SYCA 3SYPA 3F7YC 5IWAO 1KP2A 1ENVA 4FLTA 2QKSA 2ZINA 4J11A 4CKNA 3RYIA 3AG3C 4FM0A 3NXSA 1GK9A 1VQKV 3VQVA 1H38A 3RYCA 2JDIG 3M8AA 2HVJC 1IZ3A 4DV3O 1GN3A 4UCVA 2B5UA 3CC2V 2QWNB 1K34A 3OGIB 1YEWA 1XILA 3ZHRA 3QG5A 4EEQA 1Q7YW 3A0RA 2PI4A 2YDEA 1FJGB 4TQFA 4FFBA 4TQDA 3G71V 4HZ3A 3JCUZ 1V55C 4WBNA 4TV8B 4DYLA 3R66A 4DUZB 1QLEB 4W4LA 5EIBD 4PA3A 4NXMO 4UFZA 4B7EA 4MVOA 1Z2GA 4B3RB 3ZX6A 1GH6A 5CBGA 5GONA 3WG7C 3CRRA 4UXNA 5EK0A 3CCLV 2WLIB 1DK1A 4WFFA 1COWG 4ZHQA 3CRQA 4KP4A 3AG2C 3SJBC 3P32A 5DN6G 3ABMB 3SGIA 4PDMA 1K4DC 4FZ0A 3OUSA 4JAAA 4UB6Z 2QJ1A 1VARA 3OMNB 2ADPA 2FL4A 5CA1A 1VQ6V 2LW1A 4JI5O 4FPPA 4LNUA 2ZDIC 1KQSU 4LF6O 4UCRA 3JATA 1XNQB 2OIGA 1K9MW 4JI4B 4IT5A 1Q90D 1NZ6A 3CHXA 2NLJC 4UV9A 1Z5VA 1IBLO 4DV4O 3K08A 1AP6A 4TUYB 2WLMA 1Q3EA 3ZEDA 2ZR2A 1VIBA 4NR1A 2JGDA 1S77D 2XAHA 3ASNB 4OXSA 1IXBA 2E5LB 1GMGA 3MD0A 5JWPA 1K5SA 1OCCB 2JS5A 3VBBA 4GKJO 1R3JC 3LDEA 2P6JA 4NVPA 2G38A 2K9PA 1R6TA 1OZ0A 4QPKA 4K0KB 3II6A 5ITZA 1TUBA 2L6LA 4MS2A 3HKCB 4G2KA 5IYZA 4NXNO 4WFHA 3SPGA 2ADQB 4DV4B 1R3IC 4LFAO 1XMOB 1S5LZ 4XDLA 2UUBB 1K4CC 2BSKB 5EBMC 1VQPV 1LNQA 5B1OA 4L87A 3STZC 2XAGA 3DC5A 2ZT9B 3KCYA 4O4JB 3RYFA 2Y48A 1XDCA 2Q67A 5FPRA 1E1RG 1G4YB 1AI5A 3F7VC 2UXNA 1P7GA 3W7XA 3E83A 5HFLA 3FYIB 1QR9A 5IYCO 2ARHA 3E22B 3CE2A 4J7ZA 3T4DA 2IJHA 3IC9A 4FJCC 2Q5ZA 3QTCA 4O4LA 2WLLB 3ABKB 2CGNA 4LF4B 3SJAC 2LGQA 3ABLB 3RVYA 5IJ0B 2IJJA 2QA4V 2P4KA 1KD1W 1BHAA 4WCEV 3K5NA 1G6UA 1KECA 2CE4A 3ML0A 4I50B 4JV5O 2Q69A 1NBMG 2UU9O 1F51A 2LP7A 4IHJA 3IFXA 4H33A 2QKAA 3O65A 4B3TO 1MSDA 1W59A 1SQPH 2V7QG 3D3IA 3N2KA 2Q4PA 1V9PA 3T1HO 1BQ0A 5B3SC 3X2QB 1VQ8V 2X6AA 1WPXA 2L35A 4DR7B 2AW9A 1OCOB 4X64B 2DYRB 3DC6A 5DECA 4DRXA 2DN9A 1EN6A 2IH1C 5EIBC 1VQ9V 3RN4A 2F93B 1G8MA 2QWRB 1SQBH 2RJZA 5LP6C 2CH7B 2GUZA 3OR6C 1KMIZ 2RNBA 4JYAO 3ZMTA 1ZWIC 3CPWU 4P9OA 2VQFO 2AZ0A 1NI8A 3D36A 1RFYA 2VQEO 5IT9N 1P84F 2YIAA 1OCCC 1YTFD 4JI8O 1VMGA 5IYZB 2WLHA 5C93A 4N21A 4O2BA 3IAYA 1YIJV 2E5LO 1RSOB 2EJ7A 1SA0A 5JCOC 4PV1B 4B3RO 3A0HZ 3D8CA 2ZXWC 5BMVA 3RWRD 1TUEB 2EIJB 3CXCU 1N36B 2IW5A 3P30A 1ORQC 1FD9A 5LMUO 2ZR3A 1SRYA 2DQ0A 3B09A 5L3DA 3OR7C 4X66O 2HHHO 2DQ3A 4J10A 3QO7A 1XHXA 3K5LA 3ZMUA 5KUKA 4ICGA 3N27A 1I94O 3ASNC 4HNAB 4EB6A 2ETNA 4DR1O 3Q4HA 4FLVA 1Q43A 2XHBA 4X1YA 2WAMA 2QE7G 2EIKC 2JIZG 2BSKA 4IHJB 4JI5B 5CBHA 4GYCB 3JASB 1F4NA 1FPOA 4AILC 4Z1MG 1AR1B 4WFBV 1AP5A 4YJ2A 4UV8A 4N23A 1EFRG 4JZ2A 2Q7GA 5KMGA 2W0XA 1EZVH 1NQTA 1N0JA 2CDYA 5EZYB 2BOBC 4JTDB 4DW0A 3VQYA 2DOSA 4D7TA 2XAQA 3L73H 3OGCC 4LWSA 2YXHA 2OYQA 4I0XB 4BW9A 1JFFB 1WPBA 3RWRA 2XT9A
chains in the Genus database with same CATH topology
3ETQA 4DK0A 4ZIBA 5EYPA 4TV8A 1HR0B 4DR3B 2QM4A 4IIJA 1VF7A 2Q7EA 4JV5B 4FLYA 1N33B 1TVKB 5KHHA 4FM2A 4X1KA 2UU9B 1S5JA 3HKCA 2ZIMA 1TA8A 1KU9A 4LNUB 3FFQA 1L8DA 2UUCB 3MAQA 3VQXA 3WB1A 3JAKB 4X20A 5IJ9A 4O4IB 1IBKB 3QF7A 4LFAB 2R9AA 4FLTA 2ZINA 4YY3B 4ZOLA 4CC6A 3T1HB 3BA8A 4X1KB 3BHPA 4O4IA 3RYIA 4LF9B 1FU1A 5FNVA 4FM0A 4ZI7B 3VQVA 4CC5A 2Q0AA 3RYCA 3SR2A 5K1XA 4UCTA 4UCVA 4FFBB 4DUYB 3MUDA 1YEWA 1XNRB 4OX9B 3QG5A 5CA0A 4EEQA 4CH4A 4F6RA 4I4TA 1D5AA 4DV1B 2F4VB 1Z5WA 3N2GA 4X1YB 5IWAB 1FJGB 1J5EB 5EZYA 4TQFA 4WBNB 4FFBA 1HNXB 4I4TB 4TQDA 4D7SA 4LH7A 4I9QA 5JVDB 4WBNA 4TV8B 5IJ0A 4DUZB 2UXBB 3K5MA 4LFCB 5CJ0A 1SKVA 5EIBD 3RYHA 4TV9B 5JJEB 2JVDA 4UFZA 4B3RB 5J2TA 5K1PA 5LYJB 3JARB 3U11A 4AQYB 4JI0B 5LA6B 5GONA 1TGOA 1TVKA 3OTOB 4LF7B 4EFEA 5LXTB 2BTOA 4PI0A 4ZHQA 1IBLB 1B04A 3SJBC 5KHGA 4DR6B 4CH5A 3ZS8C 3SGIA 4B3MB 4DR2B 2QJ1A 4DV6B 5CA1A 2OWOA 4FVMA 4KHPB 4ZI7A 5JQGB 5LMNB 4DV5B 3SJCC 4L8JA 4LNUA 4YJ3B 4GKJB 2YIBD 1XQ8A 2P5OA 4CS2A 4UCRA 3JATA 1JFFA 1XNQB 3WB2A 3PN1A 4JI1B 2BTQB 4NXNB 4YHHB 4JI4B 3CHXA 2UXDB 1ZAUA 3E22A 5LP6B 4K8XA 1Z5VA 5JCOA 1QHTA 4O2AB 4TUYB 4LF5B 2ZNJA 3UT5A 1Q3EA 3ZEDA 4TOIA 2PYLA 4DV2B 3RYHB 1O9HA 4U3JB 3OTFA 4O2AA 5KHIA 3CSXA 1O9GA 1RSOA 1H2SB 4O4HA 5IJ9B 2E5LB 5CA0B 2JS5A 4B08A 4FLZA 2F1MA 4GKKB 5CJ4A 4CS4A 3JARA 4NVPA 2VWKA 4LF6B 2YI8A 4K0KB 3II6A 4CS3A 5ITZA 4FLWA 1TUBA 1HNZB 3HKCB 5D5QA 5IYZA 2V4DA 4UCSA 3B2EE 3K58A 4IIJB 4FLUA 3RFRA 5JVDA 1N34B 2PZSA 4X20B 4DV4B 5CB4A 1N32B 1M93A 5C8YB 5J2UB 4TV9A 4ZHQB 1XMOB 3JSNA 4DR1B 2UUBB 5CHXA 2UUAB 5LOVA 1TUBB 5CB4B 5LYJA 5D5PA 2IM9A 5KX5B 4DR5B 4O4JB 4GLXA 3RYCB 3JALA 3RYFA 1T5EA 4YJ2B 5J2UA 2HEPA 1WNSA 3DSQA 5FNVB 2JGUA 4EFBA 3K5OA 4O4LB 5FPRA 1FFXA 3BRCA 4PHZA 5JJJB 5KX5A 4O4JA 2PGGA 4TUYA 4JI7B 4CH3A 4X65B 3JSLA 4FM1A 1M5IA 3E22B 3BPZA 1X4TA 1XMQB 4UCUA 3QTCA 4O4LA 1FFXB 2PY5A 4LF4B 3SJAC 5IJ0B 4LFBB 2GV9A 4FLXA 1HNWB 4EB6B 4XA4A 3K5NA 1G6UA 2YI9A 4O2BB 4I50B 1WN7A 2E3CA 3RGBA 5GONB 5BMVB 4IHJA 5ITZB 3LNNA 4DR4B 3JAKA 3UT5B 2YIBA 1IK9A 4LR3A 4JYAB 4YJ3A 4B3SB 5EYPB 3HKDA 3CB2A 3N2KA 2VQFB 1V9PA 1HW7A 2ZIOA 3HKEB 3JAWB 5C8YA 5LXTA 1XHZA 2VQEB 1IBMB 4JI3B 4BWAA 3U0ZA 5LOVB 4DR7B 2ZM6B 2ZCEA 4X64B 4DRXA 3A2FA 2CAZC 1I7FA 5BR8B 4DV3B 4LF8B 3UQ8A 5EIBC 3JAWA 1P49A 2EX3A 2F93B 2R70A 2F66C 4U3JA 4ZOLB 2RJZA 4X1IA 1XI1A 4K8ZA 2RQ6A 5LMUB 5LP6C 1Q8IA 2F95B 4B3TB 1KMIZ 4X66B 2HHHB 4X1IB 2ZNIA 5JH7B 3THOA 5KHKA 5KHJA 2P22C 3JATB 2Q7HA 3K57A 1SQFA 2PTMA 4X62B 1QQCA 2YIAA 5IYZB 4I55B 3BABA 5JH7A 4NXMB 4O2BA 3IAYA 4F6RB 4CH6A 5J2TB 4O4HB 2VWJA 5JCOC 1SA0A 5BMVA 3RWRD 1N36B 1SA0B 4Q6GA 4LH6A 3K59A 1SQGA 3HKBA 3N2KB 5JJNB 2YXLA 3RYFB 1XHXA 3K5LA 5JQGA 1TAEA 4HNAB 1M4UA 4EB6A 5CA1B 3U10A 4FLVA 1Q43A 4JI8B 3SR2C 2XHBA 4X1YA 2PYJA 2UXCB 3HKBB 4I50A 4UCOA 3ICXA 3RYIB 2KKWA 1JJOA 3JASA 4AHCA 4IHJB 4JI5B 3BA9A 4KL1A 4DV0B 4HNAA 1Q5OA 4DK1A 1JMKC 4JI6B 4GYCB 3JASB 5LP6A 4HBNA 5KMGB 3HKDB 3M7MX 4AILC 3HKEA 3JALB 2BTQA 5FPOA 4YJ2A 5LA6A 3VQWA 2PUSA 3N2GB 5KMGA 2Q7GA 1I94B 4JI2B 3WB0A 4DRXB 1DGSA 3BAAA 1NT2B 5EZYB 3VQYA 4DV7B 3T1YB 4D7TA 4PI2A 2OYQA 4BW9A 1JFFB 1WPBA 2R72A 3RWRA 4I55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CJ4 A;  2R9A A;  3MUD A;  2QM4 A;  1FU1 A;  3RWR D;  3SR2 A;  5CHX A;  1IK9 A;  5CJ0 A;  3SR2 C;  3RWR A;  3II6 A;  1KU9 A;  1M5I A;  4XA4 A; 
#chains in the Genus database with same CATH topology
 2QEX V;  2EIN C;  3TJT A;  4GKK O;  2OCC B;  2QM4 A;  2LGW A;  3K03 A;  4RQE A;  3OMA B;  3HKC A;  2Z5U A;  1TA8 A;  1KU9 A;  3E8G A;  1GM8 A;  4J7J A;  3MAQ A;  3VQX A;  2ZKO A;  4X20 A;  1E1Q G;  4QGP A;  5LBQ A;  4LFA B;  3GVM A;  2R9A A;  2A0L A;  1CPY A;  3BHP A;  1B6Q A;  4IYI A;  5LHH A;  1BMF G;  4ZI7 B;  4DUZ O;  1N8R W;  1PNM A;  4NTW A;  4CC5 A;  2Q0A A;  3G6B A;  3OEE G;  4BIU A;  2B9Z A;  1SQQ H;  4DR3 O;  3ABK C;  1KP3 A;  4LF8 O;  2Y69 B;  1YVW A;  3KCX A;  1S5H C;  1XNR B;  1AR4 A;  2CTQ A;  3LDC A;  5H5N A;  4LF7 O;  1D5A A;  1ZUQ A;  2DW4 A;  4X1Y B;  4XDJ A;  5EZY A;  4ZBM A;  4WBN B;  1HNX B;  3APO A;  1M90 W;  4LH7 A;  4P9P A;  4I9Q A;  2EZO A;  3CCJ V;  3ZN0 A;  1FAF A;  2CGO A;  2UXB B;  3K5M A;  4LFC B;  4LFB O;  1OCZ B;  5JJE B;  2JVD A;  3E8B A;  5B1B B;  1NR1 A;  4J9Z B;  5LYJ B;  1PM9 A;  3JAR B;  4AQY B;  4JI0 B;  3FD9 A;  2ZDI A;  3LSU A;  1NKD A;  3OTO B;  4KXR A;  3S3X A;  1JOY A;  2AGA A;  3G4S V;  3SYO A;  4JI4 O;  4JZG A;  1J5E O;  1QCE A;  2GHY A;  1US6 A;  2DWD C;  1B04 A;  5KHG A;  1VQ7 V;  4MTX A;  1JR9 A;  3ZS8 C;  4DR6 B;  2Y3V A;  1ZSP A;  3EXA A;  3JD1 A;  2D3O W;  4X64 O;  2OWO A;  4LFC O;  2IBZ H;  4FVM A;  2HR3 A;  1Q82 W;  4ZI7 A;  5AG2 A;  2QM8 A;  3PJS K;  4GEU A;  2KSD A;  3C90 A;  4GKJ B;  5LHG A;  1XQ8 A;  1KB9 F;  4DW1 A;  3PN1 A;  1BE3 H;  2UXD B;  3MHH C;  3E22 A;  2EBO A;  4RQF A;  4LF5 B;  3UT5 A;  4X62 O;  3CCU V;  1XMO O;  1NH2 B;  2GBO A;  1M57 C;  1XL4 A;  3IGA C;  3TK1 A;  2EIN B;  4X8A A;  4KUM A;  5LGT A;  4O4H A;  4QE7 A;  4W4K A;  3FKS G;  1N36 O;  5CJ4 A;  2ITC C;  1YTF B;  4LF6 B;  2YI8 A;  4CS3 A;  4FLW A;  2M6Y A;  2V1D A;  5D5Q A;  2V4D A;  3HPL C;  2UUC O;  1NS1 A;  1YJN V;  4FLU A;  1GRJ A;  5JVD A;  4X65 O;  4X20 B;  3IJ4 A;  5CB4 A;  1N32 B;  2AHZ A;  5J2U B;  4DR1 B;  4DXW A;  5CHX A;  4GFC A;  2HVK C;  3ETG A;  1TUB B;  5CB4 B;  4WFE A;  5LYJ A;  4I9W A;  4QNH B;  5D5P A;  1RM1 C;  1R6N A;  4LF4 O;  4PDL A;  1SER A;  1KUQ A;  4DR5 B;  2QM7 A;  3JAL A;  4YJ2 B;  2M7W A;  2FB5 A;  2EUL A;  4TT3 G;  1VEW A;  3BFR A;  5JJJ B;  4PHZ A;  2N05 A;  3OAA G;  3K04 A;  3ZRW B;  2PGG A;  4TUY A;  3ZHQ A;  1X59 A;  4CH3 A;  4X65 B;  3JSL A;  4Z1V A;  3ASO B;  3STL C;  1QLE C;  4H37 A;  1XMQ B;  4UCU A;  1HNX O;  3JD0 A;  1FFX B;  1U96 A;  3TGU H;  1A32 A;  4CKM A;  3OFN G;  1FXK C;  1YI2 V;  2Q73 A;  4GZR B;  2W6I G;  4LFB B;  2GV9 A;  1HNW B;  1BHB A;  4XA4 A;  4DO2 A;  1KKD A;  1V54 B;  1PL4 A;  1Q6I A;  1YF2 A;  2E3C A;  4OPA A;  3UO3 A;  1EZJ A;  2EJR A;  1MOF A;  2OCC C;  2IU0 A;  4DR4 B;  2YIB A;  1FXV A;  2R9I A;  1D5N A;  4QJF B;  3TXS A;  4LR3 A;  1IBK O;  3CCM V;  1AI4 A;  2ZE6 A;  4B3S B;  1XBL A;  4K35 A;  5EYP B;  3HKD A;  3CB2 A;  3H1K H;  2VQF B;  2ZIO A;  3TCU A;  4XDK A;  4LF9 O;  2FTK A;  2VQE B;  4MW3 A;  3CXH F;  3U0Z A;  4Z2W A;  3RT3 C;  1K92 A;  2NNU A;  2ZCE A;  2LQT A;  2B1I A;  2JEU A;  3E86 A;  1CP9 A;  1GN2 A;  1QU7 A;  4F6E A;  3A2F A;  1I7F A;  5BR8 B;  2QR4 A;  2DYS C;  1YSC A;  5H2F Z;  2EX3 A;  1YIT V;  2F66 C;  5KLV H;  1XI1 A;  1MZF A;  2RQ6 A;  3CC4 V;  2LJ2 A;  5LMU B;  2ZQM A;  4DR4 O;  2Q68 A;  3ABM C;  3H9V A;  4X1I B;  5EBW C;  4JYB A;  1FJG O;  5GTH Z;  4B3S O;  3THO A;  1I0H A;  2WA3 A;  3SPI A;  4X89 A;  4PA7 A;  3CD6 V;  4LF5 O;  5IYD O;  4RUF A;  4MVM A;  2HJF C;  1EBO A;  4RUE A;  4B7K A;  2UXC O;  1H2M A;  1NTM H;  3KZI Z;  2HG5 C;  4NTY A;  3W7T A;  2VWJ A;  4CH6 A;  5J2T B;  4G28 B;  3ZRS A;  2PF4 E;  2ZE5 A;  4FIP C;  3CCV V;  4JI0 O;  5L3B A;  1QBZ A;  1SA0 B;  5B1B C;  1GAX A;  3CCQ V;  4PJ0 Z;  2MW2 B;  4LH6 A;  1AVM A;  1SQG A;  2FYU H;  5JJN B;  1VQ5 V;  1QVG U;  1AJQ A;  2UXX A;  1N34 O;  1JCH A;  4GUN A;  3E8F A;  3T1C A;  3SDL A;  3ZMS A;  2ZE8 A;  2UUB O;  3B40 A;  2CTW A;  5CA1 B;  5KA6 A;  4JI8 B;  2IH3 C;  3SR2 C;  2PYJ A;  2UXC B;  3PYI A;  4UCO A;  3RYI B;  2KKW A;  2KG7 A;  3JAS A;  5A2Q N;  4AHC A;  2YEV A;  3OW2 U;  3BA9 A;  3ZHU A;  4DV0 B;  1JMK C;  4JI6 B;  4DK1 A;  1Y67 A;  2EIM C;  4YIP A;  3C3S A;  3M7M X;  3DXR A;  3I55 V;  3ASO C;  2QGN A;  3N2G B;  2JEX A;  1L0L H;  2KQX A;  4JTC B;  3CYO A;  2GTS A;  1AJN A;  1FXK B;  4JYC A;  1FYJ A;  4JI2 B;  1J95 A;  3BAA A;  1NT2 B;  5FL7 G;  1H2K A;  2YXY A;  5H6R A;  4LC1 A;  2B1G A;  3JD4 A;  1KKC A;  1M57 B;  4DK0 A;  4ZIB A;  5EYP A;  3FB8 C;  3RVZ A;  3EHB B;  2EZP A;  4IIJ A;  1SZX A;  2Q7E A;  1K3E A;  1N33 B;  4X1K A;  1E79 G;  2ODM A;  2OIE A;  1QVF U;  3OUF A;  5IDJ A;  4P30 A;  4JGS A;  1WB7 A;  1DF4 A;  1U97 A;  1GKF A;  2YUA A;  1L8D A;  3FFQ A;  3JCZ A;  4JPR A;  3WB1 A;  3JAK B;  4O4I B;  1IBK B;  2DE0 X;  3QF7 A;  4HYO A;  1JA8 A;  4UVA A;  4ZOL A;  4CC6 A;  1XRE A;  1HP8 A;  4G79 A;  3F5T A;  1UJW B;  1S0V A;  4J9Y B;  3P3N A;  2KG7 B;  1Y66 A;  4RO2 A;  5FNV A;  1AR5 A;  1QNM A;  4DR7 O;  1R6K A;  1NTK H;  3SR2 A;  2YSU B;  1Y6X A;  3CC7 V;  2X7R B;  1PV0 A;  5CMU A;  1YHQ V;  2XND G;  4FFB B;  3ZRX A;  2W0F C;  3VOU A;  1Q81 W;  2A7W A;  5H6Q A;  3MUD A;  3TET A;  4OX9 B;  2LO1 A;  5CA0 A;  4U3F H;  4I4T A;  1L1F A;  4DV1 B;  5B5E Z;  2F4V B;  2QWO B;  2BOC C;  1Z5W A;  5IWA B;  3GWO A;  1J5E B;  4YY3 O;  4MVS A;  1XMQ O;  3H1I H;  4I4T B;  1KC8 W;  3H1H H;  2DYS B;  3OMI B;  2Y0P A;  1YJW V;  4GEX A;  3RYH A;  1UFI A;  2EIJ C;  4P2Z A;  3RW0 A;  3ZMZ A;  4PD4 F;  2AHY A;  3ABL C;  5B1N A;  3ZHT A;  3U11 A;  2WA4 A;  2OCH A;  3UM7 A;  1YXB A;  4LF7 B;  5E1A C;  2QSA A;  2NR5 A;  1GM7 A;  3JD3 A;  3EVK A;  1MG1 A;  3AK1 A;  4H0L B;  1Q6U A;  1SF9 A;  3I5D A;  1IUR A;  3K3W A;  4LCU C;  4CH5 A;  1IBM O;  1NH2 D;  1P4R A;  4DR2 B;  4MVU A;  5DM6 V;  2P7T C;  1JJ2 U;  3DTU B;  1PNL A;  3ETD A;  2XAJ A;  1AIL A;  2RDC A;  2WLL A;  2CH7 A;  1AJP A;  3SJC C;  4L8J A;  2F43 G;  2YIB D;  4NKG B;  4UVB A;  2DJV A;  4AI8 A;  4UUJ C;  2Y4T A;  4CS2 A;  1QR8 A;  4K0K O;  3QO5 A;  3WB2 A;  3ZBH A;  1BZK A;  4LP8 A;  4NXN B;  4YHH B;  3CJH A;  3JAM N;  2K1E A;  3EFF K;  2CTP A;  1ZAU A;  1WJZ A;  3CP1 A;  1QHT A;  2WWW A;  2N74 A;  4O2A B;  1AI7 A;  4B3M O;  4TOI A;  2PYL A;  3QO8 A;  3RYH B;  4U3J B;  4GX5 A;  3BEH A;  3SPJ A;  4O2A A;  5KHI A;  1O9G A;  4UB8 Z;  1R3L C;  2ILM A;  2NN4 A;  4GT1 A;  4CKP A;  5EBL C;  3CCR V;  3L72 H;  1K97 A;  3SYQ A;  4G27 B;  1HR0 O;  4MVZ A;  5CN0 A;  1OJH A;  4B08 A;  2F1M A;  4GKK B;  1NTZ H;  4CS4 A;  3TXQ A;  2VWK A;  3ETE A;  2EIL C;  5IY5 C;  1W2B U;  1HNZ B;  4UCS A;  3K58 A;  3F5W C;  4IIJ B;  1N34 B;  4JI7 O;  2HFE C;  1FS0 G;  1XUQ A;  1M93 A;  5IE9 A;  4TV9 A;  3T2M A;  3JSN A;  2D2C B;  2Y4U A;  4WFA V;  3E8H A;  2UUA B;  5LOV A;  1Y74 A;  2H3O A;  3GB7 C;  2IM9 A;  4PEL A;  4RWU A;  2HJD A;  3R65 A;  4CZZ A;  1HNW O;  4GLX A;  4X9Q A;  4FFK A;  2Q0O C;  5J2U A;  1CEZ A;  2HEP A;  3S3W A;  1WNS A;  3DSQ A;  2QWP B;  3SPC A;  2OTJ V;  4EFB A;  3AG1 C;  2AXT Z;  1PKX A;  3CJH B;  2OT5 A;  3BRC A;  3RBZ A;  1VQ4 V;  5KX5 A;  1LUW A;  5LGN A;  4O4J A;  4E2L A;  4ZKI A;  5BXZ A;  4JI7 B;  1OCR B;  2EIM B;  4FM1 A;  1BS3 A;  1N32 O;  4Q20 A;  1V55 B;  2JGD B;  1QLN A;  1S76 D;  3BPZ A;  1L0N H;  1VQL V;  4BAY A;  1Q86 W;  3WU2 Z;  2PY5 A;  3UKM A;  4R50 A;  3Q0Y A;  2O57 A;  1N4C A;  5BY1 A;  1XL6 A;  4O2B B;  4AQY O;  1WN7 A;  2ITD C;  3RGB A;  1B06 A;  3A8T A;  4JYY A;  5J9P C;  5ITZ B;  3K79 A;  3JAK A;  2P67 A;  2LFR A;  1MAB G;  4JYA B;  2CTR A;  3DGE A;  4YJ3 A;  2A06 H;  4H13 B;  1VF6 C;  3JAW B;  5C8Y A;  1ZL8 B;  5LXT A;  3LSQ A;  1XHZ A;  5IYB O;  1IBM B;  4BWA A;  4DR2 O;  2E75 B;  5LGU A;  3ZJZ A;  2IJI A;  4MTO A;  3ZIA G;  3HB3 B;  1GN4 A;  3D36 C;  3W7U A;  4DUY O;  2RN9 A;  4U3J A;  4ASU G;  4X1I A;  4K8Z A;  1PD3 A;  4CBC A;  1Q8I A;  5L3E A;  3SYA A;  1BSM A;  4B3T B;  2CUG A;  5JH7 B;  2XAF A;  5KHK A;  1CXZ B;  3LSS A;  3K57 A;  1SQF A;  3ZN1 A;  2FKX A;  3K06 A;  1SC5 B;  1QQC A;  3L75 H;  1YJ9 V;  3BAB A;  5JH7 A;  2BE3 A;  5BZB A;  3B77 A;  4O4H B;  3QNE A;  2EIL B;  5IY5 B;  2F23 A;  1NU1 H;  4WFG A;  1EN4 A;  1Y4M A;  1PPJ H;  5KUM A;  4Q6G A;  5B66 Z;  4GX1 A;  3K59 A;  4U7O A;  1EN5 A;  2YXL A;  3RYF B;  4BIO A;  3Q4H B;  1G1X B;  2RMK B;  1TAE A;  1UPG A;  5KAF Z;  1JQ0 A;  1R1B A;  4J7K A;  1JVM A;  1WP8 A;  4DV7 O;  3T1Y O;  4KHP O;  3ZHV A;  1VQN V;  1MMM A;  3E89 A;  3ICX A;  2E74 B;  5DED A;  1JJO A;  4K3A A;  2ZD9 A;  5KAI Z;  4FZ1 A;  3ABU A;  3G80 A;  4U7N A;  3H1J H;  1SQX H;  4H44 B;  4HNA A;  1Q5O A;  3DXR B;  1F7Y A;  2ZE7 A;  1K7D A;  2GUZ B;  1KYO F;  1WB8 A;  4HBN A;  5LP6 A;  1N33 O;  3AEI A;  1B3Q A;  3JAL B;  2BTQ A;  5FPO A;  1THZ A;  4JI1 O;  1OV9 A;  5LA6 A;  3CCS V;  3E35 A;  1SZT A;  1I94 B;  3ZHS A;  1MNG A;  4DRX B;  3MHS C;  1BQZ A;  2X0L A;  4DV7 B;  3T1Y B;  1SET A;  1F23 A;  1VF5 B;  1V54 C;  5GW7 A;  1WA8 B;  3CRM A;  3OE7 G;  4F4L A;  3E2E A;  2Q8V A;  2HKO A;  4TV8 A;  1MSW D;  3L74 H;  1OCR C;  1H2N A;  1TVK B;  3AK2 A;  1GO3 F;  1S5J A;  1GTO A;  4J42 A;  4OX9 O;  4LNU B;  2WLI A;  2YIC A;  2Y3W A;  3ZMV A;  1FFT B;  2FML A;  2P90 A;  3AG1 B;  5IJ9 A;  1MA1 A;  4GX2 A;  2C2A A;  1OCO C;  4YY3 B;  2QTS A;  4J80 A;  3T1H B;  2DYR C;  2Q6A A;  1N0N A;  3BA8 A;  4X1K B;  4O4I A;  4LF9 B;  3BY6 A;  1FKA O;  1FU1 A;  4GCZ A;  5B1A B;  2R9R B;  1SQV H;  1M9N A;  2A79 B;  2XAS A;  2UXB O;  1BL8 A;  5L3F A;  5K1X A;  3CX5 F;  4UCT A;  2JK5 C;  4RAI A;  4DUY B;  4PA4 A;  1SES A;  3H1L H;  3ABT A;  2WLN A;  3CEI A;  1I5X A;  4CH4 A;  3OTO O;  5GTI Z;  4F6R A;  5LL6 Y;  3B8N A;  3J7A U;  3X2Q C;  1HWY A;  3N2G A;  1W0J G;  3L70 H;  1S72 V;  2PI5 A;  4R7C A;  4D7S A;  1IVS A;  4J41 A;  1WA8 A;  5JVD B;  5LHI A;  4NB5 A;  3CWB H;  5IJ0 A;  5CJ0 A;  1SKV A;  4TV9 B;  5F2V O;  3SJQ C;  1NVP D;  5J2T A;  2CK3 G;  2YC0 A;  5K1P A;  3BCC H;  1PP9 H;  2XTA A;  1S3J A;  3CRA A;  5LA6 B;  3KKY A;  4JTA B;  1TGO A;  1WLE A;  2A3Q A;  3APQ A;  5KA5 A;  1TVK A;  4EKW A;  3OM3 B;  1RPR A;  2DMX A;  1IX9 A;  5L3C A;  4EFE A;  5LXT B;  2BTO A;  3CMA V;  1M1K W;  4YHH O;  4PI0 A;  4PDV A;  2UXD O;  1PL0 A;  2GSM B;  3O9O A;  1IBL B;  3G6E V;  4ABM A;  4B3M B;  3D3Q A;  4JI3 O;  2JRI A;  4DV6 B;  4WF9 V;  3JD2 A;  3FX7 A;  4KHP B;  4OGQ B;  1YZB A;  5JQG B;  5LMN B;  5B3S B;  4DV5 B;  3NR7 A;  4YJ3 B;  1YCI A;  3OT7 A;  2LFS A;  2XOK G;  1W0K G;  3JYC A;  3UO2 A;  2P5O A;  4LWS B;  1JFF A;  4BR6 A;  3FB7 C;  4BW5 A;  4R8C A;  3A0B Z;  2BTQ B;  4JI1 B;  4YXW G;  1SS3 A;  5LP6 B;  4K8X A;  2X6C A;  1Y76 B;  1I08 A;  5JCO A;  3HR0 A;  1DLB A;  2ZNJ A;  4DR6 O;  3OD4 A;  4DV2 B;  3B4S A;  1M56 C;  4NYK A;  1O9H A;  4DV6 O;  3ZRV A;  3FAV A;  3OTF A;  4QIW F;  1FXK A;  3CSX A;  2LW7 A;  1RPO A;  1YDX A;  1RSO A;  1H2S B;  1ROP A;  5IJ9 B;  5LMN O;  1R73 A;  5CBF A;  1DTO A;  5CA0 B;  3T4Z A;  4X88 A;  3AG4 B;  4FLZ A;  3JAR A;  2H8P C;  2OTL V;  1Q6H A;  1XNQ O;  2EIK B;  4BIZ A;  2VS0 A;  3GWK C;  2ZXW B;  2KB1 A;  1Y74 B;  4PA6 A;  4IL6 Z;  1IXM A;  3B2E E;  3IC7 A;  3RFR A;  3CS5 A;  3AG3 B;  4QPJ A;  4MVQ A;  2PZS A;  5C8Y B;  4ZHQ B;  4JAV A;  4DV2 O;  5HFM A;  4MW8 A;  2QWQ B;  1ZL8 A;  3FB5 C;  5KX5 B;  1VF6 A;  3H01 A;  5E79 Z;  3QVN A;  1PNK A;  3RYC B;  3C3T A;  1T5E A;  1RP3 B;  1BT8 A;  3W7S A;  5FNV B;  4E4E A;  2JGU A;  4KFM A;  4JI6 O;  3K5O A;  4O4L B;  2AZ2 A;  1K5Q A;  1FFX A;  1XOU A;  4OPH A;  1XNR O;  1BCC H;  1H2L A;  4TSF G;  2JS3 A;  1VQO V;  1OHH G;  2P4V A;  5H9C A;  5B1A C;  1M5I A;  3G67 A;  1URF A;  1X4T A;  2UUA O;  3Q0X A;  2HP8 A;  1GN6 A;  4IYH A;  3ZRW A;  1I5Y A;  2ZM6 O;  2WLK A;  4A5U B;  1IDS A;  4I5S A;  4DR5 O;  4FLX A;  4EB6 B;  5BR8 O;  2YI9 A;  2RCV A;  2YS8 A;  2P06 A;  5GON B;  5BMV B;  3AG7 A;  2YEV B;  1EM1 A;  4XBF A;  3LNN A;  3W7W A;  3UT5 B;  1LR1 A;  3M99 B;  2IU3 A;  1IK9 A;  2GDS A;  4I0X A;  3J81 N;  4PA9 A;  3CCE V;  3FAV B;  4MTG A;  3ZCC A;  4FMT A;  1NR7 A;  1OCZ C;  1HW7 A;  3HKE B;  2Z0A A;  3K9S A;  2MK3 A;  2IJK A;  4JI3 B;  2BCC H;  5LOV B;  2ZM6 B;  4MT8 A;  1ARO P;  3AK3 A;  3J80 N;  3SPH A;  2JJ2 G;  1WAZ A;  3P3P A;  2CAZ C;  4DV3 B;  5A9G A;  3BVO A;  4NTX A;  4LF8 B;  3UQ8 A;  1VP7 A;  1P49 A;  3JAW A;  4GX0 A;  4PDR A;  3KG2 A;  2R70 A;  1K73 W;  4ZOL B;  2JJ1 G;  4JAS A;  3LNM B;  4QE9 A;  2A9H A;  2QKC A;  2F95 B;  2Y69 C;  4X66 B;  2HHH B;  4DV1 O;  1H2G A;  2F4V O;  2ZNI A;  3K0D A;  5KHJ A;  4MVR A;  2P22 C;  3L71 H;  3JAT B;  2Q7H A;  1K8A W;  1WP7 A;  2PTM A;  3MDS A;  4X62 B;  2X6B A;  4JAU A;  4I55 B;  1NJI W;  4GFA A;  2XUM A;  1NVP B;  2QTO A;  4FK5 C;  4NXM B;  5EC2 C;  4F6R B;  4YIO A;  4LBE C;  3K9A A;  4DV0 O;  3FYE B;  1BGY H;  4I7Z B;  3LDD A;  3OEH G;  4UVC A;  1HDJ A;  3HKB A;  3WG7 B;  3N2K B;  1FXH A;  4JF3 A;  2E76 B;  1XEQ A;  5JQG A;  2ATK C;  4JI2 O;  5L3G A;  1M4U A;  1AI6 A;  1AB3 A;  2Z3Y A;  3WFV A;  1MZE A;  3U10 A;  1ZTE A;  3HKB B;  3AG2 B;  4I50 A;  2Q9L A;  1ZLZ A;  5EC1 C;  4DV5 O;  2W6J G;  2DWE C;  1R3K C;  3K0G A;  4C7U A;  4IGG A;  1F4M A;  1M56 B;  4D6T H;  4KL1 A;  3I56 V;  1D2D A;  2GTA A;  3LUT B;  1Y76 A;  3CRC A;  5KMG B;  2N04 A;  3HKD B;  3HKE A;  2VRZ A;  4HAM A;  1VQM V;  3AG4 C;  3UCS C;  3VQW A;  1LUV A;  2PUS A;  1P7B A;  1JX9 A;  5CA3 A;  2QDO A;  1ZX3 A;  5FLX N;  1H8E G;  2WPD G;  3WB0 A;  2H94 A;  1DGS A;  3FB6 C;  2WLJ A;  3CME V;  5TIS Z;  2YID A;  4PI2 A;  1K33 A;  4R6Z A;  2R72 A;  4I55 A;  2HLD G;  4MTF A;  3B8M A;  3ETQ A;  4MSW C;  1HR0 B;  1JPX A;  4DR3 B;  1GM9 A;  1RM1 B;  1KBH A;  1VF7 A;  4JV5 B;  4FLY A;  1DF5 A;  5KHH A;  4FM2 A;  2Y0I A;  4TWK A;  2UU9 B;  2WSS G;  2ZIM A;  1H8H G;  1HNZ O;  2UUC B;  3L9D A;  3SYC A;  3SYP A;  3F7Y C;  5IWA O;  1KP2 A;  1ENV A;  4FLT A;  2QKS A;  2ZIN A;  4J11 A;  4CKN A;  3RYI A;  3AG3 C;  4FM0 A;  3NXS A;  1GK9 A;  1VQK V;  3VQV A;  1H38 A;  3RYC A;  2JDI G;  3M8A A;  2HVJ C;  1IZ3 A;  4DV3 O;  1GN3 A;  4UCV A;  2B5U A;  3CC2 V;  2QWN B;  1K34 A;  3OGI B;  1YEW A;  1XIL A;  3ZHR A;  3QG5 A;  4EEQ A;  1Q7Y W;  3A0R A;  2PI4 A;  2YDE A;  1FJG B;  4TQF A;  4FFB A;  4TQD A;  3G71 V;  4HZ3 A;  3JCU Z;  1V55 C;  4WBN A;  4TV8 B;  4DYL A;  3R66 A;  4DUZ B;  1QLE B;  4W4L A;  5EIB D;  4PA3 A;  4NXM O;  4UFZ A;  4B7E A;  4MVO A;  1Z2G A;  4B3R B;  3ZX6 A;  1GH6 A;  5CBG A;  5GON A;  3WG7 C;  3CRR A;  4UXN A;  5EK0 A;  3CCL V;  2WLI B;  1DK1 A;  4WFF A;  1COW G;  4ZHQ A;  3CRQ A;  4KP4 A;  3AG2 C;  3SJB C;  3P32 A;  5DN6 G;  3ABM B;  3SGI A;  4PDM A;  1K4D C;  4FZ0 A;  3OUS A;  4JAA A;  4UB6 Z;  2QJ1 A;  1VAR A;  3OMN B;  2ADP A;  2FL4 A;  5CA1 A;  1VQ6 V;  2LW1 A;  4JI5 O;  4FPP A;  4LNU A;  2ZDI C;  1KQS U;  4LF6 O;  4UCR A;  3JAT A;  1XNQ B;  2OIG A;  1K9M W;  4JI4 B;  4IT5 A;  1Q90 D;  1NZ6 A;  3CHX A;  2NLJ C;  4UV9 A;  1Z5V A;  1IBL O;  4DV4 O;  3K08 A;  1AP6 A;  4TUY B;  2WLM A;  1Q3E A;  3ZED A;  2ZR2 A;  1VIB A;  4NR1 A;  2JGD A;  1S77 D;  2XAH A;  3ASN B;  4OXS A;  1IXB A;  2E5L B;  1GMG A;  3MD0 A;  5JWP A;  1K5S A;  1OCC B;  2JS5 A;  3VBB A;  4GKJ O;  1R3J C;  3LDE A;  2P6J A;  4NVP A;  2G38 A;  2K9P A;  1R6T A;  1OZ0 A;  4QPK A;  4K0K B;  3II6 A;  5ITZ A;  1TUB A;  2L6L A;  4MS2 A;  3HKC B;  4G2K A;  5IYZ A;  4NXN O;  4WFH A;  3SPG A;  2ADQ B;  4DV4 B;  1R3I C;  4LFA O;  1XMO B;  1S5L Z;  4XDL A;  2UUB B;  1K4C C;  2BSK B;  5EBM C;  1VQP V;  1LNQ A;  5B1O A;  4L87 A;  3STZ C;  2XAG A;  3DC5 A;  2ZT9 B;  3KCY A;  4O4J B;  3RYF A;  2Y48 A;  1XDC A;  2Q67 A;  5FPR A;  1E1R G;  1G4Y B;  1AI5 A;  3F7V C;  2UXN A;  1P7G A;  3W7X A;  3E83 A;  5HFL A;  3FYI B;  1QR9 A;  5IYC O;  2ARH A;  3E22 B;  3CE2 A;  4J7Z A;  3T4D A;  2IJH A;  3IC9 A;  4FJC C;  2Q5Z A;  3QTC A;  4O4L A;  2WLL B;  3ABK B;  2CGN A;  4LF4 B;  3SJA C;  2LGQ A;  3ABL B;  3RVY A;  5IJ0 B;  2IJJ A;  2QA4 V;  2P4K A;  1KD1 W;  1BHA A;  4WCE V;  3K5N A;  1G6U A;  1KEC A;  2CE4 A;  3ML0 A;  4I50 B;  4JV5 O;  2Q69 A;  1NBM G;  2UU9 O;  1F51 A;  2LP7 A;  4IHJ A;  3IFX A;  4H33 A;  2QKA A;  3O65 A;  4B3T O;  1MSD A;  1W59 A;  1SQP H;  2V7Q G;  3D3I A;  3N2K A;  2Q4P A;  1V9P A;  3T1H O;  1BQ0 A;  5B3S C;  3X2Q B;  1VQ8 V;  2X6A A;  1WPX A;  2L35 A;  4DR7 B;  2AW9 A;  1OCO B;  4X64 B;  2DYR B;  3DC6 A;  5DEC A;  4DRX A;  2DN9 A;  1EN6 A;  2IH1 C;  5EIB C;  1VQ9 V;  3RN4 A;  2F93 B;  1G8M A;  2QWR B;  1SQB H;  2RJZ A;  5LP6 C;  2CH7 B;  2GUZ A;  3OR6 C;  1KMI Z;  2RNB A;  4JYA O;  3ZMT A;  1ZWI C;  3CPW U;  4P9O A;  2VQF O;  2AZ0 A;  1NI8 A;  3D36 A;  1RFY A;  2VQE O;  5IT9 N;  1P84 F;  2YIA A;  1OCC C;  1YTF D;  4JI8 O;  1VMG A;  5IYZ B;  2WLH A;  5C93 A;  4N21 A;  4O2B A;  3IAY A;  1YIJ V;  2E5L O;  1RSO B;  2EJ7 A;  1SA0 A;  5JCO C;  4PV1 B;  4B3R O;  3A0H Z;  3D8C A;  2ZXW C;  5BMV A;  3RWR D;  1TUE B;  2EIJ B;  3CXC U;  1N36 B;  2IW5 A;  3P30 A;  1ORQ C;  1FD9 A;  5LMU O;  2ZR3 A;  1SRY A;  2DQ0 A;  3B09 A;  5L3D A;  3OR7 C;  4X66 O;  2HHH O;  2DQ3 A;  4J10 A;  3QO7 A;  1XHX A;  3K5L A;  3ZMU A;  5KUK A;  4ICG A;  3N27 A;  1I94 O;  3ASN C;  4HNA B;  4EB6 A;  2ETN A;  4DR1 O;  3Q4H A;  4FLV A;  1Q43 A;  2XHB A;  4X1Y A;  2WAM A;  2QE7 G;  2EIK C;  2JIZ G;  2BSK A;  4IHJ B;  4JI5 B;  5CBH A;  4GYC B;  3JAS B;  1F4N A;  1FPO A;  4AIL C;  4Z1M G;  1AR1 B;  4WFB V;  1AP5 A;  4YJ2 A;  4UV8 A;  4N23 A;  1EFR G;  4JZ2 A;  2Q7G A;  5KMG A;  2W0X A;  1EZV H;  1NQT A;  1N0J A;  2CDY A;  5EZY B;  2BOB C;  4JTD B;  4DW0 A;  3VQY A;  2DOS A;  4D7T A;  2XAQ A;  3L73 H;  3OGC C;  4LWS A;  2YXH A;  2OYQ A;  4I0X B;  4BW9 A;  1JFF B;  1WPB A;  3RWR A;  2XT9 A; 
#chains in the Genus database with same CATH homology
 3ETQ A;  4DK0 A;  4ZIB A;  5EYP A;  4TV8 A;  1HR0 B;  4DR3 B;  2QM4 A;  4IIJ A;  1VF7 A;  2Q7E A;  4JV5 B;  4FLY A;  1N33 B;  1TVK B;  5KHH A;  4FM2 A;  4X1K A;  2UU9 B;  1S5J A;  3HKC A;  2ZIM A;  1TA8 A;  1KU9 A;  4LNU B;  3FFQ A;  1L8D A;  2UUC B;  3MAQ A;  3VQX A;  3WB1 A;  3JAK B;  4X20 A;  5IJ9 A;  4O4I B;  1IBK B;  3QF7 A;  4LFA B;  2R9A A;  4FLT A;  2ZIN A;  4YY3 B;  4ZOL A;  4CC6 A;  3T1H B;  3BA8 A;  4X1K B;  3BHP A;  4O4I A;  3RYI A;  4LF9 B;  1FU1 A;  5FNV A;  4FM0 A;  4ZI7 B;  3VQV A;  4CC5 A;  2Q0A A;  3RYC A;  3SR2 A;  5K1X A;  4UCT A;  4UCV A;  4FFB B;  4DUY B;  3MUD A;  1YEW A;  1XNR B;  4OX9 B;  3QG5 A;  5CA0 A;  4EEQ A;  4CH4 A;  4F6R A;  4I4T A;  1D5A A;  4DV1 B;  2F4V B;  1Z5W A;  3N2G A;  4X1Y B;  5IWA B;  1FJG B;  1J5E B;  5EZY A;  4TQF A;  4WBN B;  4FFB A;  1HNX B;  4I4T B;  4TQD A;  4D7S A;  4LH7 A;  4I9Q A;  5JVD B;  4WBN A;  4TV8 B;  5IJ0 A;  4DUZ B;  2UXB B;  3K5M A;  4LFC B;  5CJ0 A;  1SKV A;  5EIB D;  3RYH A;  4TV9 B;  5JJE B;  2JVD A;  4UFZ A;  4B3R B;  5J2T A;  5K1P A;  5LYJ B;  3JAR B;  3U11 A;  4AQY B;  4JI0 B;  5LA6 B;  5GON A;  1TGO A;  1TVK A;  3OTO B;  4LF7 B;  4EFE A;  5LXT B;  2BTO A;  4PI0 A;  4ZHQ A;  1IBL B;  1B04 A;  3SJB C;  5KHG A;  4DR6 B;  4CH5 A;  3ZS8 C;  3SGI A;  4B3M B;  4DR2 B;  2QJ1 A;  4DV6 B;  5CA1 A;  2OWO A;  4FVM A;  4KHP B;  4ZI7 A;  5JQG B;  5LMN B;  4DV5 B;  3SJC C;  4L8J A;  4LNU A;  4YJ3 B;  4GKJ B;  2YIB D;  1XQ8 A;  2P5O A;  4CS2 A;  4UCR A;  3JAT A;  1JFF A;  1XNQ B;  3WB2 A;  3PN1 A;  4JI1 B;  2BTQ B;  4NXN B;  4YHH B;  4JI4 B;  3CHX A;  2UXD B;  1ZAU A;  3E22 A;  5LP6 B;  4K8X A;  1Z5V A;  5JCO A;  1QHT A;  4O2A B;  4TUY B;  4LF5 B;  2ZNJ A;  3UT5 A;  1Q3E A;  3ZED A;  4TOI A;  2PYL A;  4DV2 B;  3RYH B;  1O9H A;  4U3J B;  3OTF A;  4O2A A;  5KHI A;  3CSX A;  1O9G A;  1RSO A;  1H2S B;  4O4H A;  5IJ9 B;  2E5L B;  5CA0 B;  2JS5 A;  4B08 A;  4FLZ A;  2F1M A;  4GKK B;  5CJ4 A;  4CS4 A;  3JAR A;  4NVP A;  2VWK A;  4LF6 B;  2YI8 A;  4K0K B;  3II6 A;  4CS3 A;  5ITZ A;  4FLW A;  1TUB A;  1HNZ B;  3HKC B;  5D5Q A;  5IYZ A;  2V4D A;  4UCS A;  3B2E E;  3K58 A;  4IIJ B;  4FLU A;  3RFR A;  5JVD A;  1N34 B;  2PZS A;  4X20 B;  4DV4 B;  5CB4 A;  1N32 B;  1M93 A;  5C8Y B;  5J2U B;  4TV9 A;  4ZHQ B;  1XMO B;  3JSN A;  4DR1 B;  2UUB B;  5CHX A;  2UUA B;  5LOV A;  1TUB B;  5CB4 B;  5LYJ A;  5D5P A;  2IM9 A;  5KX5 B;  4DR5 B;  4O4J B;  4GLX A;  3RYC B;  3JAL A;  3RYF A;  1T5E A;  4YJ2 B;  5J2U A;  2HEP A;  1WNS A;  3DSQ A;  5FNV B;  2JGU A;  4EFB A;  3K5O A;  4O4L B;  5FPR A;  1FFX A;  3BRC A;  4PHZ A;  5JJJ B;  5KX5 A;  4O4J A;  2PGG A;  4TUY A;  4JI7 B;  4CH3 A;  4X65 B;  3JSL A;  4FM1 A;  1M5I A;  3E22 B;  3BPZ A;  1X4T A;  1XMQ B;  4UCU A;  3QTC A;  4O4L A;  1FFX B;  2PY5 A;  4LF4 B;  3SJA C;  5IJ0 B;  4LFB B;  2GV9 A;  4FLX A;  1HNW B;  4EB6 B;  4XA4 A;  3K5N A;  1G6U A;  2YI9 A;  4O2B B;  4I50 B;  1WN7 A;  2E3C A;  3RGB A;  5GON B;  5BMV B;  4IHJ A;  5ITZ B;  3LNN A;  4DR4 B;  3JAK A;  3UT5 B;  2YIB A;  1IK9 A;  4LR3 A;  4JYA B;  4YJ3 A;  4B3S B;  5EYP B;  3HKD A;  3CB2 A;  3N2K A;  2VQF B;  1V9P A;  1HW7 A;  2ZIO A;  3HKE B;  3JAW B;  5C8Y A;  5LXT A;  1XHZ A;  2VQE B;  1IBM B;  4JI3 B;  4BWA A;  3U0Z A;  5LOV B;  4DR7 B;  2ZM6 B;  2ZCE A;  4X64 B;  4DRX A;  3A2F A;  2CAZ C;  1I7F A;  5BR8 B;  4DV3 B;  4LF8 B;  3UQ8 A;  5EIB C;  3JAW A;  1P49 A;  2EX3 A;  2F93 B;  2R70 A;  2F66 C;  4U3J A;  4ZOL B;  2RJZ A;  4X1I A;  1XI1 A;  4K8Z A;  2RQ6 A;  5LMU B;  5LP6 C;  1Q8I A;  2F95 B;  4B3T B;  1KMI Z;  4X66 B;  2HHH B;  4X1I B;  2ZNI A;  5JH7 B;  3THO A;  5KHK A;  5KHJ A;  2P22 C;  3JAT B;  2Q7H A;  3K57 A;  1SQF A;  2PTM A;  4X62 B;  1QQC A;  2YIA A;  5IYZ B;  4I55 B;  3BAB A;  5JH7 A;  4NXM B;  4O2B A;  3IAY A;  4F6R B;  4CH6 A;  5J2T B;  4O4H B;  2VWJ A;  5JCO C;  1SA0 A;  5BMV A;  3RWR D;  1N36 B;  1SA0 B;  4Q6G A;  4LH6 A;  3K59 A;  1SQG A;  3HKB A;  3N2K B;  5JJN B;  2YXL A;  3RYF B;  1XHX A;  3K5L A;  5JQG A;  1TAE A;  4HNA B;  1M4U A;  4EB6 A;  5CA1 B;  3U10 A;  4FLV A;  1Q43 A;  4JI8 B;  3SR2 C;  2XHB A;  4X1Y A;  2PYJ A;  2UXC B;  3HKB B;  4I50 A;  4UCO A;  3ICX A;  3RYI B;  2KKW A;  1JJO A;  3JAS A;  4AHC A;  4IHJ B;  4JI5 B;  3BA9 A;  4KL1 A;  4DV0 B;  4HNA A;  1Q5O A;  4DK1 A;  1JMK C;  4JI6 B;  4GYC B;  3JAS B;  5LP6 A;  4HBN A;  5KMG B;  3HKD B;  3M7M X;  4AIL C;  3HKE A;  3JAL B;  2BTQ A;  5FPO A;  4YJ2 A;  5LA6 A;  3VQW A;  2PUS A;  3N2G B;  5KMG A;  2Q7G A;  1I94 B;  4JI2 B;  3WB0 A;  4DRX B;  1DGS A;  3BAA A;  1NT2 B;  5EZY B;  3VQY A;  4DV7 B;  3T1Y B;  4D7T A;  4PI2 A;  2OYQ A;  4BW9 A;  1JFF B;  1WPB A;  2R72 A;  3RWR A;  4I55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...