2QM4A

Crystal structure of human xlf/cernunnos, a non-homologous end-joining factor
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
232
structure length
232
Chain Sequence
b'SGMEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-homologous end-joining factor 1
publication title Crystal structure of human XLF/Cernunnos reveals unexpected differences from XRCC4 with implications for NHEJ.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Recombination
total genus 59
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2qm4A02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 2qm4A01
5CHXA 1IK9A 1KU9A 4XA4A 5CJ0A 3RWRA 3SR2A 1M5IA 5CJ4A 3RWRD 3MUDA 3SR2C 2QM4A 3II6A 1FU1A 2R9AA
chains in the Genus database with same CATH superfamily
1AP5A 3OMAB 1IVSA 4H0LB 4CS2A 4P9PA 1Q3EA 1WP8A 3ABMB 4JI5O 5DEDA 4FLZA 3IFXA 4LF8B 4R8CA 4CH5A 1YVWA 1FU1A 2Z0AA 3T4ZA 3S3XA 2KQXA 3JALB 3E2EA 1Y74B 5LA6B 4CKMA 2Y69B 3FX7A 2ZINA 1BQ0A 1IX9A 4JGSA 4DRXA 4A5UB 4FLWA 2WA3A 2D3OW 1P84F 4CC5A 2LW1A 4D6TH 1QLEB 4ZHQA 3U11A 1MG1A 4B3SO 1HWYA 1QR8A 1KB9F 3JSLA 4LF7O 3ZRWB 3D3IA 3SYAA 4FFBB 3NR7A 3A0BZ 4KUMA 4RO2A 4C7UA 2HJDA 1P7BA 3ZMZA 3B8MA 4DR3O 3SYPA 2LO1A 1R73A 3QO7A 4Z1MG 4MVZA 4W4KA 3AG7A 1H2MA 2LQTA 2Q8VA 5EZYA 2QWNB 1XBLA 2RJZA 3HKBB 3JAWB 3T2MA 1YHQV 1QLNA 3BA9A 2CTQA 4DR6O 2DOSA 3APQA 4ABMA 4TV9B 4RAIA 1F7YA 3CRAA 5IYDO 2B1GA 5LXTA 3S3WA 5FPOA 3ZN1A 4DV7O 4WFHA 4X1IB 4ZOLB 3G71V 4JYCA 2UXNA 3APOA 2Y3WA 3QVNA 4X1KA 2GDSA 1ZSPA 1B06A 1THZA 3T1CA 3P3NA 2UUCO 4J42A 4J9ZB 3HKEA 4NKGB 4PA4A 4CH3A 4LFBO 2A9HA 3ASNB 2RMKB 1H8EG 4GKKB 5GONA 1OCRC 4HZ3A 2LFSA 4QNHB 4WF9V 3P30A 1UJWB 1ZL8A 1I94O 2L35A 2ZE5A 3F5TA 4DK1A 4L8JA 1RP3B 3CCVV 4AI8A 3JASB 3AG2C 5E1AC 1VF7A 2JS5A 4GX2A 3OT7A 1JCHA 4JYYA 2PUSA 1NQTA 4P2ZA 4DUZO 5EK0A 4IYIA 1BCCH 3BRCA 5BXZA 2P5OA 1XNQO 2QGNA 1FAFA 3RYFB 3D8CA 5CA1A 2QEXV 3A2FA 1HP8A 3CCSV 2BE3A 1AR1B 3DC5A 2VWJA 2AHZA 5LMNO 2ZM6B 3B8NA 2LJ2A 4DV1O 1K4DC 2XAJA 1GMGA 1NBMG 4LF5B 4UCTA 5B1BC 3VOUA 2IH3C 4PA9A 1GM7A 4BIUA 1SA0B 2O57A 5KHHA 2F1MA 2H94A 3HKDA 2JVDA 3GVMA 4EB6A 4ZIBA 1RFYA 2CTWA 5LL6Y 1G8MA 2B9ZA 3ETGA 2Q4PA 3ZCCA 4X66O 1MNGA 3ASOB 3I56V 3ZN0A 2UXCO 4MVUA 1EFRG 4UCRA 4UCSA 3X2QC 1PD3A 2OTJV 3T1YB 1N33B 4HNAB 2EJ7A 1DF4A 2PYJA 1AP6A 5CMUA 3JALA 2VQFB 4I55A 1Y74A 3VQWA 4E2LA 2H3OA 1DF5A 5EIBC 4WBNA 1IK9A 4K35A 3O9OA 5B3SB 4FM0A 2UU9O 5BR8O 4NXMO 4TUYB 2XNDG 2IJIA 2AXTZ 1UFIA 1FXKB 5IWAB 1VQ6V 3M7MX 3ZRWA 1QVGU 1NU1H 4FFBA 5H2FZ 3WU2Z 3N27A 3F7VC 2BSKB 2HHHO 4QE9A 3AG4B 1AILA 2H8PC 3OGIB 2WAMA 1HNWB 4LF4O 3BHPA 1AI6A 3OGCC 2JDIG 3JARA 4FLUA 2VQEO 1QVFU 1VQPV 3HKBA 3MHHC 5BZBA 2KKWA 3AG3C 4MW8A 1ZWIC 1D5AA 2ARHA 2XAHA 1WPXA 1K9MW 4PDMA 1X4TA 2W0FC 1TAEA 5ITZA 4TQFA 1NT2B 4X1IA 4JTCB 1E79G 4AQYB 4X88A 2F43G 4LF6B 5B66Z 1SKVA 4DUYO 1JR9A 2QWPB 2DWEC 4LH6A 2UUAO 1VEWA 1VQ5V 1SQBH 2QM8A 3B09A 5LBQA 3RN4A 1IBLO 4O4JB 1YDXA 2EJRA 4MTGA 1XHXA 3CWBH 2ODMA 3HKCB 2OIGA 3VBBA 4LCUC 3H1LH 3J81N 4FMTA 3IJ4A 2EIMB 3PJSK 1NS1A 1Z5VA 3CCMV 2Q0OC 1VQ8V 2JGUA 1A32A 2FTKA 3JASA 4JAUA 5JJEB 1XMOB 4H44B 5GTHZ 1R3IC 5CHXA 2IJKA 1VIBA 5IJ9A 3CEIA 1GO3F 1OV9A 2YS8A 4JI4O 1JFFA 2A79B 1KKCA 4D7TA 2QKSA 2V4DA 5JVDB 4YXWG 1FS0G 3K58A 1DLBA 1BSMA 4ZKIA 2A3QA 4MTFA 2CGNA 3OEHG 4U3JA 2M6YA 1GM8A 4RUFA 2AHYA 5JCOA 3RYFA 4TV8B 2R9IA 4TQDA 3H1HH 1I0HA 2QTSA 2FMLA 1N32B 2DYRB 3HB3B 3E22B 2A06H 5FPRA 3CRRA 3KKYA 4DK0A 1SA0A 3OMIB 5KHJA 5GW7A 4BIZA 1VQOV 3OUFA 1OZ0A 1AJPA 2F4VO 2YI9A 3CXCU 3CD6V 1YF2A 4BW9A 3ABKC 3M8AA 4G2KA 4F6EA 1VQ7V 4GCZA 3RFRA 4HAMA 2N05A 2PGGA 3SPJA 5DM6V 2QA4V 4PI0A 4AHCA 2ZQMA 3K57A 4B3MO 1BQZA 2BTQA 4JV5B 1N4CA 5JJJB 4X1YA 1QHTA 5C8YB 4HNAA 2CTPA 3KG2A 4X9QA 4BWAA 4JI3B 1HNZO 2E5LB 1V54B 4QGPA 4X62B 2HLDG 2KG7A 1R3KC 5FNVB 4FLXA 3K79A 1Z5WA 2E76B 3FAVB 1U97A 3RBZA 4KXRA 2ZT9B 1RM1C 4DW1A 2EX3A 1YIJV 2R9AA 1KYOF 3O65A 1TA8A 2QDOA 5H6RA 3K9SA 3LDCA 3H9VA 4JI6B 1BE3H 1XNRO 4XDLA 1FXKA 2NNUA 4OX9B 3E83A 1EBOA 2ZXWB 4JAAA 4PV1B 2Y3VA 4W4LA 2BSKA 4DR4B 4CS3A 3GB7C 1GK9A 4TWKA 2OIEA 2ADPA 1XOUA 4FFKA 2YXYA 4QJFB 3JD3A 3ZHVA 4QIWF 1MZFA 3R65A 3K5NA 4LC1A 1YITV 1FYJA 2WWWA 1QQCA 4DR2O 4X20A 3DSQA 1G1XB 2F93B 4G27B 1K34A 2ATKC 1VMGA 3QTCA 3L9DA 4DO2A 4CH6A 2ZE8A 1FPOA 5CB4B 1HNXO 4N23A 1GN4A 1IBKB 4DV2O 3FB5C 4JPRA 5LMUB 1XMQB 4DV0B 2B5UA 4DW0A 3CCRV 3CC4V 2QKCA 3JD0A 1GTOA 3HKCA 1E1RG 1IZ3A 1O9HA 1IBMB 3H1JH 4GYCB 4DXWA 4I4TB 1K3EA 4ASUG 4NYKA 3F5WC 1LR1A 4JTAB 3L70H 4GKJO 1F4NA 1N34O 1OCRB 4JYAO 2GUZA 4CS4A 1COWG 4IHJB 3Q4HA 2IJHA 4YHHB 4DR5B 4YIOA 1TUBB 2ILMA 2FL4A 3ZHSA 3TETA 1KD1W 1P49A 1FJGO 3AG2B 5JQGB 1XDCA 1N36O 2OTLV 1NI8A 4JI2O 2QM7A 4TV8A 3C3SA 4FLYA 4YY3B 1SF9A 4R50A 2K1EA 3CSXA 2EILC 3BVOA 1AI4A 3E22A 3RYHB 4DV6B 1K4CC 3VQVA 4JI7B 3P3PA 2XHBA 1U96A 4LR3A 3A8TA 3RWRD 1IDSA 3K5OA 2OCCB 1FXHA 4NVPA 3IAYA 2F66C 5EIBD 2JJ2G 4WFFA 5CN0A 2QWQB 3K04A 5EC1C 1KQSU 3OUSA 4I9QA 4R6ZA 3MAQA 1AR5A 4IIJA 2W0XA 4TOIA 5JH7B 3T4DA 4DV5O 5J9PC 1KBHA 4QPKA 2YEVB 5C8YA 1OCZC 3ETEA 3GWOA 4R7CA 2Q6AA 5F2VO 4J41A 4PI2A 2HKOA 3E89A 2QWRB 3ABLC 4LF9O 1B04A 4J9YB 3JCUZ 3KZIZ 1P4RA 2JGDB 2ZR3A 1FFTB 3AEIA 4BIOA 3B77A 1AJNA 1Y4MA 2ZDIA 4B7EA 1JA8A 4JI1O 3SJBC 4ZBMA 2HG5C 4DV3O 2IU0A 4B3TB 4O4IB 1L0NH 1RSOA 1QU7A 1NJIW 5B1AC 4GUNA 4H33A 4JI8B 2WLIA 4JAVA 4MTXA 4P9OA 4X64O 4K0KB 3Q0XA 4ZI7B 4L87A 2DWDC 3CRCA 3RT3C 3ZHTA 1KP2A 5BMVA 2UUBB 4F6RB 1HR0B 3OTOB 1GN6A 3IC7A 1Q6HA 3ZS8C 4UV9A 1VARA 2NN4A 4FLVA 1W2BU 1S76D 3CXHF 3ZIAG 1F51A 3LSUA 2BTOA 1XNQB 4XDKA 1F23A 1Z2GA 1IXMA 4LFAB 3MUDA 3JD1A 1VQ4V 2Q67A 4GLXA 2X6BA 4LF8O 2Y48A 1NH2D 3ZRXA 1AVMA 4PA6A 3TGUH 4O4HB 3CCLV 3ZJZA 4OPHA 4GX5A 4NTYA 2QKAA 2EBOA 4BW5A 5IYBO 2XAQA 2ZNJA 5CB4A 1JX9A 3CRQA 4I50B 4KHPB 1MABG 1YI2V 3WB2A 3K5MA 4WFBV 1MMMA 3QF7A 4PA7A 1TGOA 2YIBA 4IL6Z 1M90W 4FJCC 1K8AW 5FL7G 3G6EV 4Z2WA 3LSSA 2XAFA 1ZLZA 5L3GA 5IE9A 1M57B 4I4TA 1V55C 2C2AA 3NXSA 2A0LA 1H2KA 1B6QA 2EIKC 3ZHRA 3K0DA 2CK3G 1TVKB 2DYSC 4IHJA 1JMKC 1NH2B 3CE2A 3UKMA 1TUBA 2QM4A 1XI1A 1PM9A 3AK1A 1ZAUA 2Q7HA 2RDCA 5IJ0B 4I9WA 1SERA 4YIPA 5B1OA 2Q7EA 2ZR2A 4UVBA 3CRMA 3WG7C 1NR1A 2ADQB 4J10A 2E74B 4WFGA 3RYHA 2EIJC 5KAIZ 1SQGA 4NB5A 2X6CA 4LWSB 4DV4B 3ABMC 2WLHA 4CKNA 4FVMA 1MOFA 1GN2A 4LF4B 2Y4TA 2G38A 4JI0B 1YTFD 1XL4A 4GKKO 3SJQC 1NTKH 2E3CA 1HW7A 1Q5OA 3D3QA 1WAZA 4IT5A 1S77D 4PELA 5JH7A 1Y6XA 3JAMN 1GM9A 1M4UA 3B4SA 4UV8A 2GTSA 2YEVA 5LA6A 4K8XA 3DGEA 3TCUA 4DYLA 1PL0A 3ABKB 2Q69A 4U7NA 1CEZA 4PDRA 3THOA 1N0JA 2V7QG 1KC8W 5KA5A 3HR0A 3DTUB 3RVYA 5KLVH 4PJ0Z 4CH4A 2BCCH 2PF4E 2GTAA 4MVQA 2OYQA 5LP6B 1EN5A 2EZOA 3ETDA 3ML0A 2XTAA 4UVCA 3W7XA 4JZ2A 3UO3A 2ZM6O 1E1QG 4ZI7A 3B2EE 3VQXA 4LF5O 4UCUA 2XAGA 4O2BB 3CPWU 2CDYA 1Q90D 3QO5A 3KCYA 1M9NA 5L3EA 2B1IA 4I7ZB 4H13B 3QNEA 3ZRVA 4WCEV 3SR2A 2Y0PA 3JAWA 3I55V 3B40A 1IURA 1AJQA 4JYBA 4TV9A 1JJOA 2IU3A 4DR1B 3J7AU 4ZOLA 2LW7A 1PKXA 3T1YO 1N33O 1AROP 3PYIA 2DN9A 2Z5UA 3DC6A 1J95A 1W59A 5J2TB 2WLKA 2VQFO 1OCOB 2ZKOA 1ROPA 2PZSA 2PI4A 1EZVH 3CYOA 4UFZA 2R72A 1AI7A 4O2AB 3JD4A 2DW4A 3JYCA 5CJ4A 4MW3A 1R6NA 4JASA 1I08A 1WA8B 5HFLA 1ZTEA 4CZZA 5K1PA 3ZMTA 3U0ZA 3L73H 3C90A 2ZNIA 5IWAO 3GWKC 4DR7B 3K08A 5JCOC 3CMAV 5A9GA 1BL8A 4XBFA 1R1BA 4EKWA 1TVKA 2GV9A 1HNWO 1MA1A 3OTFA 3G80A 3TXQA 3UO2A 3ICXA 2P90A 3BA8A 3ZEDA 1H2NA 1GH6A 2YSUB 1BT8A 3U10A 3ABUA 2Q73A 4D7SA 1YJNV 1I7FA 4J7JA 2YI8A 2NR5A 4O4LB 4AQYO 1S5HC 1KUQA 1M56C 3OR6C 1O9GA 5LOVB 3FKSG 4LF6O 2UXDB 4LWSA 2VRZA 5EYPB 3JSNA 4X65B 1GN3A 3EFFK 5LYJB 3WB0A 1FFXB 1SQQH 1XILA 3ETQA 1J5EB 1WB7A 2DQ0A 3D36A 2UXBB 5LHIA 2CGOA 1WP7A 4WFEA 5IY5C 1QR9A 3BEHA 2EINC 4UVAA 2XT9A 3BPZA 2ZIMA 1Q43A 1CP9A 5B3SC 1CXZB 1WB8A 1XMOO 4X89A 1T5EA 3OR7C 1KP3A 5KHIA 3L71H 4NXNB 5K1XA 1IXBA 3UM7A 4LNUB 3ABTA 2LGWA 4GZRB 1FXKC 1CPYA 1BMFG 2M7WA 2RN9A 3IC9A 5DECA 1OCZB 1JOYA 4BR6A 4MVSA 4TUYA 3ZMUA 5LP6A 2DMXA 3AG4C 3SGIA 1VF5B 2IJJA 1XREA 3QG5A 4FM1A 1OJHA 4PDLA 1Q7YW 2AZ2A 2FB5A 4FK5C 3BABA 2W6IG 3E8FA 3JAKB 2BOBC 4B3RB 4FLTA 3EXAA 5KX5B 5CBFA 2R70A 4LFCB 3N2KB 5EZYB 1TUEB 2EZPA 1FJGB 2WLLB 3MHSC 1N36B 2IH1C 4JV5O 1BHBA 4RUEA 5EBWC 2P06A 5L3FA 3CCEV 4JI2B 2WPDG 5H9CA 4Z1VA 5LXTB 2CUGA 2AGAA 1OHHG 5J2TA 4JI3O 4BAYA 3LUTB 4JTDB 2E5LO 2JK5C 4X62O 4FZ1A 1NTMH 2JEUA 4TSFG 4H37A 5L3BA 4UUJC 1SESA 1VF6A 1S5LZ 4O4JA 5CA3A 1K97A 4O2AA 1MSWD 3HKEB 2ZCEA 3T1HB 3SYCA 1WJZA 2MW2B 4G79A 2ITCC 4JI5B 5DN6G 5KUKA 4FIPC 4JI6O 1GKFA 3FB7C 1DGSA 1LUVA 4OX9O 1YCIA 1GAXA 1FKAO 1PV0A 2LFRA 5JVDA 1H38A 2YIDA 4MVRA 4DR4O 1BS3A 3LDEA 3G67A 1H2SB 4GFAA 1Q6UA 2DYRC 4LP8A 3PN1A 4EEQA 4TT3G 3DXRB 5IYCO 3OE7G 4B3SB 1DK1A 2WLNA 4DV3B 4J7ZA 4LF7B 5CA1B 1XL6A 3F7YC 3K06A 2D2CB 5GTIZ 5KAFZ 3ZMVA 2DYSB 4I0XB 4DR3B 4YJ3B 3L72H 5LOVA 3JD2A 1ENVA 1OCCC 5D5PA 1VQKV 3HKDB 4PD4F 1IBKO 4KL1A 5LYJA 5LMUO 5B1BB 1XMQO 1FFXA 4DV0O 1W0JG 1H2LA 1YZBA 2QE7G 5IYZB 3WG7B 4DR6B 3RYCB 1NTZH 2CE4A 3W7WA 1EN4A 3ZHUA 1V9PA 1IBMO 2EIJB 5EBLC 4DV7B 2ZDIC 3E8HA 2AW9A 4MVOA 5FNVA 5CA0B 3W7UA 3OFNG 3JATB 4FPPA 3FAVA 3X2QB 3P32A 2UUCB 4I55B 4LFBB 3M99B 4LNUA 3SJCC 2Q5ZA 1G4YB 4YHHO 4DR5O 1S5JA 2WLJA 1SS3A 4EFEA 1WLEA 4I5SA 4WBNB 4HYOA 2ZXWC 1I94B 3FD9A 3UCSC 2PTMA 4FM2A 4GEUA 1NKDA 3G6BA 4QE7A 3IGAC 4YY3O 1EN6A 1AI5A 5A2QN 5KMGB 4DV6O 4JI7O 3JAKA 4DUZB 4CBCA 2MK3A 3E35A 3H1IH 1HDJA 2DJVA 5C93A 1Y76B 4J80A 1Q81W 5KX5A 1KMIZ 2FYUH 4J11A 3JARB 4CKPA 1FD9A 4FZ0A 3Q0YA 3FYIB 2Q68A 5CBHA 2X7RB 3N2KA 1SQXH 3SYOA 5LMNB 1YSCA 1KU9A 1R6KA 4DV1B 2WLLA 3JCZA 2GSMB 2IM9A 3AG1C 4IGGA 3FYEB 1EM1A 5ITZB 2HEPA 4GEXA 3RYIB 2X0LA 2FKXA 3E8BA 3AG3B 3CX5F 3ZRSA 2JS3A 4X66B 3RW0A 3K3WA 1I5YA 2JRIA 3LNMB 2YXLA 1VQ9V 2P67A 1XQ8A 1NR7A 3VQYA 2UXCB 2LP7A 1N0NA 2LGQA 3LDDA 2X6AA 3BFRA 4B3TO 1GRJA 3N2GB 1S3JA 2K9PA 5L3CA 1S0VA 4JI8O 2R9RB 1G6UA 1BHAA 1UPGA 5JWPA 4K0KO 2JIZG 3FB8C 3RVZA 2JEXA 4RWUA 2UUBO 3RGBA 4Q6GA 3OTOO 1HR0O 5IJ9B 4YJ2B 1F4MA 5IDJA 2ZE7A 1US6A 1JFFB 1WNSA 1L1FA 3TK1A 2YICA 5JQGA 2OWOA 5B5EZ 2UU9B 4LBEC 5BR8B 4NXMB 3DXRA 1BGYH 4U3JB 4IYHA 4LFAO 1DTOA 1KECA 2Z3YA 1PNLA 2OCCC 1XUQA 4F4LA 1PNKA 3CS5A 3STZC 4U3FH 4QPJA 1Q8IA 2HHHB 4I0XA 1H8HG 3J80N 4G28B 4YJ3A 1KKDA 1PNMA 5KHKA 3OM3B 5EC2C 1L0LH 2VQEB 5LHGA 4KHPO 2Y69C 4CC6A 5IYZA 1W0KG 5EBMC 3RYCA 1M56B 2EULA 4Q20A 2BTQB 1QLEC 4X1YB 4B08A 2WA4A 1Y66A 2KSDA 2Q7GA 2JGDA 1URFA 3W7TA 3SPIA 5HFMA 5CA0A 4DUYB 3JATA 2AZ0A 2ZIOA 3E86A 3QO8A 2UUAB 1VQNV 2KG7B 3C3TA 3CB2A 1Y67A 1IBLB 4GT1A 5IY5B 4O4IA 2EINB 1RPOA 2P4KA 3RWRA 2A7WA 3ZHQA 1D2DA 2N04A 1YTFB 2KB1A 1SRYA 3SR2C 4F6RA 4MT8A 1RM1B 3EHBB 4JI4B 5KMGA 2DQ3A 1RPRA 3OAAG 5CJ0A 3SYQA 1JVMA 4DV4O 1YXBA 5E79Z 2HFEC 1LUWA 4ICGA 1Y76A 4JI0O 4PDVA 3K5LA 1K33A 3CJHB 1VQMV 5B1NA 3ASNC 4O4HA 1AB3A 1VQLV 1YEWA 1N8RW 2RCVA 3UT5B 1ZUQA 4GX1A 2VWKA 3W7SA 4X20B 3MDSA 3CP1A 1QBZA 4KFMA 3RYIA 3CMEV 2XOKG 1YJWV 1Q86W 4I50A 2F4VB 1R3JC 2JJ1G 4UB6Z 1X59A 1M57C 2BOCC 3CCQV 2PYLA 1Q82W 1FXVA 2OT5A 1SZXA 4HBNA 2HVJC 4B3MB 1YJ9V 3WFVA 1SC5B 3SPCA 5TISZ 5L3DA 4UXNA 4UCVA 1SQVH 1K5QA 2F95B 1R3LC 2YIAA 3N2GA 2YDEA 2N74A 1L8DA 4NTWA 1D5NA 2W6JG 3G4SV 1HNZB 2QJ1A 3K0GA 2ZD9A 4N21A 5J2UB 2GHYA 4YJ2A 3MD0A 5JJNB 2GUZB 3SPGA 2ETNA 5AG2A 4K8ZA 3Q4HB 2OCHA 2Q0AA 4LH7A 5IJ0A 3CCJV 2CH7B 4WFAV 3UQ8A 4U7OA 2PI5A 3EVKA 4JZGA 4XDJA 3ASOC 4OXSA 4DR1O 1XNRB 2ZE6A 3SPHA 3ZBHA 2XUMA 2L6LA 2QSAA 3OMNB 5KUMA 1WPBA 3D36C 4MTOA 2GBOA 3OW2U 1XHZA 2HP8A 2IBZH 1H2GA 2WSSG 3L74H 3K59A 1M5IA 3H01A 4PHZA 1NZ6A 2HR3A 4B7KA 1ZX3A 2EILB 1K73W 2HJFC 3L75H 3BCCH 5CBGA 3CC2V 4DR2B 1PPJH 4XA4A 5LHHA 2VS0A 5H5NA 4IIJB 4AILC 1OCCB 1S72V 3ZX6A 4JF3A 3SDLA 4UB8Z 4RQEA 4DR7O 2P22C 1SQPH 3CHXA 3AK2A 2P4VA 5LP6C 3TXSA 1HNXB 4UCOA 3ZMSA 3CC7V 3FB6C 4DRXB 4DV2B 3A0RA 3CCUV 3BY6A 1I5XA 3K03A 3STLC 3ABLB 4ZHQB 1MSDA 5D5QA 2F23A 1B3QA 3E8GA 2Q9LA 1N32O 1AR4A 1RSOB 2QTOA 1XEQA 4O2BA 2WLIB 2E75B 4GKJB 2RNBA 5KHGA 1EZJA 1N34B 2PY5A 1QCEA 4JYAB 5BMVB 2YIBD 5B1AB 2UXDO 1SQFA 1QNMA 3II6A 4X65O 1JPXA 3WB1A 1J5EO 4E4EA 2UXBO 3CJHA 1OCOC 4J7KA 3OD4A 3LSQA 3A0HZ 1VF6C 3H1KH 4X8AA 5BY1A 3LNNA 5IT9N 1K92A 4X1KB 4P30A 3UT5A 5LGNA 2YC0A 2QWOB 2EIMC 1WN7A 4GFCA 4NXNO 3R66A 4KP4A 1BZKA 5GONB 4PA3A 4GX0A 1WA8A 1P7GA 2Y4UA 1PL4A 1ZL8B 1ORQC 4RQFA 2DE0X 1JJ2U 3AG1B 1R6TA 4EFBA 4DV5B 1NVPD 2IW5A 3I5DA 5KA6A 3FFQA 1M93A 4LF9B 2QR4A 1K7DA 2P6JA 4MSWC 5J2UA 3BAAA 5FLXN 2YXHA 4B3RO 2CTRA 1V55B 2WLMA 1MZEA 2RQ6A 2XASA 4NTXA 4MVMA 4JI1B 4K3AA 4NR1A 2Y0IA 2EIKB 2UXXA 4OGQB 2CH7A 5LGUA 3OEEG 3SJAC 4OPAA 4LFCO 2YUAA 5LGTA 1SZTA 3AK3A 4X64B 1M1KW 3KCXA 1VP7A 2CAZC 1SETA 5H6QA 1JQ0A 4O4LA 1Q6IA 3K9AA 4MS2A 2P7TC 2V1DA 5EYPA 4EB6B 3TJTA 2HVKC 3HPLC 2ITDC 1LNQA 1PP9H 2NLJC 1NVPB 1K5SA 1V54C 3T1HO
chains in the Genus database with same CATH topology
4JI6B 4CS2A 1Q3EA 5JQGA 4FLZA 2OWOA 2PZSA 4OX9B 4LF8B 2UU9B 4UFZA 2R72A 4CH5A 5BR8B 4O2AB 4NXMB 1FU1A 4U3JB 4DR4B 5CJ4A 4CS3A 3JALB 5LA6B 2ZINA 5K1PA 3U0ZA 1Q8IA 4DRXA 2HHHB 4FLWA 2ZNIA 4YJ3A 4DR7B 3K5NA 4CC5A 5JCOC 4ZHQA 5KHKA 1QQCA 4X20A 3DSQA 3U11A 2VQEB 4CC6A 1TVKA 2F93B 2GV9A 3JSLA 5IYZA 3QTCA 3RYCA 3OTFA 4CH6A 4FFBB 5CB4B 3ICXA 3BA8A 3ZEDA 1IBKB 2BTQB 4X1YB 5LMUB 4B08A 1XMQB 4DV0B 2Q7GA 3U10A 4D7SA 5CA0A 4DUYB 3JATA 3HKCA 1I7FA 2ZIOA 2UUAB 1O9HA 2YI8A 1IBMB 5EZYA 4GYCB 4I4TB 2RJZA 3HKBB 3JAWB 4O4LB 3CB2A 5LOVB 1O9GA 3BA9A 1IBLB 2UXDB 4TV9B 4O4IA 5EYPB 3JSNA 5LXTA 4X65B 5FPOA 4X1IB 4ZOLB 3RWRA 5LYJB 3WB0A 1FFXB 3ETQA 4CS4A 1J5EB 4IHJB 4X1KA 2UXBB 4YHHB 4DR5B 3SR2C 1TUBB 4F6RA 3HKEA 1P49A 4JI4B 5KMGA 4CH3A 5JQGB 3BPZA 2ZIMA 1Q43A 5CJ0A 4GKKB 4TV8A 5GONA 4FLYA 4YY3B 1T5EA 4DK1A 5KHIA 4NXNB 3CSXA 5K1XA 4L8JA 4LNUB 3E22A 3K5LA 3RYHB 4DV6B 3VQVA 4JI7B 2XHBA 3JASB 4LR3A 1VF7A 4O4HA 3RWRD 2JS5A 3K5OA 1YEWA 4TUYA 4NVPA 5LP6A 3IAYA 3UT5B 2F66C 5EIBD 2PUSA 2VWKA 4X20B 3SGIA 3QG5A 4FM1A 3BRCA 2P5OA 3RYIA 4I9QA 3MAQA 3BABA 4I50A 4IIJA 4TOIA 5JH7B 2F4VB 3RYFB 3JAKB 5C8YA 2PYLA 5CA1A 3A2FA 4B3RB 4PI2A 4FLTA 2VWJA 4HBNA 2ZM6B 4B3MB 1B04A 4UCVA 5KX5B 4UCTA 4LF5B 2YIAA 2F95B 3N2GA 2R70A 1SA0B 5KHHA 2F1MA 4LFCB 3N2KB 1L8DA 5EZYB 3HKDA 2JVDA 1FJGB 1HNZB 2QJ1A 4EB6A 4ZIBA 1N36B 3SJBC 4JI2B 4B3TB 4O4IB 1RSOA 5J2UB 5LXTB 4YJ2A 4JI8B 5J2TA 4UCRA 5JJNB 4K0KB 4ZI7B 4UCSA 4K8ZA 2Q0AA 5BMVA 4LH7A 3T1YB 5IJ0A 1N33B 2UUBB 4HNAB 4F6RB 1HR0B 3OTOB 4O4JA 4O2AA 3UQ8A 3HKEB 3ZS8C 2ZCEA 2PYJA 3T1HB 1XNRB 3JALA 2VQFB 4I55A 4FLVA 4JI5B 3VQWA 1WPBA 2BTOA 5EIBC 4WBNA 1XNQB 1XHZA 1IK9A 4LFAB 1DGSA 3MUDA 4GLXA 4FM0A 3K59A 1M5IA 5JVDA 4O4HB 4PHZA 4TUYB 5IWAB 1H2SB 3M7MX 2ZNJA 4FFBA 5CB4A 3PN1A 4EEQA 4DR2B 4XA4A 4I50B 4IIJB 4B3SB 4KHPB 4AILC 3WB2A 3K5MA 4DV3B 1HNWB 3QF7A 4LF7B 3BHPA 5CA1B 2P22C 3CHXA 1TGOA 2YIBA 5LP6C 3JARA 1HNXB 4UCOA 4FLUA 4DRXB 4DV2B 4I4TA 3HKBA 4DR3B 2KKWA 4YJ3B 5LOVA 1D5AA 5D5PA 4ZHQB 3HKDB 5D5QA 1X4TA 1TAEA 5ITZA 4TQFA 1NT2B 4X1IA 4KL1A 5LYJA 1TVKB 1FFXA 4AQYB 5IYZB 4IHJA 1JMKC 4DR6B 4LF6B 3RYCB 1SKVA 4O2BA 1TUBA 4GKJB 2QM4A 4LH6A 1XI1A 1V9PA 4DV7B 1ZAUA 2Q7HA 5KHGA 1N34B 2PY5A 4JYAB 5BMVB 5IJ0B 2YIBD 2Q7EA 4O4JB 5FNVA 1XHXA 5CA0B 1SQFA 3JATB 3HKCB 3II6A 2UUCB 3WB1A 4I55B 4LFBB 4LNUA 1Z5VA 3SJCC 3RYHA 1SQGA 2JGUA 1S5JA 3JASA 4EFEA 5JJEB 4DV4B 1XMOB 4WBNB 5CHXA 5IJ9A 1I94B 3LNNA 4FVMA 1JFFA 2PTMA 4FM2A 4LF4B 4JI0B 4X1KB 3UT5A 4D7TA 2V4DA 5JVDB 3K58A 2E3CA 1HW7A 1Q5OA 1WN7A 4U3JA 5KMGB 5JH7A 5JCOA 3RYFA 1M4UA 3JAKA 4TV8B 5GONB 4TQDA 5LA6A 4DUZB 4K8XA 1N32B 3THOA 4EFBA 3E22B 4DV5B 5KX5A 1KMIZ 3JARB 5FPRA 4DK0A 1SA0A 5KHJA 3FFQA 4CH4A 3N2KA 1M93A 5LMNB 1KU9A 4LF9B 4DV1B 2YI9A 2OYQA 2IM9A 5LP6B 4BW9A 5J2UA 3BAAA 3RFRA 5ITZB 2HEPA 2PGGA 4PI0A 3RYIB 4AHCA 3K57A 2RQ6A 4JI1B 4ZI7A 2BTQA 4JV5B 5JJJB 3B2EE 3VQXA 4X1YA 4UCUA 1QHTA 4X66B 4O2BB 5C8YB 4HNAA 2YXLA 3SJAC 1XQ8A 3VQYA 2UXCB 4BWAA 4JI3B 4X64B 2E5LB 4X62B 2CAZC 3SR2A 3JAWA 5FNVB 4O4LA 4FLXA 3N2GB 1Z5WA 4TV9A 1JJOA 1G6UA 5EYPA 4EB6B 4DR1B 2EX3A 4ZOLA 2R9AA 3RGBA 4Q6GA 5IJ9B 4YJ2B 1TA8A 5J2TB 1JFFB 1WNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHX A;  1IK9 A;  1KU9 A;  4XA4 A;  5CJ0 A;  3RWR A;  3SR2 A;  1M5I A;  5CJ4 A;  3RWR D;  3MUD A;  3SR2 C;  2QM4 A;  3II6 A;  1FU1 A;  2R9A A; 
#chains in the Genus database with same CATH topology
 1AP5 A;  3OMA B;  1IVS A;  4H0L B;  4CS2 A;  4P9P A;  1Q3E A;  1WP8 A;  3ABM B;  4JI5 O;  5DED A;  4FLZ A;  3IFX A;  4LF8 B;  4R8C A;  4CH5 A;  1YVW A;  1FU1 A;  2Z0A A;  3T4Z A;  3S3X A;  2KQX A;  3JAL B;  3E2E A;  1Y74 B;  5LA6 B;  4CKM A;  2Y69 B;  3FX7 A;  2ZIN A;  1BQ0 A;  1IX9 A;  4JGS A;  4DRX A;  4A5U B;  4FLW A;  2WA3 A;  2D3O W;  1P84 F;  4CC5 A;  2LW1 A;  4D6T H;  1QLE B;  4ZHQ A;  3U11 A;  1MG1 A;  4B3S O;  1HWY A;  1QR8 A;  1KB9 F;  3JSL A;  4LF7 O;  3ZRW B;  3D3I A;  3SYA A;  4FFB B;  3NR7 A;  3A0B Z;  4KUM A;  4RO2 A;  4C7U A;  2HJD A;  1P7B A;  3ZMZ A;  3B8M A;  4DR3 O;  3SYP A;  2LO1 A;  1R73 A;  3QO7 A;  4Z1M G;  4MVZ A;  4W4K A;  3AG7 A;  1H2M A;  2LQT A;  2Q8V A;  5EZY A;  2QWN B;  1XBL A;  2RJZ A;  3HKB B;  3JAW B;  3T2M A;  1YHQ V;  1QLN A;  3BA9 A;  2CTQ A;  4DR6 O;  2DOS A;  3APQ A;  4ABM A;  4TV9 B;  4RAI A;  1F7Y A;  3CRA A;  5IYD O;  2B1G A;  5LXT A;  3S3W A;  5FPO A;  3ZN1 A;  4DV7 O;  4WFH A;  4X1I B;  4ZOL B;  3G71 V;  4JYC A;  2UXN A;  3APO A;  2Y3W A;  3QVN A;  4X1K A;  2GDS A;  1ZSP A;  1B06 A;  1THZ A;  3T1C A;  3P3N A;  2UUC O;  4J42 A;  4J9Z B;  3HKE A;  4NKG B;  4PA4 A;  4CH3 A;  4LFB O;  2A9H A;  3ASN B;  2RMK B;  1H8E G;  4GKK B;  5GON A;  1OCR C;  4HZ3 A;  2LFS A;  4QNH B;  4WF9 V;  3P30 A;  1UJW B;  1ZL8 A;  1I94 O;  2L35 A;  2ZE5 A;  3F5T A;  4DK1 A;  4L8J A;  1RP3 B;  3CCV V;  4AI8 A;  3JAS B;  3AG2 C;  5E1A C;  1VF7 A;  2JS5 A;  4GX2 A;  3OT7 A;  1JCH A;  4JYY A;  2PUS A;  1NQT A;  4P2Z A;  4DUZ O;  5EK0 A;  4IYI A;  1BCC H;  3BRC A;  5BXZ A;  2P5O A;  1XNQ O;  2QGN A;  1FAF A;  3RYF B;  3D8C A;  5CA1 A;  2QEX V;  3A2F A;  1HP8 A;  3CCS V;  2BE3 A;  1AR1 B;  3DC5 A;  2VWJ A;  2AHZ A;  5LMN O;  2ZM6 B;  3B8N A;  2LJ2 A;  4DV1 O;  1K4D C;  2XAJ A;  1GMG A;  1NBM G;  4LF5 B;  4UCT A;  5B1B C;  3VOU A;  2IH3 C;  4PA9 A;  1GM7 A;  4BIU A;  1SA0 B;  2O57 A;  5KHH A;  2F1M A;  2H94 A;  3HKD A;  2JVD A;  3GVM A;  4EB6 A;  4ZIB A;  1RFY A;  2CTW A;  5LL6 Y;  1G8M A;  2B9Z A;  3ETG A;  2Q4P A;  3ZCC A;  4X66 O;  1MNG A;  3ASO B;  3I56 V;  3ZN0 A;  2UXC O;  4MVU A;  1EFR G;  4UCR A;  4UCS A;  3X2Q C;  1PD3 A;  2OTJ V;  3T1Y B;  1N33 B;  4HNA B;  2EJ7 A;  1DF4 A;  2PYJ A;  1AP6 A;  5CMU A;  3JAL A;  2VQF B;  4I55 A;  1Y74 A;  3VQW A;  4E2L A;  2H3O A;  1DF5 A;  5EIB C;  4WBN A;  1IK9 A;  4K35 A;  3O9O A;  5B3S B;  4FM0 A;  2UU9 O;  5BR8 O;  4NXM O;  4TUY B;  2XND G;  2IJI A;  2AXT Z;  1UFI A;  1FXK B;  5IWA B;  1VQ6 V;  3M7M X;  3ZRW A;  1QVG U;  1NU1 H;  4FFB A;  5H2F Z;  3WU2 Z;  3N27 A;  3F7V C;  2BSK B;  2HHH O;  4QE9 A;  3AG4 B;  1AIL A;  2H8P C;  3OGI B;  2WAM A;  1HNW B;  4LF4 O;  3BHP A;  1AI6 A;  3OGC C;  2JDI G;  3JAR A;  4FLU A;  2VQE O;  1QVF U;  1VQP V;  3HKB A;  3MHH C;  5BZB A;  2KKW A;  3AG3 C;  4MW8 A;  1ZWI C;  1D5A A;  2ARH A;  2XAH A;  1WPX A;  1K9M W;  4PDM A;  1X4T A;  2W0F C;  1TAE A;  5ITZ A;  4TQF A;  1NT2 B;  4X1I A;  4JTC B;  1E79 G;  4AQY B;  4X88 A;  2F43 G;  4LF6 B;  5B66 Z;  1SKV A;  4DUY O;  1JR9 A;  2QWP B;  2DWE C;  4LH6 A;  2UUA O;  1VEW A;  1VQ5 V;  1SQB H;  2QM8 A;  3B09 A;  5LBQ A;  3RN4 A;  1IBL O;  4O4J B;  1YDX A;  2EJR A;  4MTG A;  1XHX A;  3CWB H;  2ODM A;  3HKC B;  2OIG A;  3VBB A;  4LCU C;  3H1L H;  3J81 N;  4FMT A;  3IJ4 A;  2EIM B;  3PJS K;  1NS1 A;  1Z5V A;  3CCM V;  2Q0O C;  1VQ8 V;  2JGU A;  1A32 A;  2FTK A;  3JAS A;  4JAU A;  5JJE B;  1XMO B;  4H44 B;  5GTH Z;  1R3I C;  5CHX A;  2IJK A;  1VIB A;  5IJ9 A;  3CEI A;  1GO3 F;  1OV9 A;  2YS8 A;  4JI4 O;  1JFF A;  2A79 B;  1KKC A;  4D7T A;  2QKS A;  2V4D A;  5JVD B;  4YXW G;  1FS0 G;  3K58 A;  1DLB A;  1BSM A;  4ZKI A;  2A3Q A;  4MTF A;  2CGN A;  3OEH G;  4U3J A;  2M6Y A;  1GM8 A;  4RUF A;  2AHY A;  5JCO A;  3RYF A;  4TV8 B;  2R9I A;  4TQD A;  3H1H H;  1I0H A;  2QTS A;  2FML A;  1N32 B;  2DYR B;  3HB3 B;  3E22 B;  2A06 H;  5FPR A;  3CRR A;  3KKY A;  4DK0 A;  1SA0 A;  3OMI B;  5KHJ A;  5GW7 A;  4BIZ A;  1VQO V;  3OUF A;  1OZ0 A;  1AJP A;  2F4V O;  2YI9 A;  3CXC U;  3CD6 V;  1YF2 A;  4BW9 A;  3ABK C;  3M8A A;  4G2K A;  4F6E A;  1VQ7 V;  4GCZ A;  3RFR A;  4HAM A;  2N05 A;  2PGG A;  3SPJ A;  5DM6 V;  2QA4 V;  4PI0 A;  4AHC A;  2ZQM A;  3K57 A;  4B3M O;  1BQZ A;  2BTQ A;  4JV5 B;  1N4C A;  5JJJ B;  4X1Y A;  1QHT A;  5C8Y B;  4HNA A;  2CTP A;  3KG2 A;  4X9Q A;  4BWA A;  4JI3 B;  1HNZ O;  2E5L B;  1V54 B;  4QGP A;  4X62 B;  2HLD G;  2KG7 A;  1R3K C;  5FNV B;  4FLX A;  3K79 A;  1Z5W A;  2E76 B;  3FAV B;  1U97 A;  3RBZ A;  4KXR A;  2ZT9 B;  1RM1 C;  4DW1 A;  2EX3 A;  1YIJ V;  2R9A A;  1KYO F;  3O65 A;  1TA8 A;  2QDO A;  5H6R A;  3K9S A;  3LDC A;  3H9V A;  4JI6 B;  1BE3 H;  1XNR O;  4XDL A;  1FXK A;  2NNU A;  4OX9 B;  3E83 A;  1EBO A;  2ZXW B;  4JAA A;  4PV1 B;  2Y3V A;  4W4L A;  2BSK A;  4DR4 B;  4CS3 A;  3GB7 C;  1GK9 A;  4TWK A;  2OIE A;  2ADP A;  1XOU A;  4FFK A;  2YXY A;  4QJF B;  3JD3 A;  3ZHV A;  4QIW F;  1MZF A;  3R65 A;  3K5N A;  4LC1 A;  1YIT V;  1FYJ A;  2WWW A;  1QQC A;  4DR2 O;  4X20 A;  3DSQ A;  1G1X B;  2F93 B;  4G27 B;  1K34 A;  2ATK C;  1VMG A;  3QTC A;  3L9D A;  4DO2 A;  4CH6 A;  2ZE8 A;  1FPO A;  5CB4 B;  1HNX O;  4N23 A;  1GN4 A;  1IBK B;  4DV2 O;  3FB5 C;  4JPR A;  5LMU B;  1XMQ B;  4DV0 B;  2B5U A;  4DW0 A;  3CCR V;  3CC4 V;  2QKC A;  3JD0 A;  1GTO A;  3HKC A;  1E1R G;  1IZ3 A;  1O9H A;  1IBM B;  3H1J H;  4GYC B;  4DXW A;  4I4T B;  1K3E A;  4ASU G;  4NYK A;  3F5W C;  1LR1 A;  4JTA B;  3L70 H;  4GKJ O;  1F4N A;  1N34 O;  1OCR B;  4JYA O;  2GUZ A;  4CS4 A;  1COW G;  4IHJ B;  3Q4H A;  2IJH A;  4YHH B;  4DR5 B;  4YIO A;  1TUB B;  2ILM A;  2FL4 A;  3ZHS A;  3TET A;  1KD1 W;  1P49 A;  1FJG O;  3AG2 B;  5JQG B;  1XDC A;  1N36 O;  2OTL V;  1NI8 A;  4JI2 O;  2QM7 A;  4TV8 A;  3C3S A;  4FLY A;  4YY3 B;  1SF9 A;  4R50 A;  2K1E A;  3CSX A;  2EIL C;  3BVO A;  1AI4 A;  3E22 A;  3RYH B;  4DV6 B;  1K4C C;  3VQV A;  4JI7 B;  3P3P A;  2XHB A;  1U96 A;  4LR3 A;  3A8T A;  3RWR D;  1IDS A;  3K5O A;  2OCC B;  1FXH A;  4NVP A;  3IAY A;  2F66 C;  5EIB D;  2JJ2 G;  4WFF A;  5CN0 A;  2QWQ B;  3K04 A;  5EC1 C;  1KQS U;  3OUS A;  4I9Q A;  4R6Z A;  3MAQ A;  1AR5 A;  4IIJ A;  2W0X A;  4TOI A;  5JH7 B;  3T4D A;  4DV5 O;  5J9P C;  1KBH A;  4QPK A;  2YEV B;  5C8Y A;  1OCZ C;  3ETE A;  3GWO A;  4R7C A;  2Q6A A;  5F2V O;  4J41 A;  4PI2 A;  2HKO A;  3E89 A;  2QWR B;  3ABL C;  4LF9 O;  1B04 A;  4J9Y B;  3JCU Z;  3KZI Z;  1P4R A;  2JGD B;  2ZR3 A;  1FFT B;  3AEI A;  4BIO A;  3B77 A;  1AJN A;  1Y4M A;  2ZDI A;  4B7E A;  1JA8 A;  4JI1 O;  3SJB C;  4ZBM A;  2HG5 C;  4DV3 O;  2IU0 A;  4B3T B;  4O4I B;  1L0N H;  1RSO A;  1QU7 A;  1NJI W;  5B1A C;  4GUN A;  4H33 A;  4JI8 B;  2WLI A;  4JAV A;  4MTX A;  4P9O A;  4X64 O;  4K0K B;  3Q0X A;  4ZI7 B;  4L87 A;  2DWD C;  3CRC A;  3RT3 C;  3ZHT A;  1KP2 A;  5BMV A;  2UUB B;  4F6R B;  1HR0 B;  3OTO B;  1GN6 A;  3IC7 A;  1Q6H A;  3ZS8 C;  4UV9 A;  1VAR A;  2NN4 A;  4FLV A;  1W2B U;  1S76 D;  3CXH F;  3ZIA G;  1F51 A;  3LSU A;  2BTO A;  1XNQ B;  4XDK A;  1F23 A;  1Z2G A;  1IXM A;  4LFA B;  3MUD A;  3JD1 A;  1VQ4 V;  2Q67 A;  4GLX A;  2X6B A;  4LF8 O;  2Y48 A;  1NH2 D;  3ZRX A;  1AVM A;  4PA6 A;  3TGU H;  4O4H B;  3CCL V;  3ZJZ A;  4OPH A;  4GX5 A;  4NTY A;  2QKA A;  2EBO A;  4BW5 A;  5IYB O;  2XAQ A;  2ZNJ A;  5CB4 A;  1JX9 A;  3CRQ A;  4I50 B;  4KHP B;  1MAB G;  1YI2 V;  3WB2 A;  3K5M A;  4WFB V;  1MMM A;  3QF7 A;  4PA7 A;  1TGO A;  2YIB A;  4IL6 Z;  1M90 W;  4FJC C;  1K8A W;  5FL7 G;  3G6E V;  4Z2W A;  3LSS A;  2XAF A;  1ZLZ A;  5L3G A;  5IE9 A;  1M57 B;  4I4T A;  1V55 C;  2C2A A;  3NXS A;  2A0L A;  1H2K A;  1B6Q A;  2EIK C;  3ZHR A;  3K0D A;  2CK3 G;  1TVK B;  2DYS C;  4IHJ A;  1JMK C;  1NH2 B;  3CE2 A;  3UKM A;  1TUB A;  2QM4 A;  1XI1 A;  1PM9 A;  3AK1 A;  1ZAU A;  2Q7H A;  2RDC A;  5IJ0 B;  4I9W A;  1SER A;  4YIP A;  5B1O A;  2Q7E A;  2ZR2 A;  4UVB A;  3CRM A;  3WG7 C;  1NR1 A;  2ADQ B;  4J10 A;  2E74 B;  4WFG A;  3RYH A;  2EIJ C;  5KAI Z;  1SQG A;  4NB5 A;  2X6C A;  4LWS B;  4DV4 B;  3ABM C;  2WLH A;  4CKN A;  4FVM A;  1MOF A;  1GN2 A;  4LF4 B;  2Y4T A;  2G38 A;  4JI0 B;  1YTF D;  1XL4 A;  4GKK O;  3SJQ C;  1NTK H;  2E3C A;  1HW7 A;  1Q5O A;  3D3Q A;  1WAZ A;  4IT5 A;  1S77 D;  4PEL A;  5JH7 A;  1Y6X A;  3JAM N;  1GM9 A;  1M4U A;  3B4S A;  4UV8 A;  2GTS A;  2YEV A;  5LA6 A;  4K8X A;  3DGE A;  3TCU A;  4DYL A;  1PL0 A;  3ABK B;  2Q69 A;  4U7N A;  1CEZ A;  4PDR A;  3THO A;  1N0J A;  2V7Q G;  1KC8 W;  5KA5 A;  3HR0 A;  3DTU B;  3RVY A;  5KLV H;  4PJ0 Z;  4CH4 A;  2BCC H;  2PF4 E;  2GTA A;  4MVQ A;  2OYQ A;  5LP6 B;  1EN5 A;  2EZO A;  3ETD A;  3ML0 A;  2XTA A;  4UVC A;  3W7X A;  4JZ2 A;  3UO3 A;  2ZM6 O;  1E1Q G;  4ZI7 A;  3B2E E;  3VQX A;  4LF5 O;  4UCU A;  2XAG A;  4O2B B;  3CPW U;  2CDY A;  1Q90 D;  3QO5 A;  3KCY A;  1M9N A;  5L3E A;  2B1I A;  4I7Z B;  4H13 B;  3QNE A;  3ZRV A;  4WCE V;  3SR2 A;  2Y0P A;  3JAW A;  3I55 V;  3B40 A;  1IUR A;  1AJQ A;  4JYB A;  4TV9 A;  1JJO A;  2IU3 A;  4DR1 B;  3J7A U;  4ZOL A;  2LW7 A;  1PKX A;  3T1Y O;  1N33 O;  1ARO P;  3PYI A;  2DN9 A;  2Z5U A;  3DC6 A;  1J95 A;  1W59 A;  5J2T B;  2WLK A;  2VQF O;  1OCO B;  2ZKO A;  1ROP A;  2PZS A;  2PI4 A;  1EZV H;  3CYO A;  4UFZ A;  2R72 A;  1AI7 A;  4O2A B;  3JD4 A;  2DW4 A;  3JYC A;  5CJ4 A;  4MW3 A;  1R6N A;  4JAS A;  1I08 A;  1WA8 B;  5HFL A;  1ZTE A;  4CZZ A;  5K1P A;  3ZMT A;  3U0Z A;  3L73 H;  3C90 A;  2ZNI A;  5IWA O;  3GWK C;  4DR7 B;  3K08 A;  5JCO C;  3CMA V;  5A9G A;  1BL8 A;  4XBF A;  1R1B A;  4EKW A;  1TVK A;  2GV9 A;  1HNW O;  1MA1 A;  3OTF A;  3G80 A;  3TXQ A;  3UO2 A;  3ICX A;  2P90 A;  3BA8 A;  3ZED A;  1H2N A;  1GH6 A;  2YSU B;  1BT8 A;  3U10 A;  3ABU A;  2Q73 A;  4D7S A;  1YJN V;  1I7F A;  4J7J A;  2YI8 A;  2NR5 A;  4O4L B;  4AQY O;  1S5H C;  1KUQ A;  1M56 C;  3OR6 C;  1O9G A;  5LOV B;  3FKS G;  4LF6 O;  2UXD B;  4LWS A;  2VRZ A;  5EYP B;  3JSN A;  4X65 B;  1GN3 A;  3EFF K;  5LYJ B;  3WB0 A;  1FFX B;  1SQQ H;  1XIL A;  3ETQ A;  1J5E B;  1WB7 A;  2DQ0 A;  3D36 A;  2UXB B;  5LHI A;  2CGO A;  1WP7 A;  4WFE A;  5IY5 C;  1QR9 A;  3BEH A;  2EIN C;  4UVA A;  2XT9 A;  3BPZ A;  2ZIM A;  1Q43 A;  1CP9 A;  5B3S C;  1CXZ B;  1WB8 A;  1XMO O;  4X89 A;  1T5E A;  3OR7 C;  1KP3 A;  5KHI A;  3L71 H;  4NXN B;  5K1X A;  1IXB A;  3UM7 A;  4LNU B;  3ABT A;  2LGW A;  4GZR B;  1FXK C;  1CPY A;  1BMF G;  2M7W A;  2RN9 A;  3IC9 A;  5DEC A;  1OCZ B;  1JOY A;  4BR6 A;  4MVS A;  4TUY A;  3ZMU A;  5LP6 A;  2DMX A;  3AG4 C;  3SGI A;  1VF5 B;  2IJJ A;  1XRE A;  3QG5 A;  4FM1 A;  1OJH A;  4PDL A;  1Q7Y W;  2AZ2 A;  2FB5 A;  4FK5 C;  3BAB A;  2W6I G;  3E8F A;  3JAK B;  2BOB C;  4B3R B;  4FLT A;  3EXA A;  5KX5 B;  5CBF A;  2R70 A;  4LFC B;  3N2K B;  5EZY B;  1TUE B;  2EZP A;  1FJG B;  2WLL B;  3MHS C;  1N36 B;  2IH1 C;  4JV5 O;  1BHB A;  4RUE A;  5EBW C;  2P06 A;  5L3F A;  3CCE V;  4JI2 B;  2WPD G;  5H9C A;  4Z1V A;  5LXT B;  2CUG A;  2AGA A;  1OHH G;  5J2T A;  4JI3 O;  4BAY A;  3LUT B;  4JTD B;  2E5L O;  2JK5 C;  4X62 O;  4FZ1 A;  1NTM H;  2JEU A;  4TSF G;  4H37 A;  5L3B A;  4UUJ C;  1SES A;  1VF6 A;  1S5L Z;  4O4J A;  5CA3 A;  1K97 A;  4O2A A;  1MSW D;  3HKE B;  2ZCE A;  3T1H B;  3SYC A;  1WJZ A;  2MW2 B;  4G79 A;  2ITC C;  4JI5 B;  5DN6 G;  5KUK A;  4FIP C;  4JI6 O;  1GKF A;  3FB7 C;  1DGS A;  1LUV A;  4OX9 O;  1YCI A;  1GAX A;  1FKA O;  1PV0 A;  2LFR A;  5JVD A;  1H38 A;  2YID A;  4MVR A;  4DR4 O;  1BS3 A;  3LDE A;  3G67 A;  1H2S B;  4GFA A;  1Q6U A;  2DYR C;  4LP8 A;  3PN1 A;  4EEQ A;  4TT3 G;  3DXR B;  5IYC O;  3OE7 G;  4B3S B;  1DK1 A;  2WLN A;  4DV3 B;  4J7Z A;  4LF7 B;  5CA1 B;  1XL6 A;  3F7Y C;  3K06 A;  2D2C B;  5GTI Z;  5KAF Z;  3ZMV A;  2DYS B;  4I0X B;  4DR3 B;  4YJ3 B;  3L72 H;  5LOV A;  3JD2 A;  1ENV A;  1OCC C;  5D5P A;  1VQK V;  3HKD B;  4PD4 F;  1IBK O;  4KL1 A;  5LYJ A;  5LMU O;  5B1B B;  1XMQ O;  1FFX A;  4DV0 O;  1W0J G;  1H2L A;  1YZB A;  2QE7 G;  5IYZ B;  3WG7 B;  4DR6 B;  3RYC B;  1NTZ H;  2CE4 A;  3W7W A;  1EN4 A;  3ZHU A;  1V9P A;  1IBM O;  2EIJ B;  5EBL C;  4DV7 B;  2ZDI C;  3E8H A;  2AW9 A;  4MVO A;  5FNV A;  5CA0 B;  3W7U A;  3OFN G;  3JAT B;  4FPP A;  3FAV A;  3X2Q B;  3P32 A;  2UUC B;  4I55 B;  4LFB B;  3M99 B;  4LNU A;  3SJC C;  2Q5Z A;  1G4Y B;  4YHH O;  4DR5 O;  1S5J A;  2WLJ A;  1SS3 A;  4EFE A;  1WLE A;  4I5S A;  4WBN B;  4HYO A;  2ZXW C;  1I94 B;  3FD9 A;  3UCS C;  2PTM A;  4FM2 A;  4GEU A;  1NKD A;  3G6B A;  4QE7 A;  3IGA C;  4YY3 O;  1EN6 A;  1AI5 A;  5A2Q N;  5KMG B;  4DV6 O;  4JI7 O;  3JAK A;  4DUZ B;  4CBC A;  2MK3 A;  3E35 A;  3H1I H;  1HDJ A;  2DJV A;  5C93 A;  1Y76 B;  4J80 A;  1Q81 W;  5KX5 A;  1KMI Z;  2FYU H;  4J11 A;  3JAR B;  4CKP A;  1FD9 A;  4FZ0 A;  3Q0Y A;  3FYI B;  2Q68 A;  5CBH A;  2X7R B;  3N2K A;  1SQX H;  3SYO A;  5LMN B;  1YSC A;  1KU9 A;  1R6K A;  4DV1 B;  2WLL A;  3JCZ A;  2GSM B;  2IM9 A;  3AG1 C;  4IGG A;  3FYE B;  1EM1 A;  5ITZ B;  2HEP A;  4GEX A;  3RYI B;  2X0L A;  2FKX A;  3E8B A;  3AG3 B;  3CX5 F;  3ZRS A;  2JS3 A;  4X66 B;  3RW0 A;  3K3W A;  1I5Y A;  2JRI A;  3LNM B;  2YXL A;  1VQ9 V;  2P67 A;  1XQ8 A;  1NR7 A;  3VQY A;  2UXC B;  2LP7 A;  1N0N A;  2LGQ A;  3LDD A;  2X6A A;  3BFR A;  4B3T O;  1GRJ A;  3N2G B;  1S3J A;  2K9P A;  5L3C A;  1S0V A;  4JI8 O;  2R9R B;  1G6U A;  1BHA A;  1UPG A;  5JWP A;  4K0K O;  2JIZ G;  3FB8 C;  3RVZ A;  2JEX A;  4RWU A;  2UUB O;  3RGB A;  4Q6G A;  3OTO O;  1HR0 O;  5IJ9 B;  4YJ2 B;  1F4M A;  5IDJ A;  2ZE7 A;  1US6 A;  1JFF B;  1WNS A;  1L1F A;  3TK1 A;  2YIC A;  5JQG A;  2OWO A;  5B5E Z;  2UU9 B;  4LBE C;  5BR8 B;  4NXM B;  3DXR A;  1BGY H;  4U3J B;  4IYH A;  4LFA O;  1DTO A;  1KEC A;  2Z3Y A;  1PNL A;  2OCC C;  1XUQ A;  4F4L A;  1PNK A;  3CS5 A;  3STZ C;  4U3F H;  4QPJ A;  1Q8I A;  2HHH B;  4I0X A;  1H8H G;  3J80 N;  4G28 B;  4YJ3 A;  1KKD A;  1PNM A;  5KHK A;  3OM3 B;  5EC2 C;  1L0L H;  2VQE B;  5LHG A;  4KHP O;  2Y69 C;  4CC6 A;  5IYZ A;  1W0K G;  5EBM C;  3RYC A;  1M56 B;  2EUL A;  4Q20 A;  2BTQ B;  1QLE C;  4X1Y B;  4B08 A;  2WA4 A;  1Y66 A;  2KSD A;  2Q7G A;  2JGD A;  1URF A;  3W7T A;  3SPI A;  5HFM A;  5CA0 A;  4DUY B;  3JAT A;  2AZ0 A;  2ZIO A;  3E86 A;  3QO8 A;  2UUA B;  1VQN V;  2KG7 B;  3C3T A;  3CB2 A;  1Y67 A;  1IBL B;  4GT1 A;  5IY5 B;  4O4I A;  2EIN B;  1RPO A;  2P4K A;  3RWR A;  2A7W A;  3ZHQ A;  1D2D A;  2N04 A;  1YTF B;  2KB1 A;  1SRY A;  3SR2 C;  4F6R A;  4MT8 A;  1RM1 B;  3EHB B;  4JI4 B;  5KMG A;  2DQ3 A;  1RPR A;  3OAA G;  5CJ0 A;  3SYQ A;  1JVM A;  4DV4 O;  1YXB A;  5E79 Z;  2HFE C;  1LUW A;  4ICG A;  1Y76 A;  4JI0 O;  4PDV A;  3K5L A;  1K33 A;  3CJH B;  1VQM V;  5B1N A;  3ASN C;  4O4H A;  1AB3 A;  1VQL V;  1YEW A;  1N8R W;  2RCV A;  3UT5 B;  1ZUQ A;  4GX1 A;  2VWK A;  3W7S A;  4X20 B;  3MDS A;  3CP1 A;  1QBZ A;  4KFM A;  3RYI A;  3CME V;  2XOK G;  1YJW V;  1Q86 W;  4I50 A;  2F4V B;  1R3J C;  2JJ1 G;  4UB6 Z;  1X59 A;  1M57 C;  2BOC C;  3CCQ V;  2PYL A;  1Q82 W;  1FXV A;  2OT5 A;  1SZX A;  4HBN A;  2HVJ C;  4B3M B;  1YJ9 V;  3WFV A;  1SC5 B;  3SPC A;  5TIS Z;  5L3D A;  4UXN A;  4UCV A;  1SQV H;  1K5Q A;  2F95 B;  1R3L C;  2YIA A;  3N2G A;  2YDE A;  2N74 A;  1L8D A;  4NTW A;  1D5N A;  2W6J G;  3G4S V;  1HNZ B;  2QJ1 A;  3K0G A;  2ZD9 A;  4N21 A;  5J2U B;  2GHY A;  4YJ2 A;  3MD0 A;  5JJN B;  2GUZ B;  3SPG A;  2ETN A;  5AG2 A;  4K8Z A;  3Q4H B;  2OCH A;  2Q0A A;  4LH7 A;  5IJ0 A;  3CCJ V;  2CH7 B;  4WFA V;  3UQ8 A;  4U7O A;  2PI5 A;  3EVK A;  4JZG A;  4XDJ A;  3ASO C;  4OXS A;  4DR1 O;  1XNR B;  2ZE6 A;  3SPH A;  3ZBH A;  2XUM A;  2L6L A;  2QSA A;  3OMN B;  5KUM A;  1WPB A;  3D36 C;  4MTO A;  2GBO A;  3OW2 U;  1XHZ A;  2HP8 A;  2IBZ H;  1H2G A;  2WSS G;  3L74 H;  3K59 A;  1M5I A;  3H01 A;  4PHZ A;  1NZ6 A;  2HR3 A;  4B7K A;  1ZX3 A;  2EIL B;  1K73 W;  2HJF C;  3L75 H;  3BCC H;  5CBG A;  3CC2 V;  4DR2 B;  1PPJ H;  4XA4 A;  5LHH A;  2VS0 A;  5H5N A;  4IIJ B;  4AIL C;  1OCC B;  1S72 V;  3ZX6 A;  4JF3 A;  3SDL A;  4UB8 Z;  4RQE A;  4DR7 O;  2P22 C;  1SQP H;  3CHX A;  3AK2 A;  2P4V A;  5LP6 C;  3TXS A;  1HNX B;  4UCO A;  3ZMS A;  3CC7 V;  3FB6 C;  4DRX B;  4DV2 B;  3A0R A;  3CCU V;  3BY6 A;  1I5X A;  3K03 A;  3STL C;  3ABL B;  4ZHQ B;  1MSD A;  5D5Q A;  2F23 A;  1B3Q A;  3E8G A;  2Q9L A;  1N32 O;  1AR4 A;  1RSO B;  2QTO A;  1XEQ A;  4O2B A;  2WLI B;  2E75 B;  4GKJ B;  2RNB A;  5KHG A;  1EZJ A;  1N34 B;  2PY5 A;  1QCE A;  4JYA B;  5BMV B;  2YIB D;  5B1A B;  2UXD O;  1SQF A;  1QNM A;  3II6 A;  4X65 O;  1JPX A;  3WB1 A;  1J5E O;  4E4E A;  2UXB O;  3CJH A;  1OCO C;  4J7K A;  3OD4 A;  3LSQ A;  3A0H Z;  1VF6 C;  3H1K H;  4X8A A;  5BY1 A;  3LNN A;  5IT9 N;  1K92 A;  4X1K B;  4P30 A;  3UT5 A;  5LGN A;  2YC0 A;  2QWO B;  2EIM C;  1WN7 A;  4GFC A;  4NXN O;  3R66 A;  4KP4 A;  1BZK A;  5GON B;  4PA3 A;  4GX0 A;  1WA8 A;  1P7G A;  2Y4U A;  1PL4 A;  1ZL8 B;  1ORQ C;  4RQF A;  2DE0 X;  1JJ2 U;  3AG1 B;  1R6T A;  4EFB A;  4DV5 B;  1NVP D;  2IW5 A;  3I5D A;  5KA6 A;  3FFQ A;  1M93 A;  4LF9 B;  2QR4 A;  1K7D A;  2P6J A;  4MSW C;  5J2U A;  3BAA A;  5FLX N;  2YXH A;  4B3R O;  2CTR A;  1V55 B;  2WLM A;  1MZE A;  2RQ6 A;  2XAS A;  4NTX A;  4MVM A;  4JI1 B;  4K3A A;  4NR1 A;  2Y0I A;  2EIK B;  2UXX A;  4OGQ B;  2CH7 A;  5LGU A;  3OEE G;  3SJA C;  4OPA A;  4LFC O;  2YUA A;  5LGT A;  1SZT A;  3AK3 A;  4X64 B;  1M1K W;  3KCX A;  1VP7 A;  2CAZ C;  1SET A;  5H6Q A;  1JQ0 A;  4O4L A;  1Q6I A;  3K9A A;  4MS2 A;  2P7T C;  2V1D A;  5EYP A;  4EB6 B;  3TJT A;  2HVK C;  3HPL C;  2ITD C;  1LNQ A;  1PP9 H;  2NLJ C;  1NVP B;  1K5S A;  1V54 C;  3T1H O; 
#chains in the Genus database with same CATH homology
 4JI6 B;  4CS2 A;  1Q3E A;  5JQG A;  4FLZ A;  2OWO A;  2PZS A;  4OX9 B;  4LF8 B;  2UU9 B;  4UFZ A;  2R72 A;  4CH5 A;  5BR8 B;  4O2A B;  4NXM B;  1FU1 A;  4U3J B;  4DR4 B;  5CJ4 A;  4CS3 A;  3JAL B;  5LA6 B;  2ZIN A;  5K1P A;  3U0Z A;  1Q8I A;  4DRX A;  2HHH B;  4FLW A;  2ZNI A;  4YJ3 A;  4DR7 B;  3K5N A;  4CC5 A;  5JCO C;  4ZHQ A;  5KHK A;  1QQC A;  4X20 A;  3DSQ A;  3U11 A;  2VQE B;  4CC6 A;  1TVK A;  2F93 B;  2GV9 A;  3JSL A;  5IYZ A;  3QTC A;  3RYC A;  3OTF A;  4CH6 A;  4FFB B;  5CB4 B;  3ICX A;  3BA8 A;  3ZED A;  1IBK B;  2BTQ B;  4X1Y B;  5LMU B;  4B08 A;  1XMQ B;  4DV0 B;  2Q7G A;  3U10 A;  4D7S A;  5CA0 A;  4DUY B;  3JAT A;  3HKC A;  1I7F A;  2ZIO A;  2UUA B;  1O9H A;  2YI8 A;  1IBM B;  5EZY A;  4GYC B;  4I4T B;  2RJZ A;  3HKB B;  3JAW B;  4O4L B;  3CB2 A;  5LOV B;  1O9G A;  3BA9 A;  1IBL B;  2UXD B;  4TV9 B;  4O4I A;  5EYP B;  3JSN A;  5LXT A;  4X65 B;  5FPO A;  4X1I B;  4ZOL B;  3RWR A;  5LYJ B;  3WB0 A;  1FFX B;  3ETQ A;  4CS4 A;  1J5E B;  4IHJ B;  4X1K A;  2UXB B;  4YHH B;  4DR5 B;  3SR2 C;  1TUB B;  4F6R A;  3HKE A;  1P49 A;  4JI4 B;  5KMG A;  4CH3 A;  5JQG B;  3BPZ A;  2ZIM A;  1Q43 A;  5CJ0 A;  4GKK B;  4TV8 A;  5GON A;  4FLY A;  4YY3 B;  1T5E A;  4DK1 A;  5KHI A;  4NXN B;  3CSX A;  5K1X A;  4L8J A;  4LNU B;  3E22 A;  3K5L A;  3RYH B;  4DV6 B;  3VQV A;  4JI7 B;  2XHB A;  3JAS B;  4LR3 A;  1VF7 A;  4O4H A;  3RWR D;  2JS5 A;  3K5O A;  1YEW A;  4TUY A;  4NVP A;  5LP6 A;  3IAY A;  3UT5 B;  2F66 C;  5EIB D;  2PUS A;  2VWK A;  4X20 B;  3SGI A;  3QG5 A;  4FM1 A;  3BRC A;  2P5O A;  3RYI A;  4I9Q A;  3MAQ A;  3BAB A;  4I50 A;  4IIJ A;  4TOI A;  5JH7 B;  2F4V B;  3RYF B;  3JAK B;  5C8Y A;  2PYL A;  5CA1 A;  3A2F A;  4B3R B;  4PI2 A;  4FLT A;  2VWJ A;  4HBN A;  2ZM6 B;  4B3M B;  1B04 A;  4UCV A;  5KX5 B;  4UCT A;  4LF5 B;  2YIA A;  2F95 B;  3N2G A;  2R70 A;  1SA0 B;  5KHH A;  2F1M A;  4LFC B;  3N2K B;  1L8D A;  5EZY B;  3HKD A;  2JVD A;  1FJG B;  1HNZ B;  2QJ1 A;  4EB6 A;  4ZIB A;  1N36 B;  3SJB C;  4JI2 B;  4B3T B;  4O4I B;  1RSO A;  5J2U B;  5LXT B;  4YJ2 A;  4JI8 B;  5J2T A;  4UCR A;  5JJN B;  4K0K B;  4ZI7 B;  4UCS A;  4K8Z A;  2Q0A A;  5BMV A;  4LH7 A;  3T1Y B;  5IJ0 A;  1N33 B;  2UUB B;  4HNA B;  4F6R B;  1HR0 B;  3OTO B;  4O4J A;  4O2A A;  3UQ8 A;  3HKE B;  3ZS8 C;  2ZCE A;  2PYJ A;  3T1H B;  1XNR B;  3JAL A;  2VQF B;  4I55 A;  4FLV A;  4JI5 B;  3VQW A;  1WPB A;  2BTO A;  5EIB C;  4WBN A;  1XNQ B;  1XHZ A;  1IK9 A;  4LFA B;  1DGS A;  3MUD A;  4GLX A;  4FM0 A;  3K59 A;  1M5I A;  5JVD A;  4O4H B;  4PHZ A;  4TUY B;  5IWA B;  1H2S B;  3M7M X;  2ZNJ A;  4FFB A;  5CB4 A;  3PN1 A;  4EEQ A;  4DR2 B;  4XA4 A;  4I50 B;  4IIJ B;  4B3S B;  4KHP B;  4AIL C;  3WB2 A;  3K5M A;  4DV3 B;  1HNW B;  3QF7 A;  4LF7 B;  3BHP A;  5CA1 B;  2P22 C;  3CHX A;  1TGO A;  2YIB A;  5LP6 C;  3JAR A;  1HNX B;  4UCO A;  4FLU A;  4DRX B;  4DV2 B;  4I4T A;  3HKB A;  4DR3 B;  2KKW A;  4YJ3 B;  5LOV A;  1D5A A;  5D5P A;  4ZHQ B;  3HKD B;  5D5Q A;  1X4T A;  1TAE A;  5ITZ A;  4TQF A;  1NT2 B;  4X1I A;  4KL1 A;  5LYJ A;  1TVK B;  1FFX A;  4AQY B;  5IYZ B;  4IHJ A;  1JMK C;  4DR6 B;  4LF6 B;  3RYC B;  1SKV A;  4O2B A;  1TUB A;  4GKJ B;  2QM4 A;  4LH6 A;  1XI1 A;  1V9P A;  4DV7 B;  1ZAU A;  2Q7H A;  5KHG A;  1N34 B;  2PY5 A;  4JYA B;  5BMV B;  5IJ0 B;  2YIB D;  2Q7E A;  4O4J B;  5FNV A;  1XHX A;  5CA0 B;  1SQF A;  3JAT B;  3HKC B;  3II6 A;  2UUC B;  3WB1 A;  4I55 B;  4LFB B;  4LNU A;  1Z5V A;  3SJC C;  3RYH A;  1SQG A;  2JGU A;  1S5J A;  3JAS A;  4EFE A;  5JJE B;  4DV4 B;  1XMO B;  4WBN B;  5CHX A;  5IJ9 A;  1I94 B;  3LNN A;  4FVM A;  1JFF A;  2PTM A;  4FM2 A;  4LF4 B;  4JI0 B;  4X1K B;  3UT5 A;  4D7T A;  2V4D A;  5JVD B;  3K58 A;  2E3C A;  1HW7 A;  1Q5O A;  1WN7 A;  4U3J A;  5KMG B;  5JH7 A;  5JCO A;  3RYF A;  1M4U A;  3JAK A;  4TV8 B;  5GON B;  4TQD A;  5LA6 A;  4DUZ B;  4K8X A;  1N32 B;  3THO A;  4EFB A;  3E22 B;  4DV5 B;  5KX5 A;  1KMI Z;  3JAR B;  5FPR A;  4DK0 A;  1SA0 A;  5KHJ A;  3FFQ A;  4CH4 A;  3N2K A;  1M93 A;  5LMN B;  1KU9 A;  4LF9 B;  4DV1 B;  2YI9 A;  2OYQ A;  2IM9 A;  5LP6 B;  4BW9 A;  5J2U A;  3BAA A;  3RFR A;  5ITZ B;  2HEP A;  2PGG A;  4PI0 A;  3RYI B;  4AHC A;  3K57 A;  2RQ6 A;  4JI1 B;  4ZI7 A;  2BTQ A;  4JV5 B;  5JJJ B;  3B2E E;  3VQX A;  4X1Y A;  4UCU A;  1QHT A;  4X66 B;  4O2B B;  5C8Y B;  4HNA A;  2YXL A;  3SJA C;  1XQ8 A;  3VQY A;  2UXC B;  4BWA A;  4JI3 B;  4X64 B;  2E5L B;  4X62 B;  2CAZ C;  3SR2 A;  3JAW A;  5FNV B;  4O4L A;  4FLX A;  3N2G B;  1Z5W A;  4TV9 A;  1JJO A;  1G6U A;  5EYP A;  4EB6 B;  4DR1 B;  2EX3 A;  4ZOL A;  2R9A A;  3RGB A;  4Q6G A;  5IJ9 B;  4YJ2 B;  1TA8 A;  5J2T B;  1JFF B;  1WNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...