2QM4A

Crystal structure of human xlf/cernunnos, a non-homologous end-joining factor
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
232
structure length
232
Chain Sequence
SGMEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-homologous end-joining factor 1
publication title Crystal structure of human XLF/Cernunnos reveals unexpected differences from XRCC4 with implications for NHEJ.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Recombination
total genus 59
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2qm4A02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 2qm4A01
1IK9A 3RWRD 4XA4A 5CJ0A 5CHXA 1M5IA 1KU9A 3MUDA 2QM4A 1FU1A 3SR2C 3II6A 2R9AA 3RWRA 5CJ4A 3SR2A
chains in the Genus database with same CATH superfamily
2XOKG 3X2QC 3EXAA 4CS3A 2ZE6A 3APQA 2ATKC 1AR1B 2QM4A 2P4KA 1VQKV 4UCSA 4K0KB 4BIOA 3ZJZA 1M93A 3JASB 5EYPA 1VQ4V 1M4UA 3CD6V 2MK3A 2BOBC 5KHHA 3CCJV 3RN4A 3M7MX 5EBWC 1GN3A 1MABG 1Q82W 4O2BB 3BRCA 3CJHA 2X6BA 3ZHVA 3K57A 1GAXA 1RM1C 1R3LC 1XUQA 3D8CA 4P9OA 5J2TB 2WLIA 2N05A 1AILA 1I94O 2F93B 1KU9A 1NJIW 5B1BB 4I5SA 5DECA 3KG2A 3OT7A 5B1BC 1F4NA 3K3WA 3ZHQA 2W0XA 5CA0A 4X66B 2Y3WA 3OFNG 3CX5F 4AILC 5LA6B 3SYAA 3CEIA 4JAAA 3OR7C 4U3FH 3HKDB 5DN6G 3PJSK 1BHAA 1RPRA 5CA1A 5IJ9B 3OEEG 1JR9A 3OTOO 4MVOA 4Z1VA 2Z3YA 2XNDG 3E8GA 5H9CA 4UCRA 4X1YA 4MVZA 5IDJA 2OTLV 2QWQB 1FFXA 4RQFA 3JALA 2E3CA 3WU2Z 3CHXA 4GX0A 3AK3A 2KB1A 2VWKA 4JI5B 1FXVA 4CH5A 4UXNA 1N34B 4P30A 3E8BA 2HJDA 3BPZA 5IYBO 3CCVV 2UXXA 4JPRA 2F66C 5LMNB 4DR3O 5H5NA 1HNZB 1ZSPA 3B09A 3APOA 1YEWA 4LFBO 4LF6B 1YJNV 4MT8A 5D5PA 2ADQB 3ABUA 3DXRB 3JAKA 3HKCB 1BZKA 4JI3O 3VQXA 1V9PA 2F23A 4O4HA 4B3RB 1XEQA 1DTOA 1DK1A 1D2DA 1EN6A 5CHXA 1PNMA 1TVKB 4WFAV 5LYJB 2EZOA 1LR1A 4WBNB 3E2EA 4H33A 2ZXWB 3I56V 3TK1A 4RUEA 4TQFA 1SETA 4EB6A 1COWG 1WPXA 4JI4O 1WAZA 4FK5C 1BE3H 1AJNA 3Q4HB 4G27B 1NH2D 1SS3A 2R72A 2F43G 4F6RB 2QWOB 1MSWD 3CRCA 3H1HH 5E79Z 2HVKC 1UPGA 5IWAO 3L72H 3CRMA 3PN1A 1F23A 2BOCC 4WFEA 2V4DA 3UT5B 2PZSA 3RGBA 1HR0B 2UUAB 4JI6O 3FAVB 1JJ2U 3C3TA 4FLZA 5BXZA 4BR6A 2JJ1G 1SA0B 5C8YB 1AI6A 2ZM6B 1FKAO 5BR8B 4E4EA 5H2FZ 1SQBH 4X65B 3M99B 4I4TB 3JAWA 1YF2A 4U7OA 4BW5A 4LNUA 4W4LA 4X64B 3W7SA 1K97A 4CKMA 3OMAB 4GKJO 3ZHSA 4DV6O 1XNRO 2QSAA 4AQYO 3LSQA 2RJZA 3QTCA 2WLLA 1KKDA 2DYRB 3H1KH 3ABMB 4B3MO 1E1QG 3ABMC 1YDXA 4U3JA 3HR0A 5H6QA 4UCOA 5LBQA 4IT5A 2X6CA 2O57A 4HNAB 4MW3A 3SR2A 1H2SB 1MA1A 3LDDA 1BQZA 3N2KB 2Y4TA 1ZX3A 2WWWA 3OGCC 2P90A 2YDEA 2LQTA 3QNEA 2FB5A 5EIBD 5IYZB 2QWRB 2YIBA 2BSKA 4DR4B 2JEXA 2MW2B 1Y74B 1Z2GA 2N04A 3CS5A 4ZOLA 4DRXB 2Y3VA 5CB4B 2HHHB 5IYCO 1Z5WA 1FS0G 2ODMA 1Y6XA 2Q9LA 3JATA 1PKXA 3CCEV 1K92A 1Z5VA 4DV5B 2YC0A 4JYAB 4FFBB 3VQVA 1WN7A 3UCSC 3SYPA 4UUJC 4MVQA 3MDSA 1URFA 3K5LA 1AVMA 1VQ9V 4DR7B 1HNXO 1QQCA 3OW2U 4DV1O 2ADPA 1K4DC 1I7FA 3H01A 1W0KG 1QR8A 1JOYA 5GW7A 1SERA 1VQ6V 4DV7B 2LFSA 4G79A 3K0DA 3S3WA 5LP6A 2YEVA 4LH7A 1UJWB 1IURA 4GLXA 2Q6AA 1BL8A 2M7WA 4ZIBA 5LXTB 2XTAA 3RT3C 4KFMA 1N0JA 3RFRA 3CC4V 4PELA 3HKEA 1V55B 4FVMA 1Q90D 3HKBA 2W6IG 4DV0O 3H1IH 1Q6IA 4B3TB 2WPDG 4CBCA 1NTZH 2EINB 1N4CA 2EINC 2IJIA 2HJFC 2YS8A 3ASOB 3BY6A 1R3KC 2QTSA 3IC7A 4CH6A 1NTMH 2UXNA 2FYUH 3T4ZA 4CKPA 4MVSA 3E22A 4FIPC 2DN9A 5BMVB 3T2MA 3AEIA 3L70H 5EBMC 1XMOB 1N36B 4JI8O 3STLC 3ETDA 3JASA 5DM6V 1M9NA 3W7WA 4DR1B 1TA8A 1K34A 2DW4A 4UCUA 1Q6UA 1E1RG 2UUBO 1JQ0A 4JI0O 1K9MW 4O2BA 3SDLA 3G80A 2H8PC 4DV4O 2AHYA 3JSLA 2Q7EA 1Q3EA 3RWRD 3AG3C 3K04A 2BCCH 5J2TA 4WFFA 2EJ7A 3FD9A 1ZTEA 4NVPA 3A0HZ 2DYSB 3BEHA 2GUZB 1WPBA 3B77A 4BWAA 2YXHA 1XHZA 3K06A 1S76D 5LA6A 4DR5O 2H94A 3HKDA 3FX7A 2HLDG 4NYKA 1ZLZA 2CTQA 1L0NH 3RW0A 1VMGA 1QR9A 3WB0A 3DSQA 5J2UB 5IJ9A 3N2GB 2UXCB 1BHBA 1AB3A 3B4SA 4EFBA 2UXBB 1QLEB 2W6JG 1XMQB 5EK0A 4BIUA 3DTUB 1PPJH 1KD1W 1K33A 1H2GA 1MG1A 2ITCC 1P4RA 3BHPA 1XOUA 1JFFA 5B1NA 4LF7O 4D7TA 2EIJB 3SJBC 1K7DA 2EIJC 1VIBA 1ZAUA 4X8AA 3SPHA 3D3QA 2C2AA 4L87A 5EIBC 4LBEC 4DUZB 2EZPA 4H13B 2QTOA 1SESA 1J95A 2K9PA 5EZYB 4FLVA 4C7UA 4LFCO 3BA9A 3WFVA 3ZRSA 3F5TA 2L35A 4EKWA 2F4VO 3CPWU 1F7YA 2R70A 2UU9B 2ZCEA 3DXRA 1AJQA 1YIJV 5TISZ 4IIJB 3HKCA 3R65A 3WB2A 3K59A 1VEWA 1XQ8A 1IBLB 3ZCCA 3K08A 4DK0A 2GSMB 4O2AB 2WLJA 4ZI7B 1TVKA 2ZD9A 4JI1B 5LYJA 5B3SB 5B3SC 4X62B 4UVBA 3IJ4A 4WBNA 3ZHRA 4DV2O 1NR7A 4NTYA 2VQEO 4YY3O 3OMIB 4MVUA 2YXYA 2P5OA 4GKKO 4LCUC 1AROP 4XDKA 5JQGB 1HDJA 2WLMA 1RFYA 2A79B 2N74A 1EN5A 4H0LB 3W7TA 3CXCU 4CC6A 3Q4HA 1SQVH 4F6RA 5E1AC 4UVAA 5JJEB 5D5QA 4JI7B 1ZUQA 2JS3A 3KKYA 5KHIA 3UT5A 5KLVH 2B1IA 2RCVA 1MSDA 1IK9A 3MHSC 3W7UA 5B1AB 5GTIZ 4NR1A 2CAZC 5LHHA 4KP4A 5B1AC 3LSUA 4BIZA 1SA0A 5C8YA 1M57B 4TWKA 2ZT9B 2X0LA 2ITDC 1M57C 4DR2O 2CGOA 4PDVA 3B40A 2DMXA 1CEZA 2WSSG 4I4TA 3CCLV 1IXMA 4GEUA 3F7YC 5LOVB 4I55B 3QO5A 1H2KA 4PDMA 1KKCA 4LF4B 4LF5O 5B5EZ 1WA8B 4TUYB 3UM7A 2QM7A 2ZDIC 4QE9A 4HNAA 4JYYA 3T1YO 2DWEC 3N2KA 5KUMA 1H2LA 2F1MA 3Q0XA 4PA3A 5IYZA 4PA9A 4NXMO 2JVDA 1N33O 3JARB 3P30A 1Y74A 5L3BA 4DRXA 3STZC 4D6TH 5CB4A 3T1HB 1O9GA 1G6UA 4EFEA 2Q4PA 1XNQO 5F2VO 4FM1A 4B7EA 1QCEA 3JD3A 4RWUA 5LMUO 3THOA 5FLXN 4JI2O 4MTOA 1N0NA 1KYOF 5JJJB 2E76B 1AP6A 4LWSB 4MVRA 2ZQMA 2ZKOA 2F95B 3A8TA 2VQFB 4FFBA 3AG4B 4J80A 1KP3A 3OD4A 4KXRA 3RYIA 1TGOA 1J5EB 2V7QG 4K8ZA 5JCOC 2PTMA 3AG7A 1F51A 3ABTA 4MTXA 3P32A 2Y48A 2GDSA 1WNSA 2KQXA 3I55V 2E5LB 1H8EG 2OTJV 2DE0X 1NU1H 4TSFG 4U7NA 3T4DA 3SPGA 5LXTA 1HNWO 2K1EA 3QF7A 2WLNA 2ZIOA 4AHCA 1IBKO 2RN9A 4K8XA 2UUCO 2G38A 1Y76B 3K9SA 2LW1A 4OPHA 2ZIMA 3TCUA 1ROPA 1QVGU 2UXDO 3NXSA 3CSXA 4NTWA 2IJHA 1NS1A 3ZIAG 1ZL8B 3ZMUA 2QJ1A 3ZMZA 1I94B 3S3XA 3G6BA 1XNQB 1HWYA 5CBHA 1QHTA 2Q73A 4L8JA 2PGGA 3LUTB 4I9WA 5BMVA 2WAMA 4OX9O 2RQ6A 1NBMG 1JX9A 3ZN0A 5FNVB 5BY1A 2EILB 2Z0AA 3JD1A 4O4JB 2PUSA 1SQQH 2EILC 2ZXWC 3OTOB 1MNGA 1GM9A 1PP9H 1VQ7V 2OIEA 2CTPA 5JH7B 4JV5O 4LF8O 3CB2A 4HZ3A 3IGAC 1W2BU 2CDYA 4XDLA 2E75B 3C3SA 3MUDA 1NQTA 4QJFB 3ZRXA 4H37A 5IJ0B 2BE3A 4LF9O 2GUZA 2XAJA 4D7SA 3MAQA 2HVJC 3L74H 5JVDB 2JS5A 4ZHQB 2Q0OC 3L71H 3VQYA 3ZMVA 1FXKB 4DR3B 1FXKC 4FM2A 2YXLA 2LO1A 2A7WA 1V54B 5J2UA 3SYOA 4LFBB 4JAVA 4QGPA 1KP2A 1IVSA 4LFAO 4N21A 1MZEA 1G1XB 1YXBA 2AHZA 3FB6C 4O4LB 2IBZH 4JI3B 4GZRB 1YI2V 5LHIA 3B8NA 1SKVA 3VQWA 3OM3B 2ZE8A 2ZNIA 4OX9B 2JK5C 2Y0IA 5CMUA 4I50B 1BCCH 2DYRC 3AK2A 2YI8A 1WJZA 3L73H 1P84F 2EBOA 2RDCA 1WLEA 4TQDA 3SJQC 4DYLA 3RBZA 1VQNV 4KUMA 3LSSA 5EZYA 3WB1A 1JVMA 3ABKB 3BAAA 4JI4B 2FMLA 4X89A 4ZKIA 1I5XA 2WLHA 4I9QA 2ARHA 1Y4MA 5KHJA 1XHXA 2W0FC 3UKMA 5IWAB 3EHBB 3ZMTA 4YIOA 2GHYA 1YJWV 3F5WC 5GONB 4O2AA 2JEUA 4ZI7A 4GFCA 4DW0A 4QE7A 4JI6B 3LNMB 4CKNA 4PA6A 1YITV 2QWPB 1YTFB 4X88A 3D36C 4UV9A 3J81N 2IW5A 5K1PA 2FKXA 3CCUV 1NTKH 5JQGA 1A32A 3DC6A 2Q8VA 3JCZA 3ZHTA 2XAGA 5L3CA 3ABLB 2OT5A 4GKJB 2PY5A 1XDCA 4DV6B 1XNRB 5H6RA 1AP5A 4AQYB 3P3NA 1SZXA 1DGSA 3K0GA 1MZFA 4B3MB 2QGNA 2A0LA 1WP7A 4KHPO 4LC1A 5EC2C 4K35A 4Z1MG 5EBLC 5AG2A 2EIMB 2QKAA 3L75H 2EIMC 1V55C 3FKSG 3RVZA 4X1KB 1EBOA 1IBMO 4UFZA 2DOSA 4FLYA 1WB7A 4CS2A 1IDSA 1GN6A 1KMIZ 1AJPA 1S3JA 2Z5UA 3VOUA 1PL4A 3ASOC 4R7CA 5LOVA 4I55A 3GWKC 1BGYH 4J7KA 5CJ4A 1WA8A 4TUYA 3CMAV 2HFEC 4BW9A 1FFTB 1GO3F 2ZDIA 3CRRA 3JAMN 3J80N 1FPOA 1H8HG 1HW7A 3JD0A 3QO7A 4WFGA 2R9RB 3OE7G 1H2NA 4P2ZA 3A0RA 4R50A 1LNQA 4GT1A 5KAFZ 4FLUA 4DR6O 4TV9B 3FB8C 5K1XA 3RWRA 1P7GA 4IHJB 1X59A 4MS2A 4N23A 4UCVA 1HNXB 4DV1B 2X6AA 3JARA 3GVMA 3U10A 4FLTA 2YICA 2CH7B 5JJNB 1NR1A 5KUKA 1SQGA 4YJ3B 4JZGA 4JZ2A 5IY5B 5IY5C 4NXNO 3G71V 2L6LA 4FM0A 2DYSC 3RYFB 1VF6C 5LGNA 4TV8B 3KZIZ 5KHGA 4LWSA 2P4VA 3O65A 1R1BA 1NVPB 1F4MA 1PV0A 4DV0B 2QWNB 3K9AA 1N32O 4XBFA 2D2CB 3ETEA 1VQ8V 5IYDO 5JCOA 1IX9A 2QM8A 1QLEC 2LFRA 1OCCB 2JGDB 2IH1C 3ICXA 2P7TC 1OCCC 2IJKA 2OCCB 1TUBB 2AXTZ 2OCCC 4JI8B 1BSMA 1Y76A 2DQ3A 5FPOA 5KMGB 2UUBB 4E2LA 4JI0B 4LR3A 4DV4B 5LGTA 3JSNA 2LW7A 1VQMV 3P3PA 4KL1A 2PI5A 2XAHA 1GMGA 3BVOA 1ZL8A 4WFBV 1NKDA 1CXZB 1PM9A 3TGUH 3M8AA 3SPIA 5C93A 3N27A 4YHHO 3MD0A 1T5EA 3BA8A 3CCRV 4TT3G 5JWPA 1KBHA 4DR5B 5FNVA 1EFRG 3ZBHA 4O4JA 1KECA 1P49A 2LP7A 4BAYA 3SPCA 3UO3A 3JYCA 2DWDC 5L3GA 1MMMA 4PA4A 1NZ6A 4DV3O 3E35A 4WCEV 3E83A 3EFFK 4DW1A 3ZN1A 5IE9A 1L8DA 5KAIZ 1NI8A 4GCZA 3L9DA 2AW9A 2DQ0A 4NKGB 4RAIA 2QA4V 4CS4A 2VS0A 1K3EA 3CE2A 4PJ0Z 4LF7B 2ZINA 4K0KO 5IJ0A 4FMTA 2BTOA 5A9GA 2AZ2A 2YIDA 4MSWC 4JGSA 2NLJC 5HFLA 2PF4E 4R8CA 4DUYO 5JVDA 4J7JA 4LH6A 3LNNA 3FAVA 4CH3A 2EX3A 3JCUZ 4ZHQA 1FXKA 4JAUA 1K5SA 4FPPA 1S77D 3TXQA 1OCOB 1ORQC 4LFCB 5KA6A 1IXBA 3K79A 2F4VB 2KG7B 4R6ZA 2XAQA 2ZR3A 1B3QA 4JYBA 1GK9A 4O4LA 5CA3A 3PYIA 2GTSA 4X66O 2RNBA 1B04A 3AG1B 3ETQA 2IH3C 3SJAC 3D3IA 1GTOA 3AG1C 4YJ2B 5CN0A 1SRYA 1R3IC 2PI4A 4I50A 2Y0PA 1OV9A 1QNMA 4GEXA 5CBGA 1S5LZ 3NR7A 4DV2B 2VQEB 4YY3B 3K5NA 4GKKB 3SYCA 2QKSA 4J9YB 4QIWF 1Q81W 4FFKA 5A2QN 1KUQA 1FU1A 4UV8A 4CC5A 1L1FA 1PL0A 1BMFG 4B7KA 4O4IB 1US6A 1XL4A 1WB8A 2HP8A 2ZR2A 1G8MA 2FTKA 4JI5O 1S5JA 1N34O 4XA4A 1YSCA 3BCCH 3K58A 5GONA 2WA4A 4DUYB 2CE4A 1RPOA 5LMNO 2YUAA 1KB9F 3DC5A 3RYHB 1HNZO 3D36A 4X1IB 1JCHA 1KQSU 4AI8A 3ZEDA 1JMKC 4LF6O 4GX1A 4DR2B 1RM1B 1JA8A 1VQ5V 1Q5OA 2P6JA 5B1OA 3AG4C 1PD3A 3VBBA 4X20B 1YTFD 1YCIA 1QU7A 3Q0YA 4PD4F 4PDRA 2ZNJA 4B3RO 5GTHZ 3OR6C 3OEHG 4LF5B 4PDLA 1O9HA 4UVCA 3UQ8A 1OCZB 4PHZA 2FL4A 1OCZC 3W7XA 1U97A 2A9HA 1DF4A 3T1YB 2EULA 4Z2WA 1WP8A 1K73W 4W4KA 4F4LA 1R73A 3ASNB 4X1KA 5ITZB 2CUGA 1DF5A 2XAFA 3ASNC 4NXMB 1GN2A 1N33B 1JFFB 2DJVA 3CCMV 1K8AW 4GUNA 3O9OA 2PYJA 1JJOA 2IJJA 1S0VA 3FYIB 2GV9A 1G4YB 5J9PC 4UB8Z 4DK1A 2UUAO 1HR0O 3II6A 3E89A 3CCQV 3ZRWB 4H44B 5LMUB 4JI2B 4EEQA 2ZM6O 4PA7A 1TAEA 5BR8O 4X65O 1Y66A 1RSOB 4DO2A 1VF7A 4TV9A 2VRZA 4IHJA 5KX5B 4X64O 3SJCC 3E86A 2CTWA 3KCYA 1MOFA 2CH7A 2NN4A 4RQEA 3OUFA 1AI4A 2R9IA 3G4SV 3KCXA 4YJ3A 1R3JC 1P7BA 5BZBA 2HR3A 1FYJA 1L0LH 1I0HA 1HNWB 3E8FA 2WA3A 2WLKA 4TOIA 5CBFA 1IBKB 1VF6A 2B9ZA 1CP9A 1GM8A 1N8RW 3RYFA 1VQLV 4TV8A 2VWJA 2UUCB 1M90W 3OTFA 4J7ZA 2Q5ZA 3H1JH 4WFHA 4I0XB 4B08A 4DR4O 1IZ3A 1I08A 1EZJA 2UXDB 3OAAG 2HHHO 4F6EA 4X9QA 1V54C 2V1DA 3N2GA 1SZTA 1NVPD 1GN4A 1EN4A 3SPJA 1RP3B 4OGQB 2ZE5A 2JGDA 2KKWA 2JGUA 1SF9A 4JYCA 1M5IA 4ABMA 4GYCB 3RVYA 4DV5O 3BABA 4JYAO 2LGQA 3AK1A 1TUBA 2CK3G 4JTAB 3A2FA 4RO2A 2Q7GA 2GBOA 3CMEV 3CP1A 1SQPH 4DR7O 2P67A 4J11A 1GKFA 1S72V 2QKCA 1YJ9V 5KMGA 3GB7C 2YSUB 2Q0AA 2X7RB 2HKOA 1Q6HA 1XL6A 4JV5B 4DV7O 4JTDB 4LF8B 3ABKC 4P9PA 3RYCB 2BTQB 4A5UB 1YVWA 3CXHF 1FJGO 1U96A 1Q8IA 5DEDA 5CJ0A 4IIJA 1UFIA 1VQPV 1HP8A 2AZ0A 4LF9B 4K3AA 4UCTA 1AR4A 5EYPB 4HAMA 2D3OW 3I5DA 3HB3B 2HEPA 1SQFA 1AI7A 1R6NA 3LDCA 2YIAA 4MW8A 1QBZA 3CJHB 4I7ZB 3GWOA 4B3TO 2KSDA 2NR5A 2B1GA 1TUEB 4J41A 4Q20A 4NTXA 3QVNA 1JPXA 1YZBA 4MTGA 4MVMA 1OCRB 4QPKA 3R66A 2WLIB 4LFAB 5KA5A 1OCRC 3B2EE 5IT9N 4G2KA 2XHBA 2YIBD 3CC2V 3IAYA 1GM7A 5FL7G 2Q7HA 2P06A 3ABLC 3JD2A 2JIZG 2IU3A 1PNLA 3OMNB 5CA0B 1XMOO 4FZ1A 1N36O 4CH4A 2OYQA 1THZA 4DR1O 3IFXA 1X4TA 3T1CA 5CA1B 5EC1C 3RYIB 1W59A 3LDEA 3QO8A 2M6YA 2NNUA 3H1LH 1BS3A 2OWOA 4X1YB 1FFXB 1AR5A 3JALB 4IGGA 5L3FA 2KG7A 1FJGB 2GTAA 4HYOA 2H3OA 3F7VC 4GFAA 1GRJA 2HG5C 1Q86W 2Q67A 1YHQV 4ZBMA 2A3QA 3AG2B 5L3EA 4ASUG 3AG2C 3QG5A 4YJ2A 4HBNA 2EIKB 4GX2A 5L3DA 2EIKC 3ZMSA 2UXCO 3U0ZA 1SC5B 4PI2A 2OCHA 2UXBO 3JAKB 4LP8A 1VP7A 1XMQO 2CGNA 2YI9A 4O4IA 3IC9A 4NB5A 1QLNA 4O4HB 2AGAA 3K5MA 3FB5C 1DLBA 3FYEB 3SYQA 5FPRA 3E8HA 1Y67A 1NH2B 4B3SO 3CRQA 4KHPB 4DUZO 3A0BZ 4PI0A 4EB6B 5B66Z 1AI5A 1S5HC 3RYHA 4X1IA 3AG3B 3JD4A 4J10A 2UU9O 1IBMB 5LHGA 1OJHA 4UB6Z 2XUMA 4X20A 1BQ0A 1IBLO 3G67A 3HPLC 1Q43A 3H9VA 1OHHG 4GX5A 4JI1O 4OPAA 4FJCC 4FZ0A 4QPJA 3ZX6A 3TETA 1EM1A 3C90A 3OGIB 4WF9V 4X62O 2JRIA 3FB7C 4IL6Z 2A06H 4YIPA 4RUFA 1GH6A 3JAWB 2QR4A 3FFQA 1VQOV 4DR6B 2LGWA 3ZS8C 1XILA 3G6EV 4J42A 4MTFA 4LNUB 1XBLA 5ITZA 1XI1A 2P22C 1R6TA 3SGIA 4JI7O 2WLLB 2Q68A 2JJ2G 2B5UA 2QDOA 4U3JB 2RMKB 2ETNA 4B3SB 4NXNB 2Q69A 3DGEA 3BFRA 1LUVA 1LUWA 3ZRWA 2QEXV 2LJ2A 3CWBH 3SR2C 1M1KW 4IYHA 3MHHC 2ILMA 5LL6Y 2PYLA 1FD9A 3CRAA 1D5AA 2BSKB 1H2MA 1K4CC 1RSOA 2IU0A 2EJRA 1VF5B 1I5YA 2E74B 4ZOLB 1FXHA 5KX5A 2JDIG 3CCSV 4JF3A 1E79G 1N32B 1ZWIC 5JH7A 1D5NA 3ZHUA 4J9ZB 4LF4O 3JATB 3CC7V 1B6QA 2XASA 2Y4UA 2QE7G 3K03A 1XREA 1EZVH 4XDJA 4IYIA 1CPYA 1OZ0A 4ICGA 1B06A 4DXWA 5KHKA 1VARA 3ZRVA 3OUSA 3WG7B 1QVFU 4Q6GA 4PV1B 3WG7C 4G28B 4JTCB 3ML0A 4I0XA 2ZE7A 1Q7YW 1OCOC 5LP6B 2YEVB 3T1HO 1R6KA 3U11A 5LP6C 4FLXA 2CTRA 5HFMA 3EVKA 1K5QA 2IM9A 3UO2A 3TJTA 1NT2B 1H38A 1M56B 4JASA 1SQXH 1PNKA 1M56C 4OXSA 3HKEB 4YHHB 2OIGA 2Y69B 4YXWG 3HKBB 2Y69C 4QNHB 2VQFO 1BT8A 1ENVA 2R9AA 1W0JG 3B8MA 3ETGA 3CYOA 1J5EO 4CZZA 5LGUA 4DV3B 1FAFA 2XT9A 1KC8W 3J7AU 3E22B 3K5OA 3RYCA 2E5LO 2BTQA 4FLWA 3TXSA 3X2QB
chains in the Genus database with same CATH topology
3SJBC 4CS3A 4B3MB 2QM4A 1ZAUA 4UCSA 4K0KB 1HNWB 1M93A 4TOIA 3JASB 5EIBC 5EYPA 1IBKB 1M4UA 3RYFA 4DUZB 4TV8A 2VWJA 2UUCB 5KHHA 3M7MX 3OTFA 5EZYB 4FLVA 4O2BB 3BA9A 3BRCA 4B08A 4X1KB 3K57A 4UFZA 2UXDB 4FLYA 4CS2A 1KMIZ 2R70A 2UU9B 2ZCEA 5J2TB 3N2GA 4IIJB 3HKCA 3WB2A 2F93B 1KU9A 3K59A 1XQ8A 1IBLB 5LOVA 4I55A 4DK0A 4O2AB 4ZI7B 5CJ4A 2KKWA 2JGUA 1TVKA 4JI1B 5CA0A 4X66B 5LYJA 1M5IA 4TUYA 4GYCB 4BW9A 4AILC 5LA6B 3BABA 4X62B 4WBNA 3HKDB 1HW7A 1TUBA 3A2FA 2P5OA 2Q7GA 5CA1A 5IJ9B 1JFFA 4FLUA 4TV9B 5JQGB 5K1XA 3RWRA 4IHJB 4UCVA 5KMGA 1HNXB 2Q0AA 4DV1B 4UCRA 4CC6A 4X1YA 4JV5B 4LF8B 3JARA 3U10A 4FLTA 1FFXA 4F6RA 3RYCB 5JJNB 2BTQB 3JALA 2E3CA 5JJEB 5D5QA 4JI7B 3CHXA 1SQGA 4YJ3B 1Q8IA 5KHIA 5CJ0A 4IIJA 2VWKA 4JI5B 3UT5A 4CH5A 1N34B 4LF9B 3BPZA 1IK9A 4UCTA 4FM0A 5EYPB 2CAZC 3RYFB 4TV8B 2F66C 2HEPA 1SQFA 5LMNB 1SA0A 5C8YA 5KHGA 1HNZB 2YIAA 1YEWA 4DV0B 4LF6B 5D5PA 4I4TA 4LFAB 3JAKA 3B2EE 5JCOA 3HKCB 2XHBA 3VQXA 2YIBD 1V9PA 5LOVB 4I55B 3IAYA 4O4HA 2Q7HA 4B3RB 4LF4B 5CHXA 1TVKB 3ICXA 5CA0B 5LYJB 4TUYB 4WBNB 4CH4A 2OYQA 1TUBB 4HNAA 4JI8B 1X4TA 5CA1B 4TQFA 3RYIB 4EB6A 3N2KA 5FPOA 2F1MA 5KMGB 2UUBB 2OWOA 5IYZA 4X1YB 4JI0B 4LR3A 2JVDA 4DV4B 2R72A 3JARB 1FFXB 3JSNA 4F6RB 4KL1A 3JALB 4DRXA 5CB4A 1FJGB 3T1HB 1O9GA 3PN1A 2V4DA 1G6UA 4EFEA 3UT5B 2PZSA 3RGBA 4FM1A 1HR0B 2UUAB 3THOA 4FLZA 3QG5A 4YJ2A 1T5EA 3BA8A 4HBNA 1SA0B 5C8YB 5JJJB 2F95B 2ZM6B 4DR5B 5FNVA 2VQFB 4FFBA 5BR8B 4O4JA 1P49A 4X65B 3U0ZA 4I4TB 3JAWA 4PI2A 3RYIA 1TGOA 1J5EB 3JAKB 4K8ZA 4LNUA 4X64B 5JCOC 2PTMA 2YI9A 4O4IA 1L8DA 4O4HB 3K5MA 1WNSA 2RJZA 3QTCA 2E5LB 4CS4A 4U3JA 5FPRA 4LF7B 2ZINA 4UCOA 5IJ0A 5LXTA 2BTOA 3QF7A 2ZIOA 4AHCA 4K8XA 4HNAB 4KHPB 5JVDA 3SR2A 4LH6A 3LNNA 4PI0A 4CH3A 2EX3A 1H2SB 4ZHQA 4EB6B 3N2KB 3RYHA 4X1IA 2ZIMA 5EIBD 5IYZB 2YIBA 4LFCB 4DR4B 1IBMB 4ZOLA 3CSXA 4DRXB 2F4VB 5CB4B 2HHHB 4X20A 2QJ1A 1Z5WA 1I94B 4O4LA 1Q43A 1XNQB 1QHTA 3JATA 4L8JA 2PGGA 1B04A 3ETQA 3SJAC 5BMVA 4YJ2B 1Z5VA 4I50A 2RQ6A 4DV5B 4JYAB 5FNVB 4FFBB 3VQVA 4DV2B 1WN7A 2VQEB 4YY3B 4O4JB 2PUSA 3K5NA 4GKKB 3K5LA 3JAWB 3OTOB 1FU1A 3FFQA 4DR7B 4DR6B 3ZS8C 1QQCA 4CC5A 1I7FA 5JH7B 4LNUB 3CB2A 5ITZA 4O4IB 1XI1A 2P22C 4DV7B 3MUDA 3SGIA 5LP6A 4LH7A 4GLXA 4U3JB 1S5JA 5IJ0B 4ZIBA 5LXTB 4XA4A 4B3SB 4NXNB 4D7SA 3MAQA 3K58A 5GONA 4DUYB 3RFRA 5JVDB 2JS5A 3HKEA 4ZHQB 4FVMA 3SR2C 3VQYA 3RYHB 3HKBA 4X1IB 4DR3B 4FM2A 3ZEDA 1JMKC 2YXLA 2PYLA 4DR2B 1D5AA 1RSOA 1Q5OA 5J2UA 4B3TB 4LFBB 4ZOLB 5KX5A 4CH6A 4X20B 1N32B 5JH7A 4O4LB 3E22A 2ZNJA 4JI3B 1SKVA 3VQWA 3JATB 5BMVB 4LF5B 2ZNIA 4OX9B 1O9HA 3UQ8A 4I50B 4PHZA 1XMOB 1N36B 2YI8A 3JASA 4DR1B 1TA8A 5KHKA 4UCUA 4TQDA 3T1YB 4Q6GA 5EZYA 4O2BA 3WB1A 3BAAA 4JI4B 4X1KA 5ITZB 3JSLA 2Q7EA 1Q3EA 4NXMB 4I9QA 1N33B 5KHJA 1JFFB 3RWRD 5LP6B 1XHXA 2PYJA 3U11A 1JJOA 5LP6C 5J2TA 4FLXA 2GV9A 5IWAB 2IM9A 4DK1A 4NVPA 3II6A 1NT2B 1WPBA 5GONB 4O2AA 4ZI7A 4JI6B 3HKEB 4BWAA 4YHHB 5LMUB 1XHZA 4JI2B 1DGSA 3HKBB 4EEQA 5LA6A 3HKDA 1TAEA 3WB0A 3DSQA 5J2UB 5IJ9A 2R9AA 5K1PA 1VF7A 4TV9A 5JQGA 3N2GB 2UXCB 4IHJA 5KX5B 3SJCC 4EFBA 2UXBB 4DV3B 1XMQB 4GKJB 3E22B 2PY5A 3K5OA 3RYCA 4DV6B 2BTQA 4FLWA 1XNRB 4AQYB 3BHPA 4YJ3A 4D7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IK9 A;  3RWR D;  4XA4 A;  5CJ0 A;  5CHX A;  1M5I A;  1KU9 A;  3MUD A;  2QM4 A;  1FU1 A;  3SR2 C;  3II6 A;  2R9A A;  3RWR A;  5CJ4 A;  3SR2 A; 
#chains in the Genus database with same CATH topology
 2XOK G;  3X2Q C;  3EXA A;  4CS3 A;  2ZE6 A;  3APQ A;  2ATK C;  1AR1 B;  2QM4 A;  2P4K A;  1VQK V;  4UCS A;  4K0K B;  4BIO A;  3ZJZ A;  1M93 A;  3JAS B;  5EYP A;  1VQ4 V;  1M4U A;  3CD6 V;  2MK3 A;  2BOB C;  5KHH A;  3CCJ V;  3RN4 A;  3M7M X;  5EBW C;  1GN3 A;  1MAB G;  1Q82 W;  4O2B B;  3BRC A;  3CJH A;  2X6B A;  3ZHV A;  3K57 A;  1GAX A;  1RM1 C;  1R3L C;  1XUQ A;  3D8C A;  4P9O A;  5J2T B;  2WLI A;  2N05 A;  1AIL A;  1I94 O;  2F93 B;  1KU9 A;  1NJI W;  5B1B B;  4I5S A;  5DEC A;  3KG2 A;  3OT7 A;  5B1B C;  1F4N A;  3K3W A;  3ZHQ A;  2W0X A;  5CA0 A;  4X66 B;  2Y3W A;  3OFN G;  3CX5 F;  4AIL C;  5LA6 B;  3SYA A;  3CEI A;  4JAA A;  3OR7 C;  4U3F H;  3HKD B;  5DN6 G;  3PJS K;  1BHA A;  1RPR A;  5CA1 A;  5IJ9 B;  3OEE G;  1JR9 A;  3OTO O;  4MVO A;  4Z1V A;  2Z3Y A;  2XND G;  3E8G A;  5H9C A;  4UCR A;  4X1Y A;  4MVZ A;  5IDJ A;  2OTL V;  2QWQ B;  1FFX A;  4RQF A;  3JAL A;  2E3C A;  3WU2 Z;  3CHX A;  4GX0 A;  3AK3 A;  2KB1 A;  2VWK A;  4JI5 B;  1FXV A;  4CH5 A;  4UXN A;  1N34 B;  4P30 A;  3E8B A;  2HJD A;  3BPZ A;  5IYB O;  3CCV V;  2UXX A;  4JPR A;  2F66 C;  5LMN B;  4DR3 O;  5H5N A;  1HNZ B;  1ZSP A;  3B09 A;  3APO A;  1YEW A;  4LFB O;  4LF6 B;  1YJN V;  4MT8 A;  5D5P A;  2ADQ B;  3ABU A;  3DXR B;  3JAK A;  3HKC B;  1BZK A;  4JI3 O;  3VQX A;  1V9P A;  2F23 A;  4O4H A;  4B3R B;  1XEQ A;  1DTO A;  1DK1 A;  1D2D A;  1EN6 A;  5CHX A;  1PNM A;  1TVK B;  4WFA V;  5LYJ B;  2EZO A;  1LR1 A;  4WBN B;  3E2E A;  4H33 A;  2ZXW B;  3I56 V;  3TK1 A;  4RUE A;  4TQF A;  1SET A;  4EB6 A;  1COW G;  1WPX A;  4JI4 O;  1WAZ A;  4FK5 C;  1BE3 H;  1AJN A;  3Q4H B;  4G27 B;  1NH2 D;  1SS3 A;  2R72 A;  2F43 G;  4F6R B;  2QWO B;  1MSW D;  3CRC A;  3H1H H;  5E79 Z;  2HVK C;  1UPG A;  5IWA O;  3L72 H;  3CRM A;  3PN1 A;  1F23 A;  2BOC C;  4WFE A;  2V4D A;  3UT5 B;  2PZS A;  3RGB A;  1HR0 B;  2UUA B;  4JI6 O;  3FAV B;  1JJ2 U;  3C3T A;  4FLZ A;  5BXZ A;  4BR6 A;  2JJ1 G;  1SA0 B;  5C8Y B;  1AI6 A;  2ZM6 B;  1FKA O;  5BR8 B;  4E4E A;  5H2F Z;  1SQB H;  4X65 B;  3M99 B;  4I4T B;  3JAW A;  1YF2 A;  4U7O A;  4BW5 A;  4LNU A;  4W4L A;  4X64 B;  3W7S A;  1K97 A;  4CKM A;  3OMA B;  4GKJ O;  3ZHS A;  4DV6 O;  1XNR O;  2QSA A;  4AQY O;  3LSQ A;  2RJZ A;  3QTC A;  2WLL A;  1KKD A;  2DYR B;  3H1K H;  3ABM B;  4B3M O;  1E1Q G;  3ABM C;  1YDX A;  4U3J A;  3HR0 A;  5H6Q A;  4UCO A;  5LBQ A;  4IT5 A;  2X6C A;  2O57 A;  4HNA B;  4MW3 A;  3SR2 A;  1H2S B;  1MA1 A;  3LDD A;  1BQZ A;  3N2K B;  2Y4T A;  1ZX3 A;  2WWW A;  3OGC C;  2P90 A;  2YDE A;  2LQT A;  3QNE A;  2FB5 A;  5EIB D;  5IYZ B;  2QWR B;  2YIB A;  2BSK A;  4DR4 B;  2JEX A;  2MW2 B;  1Y74 B;  1Z2G A;  2N04 A;  3CS5 A;  4ZOL A;  4DRX B;  2Y3V A;  5CB4 B;  2HHH B;  5IYC O;  1Z5W A;  1FS0 G;  2ODM A;  1Y6X A;  2Q9L A;  3JAT A;  1PKX A;  3CCE V;  1K92 A;  1Z5V A;  4DV5 B;  2YC0 A;  4JYA B;  4FFB B;  3VQV A;  1WN7 A;  3UCS C;  3SYP A;  4UUJ C;  4MVQ A;  3MDS A;  1URF A;  3K5L A;  1AVM A;  1VQ9 V;  4DR7 B;  1HNX O;  1QQC A;  3OW2 U;  4DV1 O;  2ADP A;  1K4D C;  1I7F A;  3H01 A;  1W0K G;  1QR8 A;  1JOY A;  5GW7 A;  1SER A;  1VQ6 V;  4DV7 B;  2LFS A;  4G79 A;  3K0D A;  3S3W A;  5LP6 A;  2YEV A;  4LH7 A;  1UJW B;  1IUR A;  4GLX A;  2Q6A A;  1BL8 A;  2M7W A;  4ZIB A;  5LXT B;  2XTA A;  3RT3 C;  4KFM A;  1N0J A;  3RFR A;  3CC4 V;  4PEL A;  3HKE A;  1V55 B;  4FVM A;  1Q90 D;  3HKB A;  2W6I G;  4DV0 O;  3H1I H;  1Q6I A;  4B3T B;  2WPD G;  4CBC A;  1NTZ H;  2EIN B;  1N4C A;  2EIN C;  2IJI A;  2HJF C;  2YS8 A;  3ASO B;  3BY6 A;  1R3K C;  2QTS A;  3IC7 A;  4CH6 A;  1NTM H;  2UXN A;  2FYU H;  3T4Z A;  4CKP A;  4MVS A;  3E22 A;  4FIP C;  2DN9 A;  5BMV B;  3T2M A;  3AEI A;  3L70 H;  5EBM C;  1XMO B;  1N36 B;  4JI8 O;  3STL C;  3ETD A;  3JAS A;  5DM6 V;  1M9N A;  3W7W A;  4DR1 B;  1TA8 A;  1K34 A;  2DW4 A;  4UCU A;  1Q6U A;  1E1R G;  2UUB O;  1JQ0 A;  4JI0 O;  1K9M W;  4O2B A;  3SDL A;  3G80 A;  2H8P C;  4DV4 O;  2AHY A;  3JSL A;  2Q7E A;  1Q3E A;  3RWR D;  3AG3 C;  3K04 A;  2BCC H;  5J2T A;  4WFF A;  2EJ7 A;  3FD9 A;  1ZTE A;  4NVP A;  3A0H Z;  2DYS B;  3BEH A;  2GUZ B;  1WPB A;  3B77 A;  4BWA A;  2YXH A;  1XHZ A;  3K06 A;  1S76 D;  5LA6 A;  4DR5 O;  2H94 A;  3HKD A;  3FX7 A;  2HLD G;  4NYK A;  1ZLZ A;  2CTQ A;  1L0N H;  3RW0 A;  1VMG A;  1QR9 A;  3WB0 A;  3DSQ A;  5J2U B;  5IJ9 A;  3N2G B;  2UXC B;  1BHB A;  1AB3 A;  3B4S A;  4EFB A;  2UXB B;  1QLE B;  2W6J G;  1XMQ B;  5EK0 A;  4BIU A;  3DTU B;  1PPJ H;  1KD1 W;  1K33 A;  1H2G A;  1MG1 A;  2ITC C;  1P4R A;  3BHP A;  1XOU A;  1JFF A;  5B1N A;  4LF7 O;  4D7T A;  2EIJ B;  3SJB C;  1K7D A;  2EIJ C;  1VIB A;  1ZAU A;  4X8A A;  3SPH A;  3D3Q A;  2C2A A;  4L87 A;  5EIB C;  4LBE C;  4DUZ B;  2EZP A;  4H13 B;  2QTO A;  1SES A;  1J95 A;  2K9P A;  5EZY B;  4FLV A;  4C7U A;  4LFC O;  3BA9 A;  3WFV A;  3ZRS A;  3F5T A;  2L35 A;  4EKW A;  2F4V O;  3CPW U;  1F7Y A;  2R70 A;  2UU9 B;  2ZCE A;  3DXR A;  1AJQ A;  1YIJ V;  5TIS Z;  4IIJ B;  3HKC A;  3R65 A;  3WB2 A;  3K59 A;  1VEW A;  1XQ8 A;  1IBL B;  3ZCC A;  3K08 A;  4DK0 A;  2GSM B;  4O2A B;  2WLJ A;  4ZI7 B;  1TVK A;  2ZD9 A;  4JI1 B;  5LYJ A;  5B3S B;  5B3S C;  4X62 B;  4UVB A;  3IJ4 A;  4WBN A;  3ZHR A;  4DV2 O;  1NR7 A;  4NTY A;  2VQE O;  4YY3 O;  3OMI B;  4MVU A;  2YXY A;  2P5O A;  4GKK O;  4LCU C;  1ARO P;  4XDK A;  5JQG B;  1HDJ A;  2WLM A;  1RFY A;  2A79 B;  2N74 A;  1EN5 A;  4H0L B;  3W7T A;  3CXC U;  4CC6 A;  3Q4H A;  1SQV H;  4F6R A;  5E1A C;  4UVA A;  5JJE B;  5D5Q A;  4JI7 B;  1ZUQ A;  2JS3 A;  3KKY A;  5KHI A;  3UT5 A;  5KLV H;  2B1I A;  2RCV A;  1MSD A;  1IK9 A;  3MHS C;  3W7U A;  5B1A B;  5GTI Z;  4NR1 A;  2CAZ C;  5LHH A;  4KP4 A;  5B1A C;  3LSU A;  4BIZ A;  1SA0 A;  5C8Y A;  1M57 B;  4TWK A;  2ZT9 B;  2X0L A;  2ITD C;  1M57 C;  4DR2 O;  2CGO A;  4PDV A;  3B40 A;  2DMX A;  1CEZ A;  2WSS G;  4I4T A;  3CCL V;  1IXM A;  4GEU A;  3F7Y C;  5LOV B;  4I55 B;  3QO5 A;  1H2K A;  4PDM A;  1KKC A;  4LF4 B;  4LF5 O;  5B5E Z;  1WA8 B;  4TUY B;  3UM7 A;  2QM7 A;  2ZDI C;  4QE9 A;  4HNA A;  4JYY A;  3T1Y O;  2DWE C;  3N2K A;  5KUM A;  1H2L A;  2F1M A;  3Q0X A;  4PA3 A;  5IYZ A;  4PA9 A;  4NXM O;  2JVD A;  1N33 O;  3JAR B;  3P30 A;  1Y74 A;  5L3B A;  4DRX A;  3STZ C;  4D6T H;  5CB4 A;  3T1H B;  1O9G A;  1G6U A;  4EFE A;  2Q4P A;  1XNQ O;  5F2V O;  4FM1 A;  4B7E A;  1QCE A;  3JD3 A;  4RWU A;  5LMU O;  3THO A;  5FLX N;  4JI2 O;  4MTO A;  1N0N A;  1KYO F;  5JJJ B;  2E76 B;  1AP6 A;  4LWS B;  4MVR A;  2ZQM A;  2ZKO A;  2F95 B;  3A8T A;  2VQF B;  4FFB A;  3AG4 B;  4J80 A;  1KP3 A;  3OD4 A;  4KXR A;  3RYI A;  1TGO A;  1J5E B;  2V7Q G;  4K8Z A;  5JCO C;  2PTM A;  3AG7 A;  1F51 A;  3ABT A;  4MTX A;  3P32 A;  2Y48 A;  2GDS A;  1WNS A;  2KQX A;  3I55 V;  2E5L B;  1H8E G;  2OTJ V;  2DE0 X;  1NU1 H;  4TSF G;  4U7N A;  3T4D A;  3SPG A;  5LXT A;  1HNW O;  2K1E A;  3QF7 A;  2WLN A;  2ZIO A;  4AHC A;  1IBK O;  2RN9 A;  4K8X A;  2UUC O;  2G38 A;  1Y76 B;  3K9S A;  2LW1 A;  4OPH A;  2ZIM A;  3TCU A;  1ROP A;  1QVG U;  2UXD O;  3NXS A;  3CSX A;  4NTW A;  2IJH A;  1NS1 A;  3ZIA G;  1ZL8 B;  3ZMU A;  2QJ1 A;  3ZMZ A;  1I94 B;  3S3X A;  3G6B A;  1XNQ B;  1HWY A;  5CBH A;  1QHT A;  2Q73 A;  4L8J A;  2PGG A;  3LUT B;  4I9W A;  5BMV A;  2WAM A;  4OX9 O;  2RQ6 A;  1NBM G;  1JX9 A;  3ZN0 A;  5FNV B;  5BY1 A;  2EIL B;  2Z0A A;  3JD1 A;  4O4J B;  2PUS A;  1SQQ H;  2EIL C;  2ZXW C;  3OTO B;  1MNG A;  1GM9 A;  1PP9 H;  1VQ7 V;  2OIE A;  2CTP A;  5JH7 B;  4JV5 O;  4LF8 O;  3CB2 A;  4HZ3 A;  3IGA C;  1W2B U;  2CDY A;  4XDL A;  2E75 B;  3C3S A;  3MUD A;  1NQT A;  4QJF B;  3ZRX A;  4H37 A;  5IJ0 B;  2BE3 A;  4LF9 O;  2GUZ A;  2XAJ A;  4D7S A;  3MAQ A;  2HVJ C;  3L74 H;  5JVD B;  2JS5 A;  4ZHQ B;  2Q0O C;  3L71 H;  3VQY A;  3ZMV A;  1FXK B;  4DR3 B;  1FXK C;  4FM2 A;  2YXL A;  2LO1 A;  2A7W A;  1V54 B;  5J2U A;  3SYO A;  4LFB B;  4JAV A;  4QGP A;  1KP2 A;  1IVS A;  4LFA O;  4N21 A;  1MZE A;  1G1X B;  1YXB A;  2AHZ A;  3FB6 C;  4O4L B;  2IBZ H;  4JI3 B;  4GZR B;  1YI2 V;  5LHI A;  3B8N A;  1SKV A;  3VQW A;  3OM3 B;  2ZE8 A;  2ZNI A;  4OX9 B;  2JK5 C;  2Y0I A;  5CMU A;  4I50 B;  1BCC H;  2DYR C;  3AK2 A;  2YI8 A;  1WJZ A;  3L73 H;  1P84 F;  2EBO A;  2RDC A;  1WLE A;  4TQD A;  3SJQ C;  4DYL A;  3RBZ A;  1VQN V;  4KUM A;  3LSS A;  5EZY A;  3WB1 A;  1JVM A;  3ABK B;  3BAA A;  4JI4 B;  2FML A;  4X89 A;  4ZKI A;  1I5X A;  2WLH A;  4I9Q A;  2ARH A;  1Y4M A;  5KHJ A;  1XHX A;  2W0F C;  3UKM A;  5IWA B;  3EHB B;  3ZMT A;  4YIO A;  2GHY A;  1YJW V;  3F5W C;  5GON B;  4O2A A;  2JEU A;  4ZI7 A;  4GFC A;  4DW0 A;  4QE7 A;  4JI6 B;  3LNM B;  4CKN A;  4PA6 A;  1YIT V;  2QWP B;  1YTF B;  4X88 A;  3D36 C;  4UV9 A;  3J81 N;  2IW5 A;  5K1P A;  2FKX A;  3CCU V;  1NTK H;  5JQG A;  1A32 A;  3DC6 A;  2Q8V A;  3JCZ A;  3ZHT A;  2XAG A;  5L3C A;  3ABL B;  2OT5 A;  4GKJ B;  2PY5 A;  1XDC A;  4DV6 B;  1XNR B;  5H6R A;  1AP5 A;  4AQY B;  3P3N A;  1SZX A;  1DGS A;  3K0G A;  1MZF A;  4B3M B;  2QGN A;  2A0L A;  1WP7 A;  4KHP O;  4LC1 A;  5EC2 C;  4K35 A;  4Z1M G;  5EBL C;  5AG2 A;  2EIM B;  2QKA A;  3L75 H;  2EIM C;  1V55 C;  3FKS G;  3RVZ A;  4X1K B;  1EBO A;  1IBM O;  4UFZ A;  2DOS A;  4FLY A;  1WB7 A;  4CS2 A;  1IDS A;  1GN6 A;  1KMI Z;  1AJP A;  1S3J A;  2Z5U A;  3VOU A;  1PL4 A;  3ASO C;  4R7C A;  5LOV A;  4I55 A;  3GWK C;  1BGY H;  4J7K A;  5CJ4 A;  1WA8 A;  4TUY A;  3CMA V;  2HFE C;  4BW9 A;  1FFT B;  1GO3 F;  2ZDI A;  3CRR A;  3JAM N;  3J80 N;  1FPO A;  1H8H G;  1HW7 A;  3JD0 A;  3QO7 A;  4WFG A;  2R9R B;  3OE7 G;  1H2N A;  4P2Z A;  3A0R A;  4R50 A;  1LNQ A;  4GT1 A;  5KAF Z;  4FLU A;  4DR6 O;  4TV9 B;  3FB8 C;  5K1X A;  3RWR A;  1P7G A;  4IHJ B;  1X59 A;  4MS2 A;  4N23 A;  4UCV A;  1HNX B;  4DV1 B;  2X6A A;  3JAR A;  3GVM A;  3U10 A;  4FLT A;  2YIC A;  2CH7 B;  5JJN B;  1NR1 A;  5KUK A;  1SQG A;  4YJ3 B;  4JZG A;  4JZ2 A;  5IY5 B;  5IY5 C;  4NXN O;  3G71 V;  2L6L A;  4FM0 A;  2DYS C;  3RYF B;  1VF6 C;  5LGN A;  4TV8 B;  3KZI Z;  5KHG A;  4LWS A;  2P4V A;  3O65 A;  1R1B A;  1NVP B;  1F4M A;  1PV0 A;  4DV0 B;  2QWN B;  3K9A A;  1N32 O;  4XBF A;  2D2C B;  3ETE A;  1VQ8 V;  5IYD O;  5JCO A;  1IX9 A;  2QM8 A;  1QLE C;  2LFR A;  1OCC B;  2JGD B;  2IH1 C;  3ICX A;  2P7T C;  1OCC C;  2IJK A;  2OCC B;  1TUB B;  2AXT Z;  2OCC C;  4JI8 B;  1BSM A;  1Y76 A;  2DQ3 A;  5FPO A;  5KMG B;  2UUB B;  4E2L A;  4JI0 B;  4LR3 A;  4DV4 B;  5LGT A;  3JSN A;  2LW7 A;  1VQM V;  3P3P A;  4KL1 A;  2PI5 A;  2XAH A;  1GMG A;  3BVO A;  1ZL8 A;  4WFB V;  1NKD A;  1CXZ B;  1PM9 A;  3TGU H;  3M8A A;  3SPI A;  5C93 A;  3N27 A;  4YHH O;  3MD0 A;  1T5E A;  3BA8 A;  3CCR V;  4TT3 G;  5JWP A;  1KBH A;  4DR5 B;  5FNV A;  1EFR G;  3ZBH A;  4O4J A;  1KEC A;  1P49 A;  2LP7 A;  4BAY A;  3SPC A;  3UO3 A;  3JYC A;  2DWD C;  5L3G A;  1MMM A;  4PA4 A;  1NZ6 A;  4DV3 O;  3E35 A;  4WCE V;  3E83 A;  3EFF K;  4DW1 A;  3ZN1 A;  5IE9 A;  1L8D A;  5KAI Z;  1NI8 A;  4GCZ A;  3L9D A;  2AW9 A;  2DQ0 A;  4NKG B;  4RAI A;  2QA4 V;  4CS4 A;  2VS0 A;  1K3E A;  3CE2 A;  4PJ0 Z;  4LF7 B;  2ZIN A;  4K0K O;  5IJ0 A;  4FMT A;  2BTO A;  5A9G A;  2AZ2 A;  2YID A;  4MSW C;  4JGS A;  2NLJ C;  5HFL A;  2PF4 E;  4R8C A;  4DUY O;  5JVD A;  4J7J A;  4LH6 A;  3LNN A;  3FAV A;  4CH3 A;  2EX3 A;  3JCU Z;  4ZHQ A;  1FXK A;  4JAU A;  1K5S A;  4FPP A;  1S77 D;  3TXQ A;  1OCO B;  1ORQ C;  4LFC B;  5KA6 A;  1IXB A;  3K79 A;  2F4V B;  2KG7 B;  4R6Z A;  2XAQ A;  2ZR3 A;  1B3Q A;  4JYB A;  1GK9 A;  4O4L A;  5CA3 A;  3PYI A;  2GTS A;  4X66 O;  2RNB A;  1B04 A;  3AG1 B;  3ETQ A;  2IH3 C;  3SJA C;  3D3I A;  1GTO A;  3AG1 C;  4YJ2 B;  5CN0 A;  1SRY A;  1R3I C;  2PI4 A;  4I50 A;  2Y0P A;  1OV9 A;  1QNM A;  4GEX A;  5CBG A;  1S5L Z;  3NR7 A;  4DV2 B;  2VQE B;  4YY3 B;  3K5N A;  4GKK B;  3SYC A;  2QKS A;  4J9Y B;  4QIW F;  1Q81 W;  4FFK A;  5A2Q N;  1KUQ A;  1FU1 A;  4UV8 A;  4CC5 A;  1L1F A;  1PL0 A;  1BMF G;  4B7K A;  4O4I B;  1US6 A;  1XL4 A;  1WB8 A;  2HP8 A;  2ZR2 A;  1G8M A;  2FTK A;  4JI5 O;  1S5J A;  1N34 O;  4XA4 A;  1YSC A;  3BCC H;  3K58 A;  5GON A;  2WA4 A;  4DUY B;  2CE4 A;  1RPO A;  5LMN O;  2YUA A;  1KB9 F;  3DC5 A;  3RYH B;  1HNZ O;  3D36 A;  4X1I B;  1JCH A;  1KQS U;  4AI8 A;  3ZED A;  1JMK C;  4LF6 O;  4GX1 A;  4DR2 B;  1RM1 B;  1JA8 A;  1VQ5 V;  1Q5O A;  2P6J A;  5B1O A;  3AG4 C;  1PD3 A;  3VBB A;  4X20 B;  1YTF D;  1YCI A;  1QU7 A;  3Q0Y A;  4PD4 F;  4PDR A;  2ZNJ A;  4B3R O;  5GTH Z;  3OR6 C;  3OEH G;  4LF5 B;  4PDL A;  1O9H A;  4UVC A;  3UQ8 A;  1OCZ B;  4PHZ A;  2FL4 A;  1OCZ C;  3W7X A;  1U97 A;  2A9H A;  1DF4 A;  3T1Y B;  2EUL A;  4Z2W A;  1WP8 A;  1K73 W;  4W4K A;  4F4L A;  1R73 A;  3ASN B;  4X1K A;  5ITZ B;  2CUG A;  1DF5 A;  2XAF A;  3ASN C;  4NXM B;  1GN2 A;  1N33 B;  1JFF B;  2DJV A;  3CCM V;  1K8A W;  4GUN A;  3O9O A;  2PYJ A;  1JJO A;  2IJJ A;  1S0V A;  3FYI B;  2GV9 A;  1G4Y B;  5J9P C;  4UB8 Z;  4DK1 A;  2UUA O;  1HR0 O;  3II6 A;  3E89 A;  3CCQ V;  3ZRW B;  4H44 B;  5LMU B;  4JI2 B;  4EEQ A;  2ZM6 O;  4PA7 A;  1TAE A;  5BR8 O;  4X65 O;  1Y66 A;  1RSO B;  4DO2 A;  1VF7 A;  4TV9 A;  2VRZ A;  4IHJ A;  5KX5 B;  4X64 O;  3SJC C;  3E86 A;  2CTW A;  3KCY A;  1MOF A;  2CH7 A;  2NN4 A;  4RQE A;  3OUF A;  1AI4 A;  2R9I A;  3G4S V;  3KCX A;  4YJ3 A;  1R3J C;  1P7B A;  5BZB A;  2HR3 A;  1FYJ A;  1L0L H;  1I0H A;  1HNW B;  3E8F A;  2WA3 A;  2WLK A;  4TOI A;  5CBF A;  1IBK B;  1VF6 A;  2B9Z A;  1CP9 A;  1GM8 A;  1N8R W;  3RYF A;  1VQL V;  4TV8 A;  2VWJ A;  2UUC B;  1M90 W;  3OTF A;  4J7Z A;  2Q5Z A;  3H1J H;  4WFH A;  4I0X B;  4B08 A;  4DR4 O;  1IZ3 A;  1I08 A;  1EZJ A;  2UXD B;  3OAA G;  2HHH O;  4F6E A;  4X9Q A;  1V54 C;  2V1D A;  3N2G A;  1SZT A;  1NVP D;  1GN4 A;  1EN4 A;  3SPJ A;  1RP3 B;  4OGQ B;  2ZE5 A;  2JGD A;  2KKW A;  2JGU A;  1SF9 A;  4JYC A;  1M5I A;  4ABM A;  4GYC B;  3RVY A;  4DV5 O;  3BAB A;  4JYA O;  2LGQ A;  3AK1 A;  1TUB A;  2CK3 G;  4JTA B;  3A2F A;  4RO2 A;  2Q7G A;  2GBO A;  3CME V;  3CP1 A;  1SQP H;  4DR7 O;  2P67 A;  4J11 A;  1GKF A;  1S72 V;  2QKC A;  1YJ9 V;  5KMG A;  3GB7 C;  2YSU B;  2Q0A A;  2X7R B;  2HKO A;  1Q6H A;  1XL6 A;  4JV5 B;  4DV7 O;  4JTD B;  4LF8 B;  3ABK C;  4P9P A;  3RYC B;  2BTQ B;  4A5U B;  1YVW A;  3CXH F;  1FJG O;  1U96 A;  1Q8I A;  5DED A;  5CJ0 A;  4IIJ A;  1UFI A;  1VQP V;  1HP8 A;  2AZ0 A;  4LF9 B;  4K3A A;  4UCT A;  1AR4 A;  5EYP B;  4HAM A;  2D3O W;  3I5D A;  3HB3 B;  2HEP A;  1SQF A;  1AI7 A;  1R6N A;  3LDC A;  2YIA A;  4MW8 A;  1QBZ A;  3CJH B;  4I7Z B;  3GWO A;  4B3T O;  2KSD A;  2NR5 A;  2B1G A;  1TUE B;  4J41 A;  4Q20 A;  4NTX A;  3QVN A;  1JPX A;  1YZB A;  4MTG A;  4MVM A;  1OCR B;  4QPK A;  3R66 A;  2WLI B;  4LFA B;  5KA5 A;  1OCR C;  3B2E E;  5IT9 N;  4G2K A;  2XHB A;  2YIB D;  3CC2 V;  3IAY A;  1GM7 A;  5FL7 G;  2Q7H A;  2P06 A;  3ABL C;  3JD2 A;  2JIZ G;  2IU3 A;  1PNL A;  3OMN B;  5CA0 B;  1XMO O;  4FZ1 A;  1N36 O;  4CH4 A;  2OYQ A;  1THZ A;  4DR1 O;  3IFX A;  1X4T A;  3T1C A;  5CA1 B;  5EC1 C;  3RYI B;  1W59 A;  3LDE A;  3QO8 A;  2M6Y A;  2NNU A;  3H1L H;  1BS3 A;  2OWO A;  4X1Y B;  1FFX B;  1AR5 A;  3JAL B;  4IGG A;  5L3F A;  2KG7 A;  1FJG B;  2GTA A;  4HYO A;  2H3O A;  3F7V C;  4GFA A;  1GRJ A;  2HG5 C;  1Q86 W;  2Q67 A;  1YHQ V;  4ZBM A;  2A3Q A;  3AG2 B;  5L3E A;  4ASU G;  3AG2 C;  3QG5 A;  4YJ2 A;  4HBN A;  2EIK B;  4GX2 A;  5L3D A;  2EIK C;  3ZMS A;  2UXC O;  3U0Z A;  1SC5 B;  4PI2 A;  2OCH A;  2UXB O;  3JAK B;  4LP8 A;  1VP7 A;  1XMQ O;  2CGN A;  2YI9 A;  4O4I A;  3IC9 A;  4NB5 A;  1QLN A;  4O4H B;  2AGA A;  3K5M A;  3FB5 C;  1DLB A;  3FYE B;  3SYQ A;  5FPR A;  3E8H A;  1Y67 A;  1NH2 B;  4B3S O;  3CRQ A;  4KHP B;  4DUZ O;  3A0B Z;  4PI0 A;  4EB6 B;  5B66 Z;  1AI5 A;  1S5H C;  3RYH A;  4X1I A;  3AG3 B;  3JD4 A;  4J10 A;  2UU9 O;  1IBM B;  5LHG A;  1OJH A;  4UB6 Z;  2XUM A;  4X20 A;  1BQ0 A;  1IBL O;  3G67 A;  3HPL C;  1Q43 A;  3H9V A;  1OHH G;  4GX5 A;  4JI1 O;  4OPA A;  4FJC C;  4FZ0 A;  4QPJ A;  3ZX6 A;  3TET A;  1EM1 A;  3C90 A;  3OGI B;  4WF9 V;  4X62 O;  2JRI A;  3FB7 C;  4IL6 Z;  2A06 H;  4YIP A;  4RUF A;  1GH6 A;  3JAW B;  2QR4 A;  3FFQ A;  1VQO V;  4DR6 B;  2LGW A;  3ZS8 C;  1XIL A;  3G6E V;  4J42 A;  4MTF A;  4LNU B;  1XBL A;  5ITZ A;  1XI1 A;  2P22 C;  1R6T A;  3SGI A;  4JI7 O;  2WLL B;  2Q68 A;  2JJ2 G;  2B5U A;  2QDO A;  4U3J B;  2RMK B;  2ETN A;  4B3S B;  4NXN B;  2Q69 A;  3DGE A;  3BFR A;  1LUV A;  1LUW A;  3ZRW A;  2QEX V;  2LJ2 A;  3CWB H;  3SR2 C;  1M1K W;  4IYH A;  3MHH C;  2ILM A;  5LL6 Y;  2PYL A;  1FD9 A;  3CRA A;  1D5A A;  2BSK B;  1H2M A;  1K4C C;  1RSO A;  2IU0 A;  2EJR A;  1VF5 B;  1I5Y A;  2E74 B;  4ZOL B;  1FXH A;  5KX5 A;  2JDI G;  3CCS V;  4JF3 A;  1E79 G;  1N32 B;  1ZWI C;  5JH7 A;  1D5N A;  3ZHU A;  4J9Z B;  4LF4 O;  3JAT B;  3CC7 V;  1B6Q A;  2XAS A;  2Y4U A;  2QE7 G;  3K03 A;  1XRE A;  1EZV H;  4XDJ A;  4IYI A;  1CPY A;  1OZ0 A;  4ICG A;  1B06 A;  4DXW A;  5KHK A;  1VAR A;  3ZRV A;  3OUS A;  3WG7 B;  1QVF U;  4Q6G A;  4PV1 B;  3WG7 C;  4G28 B;  4JTC B;  3ML0 A;  4I0X A;  2ZE7 A;  1Q7Y W;  1OCO C;  5LP6 B;  2YEV B;  3T1H O;  1R6K A;  3U11 A;  5LP6 C;  4FLX A;  2CTR A;  5HFM A;  3EVK A;  1K5Q A;  2IM9 A;  3UO2 A;  3TJT A;  1NT2 B;  1H38 A;  1M56 B;  4JAS A;  1SQX H;  1PNK A;  1M56 C;  4OXS A;  3HKE B;  4YHH B;  2OIG A;  2Y69 B;  4YXW G;  3HKB B;  2Y69 C;  4QNH B;  2VQF O;  1BT8 A;  1ENV A;  2R9A A;  1W0J G;  3B8M A;  3ETG A;  3CYO A;  1J5E O;  4CZZ A;  5LGU A;  4DV3 B;  1FAF A;  2XT9 A;  1KC8 W;  3J7A U;  3E22 B;  3K5O A;  3RYC A;  2E5L O;  2BTQ A;  4FLW A;  3TXS A;  3X2Q B; 
#chains in the Genus database with same CATH homology
 3SJB C;  4CS3 A;  4B3M B;  2QM4 A;  1ZAU A;  4UCS A;  4K0K B;  1HNW B;  1M93 A;  4TOI A;  3JAS B;  5EIB C;  5EYP A;  1IBK B;  1M4U A;  3RYF A;  4DUZ B;  4TV8 A;  2VWJ A;  2UUC B;  5KHH A;  3M7M X;  3OTF A;  5EZY B;  4FLV A;  4O2B B;  3BA9 A;  3BRC A;  4B08 A;  4X1K B;  3K57 A;  4UFZ A;  2UXD B;  4FLY A;  4CS2 A;  1KMI Z;  2R70 A;  2UU9 B;  2ZCE A;  5J2T B;  3N2G A;  4IIJ B;  3HKC A;  3WB2 A;  2F93 B;  1KU9 A;  3K59 A;  1XQ8 A;  1IBL B;  5LOV A;  4I55 A;  4DK0 A;  4O2A B;  4ZI7 B;  5CJ4 A;  2KKW A;  2JGU A;  1TVK A;  4JI1 B;  5CA0 A;  4X66 B;  5LYJ A;  1M5I A;  4TUY A;  4GYC B;  4BW9 A;  4AIL C;  5LA6 B;  3BAB A;  4X62 B;  4WBN A;  3HKD B;  1HW7 A;  1TUB A;  3A2F A;  2P5O A;  2Q7G A;  5CA1 A;  5IJ9 B;  1JFF A;  4FLU A;  4TV9 B;  5JQG B;  5K1X A;  3RWR A;  4IHJ B;  4UCV A;  5KMG A;  1HNX B;  2Q0A A;  4DV1 B;  4UCR A;  4CC6 A;  4X1Y A;  4JV5 B;  4LF8 B;  3JAR A;  3U10 A;  4FLT A;  1FFX A;  4F6R A;  3RYC B;  5JJN B;  2BTQ B;  3JAL A;  2E3C A;  5JJE B;  5D5Q A;  4JI7 B;  3CHX A;  1SQG A;  4YJ3 B;  1Q8I A;  5KHI A;  5CJ0 A;  4IIJ A;  2VWK A;  4JI5 B;  3UT5 A;  4CH5 A;  1N34 B;  4LF9 B;  3BPZ A;  1IK9 A;  4UCT A;  4FM0 A;  5EYP B;  2CAZ C;  3RYF B;  4TV8 B;  2F66 C;  2HEP A;  1SQF A;  5LMN B;  1SA0 A;  5C8Y A;  5KHG A;  1HNZ B;  2YIA A;  1YEW A;  4DV0 B;  4LF6 B;  5D5P A;  4I4T A;  4LFA B;  3JAK A;  3B2E E;  5JCO A;  3HKC B;  2XHB A;  3VQX A;  2YIB D;  1V9P A;  5LOV B;  4I55 B;  3IAY A;  4O4H A;  2Q7H A;  4B3R B;  4LF4 B;  5CHX A;  1TVK B;  3ICX A;  5CA0 B;  5LYJ B;  4TUY B;  4WBN B;  4CH4 A;  2OYQ A;  1TUB B;  4HNA A;  4JI8 B;  1X4T A;  5CA1 B;  4TQF A;  3RYI B;  4EB6 A;  3N2K A;  5FPO A;  2F1M A;  5KMG B;  2UUB B;  2OWO A;  5IYZ A;  4X1Y B;  4JI0 B;  4LR3 A;  2JVD A;  4DV4 B;  2R72 A;  3JAR B;  1FFX B;  3JSN A;  4F6R B;  4KL1 A;  3JAL B;  4DRX A;  5CB4 A;  1FJG B;  3T1H B;  1O9G A;  3PN1 A;  2V4D A;  1G6U A;  4EFE A;  3UT5 B;  2PZS A;  3RGB A;  4FM1 A;  1HR0 B;  2UUA B;  3THO A;  4FLZ A;  3QG5 A;  4YJ2 A;  1T5E A;  3BA8 A;  4HBN A;  1SA0 B;  5C8Y B;  5JJJ B;  2F95 B;  2ZM6 B;  4DR5 B;  5FNV A;  2VQF B;  4FFB A;  5BR8 B;  4O4J A;  1P49 A;  4X65 B;  3U0Z A;  4I4T B;  3JAW A;  4PI2 A;  3RYI A;  1TGO A;  1J5E B;  3JAK B;  4K8Z A;  4LNU A;  4X64 B;  5JCO C;  2PTM A;  2YI9 A;  4O4I A;  1L8D A;  4O4H B;  3K5M A;  1WNS A;  2RJZ A;  3QTC A;  2E5L B;  4CS4 A;  4U3J A;  5FPR A;  4LF7 B;  2ZIN A;  4UCO A;  5IJ0 A;  5LXT A;  2BTO A;  3QF7 A;  2ZIO A;  4AHC A;  4K8X A;  4HNA B;  4KHP B;  5JVD A;  3SR2 A;  4LH6 A;  3LNN A;  4PI0 A;  4CH3 A;  2EX3 A;  1H2S B;  4ZHQ A;  4EB6 B;  3N2K B;  3RYH A;  4X1I A;  2ZIM A;  5EIB D;  5IYZ B;  2YIB A;  4LFC B;  4DR4 B;  1IBM B;  4ZOL A;  3CSX A;  4DRX B;  2F4V B;  5CB4 B;  2HHH B;  4X20 A;  2QJ1 A;  1Z5W A;  1I94 B;  4O4L A;  1Q43 A;  1XNQ B;  1QHT A;  3JAT A;  4L8J A;  2PGG A;  1B04 A;  3ETQ A;  3SJA C;  5BMV A;  4YJ2 B;  1Z5V A;  4I50 A;  2RQ6 A;  4DV5 B;  4JYA B;  5FNV B;  4FFB B;  3VQV A;  4DV2 B;  1WN7 A;  2VQE B;  4YY3 B;  4O4J B;  2PUS A;  3K5N A;  4GKK B;  3K5L A;  3JAW B;  3OTO B;  1FU1 A;  3FFQ A;  4DR7 B;  4DR6 B;  3ZS8 C;  1QQC A;  4CC5 A;  1I7F A;  5JH7 B;  4LNU B;  3CB2 A;  5ITZ A;  4O4I B;  1XI1 A;  2P22 C;  4DV7 B;  3MUD A;  3SGI A;  5LP6 A;  4LH7 A;  4GLX A;  4U3J B;  1S5J A;  5IJ0 B;  4ZIB A;  5LXT B;  4XA4 A;  4B3S B;  4NXN B;  4D7S A;  3MAQ A;  3K58 A;  5GON A;  4DUY B;  3RFR A;  5JVD B;  2JS5 A;  3HKE A;  4ZHQ B;  4FVM A;  3SR2 C;  3VQY A;  3RYH B;  3HKB A;  4X1I B;  4DR3 B;  4FM2 A;  3ZED A;  1JMK C;  2YXL A;  2PYL A;  4DR2 B;  1D5A A;  1RSO A;  1Q5O A;  5J2U A;  4B3T B;  4LFB B;  4ZOL B;  5KX5 A;  4CH6 A;  4X20 B;  1N32 B;  5JH7 A;  4O4L B;  3E22 A;  2ZNJ A;  4JI3 B;  1SKV A;  3VQW A;  3JAT B;  5BMV B;  4LF5 B;  2ZNI A;  4OX9 B;  1O9H A;  3UQ8 A;  4I50 B;  4PHZ A;  1XMO B;  1N36 B;  2YI8 A;  3JAS A;  4DR1 B;  1TA8 A;  5KHK A;  4UCU A;  4TQD A;  3T1Y B;  4Q6G A;  5EZY A;  4O2B A;  3WB1 A;  3BAA A;  4JI4 B;  4X1K A;  5ITZ B;  3JSL A;  2Q7E A;  1Q3E A;  4NXM B;  4I9Q A;  1N33 B;  5KHJ A;  1JFF B;  3RWR D;  5LP6 B;  1XHX A;  2PYJ A;  3U11 A;  1JJO A;  5LP6 C;  5J2T A;  4FLX A;  2GV9 A;  5IWA B;  2IM9 A;  4DK1 A;  4NVP A;  3II6 A;  1NT2 B;  1WPB A;  5GON B;  4O2A A;  4ZI7 A;  4JI6 B;  3HKE B;  4BWA A;  4YHH B;  5LMU B;  1XHZ A;  4JI2 B;  1DGS A;  3HKB B;  4EEQ A;  5LA6 A;  3HKD A;  1TAE A;  3WB0 A;  3DSQ A;  5J2U B;  5IJ9 A;  2R9A A;  5K1P A;  1VF7 A;  4TV9 A;  5JQG A;  3N2G B;  2UXC B;  4IHJ A;  5KX5 B;  3SJC C;  4EFB A;  2UXB B;  4DV3 B;  1XMQ B;  4GKJ B;  3E22 B;  2PY5 A;  3K5O A;  3RYC A;  4DV6 B;  2BTQ A;  4FLW A;  1XNR B;  4AQY B;  3BHP A;  4YJ3 A;  4D7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...