2QMJA

Crystral structure of the n-terminal subunit of human maltase-glucoamylase in complex with acarbose
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human intestinal maltase-glucoamylase: crystal structure of the N-terminal catalytic subunit and basis of inhibition and substrate specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Maltase-glucoamylase, intestinal
total genus 274
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2007-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qmjA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qmjA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 2qmjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qmjA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 2qmjA01
1GQLA 3GXDA 5I5RA 4M56A 5TD4A 1W9XA 4D6FA 2BY2A 2CXGA 1JIBA 4MDOA 1TA3A 3TTSA 1GVYA 2WYSA 1BSIA 5M3WA 1VBUA 4RE4A 3W37A 1US2A 3DYOA 3NIYA 1R87A 2BS9A 1R47A 1KBKA 1CLVA 8CGTA 2DPEA 2WHKA 1QPKA 2WVVA 2W66A 4IUGA 3TOPA 3RM9A 3EJQA 5EMYA 3A4WA 2XTKA 3AMCA 4CVWA 3LRLA 7A3HA 2WNWA 2WB5A 1UWQA 4D6HA 2WZHA 1OD8A 1E6ZA 3WDJA 2EADA 4P8VA 3VDAA 1JFHA 3WD1A 1J0KA 4JFSA 2ZUUA 1C91A 4AD4A 4D6GA 4GI6A 4FNQA 1TFVA 1R7AA 5E0CA 3M46A 3VGFA 2D3NA 2CHOA 3AHVA 2BY1A 1CXHA 1LWJA 1E4MM 4YHGA 2GJPA 1JAEA 1V3KA 1WAWA 3BGAA 3G6LA 1MW2A 1HP4A 3U7BA 3K4DA 2E3ZA 4HA3A 1OGGA 1V6VA 4H41A 2BV9A 4FLOA 2B31A 4W89A 4PMXA 2ZOXA 5A6AA 1UWRA 2EPMX 3KLKA 3AZTA 3IJ9A 1C92A 1V3MA 1JZ7A 3CUHA 4F9JA 5A1AA 3WF4A 3SIMA 3FNDA 4ACZA 2EPNA 3OLGA 2DSVA 4FNTA 2VL4A 3MMDA 2DDXA 3BVVA 1RD6A 3A4XA 4TTGA 1ISVA 3SCRA 2GSJA 2EXOA 3FXYA 1BYCA 2VX7A 2WC3A 4EAMA 2OYKA 3RJYA 4AD3A 1TG7A 1UR9A 1E43A 3RM4A 4HU0A 2YLAA 1CGWA 4NF7A 4OBRA 1TCMA 4NRRA 4W8LA 1K9DA 4MADA 2WMHA 4AYGA 1JZ8A 1FH8A 3T2OA 5EBAA 2GK1A 5KZ6A 3QHNA 1H49A 3I3DA 2EBNA 5AYBA 2UY5A 4H2CA 2WW5A 4RL3A 1JYVA 2OW6A 3OGVA 1LL4A 2Z1SA 1HKKA 5I2UA 4CU7A 4ML4A 5BXSA 3ARZA 3QGVA 4LYQA 3BAWA 1JZ4A 1H0IA 1HN1A 1OIMA 4F79A 4W88A 3BUBA 2ZX7A 2FH8A 1GJWA 1Q6CA 4UOQA 1KWKA 4LQ1A 3NYDA 5GNZA 3WQ6A 2WSKA 2W67A 3L4VA 1PSPA 1BLIA 3AI0A 3ZT5A 1J0IA 3DC0A 1BVZA 3VD3A 1B9ZA 3D4ZA 2XWEA 1J12A 4JFVA 2ZUTA 1PS2A 3NSNA 3VM5A 1XYZA 3F5KA 1JI1A 1EO7A 3FAWA 4BF7A 4QCFA 2G8ZA 1QI4A 3KE0A 5CGTA 1FFRA 1M04A 5DF0A 4OGZA 1V6YA 2NT0A 4DWSC 1CPUA 2PB1A 1L0PA 4D6CA 1GW1A 4J3UA 1UWTA 3W4RA 3ZMRA 1TVNA 2YL6A 2WVVB 4NZCA 3MSGA 2FYVA 1MWOA 4TXEA 2EAEA 1G94A 2WC7A 4CN6A 1E3XA 2HVMA 2X8RA 1XSKA 1FOBA 2J7EA 5I77A 2WWCA 1WCGA 4AZ6A 4A4AA 3WF3A 2DSZA 3KLLA 2V3EA 1PIGA 1JYXA 2D0HA 3IAPA 4UQ9A 1E4IA 1DWGM 2C7FA 3MMWA 2WZEA 4KMQA 2WC4A 3N04A 1V0NA 3U57A 4W86A 4CU6A 5IFTA 1W9PA 4ZE5A 1HVXA 1NARA 3G6MA 1EXPA 4M24A 1PZ3A 1TQTA 4DUXA 1K9TA 2V3GA 3TV8A 3F5JA 1XCXA 3AHZA 1MFVA 4NXKA 3VIJA 3BSHA 3MV11 4MNMA 1N82A 1DHKA 1E6PA 1UQZA 4X0NA 3VMNA 1EQPA 1QI3A 5A6LA 2ZXQA 3EJTA 1HJWA 1JF5A 2O9OA 4MAZA 1WZKA 5I23A 2W61A 2FGZA 3LPOA 2TAAA 3CIVA 2OYMA 3WF2A 3H54A 2ZIDA 4K68A 5GPRA 1MW0A 2OSYA 3GBDA 1E40A 2W91A 3EYPA 4ZXOA 3HZ3A 3I3BA 2F7RA 2EACA 3CHFA 3BAYA 2F1AA 3UG4A 2Q8XA 4HU8A 1EGZA 1ZU8A 1CLXA 1FHLA 5JIWA 2IUZA 4WSJA 3QOMA 2VUYA 3OGSA 4AZCB 1V0MA 1JG9A 1DWAM 2VR5A 3E1F1 5ABGA 1E15A 4XB3A 4RE2A 4GO9A 3A22A 5JUVA 2DIJA 4UQDA 2BVYA 3D50A 3BCDA 1V6WA 5HDRA 1M53A 2JF6A 2UY3A 4WLCA 1B2YA 1TQUA 2J7CA 3ZIZA 4ZENA 1V6UA 4WF7A 5BRQA 2CIPA 1W2VA 4JFUA 2OWWA 3UR7A 1CIUA 2X05A 3AMDA 4D6EA 3EDKA 5DT7A 2ZUVA 1CZ1A 2XWDA 1LL6A 1QX1A 3AJ7A 3TONA 2AAAA 1PX3A 3W81A 2XUCA 2PSPA 1XV8A 2O9TA 1V3LA 4RE3A 1BAGA 3ZSSA 2E4TA 3A6OA 4EK7A 4OZOA 3CZSA 2PC8A 3SCSA 2VZTA 3SCNA 3VM7A 2XFYA 3AOFA 2WMIB 3CHEA 5EB8A 1YQ2A 1VAHA 3ZJ7A 5CGMA 5BCAA 3ARQA 2ZX6A 4KGLA 1E1FA 1J11A 3ZQ9A 4MB5A 3ZJ6A 1E3ZA 1H5VA 3DYMA 2X2IA 5FL1A 1R85A 2VRJA 3DECA 4IPNB 2YBTA 2XG9A 3WEMA 2XVLA 4H8VA 1WE5A 2CNCA 4PRWA 4QDMA 1CNVA 1BFNA 3ZM8A 1E0XA 1V3JA 3GXFA 4W85A 4QFUA 2DT0A 1QW9A 1UD4A 1XH2A 3VSUA 2CKRA 1VB9A 1CXEA 4HPHA 3WIJA 1D7FA 4A3HA 4BZYA 1QI5A 1WPCA 1AQ0A 2IXUA 3AMKA 3VOCA 2FHCA 2E9MA 4KWUA 3QHMA 2W4XA 1WB0A 1UWUA 4J27A 5EFFA 4D72A 3L2LA 1VENA 1PCPA 5CXPA 3GNRA 8A3HA 1VRXA 4D1IA 3UESA 2D3LA 3WD4A 1Z32X 1C7SA 1IV8A 3WY3A 3M6DA 1H1NA 4S3KA 3BVTA 4TX6A 1JF6A 1RH9A 2WSPA 3FW6A 4IM4A 3WDHA 2BXZA 1HJSA 2E9BA 1W9UA 1BYBA 4JIEA 1UWSA 3N11A 2VRKA 3VD5A 3CPUA 1DP0A 1EDQA 1HNYA 2QHAA 4NZFA 3S5ZA 2HISA 3WUGA 2NT1A 1LLOA 1KXHA 1FHDA 2WANA 1HL8A 5BXTA 1NP2A 1CXKA 3T0AA 3AICA 1UZ1A 3WUFA 4AD0A 1OD0A 1KQZA 4JKMA 2CCRA 1LG2A 4PUEA 1UKSA 3VNZA 1BHGA 3VX1A 4PSPA 1W3KA 4DM2A 3D3AA 1VIWA 4OBSA 1G9HA 2J7BA 3CLWA 1SMDA 1HP5A 4ACYA 2W63A 2DT3A 4HZ6A 4GO8A 1V0KA 1QI0A 2WKLA 1ODUA 3VIKA 2O9PA 1MW1A 1CEOA 2ZUWA 3VUPA 4BS0A 2VMFA 1V6XA 4Q22A 1CGUA 4HZ8A 1BVNP 1JDCA 1OSEA 1J0YA 2DGAA 5ABFA 3PZTA 3AMGA 1WDPA 2XGIA 2JALA 2YLLA 1NH6A 4PCSA 4UFHA 2JE8A 1BF2A 3BVXA 1MQQA 7TAAA 1FFQA 1KGWA 5A8QA 1C8XA 2GK1B 4IPLA 4PTMA 3O2LA 4YHEA 3K8MA 1LJYA 3S6TA 5ABHA 4PYSA 5FCZA 3VMPA 1TUXA 2Y5EA 3GNPA 2RGLA 3CC1A 1HXKA 4AIUA 2VOTA 2ALWA 3CBWA 4F8XA 4GXPA 2YFOA 1GONA 2V3DA 2XM2A 1W1VA 4W93A 2EPKX 2J79A 2UWFA 4OJYA 4HP5A 3WELA 1V02E 2F2HA 1ISZA 1OT1A 3UCQA 4Q7NA 3DX1A 2W62A 4D1JA 3AZSA 2GDUA 2JIEA 3HU7A 1OM0A 3PZUA 1BGAA 5A2AA 1SMAA 1GOMA 3PZ9A 3WQ4A 5KEZA 2WHMA 1GHSA 3TTYA 3RDKA 3AXHA 2X0YA 4AISA 4AZCA 4JFTA 2YA1A 4OIFA 4HA1A 5C70A 1HF6A 2D0FA 1AVAA 3W27A 1VFUA 5AC4A 1U2YA 4P7RA 1H2JA 2J4GA 1VBRA 5D8ZA 2PI6A 3DDFA 3GH4A 3W82A 5CSUA 1SZNA 3W26A 1E5NA 1V08A 4GPNA 2ZUNA 3IANA 4DWSA 5ABEA 4FNPA 1JD9A 1OCQA 5A6SA 3WNKA 1C8QA 1PJ9A 1WNOA 3AIBA 1ITCA 3BAKA 4AMCA 4PEEA 2VX6A 4C7GA 3BVUA 1ISYA 1GHRA 3GXIA 4AMWA 5AYIA 1J0ZA 4CD4A 3NSXA 2WLZA 5FD0A 2BXYA 4QLKA 4FNRA 1G01A 2IXVA 1AQMA 3LPFA 3OG2A 5A2BA 3W24A 4JZ5A 1HI7A 4MB3A 3CZEA 4PUDA 2D73A 2FHBA 1JGIA 3QHOA 3K1DA 4P7LA 3B9AA 3BLPX 5D9OA 4D6IA 1UKQA 2FHFA 2X2JA 3ZR6A 4P7NA 5C8BB 3ZO9A 1J9YA 4KRUA 2ZXDA 5ABFB 1GQIA 4FK9A 4P8WA 5A8PA 1E70M 3FHAA 3U7VA 3VU2A 2XGBA 3MI6A 4UZSA 2QF8A 1C93A 4CN4A 4MB1A 1HL9A 1VEOA 5I79A 3SEPA 3CHCA 3WY4A 3NCOA 3OLDA 3UEQA 3W29A 3GM8A 4AY1A 1JDDA 4DUWA 5A3HA 3CZGA 1G5AA 5A8OA 3VIHA 1M03A 1W1PA 3DX3A 4U5IA 2VVNA 2J8GA 3IJ7A 1PEZA 3RMEA 1VEMA 1B3ZA 1E6QM 1QW8A 5F7UA 3CGTA 4W87A 4MNLA 1C3FA 3S5YA 3AIUA 4FLQA 3QOKA 3POCA 3CH9A 4R5EA 3WDPP 1RP8A 4U3CA 3L4ZA 3MUAA 4UQCA 3T2QA 1XSIA 3L4TA 4FLRA 4QAWA 3CTTA 1QI2A 1J10A 2WBKA 5BRPA 1H4PA 2CBVA 1EHAA 2OSXA 3AS3A 2WHLA 3WUEA 3W28A 3GYCA 2D2OA 1KXTA 2G3NA 3CZNA 2DH3A 1ZBWA 4C7FA 1EDGA 1JZ5A 3WNPA 4GINA 3OZOA 6CGTA 3T0DA 3GH5A 1V0LA 2WWDA 5E1QA 2YL5A 1KR1A 2YL9A 1GOKA 6TAAA 4L4OA 1W3LA 1W32A 3WF0A 5LA1A 5GNXA 4X0VA 3PZNA 4DO5A 2Z1KA 3L2MA 2JFEX 3MKKA 2D22A 3ALFA 3OZPA 1XH0A 4V27A 3M7SA 3RIKA 1I1XA 3VPLA 4OKDA 4N0RA 1NWSA 2WHJA 3GH7A 2WKGA 2A3EA 1DWFM 5HNNA 1EOMA 5A6MA 1CXLA 4UTFA 4YN5A 2FE0A 5JBDA 4P8UA 5ECUA 2D1ZA 1W9VA 3BUDA 1W2PA 1X1NA 4J28A 2CYGA 3BLBA 2XN2A 4AWEA 3AIVA 2GJRA 4EKJA 3RCNA 4E4PA 5CJ5A 1QBBA 4X9YA 1TR1A 4XZWA 5E0FA 2ESCA 2WMFA 2CBUA 1WDSA 1WZAA 3D51A 1KXQA 4CUCA 2VZUA 2J47A 3IAQA 5A69A 1E6NA 1K6AA 1PIFA 2ZX8A 1CBGA 3PZIA 1QHOA 3RILA 2DEPA 1XD1A 2OLHA 3CZJA 4PMRA 1R34A 4JL2A 2F18A 5A8NA 5AY7A 3DDGA 2XPKA 2BHYA 1HKIA 3GNOA 3AIWA 3SCUA 1UUQA 1J0JA 2WMGA 4M8UA 3K46A 3GDBA 1WO2A 4B15A 5GQBA 1NOFA 2XVNA 1ZBCA 1KWGA 2V5CA 3WSUA 2UY4A 5HPOA 5JBEA 4LGXA 3EJUA 1G1YA 4FNSA 1QNOA 1MQPA 4TX8A 5IHRA 1E1EA 5IDIA 4E8CA 3AXIA 2GJXB 4PMZA 2YDRA 1IT0A 1BG4A 4H8UA 3LRMA 3VSVA 3VGHA 3H55A 2C8NA 3WNLA 2EJ1A 4XV0A 3ZJ8A 1R75A 1V03A 3L4XA 4PMUA 5DFAA 5A94A 3VGEA 5LA0A 5FL0A 1UG6A 4CD5A 1K9EA 3BUQA 4AMXA 3UG3A 4UQEA 4GIAA 4M80A 4HOXA 5A8MA 1HTYA 2ZX9A 5HXMA 1TMQA 3O6AA 1ZBVA 3B8SA 2WCAA 3AS1A 2PWDA 1GCYA 3A4AA 1PX8A 3AFBA 2D23A 3BCFA 2VQTA 2E9LA 2XN1A 3BXWA 2FDMA 4PMYA 2ZUSA 3CZKA 1KGXA 1ISXA 1AMYA 3BAJA 1J18A 3WMSA 4V28A 1E9LA 3HG4A 2FGLA 4HA4A 3ZOAA 3A23A 1E4LA 4J7RA 4ACZB 5BXPA 1UKPA 4DWSD 1E0WA 1L8NA 3QR3A 2WVSA 1IZJA 3LXBA 4GQQA 1HKMA 3WBAA 2VTFA 1FP9A 2XN0A 3AIQA 1G0CA 4OOZA 2J25A 2JEQA 3EDDA 2BVDA 4ZFMA 1BGGA 2PWHA 4D71A 3SCQA 1NQ6A 1TQVA 1TZ7A 1W91A 2YA2A 1EIBA 1Q4NX 3HG2A 1VFOA 1V3HA 2VURA 3PTMA 3EJRA 1LF1A 4LYRA 1EHNA 1QWNA 1MW3A 5E6ZA 3D52A 1XHGA 5LA2A 3WNOA 1NWUA 3WH9A 3ZR5A 2BVTA 1VFMA 5DO8A 2BHZA 4XZBA 1HJXA 2CBIA 4PMDA 3WDQA 3DX0A 1H3GA 2DSUA 5CLWA 1SYTA 3SCVA 3JUGA 2MANA 4TVCA 2VI0A 3EDEA 4Z2HA 4B9ZA 3GZAA 2VVSA 2D20A 4M29A 2Y2WA 4MAVA 4MJ4A 4MNJA 3W6MA 2XVPA 4Z2GA 3POHA 2X2YA 1PZ2A 1MFUA 1QOXA 1ZL1A 3N15A 2ZWYA 4UCFA 3PTQA 4CN1A 3WMCA 3SCWA 5A6BD 2OYLA 4AZBA 1E6RA 3VIGA 4H7VA 2XIIA 1B3XA 1LQ0A 4NSBA 1OB0A 3SUWA 5I3DA 3WNNA 1C90A 3VSTA 5DEZA 3N9KA 1EDTA 5CLTA 3WH8A 1E0VA 4DUVA 1CXIA 1O7DC 4U33A 4TTUA 2G4FA 2DQXA 2BFGA 3BUIA 4ZXLA 3AYSA 4PBGA 2NSXA 3PN8A 1TA3B 2CPUA 3WFZA 1FH9A 2VO5A 3BAIA 1EH9A 4W5ZA 1BQCA 1D2KA 4AIEA 3LPGA 1LWHA 3T09A 4J3VA 2WMIA 2VRQA 2WMJA 4JCLA 1QNRA 4E2OA 3ARPA 3TTQA 4NZJA 1R8LA 3FN9A 1B0IA 3EJPA 4PTXA 5EFDA 3DYPA 2J7GA 4UFKA 1TQSA 5A6JA 4UNIA 2BY0A 3FHQA 3KZSA 1MYRA 3AHXA 5JBFA 3BAXA 1XSJA 1DWHM 3W25A 3WQ8A 1JZ2A 1Y7VA 1E9TA 3VGGA 1HT6A 1KGUA 3VINA 3VX0A 4GQRA 2WK2A 1PBGA 1B3WA 4OUEA 2WVTA 4AIOA 5A95A 1WZMA 4WK9A 3AIEA 1M7XA 4JL1A 4MTVA 2F7OA 1R46A 1MXDA 4B3KA 4MB4A 3OBAA 4Z2KA 1M01A 2OWCA 2V3FA 3DHPA 3K8LA 1HJQA 1AQHA 1MQRA 4GZIA 3N17A 1XYFA 1PPIA 1Q6FA 1VEPA 4UQBA 2DH2A 3OB8A 3WDIA 3MSDA 5JIPA 3ARYA 3WDRA 3VD9A 1H11A 3W6LA 2QMJA 4CCEA 1DEDA 4WKFA 3APGA 4CD6A 1WP6A 3DX2A 2PF0A 1NOUA 3KWXA 3AS0A 2OSWA 1OIFA 3ALGA 1GNXA 2ZICA 4AD2A 2PWFA 4WJXA 4GKLA 4UQAA 3IGUA 2WM0A 2XM1A 4XX6A 1NP0A 3PZGA 2YKKA 1CXFA 4URIA 1EA9C 2BHUA 4AZ7A 2VX4A 4PMOA 4FF5A 3KL5A 2G3MA 1PX4A 3SCTA 2EQDA 2VZSA 4PMVA 5IFPA 3T0BA 2VCCA 2EPLX 2WZIA 3ARRA 4UZUA 4CGTA 1JZ3A 3AXXA 4KH2A 3VO0A 3D4YA 3U5YA 4LX4A 5A6BA 1CECA 4PTWA 2PBOA 1CENA 5BXRA 2O92A 1B31A 5BWFA 4WSKA 1Q6EA 1O6IA 3IJ8A 1OGSA 2CKSA 4EE9A 5D9MA 3L4YA 3NUKA 4J3XA 4QCEA 4GZJA 1OT2A 1ODZA 1ZB5A 2OWXA 1QBAA 3WH6A 1J01A 1QVBA 4JKKA 4JFWA 4DM1A 5CG0A 2V38A 2VR4A 2X2HA 4GI8A 4YPJA 1GORA 4UOZA 1LL7A 3CUGA 1E56A 2VJXA 3WQVA 1P6WA 1E5JA 1UR8A 2PWEA 4WKAA 2QV4A 1UD2A 3CV5A 4FLSA 2YA0A 3EMQA 2A3AA 2E8ZA 3VIIA 2CITA 3CHDA 1B30A 3WY2A 1UKTA 3SUUA 1JI2A 4U2YA 3WQWA 4M1RA 1U33A 1UR4A 4H04A 4IISA 3T08A 4PTVA 4AZ5A 1F4HA 4CU8A 2E40A 1JYWA 3TA9A 3DX4A 3MS8A 3II1A 1ECEA 2WAGA 3NJ3A 2O9RA 4W84A 2ZE0A 1MVYA 2ZWZA 3ARUA 4E8DA 4W8AA 3CZ8A 2YL8A 4M82A 2VNCA 5I6SA 5I0DA 3J7HA 3VIOA 1GQKA 4TVUA 3WD2A 4AZIA 4EANA 2CEQA 1UR1A 1JZ6A 1GVIA 3WD0A 3S2CA 4AW7A 5DT5A 1BPLB 1JFXA 1K9FA 1QNSA 2DSKA 3WY1A 3UR8A 3BSGA 1UWIA 2CBJA 4HMEA 6A3HA 4W7UA 3CUFA 3B9EA 2YOCA 5I24A 3HG5A 1BYDA 2WMKA 2QPSA 1VF8A 3LRKA 1UYQA 4DWSB 2D24A 2VC9A 4BQ4A 3A5VA 3LX9A 5FIPA 3EBVA 4UFLA 3VNYA 1HWWA 4HOWA 2Y4SA 1R33A 4LYPA 2WPGA 3LPPA 3N18A 1PS3A 1RPKA 1X6NA 1W3JA 4NX0A 1E4NA 3SURA 2GFTA 3N12A 2Y8KA 1C7TA 4JCMA 1DTUA 4KGJA 1E6SM 3EDFA 3NSMA 1OBAA 4HOZA 2YDQA 2J75A 2WVUA 2WLYA 1QHZA 2G3JA 3I3EA 1UOKA 1UR2A 3UETA 1KTBA 1W9BM 3A21A 2VCAA 1KFWA 4MDPA 4W7VA 1UASA 3AZRA 2V5DA 4CKQA 3A3HA 1XC6A 2W5FA 3BMVA 1IZKA 3IK2A 1HXJA 2G41A 3VDCA 4AEFA 3ARTA 3THCA 4MPKA 1UQYA 1W9DM 4JKLA 1E55A 3EDJA 2XJ7A 2YDSA 4HPGA 4F66A 4Y7EA 3GXMA 2J74A 4UFMA 2E0PA 4WKHA 1CGYA 2GDVA 3OGRA 5D9NA 4AZGA 3HMCA 1E71M 3MU7A 1UD6A 5IHSA 1UD3A 4ATWA 3ZT6A 4UFIA 3WFLA 4PMNA 5A2CA 1BTCA 1GQJA 4NXSA 1UH2A 4GZEA 3O9NA 2CETA 1GUVA 3TTOA 3WH7A 1JXKA 1UD5A 3VILA 3OLIA 1KCKA 4N42A 1HIZA 4NI3A 3PZOA 5LYRA 3VIPA 1JYNA 5E09A 1HX0A 3CZLA 3VVGA 1TVPA 3VTRA 1NOWA 3BH4A 4L4PA 4ATLA 3VDBA 1WDRA 3MUY1 3LMYA 4M81A 4OOUA 1KB3A 1US3A 1QHPA 1U30A 3VD4A 3GXPA 4MJ2A 1I75A 3VGBA 1E6XM 2F7QA 1D3CA 4J3TA 1ESWA 3AMLA 3CUJA 2A3BA 5CPSA 5M17A 1KCLA 1NM9A 1DWJM 1V3IA 4P7OA 2J7FA 4BQ5A 2EEXA 4FMVA 3UERA 1H41A 4W5UA 1GOQA 2EABA 2PWGA 5C71A 3PZMA 4FNUA 1JD7A 4U5KA 2G3IA 3THDA 2J77A 3FY1A 1ISWA 2GJXA 3W53A 2X09A 2JIWA 3MANA 3NDYA 7CGTA 1PE31 4U31A 4AD5A 2BNJA 2Y8VA 4S3JA 4Z2JA 1QNPA 3DHUA 1V02A 1B3YA 1WKYA 4JHOA 1VFFA 2WBGA 3KL0A 2XSBA 5BYWA 4QP0A 4UR9A 1R7OA 4CD7A 3OLEA 1R86A 3LXCA 3VMOA 5CSYA 3RJXA 1BYAA 4CVUA 1XCWA 4J3WA 3CUIA 4ATDA 2UY2A 3F5LA 2WXDM 2FH6A 1UZ4A 4UFJA 4DO4A 1QNQA 3CMJA 3W0KA 3PBGA 3WEOA 3VIFA 3WH5A 5M03A 1EO5A 3W38A 5A6KA 5CQ1A 2J7DA 4QLJA 2YJQA 2F8QA 1JAKA 4AD1A 3WBEA 1UKOA 3WEZA 3HN3A 3VGDA 3B9DA 2F1BA 3AQUA 5E9AA 3H53A 3SCOA 3F4VA 4W8BA 3WKZA 1T0OA 2J62A 4U2ZA 3M07A 1HJVA 1E73M 3ARXA 5I78A 1XRVA 4P8XA 4AEEA 2VX5A 3EMCA 5BROA 4AZHA 1SR0A 5FKYA 5M5DA 2VZOA 3HG3A 2J7HA 1B1YA 4BCEA 4Z2LA 1GPFA 1EQCA 1OINA 3MUZ1 5HBFA 1MXGA 1CTNA 4BQ3A 3WN6A 1B3VA 2JF7A 1QWUA 2XHYA 3LXAA 4PN2A 1XH1A 4HTYA 3WQ5A 3A47A 1A3HA 2ZUMA 2BY3A 1UH4A 4PCTA 3PTKA 3PZQA 1CYGA 1OWQA 2X0HA 1SFSA 1W1TA 1HVQA 1TE1A 2J78A 4XUYA 3SUVA 4BA0A 1W1YA 1CGTA 5CPQA 5D4YA 4HMCA 1JXJA 3D5HA 3TP4A 2DIEA 5DMYA 1GOWA 3L4WA 2QLYA 4AC1X 4DO6A 5CPTA 1CGVA 1ITXA 1UA7A 1NWRA 3VKKA 1JDAA 3KEHA 2DSWA 3GTNA 3WL1A 4LPCA 1VJZA 3BLKA 4PSRA 2XVKA 2AOSA 3VD7A 3ARSA 3AS2A 5CZKA 4TVDA 2VCBA 3PZVA 3N13A 3BC9A 3NDZA 3AYRA 2ZX5A 2GUYA 2F61A 1B90A 1UD8A 1ZJBA 3MV01 3WL0A 2CERA 1GZJA 3EMZA 1JNEA 2Y24A 2YIHA 4HMDA 1KBBA 2EO7A 4GI9A 3N1AA 2XVGA 3WUBA 4AXNA 2QPUA 1UA3A 4D6JA 2XYLA 9CGTA 2CESA 3CMGA 4WIWA 1H0GA 4CCDA 4F9DA 3AISA 4KRTA 4P7QA 3ECQA 3ZSTA 3OIHA 1KQYA 1KTCA 2CHNA 1ZS2A 5HPCA 1WZLA 1JNDA 3AIRA 4AYSA 4ZEPA 2EPOA 2IGTA 3SCPA 1CDGA 1RP9A 1XGZA 3UG5A 2X1IA 3ARWA 2VZVA 4TUFA 4U3AA 2J8FA 4JAWA 1FA2A 4ZE4A 1TQWA 3VDHA 2YBUA 5D9PA 5GNYA 2VT0A 4UOJA 2OW7A 2E8YA 4J3SA 1GJUA 2D0GA 5IXEA 1C8YA 4JHZA 5HOSA 3BMWA 3SUSA 2RGMA 5E70A 1WDQA 2QMKA 2XIBA 1GOOA 1FP8A 2GVYA 2PBGA 3ARVA 4C7DA 1H09A 3U5UA 1UHVA 2NW0A 5E6YA 1W3HA 1X6LA 2W92A 4QLLA 3KL3A 1ZBKA 3ZT7A 4PMQA 3SUTA 3WD3A 2DT1A 2ZXAA 1LG1A 3RM8A 3HJEA 3EJSA 4B9YA 2YFNA 3A24A 3BUPA 1I1WA 1CGXA 3L4UA 3GXTA 1J0HA 4H8HA 3K8KA 1UR0A 1VJSA 1OGBA 1KR0A 3CO4A 3WENA 3WNMA 1HKJA 1ZJAA 1Q6GA 4A3YA 3OA5A 3WF1A 3AHTA 2XFRA 2C0HA 3MMUA 1A47A 1FH7A 3WMBA 1JL8A 3RPMA 3T2PA 2ZXBA 1KXVA 2DT2A 3VIMA 3GXNA 2XSAA 1EOKA 4B3LA 1YHTA 4BQ2A 1GOIA 2VQUA 1F4AA 4W7WA 4CD8A 1PAMA 4LXFA 4B16A 5D8WA 2WCSA 2AMGA 3GBEA 3PHAA 2WCGA 1DWIM 4HZ7A 5FOOA 4CCCA 4D6DA 1S46A 4MNKA 4Z2IA 1E72M 3AHYA 5AC5A 1CWYA 3K4AA 1NWTA 1UH3A 3MUIA 2JEPA 4TOQA 2XFFA 2A3CA 2F7PA 1BG9A 4NRSA 1XD0A 4R27A 4V2XA 3FAXA 2A3HA 1HJUA 3AROA 3MO4A 3ZJKA 3BVWA 3RO8A 1O7AA 1Q6DA
chains in the Genus database with same CATH superfamily
3UJEA 1YDPB 3N9GH 4S1QH 3G5YA 4ZTEA 3LCGA 4QT5B 3KNBB 4UFIA 1JN6B 3KYOB 3HRZB 4PJXE 1H0DB 5ANME 3R1GH 3QQ9C 4L3ED 8FABA 2E47A 4KQ0A 3LBOA 4RX0A 4LFHG 4MDOA 4JEQA 3TTSA 3B2UC 5CIPH 5I1GL 1GVYA 4GIOA 4KAQL 3CWOX 1XRSA 3DHDA 3VAEA 4W6WB 1NMAH 3CJJA 1NKGA 2FBRA 3IJIA 3NIYA 1ZY9A 2BS9A 3TH6A 4Y1TA 3OKYA 1KBKA 3P2BA 1CLVA 1KD0A 5ACZA 2HT2C 2DPEA 5D2LA 3RVWD 3UTQA 3QFJD 2WVVA 5E2VH 3RX8A 1IKOP 2WXHA 2W66A 3QDMD 4IUGA 4F0MA 4IRSB 4JRXA 1NFPA 5CP3H 3UTOA 4OF5A 1GJIA 5EMUA 3A4WA 2ITCA 5MEOA 2H0PA 3MLVH 5GHWH 1Q9OA 2FVKA 5BS0A 2W8CA 3KPQB 4KKRA 4UNLA 2XTLA 1XYLA 5HPMB 3WLTA 1QBLL 1U8NB 2N01B 1DL7H 2YXWA 3HE6C 3K7UA 3M0KA 2WNWA 3FXGA 3BVNB 4GYKA 4GYJA 4D6HA 1FVEB 2FEEI 5LNSA 3RWCB 1E4WL 3HMXL 1MQ8A 3M8OL 4KUCF 5DS8B 3WDJA 1E6ZA 2A1YA 1JFHA 3NSDA 3PHQA 5AOIA 1J0KA 3WD1A 3KVQA 1TTJA 4YVXA 4C8XA 2ZUUA 1SW7A 4D6GA 1Q1JH 1M9HA 3M7WA 1TJIL 1JGLL 3B2VL 5SWZA 4MS8C 4DW2H 3EOOA 4AL8H 1DFXA 5AECA 4MHHI 1X44A 1YYAA 1UT1A 2DVXA 3DI2B 3M46A 1QQDA 4Q8WA 1H61A 3C6LC 3IJHB 4L80A 4NCC2 5T1JA 8XIMA 4YSTA 2VWSA 1F6AB 4QOKD 1A21A 1ZSDA 3H0TB 2R1MA 2VABB 4JANA 3EOAB 2HMIC 5IB3A 2NWRA 3AHVA 4GXVH 3RB5A 3Q05A 3ATEA 3V1PA 1SO5A 3WUZA 5B39A 4OSUL 2QFPA 4KHTL 1Q8MA 1GQNA 5I1IL 1F74A 2GI7A 1TV5A 3NVDA 4JPGA 1WAWA 1ORQB 2CDEA 3PWIA 3RFZC 3B0YA 1MW2A 3G6LA 1QOQA 3DVIA 4RAVA 4JZJC 3NQVA 5IBTL 2D4FA 1O6SA 4G72B 3D0LB 5DJCA 4EIVA 1P7TA 3NEEA 1OGGA 4S2SA 5ICXA 1TPXB 3D87B 3SPVA 4C6OA 3F12B 1AQKL 1YPZF 2B31A 1UBSA 4WUKH 5KSBB 3WO3B 4L29B 3WKML 4Q89A 1O4UA 3MRKA 2EPMX 5D7IA 2R2HA 1XL9A 2ESVE 2X44D 1C92A 1V3MA 1JZ7A 4F9JA 4M6UA 4FERA 1F3JA 4HJTA 2HVOA 3AY4C 2NUTB 1PLGH 5IESL 5IP4A 4X6EA 2EPNA 4BA8A 3BQUD 3OLGA 4U05A 2YD1A 2X4TA 3UWWA 3KHOA 4QNWA 2YW4A 1GW6A 1DBMH 1UWFA 2QQKL 2ZP8A 3MOQA 1QOPA 2HMID 4IMGA 4AWTA 1MLBA 4G80A 4KMTH 5EBWB 4IIZA 1A5NC 4B92A 4KZEH 4JM2B 2CCLA 4IP4A 1RD6A 3PJSB 1F3EA 3B37A 2VXQH 3MMEA 3NQIA 4HPOL 3QUKB 3OZKA 4ANVA 4H9TA 4TUKH 5ADOH 3MLTA 2ISDA 5B8CC 4M8RA 1KLGB 2INZA 2P8PB 2NXIA 4XQ6A 2EXOA 1Z9OA 4LYKA 3FT3B 2DQDL 3Q0HA 4TRPL 1LOQA 5H37H 1XSOA 2VX7A 1LYXA 2OYKA 4JE0A 3RJYA 2E46A 4GLRH 3OHMB 4QO1A 5LQBH 5CJBA 4GSUA 3SKOB 2OQYA 4FJYA 3QFEA 1BJ1H 3QG7L 2ENYA 4Q4EA 2YXMA 4I0KA 1T5XB 1Z9AA 4OF0A 1U1JA 3D4CA 1W6LA 2FYYB 1K3UA 1ZWIA 4JQAA 2BOCA 4G3YL 1F05A 2BSCA 1EBHA 4L8SC 4ZW6A 1J8HB 2VOMA 1LP6A 3NQ8A 5D7JA 4EI6B 2Q8ZA 4JQ2A 5T3XE 5FKAB 1K9DA 2IH8A 3ELQA 3FFCB 1FDZA 1FH8A 2WQ8A 5GGTL 4HZLA 3DTXA 4ALAL 2IKGA 3LEVH 4LVHB 1ETZB 2GK1A 3PANA 3QHNA 3WFAA 1PD0A 4IBWA 5BRZB 4TYUA 4L4VA 2YPLD 3I3DA 4LKCA 2ZCLH 3TA3C 5EHFA 1H49A 4B9IA 4ZFFA 2EBNA 3EXSA 1T7LA 4D8LA 2WW5A 2DKUA 3L0KA 3WIFB 4WO4B 1AHWB 3RJQB 4F24A 4Z0BL 5D33A 1JXFA 5IM7B 1EMTH 1IR1A 1RV8A 3OGVA 2FATH 4YVPA 2Z1SA 5LXXA 4AMAA 1C5CL 1YNLH 1BF8A 1F86A 1JPKA 4FALA 2DMBA 2E9IA 3LKQA 1L6WA 1VBGA 2Y7MA 4Y2NA 2MRYA 5HPMA 3G3LA 3IV3A 4K9EL 3SIKA 3DXAE 5JZ7D 3F7YB 1M2VA 4XWGL 5D05A 4MQSB 5TK4A 1GVFA 3KHQA 2KKQA 2R69L 3ABOA 2ZX7A 4LAJH 5IQLA 3FYEB 3UYPB 5KSAC 1IT7A 1KNWA 2X1QA 2O56A 5FSEC 5E2VL 3P3BA 1Q6CA 2XG5A 5I6OA 1VFBB 1PZSA 4AVKA 2I07A 4A2HA 3QKEA 5EC1A 3DJTA 5L2KD 1F2JA 2QCMA 2X1UA 3NYDA 4H9VA 4B5NA 1SJEA 3MNVA 1UXLA 4QJ5B 2IAMB 1CFMA 5FHBH 1ZANH 1PSPA 1G7PB 3U9UA 3Q06A 1AMKA 3C5ZA 3FQYA 3ZT5A 4AKOA 3VKDA 3DC0A 1VZGA 1BVZA 3IDXL 2CNZA 5DK0A 3L5HA 4PGDA 3CN3A 3KRSA 5AHMA 3EGSB 4EO5A 4MA3A 1I0BA 5HWNA 2ZYRA 1NBCA 4MMYA 4JFVA 4M1DL 4PMFA 1MPAL 1ZWIB 3ZZSA 1LEGB 4ANKA 3BLIA 3HE6D 3NSNA 3TVAA 1AE6L 3TV3L 3FYPA 4ZX3A 1KDIA 3NJIA 2XXFA 4FZEL 3VRIB 3F5KA 2UZ9A 2FT6A 3FAWA 4NQQA 1SVDA 5C7VA 4L9DA 4DZHA 2DD8H 3C5JB 5DI8B 3U6RA 3KE0A 2G8ZA 1B4TA 5F4XA 4U7KA 4HC1A 4ODWB 4IMFA 3MROB 3SGUA 3FU7B 3MCKB 2EO9A 5AB1A 4M6NL 3I75B 3ZE1B 4OGZA 4DBEA 5G4OA 2M1KA 4JPWH 43C9B 1MELA 2NT0A 1V6YA 5BRZA 3B7UX 3OZLA 1AL8A 3AVEA 3KOXA 4Q8PA 4JQ1A 4WRHA 4D6CA 1S5TA 1W37A 3O6MH 1BZOA 4J3UA 3EB4A 1HXYB 3MLSH 4ZSOE 5J11C 5FUZL 2ERJC 3SGDI 4LCWA 5DJXA 1QU4A 2ROXA 1AA1B 1E9QB 3VXOA 4I0PA 1CD1B 1J05B 3B56A 1T03L 3ZGIA 4JTEA 4TXEA 6PTDA 3KS6A 5GZOC 1DBTA 5HUOA 3TFXA 4Y9FA 5LNWA 2EAEA 4K73A 2CK0H 4MAYA 3H2NA 1RJQA 1W0VB 4FL4C 1NELA 5SX5K 3BP5B 1WCGA 4BSWA 4ZRGA 2XQBL 1PB0A 1V93A 1N4XL 4XNUL 3GPSA 3C60B 4FQCL 5KG9B 5DLML 1FJ1A 2G60L 1T40A 4LB4A 3HB3B 3W1TA 1CYWA 1YDPA 2ZCLL 3QXVA 4ONHA 4X5XB 3DMMC 3EX2A 4HHMA 1O5DT 5CEZL 3GHUA 4HYVA 3W72A 4XWOD 2DWDB 2AABH 4UQ9A 5DRIA 1E4IA 1FYTB 3WUWA 2WC4A 4FG4A 3QTPA 2INEA 3N04A 4UIMA 1V0NA 4DGVH 5IFTA 5IHUH 4G6MH 4MMWA 2IV8A 4LBSA 2K3HA 2UY6B 5DY3A 1KFAL 2EIZA 3EWCA 1J9SA 1NARA 1F3TA 5IJKA 1RK7A 1RUPH 2OSLA 1FLRL 4I3RL 4XB7A 4GNJA 1AHKA 2WLIA 3M0JA 1W1A1 4GSDH 1Z3RA 1TQCC 5AKVA 3TJEL 4Z7NF 3ZYOA 1GTFA 1RJZA 3CAWA 4RZCB 4IOTA 5D4IA 1G7QA 1K9TA 3BPOC 3TV8A 4ERSH 2P76A 4AV5A 1ZLVH 1XCXA 1E67A 4TLKA 2XU2A 3S9ZA 1TZIA 2P5ED 1E6JH 2C3VA 3K74B 1W80A 4GAAA 4UT9H 4U6YA 3SOTA 1S38A 1PFCA 5KBLA 2PYEB 1H62A 1X96A 3GTIA 2DWSA 2I7OA 4JY6B 5C0DA 1KCZA 1N82A 1DHKA 1WS8A 1E6PA 3L8QA 2K45A 1EQPA 1QI3A 3EJTA 4P5KA 5BNXD 2RDWA 4JIIX 1BBJA 2O9OA 5EZOL 3NBNA 2WXRA 3KMDA 1QSFA 1GZPA 1OGTA 5MHSE 5DJZB 3K6SA 4FTVD 4FNLL 3IRCA 2Q76A 1FQ0A 4Y0GA 2ZDSA 1PL9A 3CBRA 3HIZA 1ONXA 4YGAB 1CZ8H 5GS1C 4KTDH 2DLEA 1XZWA 3H54A 3Q2CA 2XWBA 2WQPA 1Z7JA 4GJJA 1ZHLB 2NY1C 1QFUL 4HFUL 5J56B 1O60A 3ALXA 2FZNA 3BP5A 3IVTA 4HK6A 3V6OC 4XP6H 1E40A 2W91A 2G95A 3EYPA 4ZXOA 4WFGE 1AD0A 5T8GA 5TE7H 4LE8A 5DC0A 4MCYB 1ODAA 3IS4A 4PRRA 1SJEB 1PCKA 2N56A 3BPLC 5LGYA 3UTZB 5CJOL 4LANA 3B5TA 1HSAA 3RLGA 1UQSA 2P46B 4JQIH 3IV8A 1EGZA 3KPTA 1TPUA 2OO0A 1CLXA 3AU2A 2YCKX 1F0LA 1PTZA 3OAUL 5EN2B 3GQYA 3W83A 2EVJA 3W11D 1U8JA 3V4LA 3TX4A 3DVGB 5GGRB 4FULA 5HDBB 3CASA 1YEIH 3JVGA 2AI0H 4PRHB 2CWXA 5HYIA 1X6UA 3HI1A 4YMPA 5HYSB 4M7TA 4TNVK 4LLQB 4O02H 1TPC1 3LN5B 2VR5A 1LLWA 4D8ZA 3E1F1 5EL1A 3CZFB 4XB3A 4N6FA 4OCMC 3GC3A 4KBPA 5F7MC 4RE2A 3P4OA 2Y6SC 2H6RA 4GO9A 4PB5A 4B5SA 5JUVA 4C60A 1E9ZB 3L3OA 5D1QA 4IK6A 5I0VA 4AEOA 4HBKA 4EPBC 1ZAJA 5AZ0A 2CLHA 1RULH 1RIUH 2C34A 3H7BB 4K5LA 4BH7A 3QHZL 1EZVX 2X87A 5HDRA 3ZS4A 2DIAA 4FOJA 5I7GA 3B2XA 5H94B 1M7DB 4QRRB 3B06A 1ZLWH 1F7BA 3IJQA 4FXRA 1H3UA 4HXBL 4DN4L 5JVLA 1Y6KR 4X4KA 4QOKE 2PMQA 1NLDL 4WLCA 3USBA 1WWBX 4I4WB 4RW3A 5KW9H 1GCFA 1F18A 1KCUL 2IQTA 1EUUA 3MLUL 1RJCA 1G9NC 1ESOA 4K3JH 2FQEA 4ZENA 5B1KA 4A2RA 1S9VA 4Z8FH 3GS4A 3NIDE 1W2VA 4JFUA 3SB0A 3DJSA 2EILB 4WEBL 1IE4A 4ANXA 3P14A 2E6YA 4GAGH 4RQQB 5IKCA 4R88A 3LBMA 4JX4A 1HL2A 4FFVC 5HYJA 3FH5A 4GRLA 1KPRB 4KK6C 4A7TA 2NY7L 5B1JA 2J8TA 2WV8A 1TYRA 3MLYL 4XCNB 4HCGA 1JPMA 3V55A 2REQA 1CZ1A 2AQNA 3BKML 5DZPA 2XWDA 5HJDA 2CDGA 4UR8A 2DF3A 2Z35B 4XNDA 3MGOB 3TONA 2PAJA 1ZQ5A 1JWUA 4JAMB 2NXZB 4WI9A 2KQMA 2IH3B 4UTBA 3DBPA 3UJ2A 3NA8A 1V79A 1XBDA 4HAGA 3MRFB 5I1CL 4NWUH 1SDDA 3PBMA 5J9PA 1XV8A 4JBSA 3KP0A 2E4TA 4AYFB 5ECJE 1Y1DA 1URZA 4P23D 4OWGA 4O2EB 4PJFE 2PA6A 2VZTA 4JMXA 1AFVL 4F58L 5FA4A 2WMIB 4C1NB 1VAHA 5EOCH 4YWIA 5CGMA 2GQ9A 2B16A 5CAKA 4GKNA 3KYNB 5AW3B 3O41B 2JCWA 4N4YB 5BCAA 4MWFA 1C9SA 4YDJB 1PNDA 3EYQC 4N2AA 1J8KA 4UBPC 3OVPA 3ZQ9A 2X2IA 3RAJH 1UCTA 5AYQA 3T6QC 5FI8A 3K2KA 3N3EA 5K9DA 2P5EE 1R85A 1T6BX 5IB1A 3UADA 1FLRH 4I3RH 2EUZA 1S4IA 3AZUA 5AG8A 2X1PA 2J4WH 3PXHA 2E1DA 2HLFD 3HZVB 4R97B 3MXWH 2XVLA 1EPFA 2FJHA 3STLB 1HXYA 5IIEA 3WHE1 3DTUB 3SE9H 2PTDA 4CMHC 2Z26A 2ZZ5A 3LNPA 4PRWA 1R5IB 3SN0A 4RDQG 3TBSB 1BFNA 3GUGA 3T77B 2W88A 5JHBA 1S7XA 2X7LA 4R7LA 3ZWTA 3QA3B 1E0XA 3O9WD 3BD4A 4NB7A 2DI8A 3HHMA 1RR2A 2DP3A 4XNBA 3JTBA 2I7SA 3UYCA 1QBML 1NEZG 1OCNA 5FF2A 2CKRA 3KLAB 4KOBA 4HF5L 3EWBX 3IJHA 1VR6A 3KPLB 3SDDB 3APDA 2AV1A 3ZE0F 4YXHH 4BZYA 1QI5A 2H3KA 3GJFA 4A3HA 1I1FA 1LEGA 2VMJA 2FHCA 4KWUA 3AQZA 3TW6A 4Q56A 3U4BH 1WB0A 1CD9B 1CL7H 3NFSL 2W4XA 3L2LA 3QHMA 3CVIL 2QV2A 3FO9B 4GUPB 15C8L 1A6WH 1VPOL 3IFOA 4PW9A 4WI4A 2IGFL 1ETJA 3BD3A 5EC1B 3RIFK 1SFDA 3HFML 1VRXA 1IFGA 3ZPDA 1FWXA 5FCSH 7PTDA 1FHGA 3UESA 2B2XL 4PG9A 3AG1B 1V7NL 2K8QA 1JGLH 4QTHA 5I8EA 3VXQB 2HJPA 3FSWA 1H1NA 4OZ4B 4M00A 3SDDC 3MRIA 2VDLL 3LMJL 4HCRL 1EZWA 1OVZA 1JQVA 2EG6A 3ZYJA 1TYEB 3F12A 1U36A 2IQAA 3BI9X 5IBXC 4P0DA 5DA0B 3N6QA 4O5LH 4WNSA 1Q94A 5AYTA 4KMTL 1W9UA 3DJ9A 4KFZC 2ZBTA 4P5UA 1UWSA 4L0PB 1MHPH 1EDQA 1Q65A 2FEDD 3SZ8A 5E1HB 1F8IA 4NZFA 4OR1A 4CMHB 5C0BB 3S5ZA 4KCUA 3O0LA 3ZWSA 3WUGA 4AX3A 4GQ0A 1KXHA 4GMTL 1OY3B 5M95B 2C9UA 4EDWH 3K1GA 1HL8A 1PKQB 3L5XH 5DYOA 1NP2A 3I9PA 2B8OT 3GU9A 3WUFA 4DTGH 3P02A 4XC1L 4AD0A 5B38G 1MLCA 4JHWH 2QUNA 1OD0A 4KVCH 3TPUB 1XKYA 3PULA 2CCRA 4U1MA 1LG2A 1GGIH 1AJ7L 2WXNA 5GJTH 1OFBA 1M57B 4BIKA 5IUCA 1KN4L 4DM2A 1W3KA 4D9RE 2VDMH 5FJUA 3G6AA 1XUZA 5BO1L 4J8RA 5EUOB 1PDZA 5C2GA 2J7BA 5GRJH 1AS6A 1BYOA 4DZBA 4UTWA 3TWCL 2W63A 5MEPB 2K0RA 2RAGA 2P45B 4NZ4A 3D48R 4PLOB 4PB4A 2CUHA 3UR2A 3VNDA 4Z7VA 4N1CA 4AHOA 4OZFG 4YXKH 3X13B 3VNJA 3A5FA 4XD6A 4TMCA 2P5WA 2WLLA 2A5UA 2G97A 3KOYA 1QI0A 2CW6A 3CXDL 3G8RA 1ODUA 3KS5A 4NFDA 4MDJB 3VIKA 2KHAA 2O9PA 2WO3B 1NCTA 2CJUH 2WLIB 4LCVA 5DY2A 5J04A 4NILA 4CC4A 3DERA 3QNYA 2WTOA 5DWPA 3ARGD 4RAUA 5DJ8A 1IGWA 4HJWA 1IJNA 4GPVA 3GNDA 2VMFA 2MTPA 4PJ9D 4JKPH 4NFBA 1CF8L 5HDBF 2AJ3B 3S2AA 4APXA 4KFOA 9XIMA 1CGUA 1JNLH 3HN8A 1LOSA 2WUCH 1LQAA 2DWDA 2E25A 2V82A 4RISL 5AOZA 3W57A 3CHOA 2WSYA 3AMGA 1A6TB 3PHOB 4Y1AA 5FYLH 2L7QA 2JALA 4JFYA 2H6PA 1FFQA 5LAPA 3SQOH 5A8QA 1HE8A 1C8XA 1ETZA 4GEJA 2Q6WB 2Z7YA 2GK1B 3O2LA 4PTMA 1CYXA 3OAZH 4G8EB 4N8CH 5CD5D 5IW1A 3MCNA 1YNKL 5BVJA 3P9MA 5FCZA 2QUTA 4KQNA 3VMPA 1F2QA 4JG1H 4LKXA 4JFDE 2Y5EA 2BTMA 5LCVL 4JCWA 4G7EA 3NCMA 2JKTM 4GAJL 3MJ9A 4GVFA 5F7KC 5GS0L 4PJ5D 3GO1L 2O5NA 4PJGF 3RGVD 4BJLA 3EA2A 2W0LA 1UZHA 4B5VA 5D1XC 3QB7C 4LAZA 4Q8MA 4JM2F 3APFA 1HXKA 2OX1A 2AANA 1EHLL 3MCG1 2NTFA 2R0WL 4F8XA 4RFOH 3MLRL 3UZXA 1OAUL 1DQLL 3K72A 4DJFD 4NI8A 4DVOA 1BVNT 3JRKA 3PB2A 4GXPA 4MVBC 1BXUA 3GSUA 4G1MB 4YLQT 2N1KA 2EPKX 4MZ1A 3U30B 3OQRA 4L1GA 3WKNA 3K5RA 4LCCC 4NKMA 2CDGB 1TTAA 8PAZA 3AABA 3V6ZB 4GW4B 1GR7A 3UG8A 1T8XA 2G9HA 1CFBA 4ZOAA 3LLFA 3W7PA 4L23A 2W62A 3KRZA 3NEXA 1WZ1L 3SDXB 2ZXEB 2DIKA 3O2DA 2JIEA 1YYMH 3ZLFA 3HU7A 1CDBA 1OM0A 5FM5M 3PZUA 1A5LC 3OJ2C 3TZFA 3GO2A 3NZQA 1ITUA 1WAPA 1O0VA 2FZ3A 4OGYH 1WBZA 3RDKA 3UR5A 4LDCA 4MA3B 2X0YA 1WGOA 3LQZB 1XAUA 3O11B 4JFTA 3NT0A 1XYMA 4AISA 4AZCA 2QKIA 2YQGA 2ICES 5C7XL 5ICYA 4ZUTB 5KVMC 2DZWA 4OQVA 4HKJB 2IMRA 3B5HA 3TW7A 5AC4A 5D2WA 1K8XA 1JPSH 1H2JA 5HGDA 3NZHH 2ODIA 2DZEA 3ZKQD 1X39A 1OFDA 3E0GA 3LHZA 4QNEA 5D8ZA 3TDFA 1NFDF 2JCCB 3QPXL 4ZZ9A 2Z7ZA 3DSFH 1QK2A 2YBGA 3BZFB 3Q9PA 5JXAH 3GH4A 4KROB 2NQZA 3I75A 1TJGH 3P1VA 2VIRB 2ZXGA 4YFEA 1W72B 4NO3B 5IVOA 1IXNA 3Q8CA 1E5NA 1MNNA 4DLMA 1ZVSA 2DI7A 1V08A 4IGBA 4PGCA 4GPNA 1AW1A 4NOBA 4DZ8A 4GJIA 3ZRCC 4OCSL 3TC9A 3UA3A 1X5LA 2OJZL 4Y2OA 4X61A 3IANA 3KVDD 4FNPA 5EU4A 3U4KA 5F3BB 2R1XB 1IBZA 1UM4L 2Y36L 1SN0A 1NBZA 2DM4A 3U9PL 3KPQA 1KRMA 5DMKA 1IARB 1JXDA 5T5FL 5IOPB 2BSLA 3BAKA 4WGXA 3GMNB 2H3DA 4H1ZA 3BEWB 2VX6A 1M7UA 5E8OB 5IQ7H 2DM7A 1U6AH 1NUFA 4WI0B 3VG9B 3ZTEA 1GHRA 5LN4A 4O2FA 1P1XA 1RPXA 3VNLA 4CA4A 3R11A 3EEGA 4N02A 3VQMA 1OX4B 2WLZA 4OZHE 5B3SB 1OKEA 2ITFA 1P6AB 3T8VA 2JKPA 4G8TA 4OFCA 1HG3A 1P5VA 4LBEA 3VD2A 2R4RH 3DKHA 2DBJA 3E0IA 5TFSL 5FM8A 5KVFH 3SQMA 1HQ4B 3D39E 2ISSA 3MV9E 3NWRA 3SDXA 4O4YL 2KI6A 3OG2A 1SW3A 2WKOF 4MZ2A 5B1CA 3IGKA 4JZ5A 4UB9A 4JFOA 1MWAA 2JVUA 2YPVL 3THAA 4B5UA 5LHDA 1JWSB 1RZFL 3RO6A 2Q8AH 1GYUA 1WBZB 4PUUA 1E0OB 4R85A 3NOYA 3K1DA 3IJEA 4YFLI 3JTTA 5JHDD 3SE8L 4P7LA 4P4KD 1BKSA 3B9AA 3BLPX 4NAEB 3UXIA 4AWUA 3U7YL 3FJ4A 2MHAB 3BZDA 2Y62A 5DZNA 1UKQA 4TQEH 2AJ3A 1LO2L 4KKBC 3ZR6A 4ABUA 4P7NA 3GIZL 4Y4HB 2ZNXA 5DMIH 4BCXA 1XLKA 4PY7A 1A4MA 1B0RA 3IIZA 5ABFB 4FK9A 1AAJA 4PBWD 2J1XA 1E70M 1JMXA 1VGKB 2TRSA 4NJJA 3ZVVA 3ERPA 2DZTA 3Q01A 4P9ML 3Q48A 4QRTB 3D3FA 4WIQA 3FYYA 4XVDA 2EIKB 3S5SA 1E1CB 1UCWA 2QF8A 3P9MB 1HI6B 2K9FB 5K59E 4DQWA 4Y6GA 2ARJQ 1BVKB 1ACYH 4HS3A 1RZGB 4HLZG 3C2YA 3SEPA 1FBIL 1DVJA 1DFBH 5F44A 2C16A 4GG6E 1F9CA 2KMWA 1KYOJ 3H2WA 3HNTL 5SWUA 5IHHA 1AR1B 4IIFA 2G9KA 1PZ5B 2K1MA 2VDNH 2FQIA 2GGJA 4P4RA 3S5OA 3CZGA 2HROA 5XIMA 1IKNA 1OTSD 4PREB 4S1RL 1ZCRA 4P4KC 3L95B 1M05B 4Z7WF 5KYXA 2IANE 1ZGLB 3BKCL 4YK4B 2H3NB 3VIHA 2RJMA 3ZXWA 4B3ZA 4KV5F 3DX3A 3V4UH 3UJSA 5KBMA 2AI0L 3ARBC 4AZ8A 4I5BB 2A4CA 1WYIA 2NLIA 2BVQB 3RK8A 3ZLGA 2NXYB 1IGYB 1NSNL 4L37A 2VE6A 2COQA 3F6LA 5FC9A 2EEBA 3RMEA 1VEMA 4FG6C 1Z1WA 1YDOA 2OVLA 3MC0A 2PO6A 1VBHA 4QSHA 1MCCA 2UZIH 3OKNB 1W5OA 1MZZA 3HUJE 3CGTA 4HUUA 1GKOA 2EE3A 4REQA 4W87A 5IB3B 5GGVH 5T1KB 4MNLA 2GGIA 4PUBH 3CDGA 3ATBA 2VUKA 2ZCKH 2ZZUT 3CQHA 3ZBMA 3FCPA 2Q7AA 2QNEA 4XVUC 4ZUTA 4BM7A 2O6CA 4ZAKD 2BNUB 3POCA 1BAWA 3QQ9D 3RWDA 4WWOA 3TV3H 2G96A 1NLBH 1Y1UA 4PTNA 3WDPP 1A2YB 3S6CA 3GI9L 1FFNA 1RP8A 4F3FB 2UZYA 1OAZH 1D3HA 3GC4A 2NY5H 4TVSa 4U3CA 2DLFH 4F8PA 2Z2AA 3T2QA 1MCKA 3GK8L 1XCFA 4LSQH 5D1QB 3LSCA 3MUAA 4A6YL 2FLRT 5J0BA 2E09A 2CIIB 5FM5O 3KLDA 2NY3B 2HZGA 1ZLVK 3ZHNA 4PRNA 2DQWA 4LLYB 2I85A 4B3VA 3FUHA 5MI0B 5TGBA 1O94A 5E5CA 3FT0A 2UVFA 5DZ9A 1SHMA 2Y0SA 4GUQA 1X1ZA 1ZIAA 4JUTA 4U6XB 5HGBB 3WUEA 4BY3A 1NSJA 1OAYL 4TUKL 2VWEE 1X7QB 4TMPA 3RBGA 5ADOL 7PAZA 1FUNA 3C8HA 1MWAL 3CZNA 4INFA 3EZ4A 4FFYL 4LEXH 4QJ4B 1ZBWA 3MBXH 4YQXL 4R7OA 4XKYA 1PKQE 5I3JA 2ADGB 1A6VH 4ZNCD 3IDMB 3EFOB 4YR6A 1XM3A 4GINA 1HOCA 2DY3A 4UWMA 1RIUL 3CIQA 1AO7E 5E1QA 2YL9A 2COVD 4FFTA 4FA6A 1MEXL 2X40A 4GUFA 1ONRA 6ALDA 3EPMA 2GTWB 4FEMA 1W3LA 5LA1A 1PLBA 3QJZA 4P3DA 4WFEE 2Z1KA 4YNYB 3ALFA 3OZPA 3JR2A 5KW9L 2X1TA 1C5BH 1FNSH 4W9KC 4AJ0A 3DFTA 2DWEA 4FQ2L 3M7SA 4WY0F 3S3GA 2BDQA 5E8PA 8TIMA 5AYUH 3FEMA 5TE4L 4Y7OC 5C86A 5KS9E 4WXZA 3TBTA 5IMLB 2ZG3A 3G1RA 2WKGA 1NQBA 2NYYD 1EOMA 2RJHA 4A8LA 3KYAA 5KOMC 4AYFA 3DG3A 4U1GC 5IJBC 1TVHB 1G69A 2P43B 3PAVA 5JBDA 3EEZA 4FXGB 4Q6IA 4P8UA 2YR3A 1EQWA 5HHOD 5ECUA 2EVGA 4AENA 5F71A 5D1ZC 4G6AD 4KCWA 4HH8A 4JZOA 3P54A 1NEPA 4YZFF 3UEZA 2FBJL 3VI4E 3ZDZF 4YO0B 4ZNEA 2GPZA 5DEGB 4HJ0D 3GFZA 4AWEA 2WQVA 3SCMB 4P49A 3SE3C 4GAYA 4AVHA 1Z41A 5EU5A 3TYFA 3P3SA 3FONB 4YH6A 2RIKA 1CF1A 3NFPA 4UTCA 4EKJA 1DTNA 2HJFB 5CJ5A 5ITFA 3RCNA 2BLEA 1QBBA 4E4PA 1TR1A 4AC4A 4XZWA 4OCRL 1S7TA 5E51A 4D94A 1KLYA 1TSIA 3WLBA 4FN0A 4HCRA 1QR1B 2WMFA 1WDAA 2LAGB 4ZMPA 3I6EA 2E9JA 5REQA 4DEFA 2QIIA 4GT0A 4Q0XL 5I1EH 3ROOB 4I0PB 2F6AA 5FAGA 4G43A 1T20B 4CUCA 3GWQA 2VZUA 3IAQA 1P4IL 4QHLB 5DD5L 3IM1A 1TJHL 1E6NA 5L88H 1EBGA 3W6YA 1NFDB 4KKBD 2F15A 1IBFA 3O4LA 3JBG7 5DMGC 3UC0H 1VRDA 4PJ9B 2B2XH 5GS2H 2PCFA 4QWWC 3OXRA 3PZIA 4QE1A 1JGEB 1HINL 4UR7A 1TPXC 5HI4C 4ALDA 1LGVA 2ZOKB 4JN1H 2DEPA 5G55A 1XD1A 2F1EA 1UJPA 1HYSC 3E5PA 1T22A 4AI7A 2VKZG 3L7FA 3THQA 3C60A 4HUMB 5KG9A 2ZCKL 2ICWI 3VI4F 1I1YB 2H2SD 4B41A 3H2OA 2ZKYA 4KXZI 3LA4A 1EFXD 2F18A 5G1MA 1QA9B 4I3GA 1T1WA 5EO0A 5A8NA 4IKNA 1I4FA 5AW8B 3S36H 4AH2B 3BCJA 4R26H 4I7UA 3C2FA 2WZ6A 2BHYA 3FU5A 4N25A 1QO2A 4Y4KC 3EXRA 4PRPB 5JO5B 4JR5A 3MA9L 2BOGX 2BP3A 2AKRA 3FBKA 3FCTB 1E7VA 3AIWA 3GNOA 3SCUA 1AY1H 4OM0L 5E00B 2NY3C 1YPZE 3NIGE 4C6QA 1GOXA 1MF2L 4LHUB 3AUWB 1QPOA 1WO2A 5DJDA 1A80A 2XVNA 3JW7A 2QS8A 5ISZE 2OKMA 3K3QA 4K2SA 2JB5H 2YCEA 1GS8A 3TX9A 3MW7A 1WCBA 5L2JB 3CFJA 3DX9A 1YDYA 4HIBA 4UT7L 5HPOA 1OGAA 3FQRB 1HL4A 2YBRA 4UV4H 2BOEX 3FA4A 1QYGL 1AXTL 3F85A 4NQXA 2VC5A 5F9OH 4GOSA 2R1KA 4YLBA 3F7JA 1LO0H 4M8QB 2IAMC 3HV9A 1VCGA 4ADGA 2CK0L 3DETD 4QHPA 4C6LA 3MV7D 4KWVA 4E8CA 2C9RA 3G8EA 2VIRA 1U5VA 4PJEA 2R59A 2Q02A 5EBMB 4ADUA 4DJFC 4EXAA 1GSKA 5E2JA 4JFED 3AJXA 3VXSB 4JTGA 4MKNA 3LRMA 1JWMB 3VSVA 5IB4A 5DO2C 5C2XA 3ZVHB 4Y2DB 1L6ZA 5CHNB 3LNGA 5EU6D 3WNLA 4ZUSA 3WTWA 2W79A 3C5QA 1U8CA 3K1KC 3KBNA 1HAWA 4PAZA 1V03A 1WV7T 3EYVA 2AXHA 2ZE3A 1XIJA 5A94A 1XW8A 4ODXA 5FL0A 3QUXC 1JNLL 4CD5A 1F3DH 5DC4B 2RDXA 4N28A 3KPSD 1VCBC 5AZ2H 1XI3A 1ROWA 1HXMB 5I9QC 4LEOB 5E99L 3U25A 3I7SA 5BMWA 2OLAA 2YYUA 2WAHA 3CPRA 1XT5A 2VDPL 1L9WA 1AUSL 3M47A 3DV6B 2QCCA 4HOXA 1JGVH 5D7JD 3EO9L 1KGCE 1MDRA 3B8UA 3KTXA 4KRZA 2NY7H 4DN1A 3RKPA 2OX4A 1OSZB 5BOPA 3QI9B 5HXMA 4CMMA 1ZBVA 4M93C 3B8SA 3MRGA 1FZKB 4F0SA 5IQNA 2YD3A 1OF2B 3AS1A 4TSBL 2PWDA 3F83A 2YPIA 4K3EL 4BZ1L 2AMUA 3HA0A 4X7EC 1JZFA 4HQQL 3NJXA 5D7EA 3TZNA 1D5MB 3H3PH 1SYVA 3MREA 1ZT4A 3G08A 4Y4KA 2DQIH 1W0WB 4L1LA 3GG7A 4UF7C 4KF1A 1BBJB 4R4FH 2Q20A 4PMYA 3QE5A 3IXTA 3QVAA 1R3IH 4R96B 1JTTA 5KYYB 1H7RA 3EPOA 1ISXA 4E5XB 3E96A 5DFVC 4K8GA 1DQML 2HJKB 2ADIB 5B80A 3LTPA 3NRFA 5HSFA 3NFSH 1TVDA 1FNEB 3E7JA 4M7KH 4NM4L 3E2HB 4NQEB 4HWEH 3OP2A 4L5FH 3HG4A 4EVZA 4MFEA 3RVVD 1D5IL 1A3ZA 2AGTA 1NAMA 2W81C 2B59B 3NFNB 1LP9F 3RPBA 1I4NA 4DWSD 1C1EL 4ESKA 4RAHA 3QR3A 3W9EA 3VC6A 5DTFB 4MMXA 4EIGB 2Y9RT 1HKMA 3UAJC 2GJNA 3TJPA 5F1IA 3FUKA 3O63A 3SSZA 2JTDA 4HULB 1DO5A 4ZGYA 4N24A 1FP9A 2XN0A 4OLEA 4TOYL 4JG1L 3O3BB 2HCVA 2Y7FA 1JGUL 3FSUA 4OOZA 4H8WC 3PC0A 2FLIA 1A5UA 1SNRA 2K6WA 4LCWB 1M71A 3WIIH 2H5UA 2O61B 2BVDA 4ZFMA 3THUA 3EKLA 5HDQL 2AJUL 1FYTA 2BWDA 3WUWB 1MCQA 1T7YA 2PWHA 3UBHA 1UP3A 1XQ4A 2XKNB 1O66A 4JPKH 4NO5B 3SCQA 1Z9SA 2DZSA 1UXMA 3KPOB 1N3NA 4AQZA 1ZHKB 3VG9C 3ZIYA 2ZADA 3TXAA 2ZOKA 1S78D 1EIBA 1Q4NX 1YEJL 3HAEH 4QF1A 3MA7A 1N68A 5KJ4A 3H42H 3T0VA 3DJZA 1JPFB 4GRLB 4L1TA 1RMFL 4M9OA 4HJSA 7FABL 3NL3A 5G5IA 1GZGA 5ICUA 3FU6A 3CSFA 2BP5M 3FT9A 2YMOA 4HWEL 4NM4H 4ODHL 3UIZA 3T1WA 1R3HA 1XHGA 3LEYH 4X50A 3FDKA 4MG4A 3QQ4B 1OF2A 4IHOB 1IAIM 3EA3A 4KTDL 1CLCA 1MUJA 1P4UA 1WZ1H 4OFIA 3TO4C 5IMLA 1IXOA 3ILQC 2CLKA 2Z7KA 4LUSA 2BVTA 2JKRM 5DO8A 3XINA 2Q8BH 1S3HA 3CBJB 4PLKD 4NKIL 2WKJA 1TZGH 2CBIA 3WJXA 3LKNB 2ICEA 1HKFA 3KBPA 5CLWA 4WFFE 3U82B 3NJJA 1XPYA 3ANUA 2EIMB 3WSQH 1F5ZA 2ZYIA 3C6EA 1ZRQA 4KEMA 2ALDA 3TJXA 2QUVA 3O0KA 4O17A 1U93A 1CUOA 3U4EA 3TO4B 3CB3A 1FIEA 4YNGA 2Y2WA 4MJ4A 4MNJA 4R7XA 5HHVL 3GB6A 3VWKD 3OA3A 4B9GA 3H2QA 4Z2GA 1Y0LA 2ZG2A 3MRBB 3POHA 2MPVA 3BICA 3QARA 3A0OA 4PS3A 4YDZA 1R0AH 4QRPD 2B7QA 2ABBA 2ZDRA 4P9HH 3PTQA 3IGAB 4J4PC 4EPDC 2OJ1A 4JQVA 1W8GA 1KCUH 2OYLA 4L05A 2DWEB 5E6UB 3RIFF 1QPPA 1E6RA 5TNVA 1U3HA 3S1UA 1BQUA 4WX2A 2FTYA 4FFZL 1CO1A 1LQ0A 5L8LB 2ZQKA 1V7NH 4LCCB 1Y8BA 3MBWB 4RDVA 4YCOA 2XZAL 3WNNA 4ZDHA 3B7YA 2OQJB 5HI4D 3WJMB 3BGFB 4HH9B 5DGRA 2Z92A 2EYRA 4FCHA 5BZXA 3N9KA 3ARBB 1ENUA 3ITOA 1EDTA 4TU1A 4HK0B 3WEBA 1IAII 1B4KA 2WQSA 1A6WL 1VPOH 1AI1L 2B4CH 2BFVL 4ISVA 3GIVB 2DFAA 3D33A 3IDGB 1SXAA 1NFIA 2XYCA 4TKWA 2ZCGA 3E2SA 4YTRA 3VCCA 4CJ1A 2G4FA 2BFGA 3FDGA 1ZE3C 1CLYL 2P48B 1XISA 3L5MA 2F6KA 1UTDA 1EXBA 1S8DB 2XTJB 2YK1L 3WQEA 3VWKA 1V7YA 1LQ2A 1RCOB 3RDTD 2LR4A 2CPUA 4M4RB 2WXJA 4ZW3A 4D9RD 1JPHA 4NKOA 5INCB 4X6DA 3VB8A 1HKLH 3S7GA 4L8DB 4LCIL 1RCXB 3I7QA 4GW1B 3PFMA 3NQFA 3T09A 3S34H 1DQIA 4J3VA 3UWEA 3T77A 3OQEA 2ITDB 4W4OC 5E2WL 3VI4B 1XXXA 3QR1A 3ARPA 4ZX5A 1QNRA 1AO7D 1NCGA 3HGOA 4NZJA 4CNTA 2O1AA 1G7IA 2OMVA 3JUZA 3FYIB 1UATA 1OANA 1B0IA 3O6FC 4LVOC 1F61A 2XIMA 2GABA 3CS2A 3H56A 1NC2B 4UM8B 1VBJA 4G7VH 4PTXA 4PH6A 3L7EB 4ZD3L 1ZJIA 2FEEL 1VSCA 2WD0A 1T2XA 2QHRH 3HZYB 4UFKA 3W7RA 5C0RL 4F92B 2RTTA 2YD5A 4NT0A 5A6JA 2NW2A 4O9HH 1S7TB 4OGQC 4UAOC 1IC4L 5FYJH 3SADA 2LU4A 1GKQA 4WUUE 2VJ0A 2ORBL 3GD6A 3HE7B 3NIDF 3RZCA 3D08A 2OULB 4B90A 2E1WA 1MQKL 3QJSB 5TAOA 5DRXA 1EZ2A 4Y5YB 4CBZA 2JQXA 5FF0A 5M94B 1YPFA 1HT6A 4JFPB 3SDOA 3EJCA 5C0AB 2NCMA 5ELIA 2WK2A 1J79A 1A9BA 1BMZA 1DL7L 1CVRA 2QELA 2VLJA 2PCFB 1P5BA 4NZTH 4Y2DC 4D0BB 2FO4B 1ZV9A 2G5BA 1YEHH 4FOMA 4MX7B 1N67A 3QDJB 2H8ZA 2XWCA 3CFQA 4FXGA 5A95A 1MFCL 4HLZH 2FJGA 3APMA 1K4CA 2HFFB 3HI6H 4OFPA 3Q37A 4WK9A 4QXVA 1A3LH 3TWBA 3PL6B 2PUQT 3D6GA 3VRJB 1N6VA 4NUQA 2UZXB 1DSWA 4TIMA 5J3HD 3TO2A 2X30A 2YCIX 2QSCL 3LYRA 3KTSA 2FBOJ 3T4YA 5K9OB 3QUYD 3RIAF 1XFPA 4OLUH 1RURL 4PR4A 3FONA 2H6OA 5ES4B 3SBQA 4W6XB 1OP5K 3QQ1A 3SDAD 3MRKB 3F4WA 2ADJB 1MRDL 1I7ZA 1GH7A 2O6FA 2P44B 3L48A 5ANMB 3SGKA 2YC1A 4KITB 1Q6FA 1NFDE 4FFZA 1TREA 1XJBA 3EB3A 4LV4A 4HNVA 2XA3A 3N41B 5H6HA 1S7UB 3GPEA 2NLJA 3L6FA 4XNUH 4HGWA 2DH2A 3P4NA 4JZNA 4XHJC 3ULUF 3H23A 3OB8A 1IVLA 3ULVL 3MSDA 3ARYA 4LSPH 2VC2L 3T4AA 3LUTA 3RX7A 3VD9A 4R7DA 5EULV 1BZ9B 1M2VB 3QIUD 1IGFH 3DA0A 3MRLA 4HVBA 4ZNEE 4LHJB 2DQJL 3W6LA 1MCBA 2EXWD 3APGA 4UTIA 5AD0A 3VH8A 5HVGB 4Y8AA 5EDSA 2BWQA 3RPDA 5IY5B 4F7EB 4LH8A 2OZTA 3AS0A 4U1JA 1HAUA 2CLRB 2OSWA 4J4KA 1AYRA 4GY1A 1OIFA 5DMMA 4I2XA 2YLKA 4M48H 4IBUA 2CCVA 4AD2A 5AC5A 4LVHC 2J1ZA 4FC3E 2VSKB 3MCOA 4BQCA 4H9UA 4DZBB 4GKLA 3MI3A 3B1UA 3BH9B 3IGUA 4OCWH 2XM1A 4IJCA 3LZ3A 4PCNA 2HEJA 3HZMA 4ZPVA 3BISA 1NGYA 3FKUS 4OZ4A 4YIQB 5AHNA 4C56D 3BRGC 3GBNL 4WK4B 3FF8A 1IFHL 4URIA 1EA9C 3CDYA 3MV8D 5BPPA 1FTXA 1WBXA 2OMTA 2VX4A 2OX5B 4HPOH 5D2NE 2M83A 2G3MA 3U30C 2EQDA 3R8GA 5J6SA 3V0VA 3FU0A 3TYZA 4WO0A 2EPLX 1R3HB 1LO2H 5CCGE 3G24A 4CGTA 2W6RA 1FDLL 2X6VA 4LV9A 1DE5A 3DSNA 2PDLA 3D4YA 4DQOH 3CUXA 3MZ2A 3TBYB 4LX4A 3ZZLA 3Q45A 3OZMA 1Q2SA 2QVHA 3K0WA 4MVAA 1FVEA 1A7PH 4AGLA 2V6AA 3E6FB 4I0PD 3GIPA 1IEQA 4GBXA 1UIOA 5CAHA 1ZUAX 3QPEA 4N9GA 1BD2A 4NM8L 1L0YA 1Z6KA 3GI8L 2X89A 1ZA3A 2O92A 2WWKT 3MO1B 5EIIG 1BVLB 3P77A 5CWSB 3TIDA 1B31A 2GSHA 4IRJA 3ZTCC 1OGPA 1Q6EA 2C3XA 4HSNA 3IJ8A 2VLRD 2GJZB 2ZAHA 4IRSA 4MMZA 5FR3A 1O95A 1M9SA 3R8HA 3BDYL 3K4ZA 2HVJB 4Z7WB 3F58L 2NSMA 3CXHJ 4NT6B 4AT6A 4HBQA 5EV7A 1RJYA 3DV4B 3R6IA 3GRWA 1SF3A 1CR9L 3KYMA 1SXSA 5EOCJ 5C08A 4KJQC 3FOMA 2FZ3B 3MJ8B 3GUWA 3NG5A 4O16A 3VXMB 4GZJA 4YBQD 4RLIA 2AV1B 3SKJH 1ODZA 4Y96A 3TZVA 3CFMA 3QUZA 3PWGA 1ITQA 1ERNA 3OR6B 2WGNB 1SJDA 4JGJA 1OC7A 4MZIA 3WNJA 4QXTA 1NF7A 2PR9A 2WXFA 1U2HA 1PAZA 1DEEA 3ELAT 4M6ML 3V0IA 2WLMA 1MRCL 1QVBA 3ZK0A 4JFWA 3KNBA 2WNZA 3UP6A 4WV1B 3WBDA 3ZKXC 2ZWLT 4WFED 1DLFL 3RY5A 5HHOA 3H7LA 1AKJB 1MIML 2XWTA 3ABLB 2O7QA 5IBTH 4YPJA 5J9PB 3LEVL 5IF0B 4L0ZA 4RZ4A 4E0CA 2IFFL 1LL7A 2VJXA 1E56A 3MCYA 1FP5A 2W80C 1IBHA 1ZT4B 1MNUL 3G08B 3JWNG 3SGJC 4AXWB 1KBLA 3UTTA 5G5DA 4NAEA 3HGJA 2Z93B 3LIUA 1G7HB 3HG1D 3NIFB 2ATPB 2MMXA 3AWGA 2A83A 3S3CB 1T1ZB 3RUGE 3QIUB 3HMWL 2NUTA 1ES0A 2VKXA 3VA6A 4BD4A 3CV5A 3MP3A 1BEYH 4FLSA 1NAMB 5AYXA 1CG9A 4Y9MA 4KY1H 3ECBB 3BUVA 3DI1A 3EMQA 1R19A 5C07D 3LQGA 2CITA 1RHHA 4OGYL 1QRND 1W16A 2QCHA 5EMLA 2ICCA 3MYZA 1XU6A 3W74A 1HQRA 4MYAA 4US5D 3B7SA 3IIOA 2VDKH 2HRWA 5AB3A 3UZEC 3WQWA 3L7RA 1Q9LA 5CU9A 2Q1EA 1T89C 4H04A 2Z31D 3VZXA 3O6ML 4MDIA 3T08A 4GQBA 1F4HA 1LM8V 4KK8C 1JYWA 2YZ5A 4AZ5A 3TA9A 2WZPA 4IOFC 1ECEA 3QN3A 1FWEC 4JTTA 2O9RA 2ZE0A 3ARUA 3NSYA 1SY6A 3TGXA 3NN8B 3VE0B 2N1TE 1NIEA 4PJ6A 2D2GA 5FEPA 4M82A 1DVZA 3WXVL 4YHEA 1CFTB 2E7BA 3GSNH 3TH4T 4ZTOL 4Y9AA 5I6SA 2BRQA 1SEQH 1QMLA 1POJA 1JE6A 3WD2A 2GCYA 2VABA 4JANB 3W7OA 2J5LC 2DZPA 3NJGA 4JGMA 1H51A 3QV6A 5BS0D 5EZIH 4J6IA 4ZQKA 3EX1A 2BHFA 1XKJA 1P5VB 1NKOA 4LBEB 2ZZ3A 3VRLE 1IEIA 4MAUL 5FYJD 2VFIA 1BPLB 1OQFA 2DSKA 3IDXH 3WY1A 3UYRL 3FFOA 3C75A 1E8YA 3BSGA 1UWIA 3ATZA 6A3HA 4TV3A 3HB3D 4TVPL 1OP3K 5HWMA 3INUL 1SJMA 5I24A 3HG5A 3KLSA 3QSKB 4QD2E 5D1QD 1BYDA 4REQB 2V7HA 3BDBA 3VTMA 3BZEB 3BG9A 2J73A 4HISA 4PV9A 3NCXA 3PV7A 2HG5A 4AVIA 4TPRL 2AAVA 1UA6H 3ILEA 2FD6L 4PJAE 4AQLA 1IC7L 1NGWB 3WTVA 2Z1WA 5HNUA 2QL1A 1EO8H 2DQHL 1Q5MA 3T4AB 2VC9A 1LYQA 4Z7OF 4RNFA 1QUMA 1Q6LA 3PUOA 5FO7B 5A7EA 3VNYA 4O51A 1HWWA 4QAMB 1ILUA 4MZYA 5TDOB 3TS8A 2QKFA 2L7UA 1CBGA 3F7YA 1I8MB 1UYWL 5F2MA 1WWWX 1U8NA 3N18A 5CZVH 1MG3C 5HI3C 3W1UA 3HE7C 3RUGB 5JPMB 5JMUA 1X6NA 2EE6A 3RURA 1AMXA 4Z0XB 4C4KT 1KFLA 5I2IA 2CJTA 4XHJD 2ASHA 3UTPE 5F0JB 2Z00A 1S7QB 4AV4A 3N12A 2Y8KA 2CE6A 3N2OA 4RMUA 3JWDC 5I1CH 4H7CA 4IP7A 1DTUA 3PGFH 4KGJA 3CV7A 2XN9D 3PP4H 4KVPA 4DO7A 1OF0A 2CA3A 4WI2A 3WFDH 5IEKA 3MLXH 4Q4QA 1I1AB 1MEXH 2D7PA 4EZLA 5J1SC 3QYNA 2QPXA 4H6EA 5DX7A 5C0AE 4GO6B 1LO0L 2XLLA 1L5GB 4NDMA 1NIUA 1OAKH 2V5JA 1FY6A 1PJWA 4JOMA 3QDJA 3Q1SH 4B9PA 3I3EA 1DJWA 5DVMA 4YEFA 5I6MA 2R56H 1BW8A 2V2CA 2WLJA 1O12A 1W9BM 3A6CL 2VCAA 5LKYA 1SO4A 4ENLA 3AZRA 4MSWB 3F03K 2ERJB 4CKQA 2JKWA 3IWVA 4ACPA 1N7KA 4G9FE 1XC6A 3NL2A 3DHMA 1T2QL 3BMVA 3IT8D 4QEEA 2CGYA 4GSRA 4LSUH 2ZNWA 1A9EA 2ODOA 2PPGA 5ABAA 4KRPB 4TUJB 3ARTA 4X4ME 1DQDL 3KR3H 3DN5A 4EBQH 5D7SL 3L9YA 3THCA 3N73A 5I0ZA 3D12B 5AKSA 1HZYA 5JIMA 2FGBA 4ML9A 1UQYA 1U0QA 1ACCA 3KBHE 5AVYB 1P4BL 4BRJA 5DK2A 4S1SH 4B5ZA 5EORH 2AQOA 4K3ZA 1T7ZA 2HTKC 4HIEA 5ITBL 4NZRL 1RZGA 4ZX4A 4WHCA 3E2VA 2AW2A 3V6BR 1QNOA 2J6EH 4L1DA 1E9QA 3FFCD 2NR6C 5FX3A 4OZIE 3GXMA 4N22A 2J74A 3NQEA 3PUGA 5H8PA 4AB4A 4KS0A 2PF8A 4EVNA 5JORA 1KB9J 4QJ3B 3M1ZA 3QDMB 1AZVA 3MU7A 3QUMB 1UD6A 4JS7A 1HINH 1U58B 5IHSA 2XQ0A 5EEWA 2X1WL 3EO0A 4WO4D 5DZOA 3SJVD 4Y5XA 2ZSVB 2ICWJ 5E9DA 3TJHD 3E6FA 1G6RB 1YEIL 5KVDL 3WS6C 3QIWD 5JOFA 3HPAA 3B05A 5BOEA 2IDUA 1UH2A 2VL5B 4AIZA 4HHWA 3O6KH 4L0YA 5ICZA 2R4SL 1U3ZA 1TJPA 2CBMA 3OKDA 3NP3A 3M6YA 3O9NA 1BVLA 3OSVA 3P77B 5HJBA 4F9PC 4HEPG 2P42B 2VUOA 2XWJB 4AQAA 5CR1A 4HJ1A 5EKYA 2ZRZA 3W1RA 4N2CA 1A7NL 3SY0B 3UPAA 4PCPA 3RUBL 2OPCA 2OJPA 1IKFH 2FQGA 4X9HA 4K5MA 5AVXB 1JBJA 3OLIA 4N42A 3OB0K 2JKIS 4HIIA 2PTUA 4NI3A 5HD8C 2PO6C 5LGJA 2A7NA 3VIPA 1J4EA 4LUJA 3NL5A 1HX0A 1NCJA 2WB1A 1N4XH 4FPSA 4XXWC 3TBWB 1KEMH 3KYKH 1WWCA 3VTRA 4IPPA 1SZRA 4XNQB 2APXA 3P4MB 3LMZA 2E5CA 4I1RA 4ATLA 1MCRA 1TETL 3S42A 2OMXA 3MUY1 2IPUG 1OOAA 1US3A 4JDEA 2PLKA 5B1AB 1WD9A 1HDMB 3EYQD 3SBWC 2PODA 2E7FA 4NNPH 3PAOA 1EEPA 3GXPA 4FHBD 1J93A 3VGBA 2Q5BA 4G8GA 1ZXQA 1XPGA 4Z42C 2D7QA 4KO5A 4MDRA 1FVDA 1KCLA 1K8IB 2NR6A 4JJ5A 4UDUB 5HHOE 4KK9D 4GG9A 4AY7A 1ME9A 2QCDB 2EEXA 1S9KC 3UERA 3K71A 4RW5A 1A6ZA 6PCYA 4ELMA 5K4XA 1CLOH 2MPAL 3AQDA 1LXMA 1WFMA 2NCEA 2ZT9C 3QYMA 1TJ2A 4PL1A 1AGBA 2ZPKH 1DJQA 1I2OA 4DZ8B 5AAMA 1RUAL 3SJVA 3VCNA 4MCZA 4PJ5E 3HC2A 4OUOA 5E4AA 4ZTXA 1XXDC 2WB7A 3V18A 3CXFA 4Z7OE 1JD7A 3O9WC 2VZ1A 2EDDA 1J88A 3L81A 2I16A 2G3IA 1MCOH 4KKQA 1ZKAA 1AODA 2R83A 3O8XA 3THDA 3TQPA 3VDGA 1F00I 5KS9B 2AL1A 4KOCA 4IX0A 1VFAA 1JCXA 3B34A 4EN2A 3KS0J 3KBWA 4C56A 5A16B 2X09A 2HBVA 3MANA 5DELA 4MNHB 1PE31 4JO3H 4AITA 4ELMF 5JXEC 3BOFA 4WV1C 4D9LH 4YS1A 2IOIA 4AD5A 4PJBE 3VYOA 4CVXB 5L7XH 1TRIA 2HXAA 5CIPA 5IOKA 1SVCP 2VYRE 4BZ2L 2H1PH 5KYUB 1XIIA 1TZHB 2XETA 4S3JA 1XZ0A 4XXWA 1MHEB 5JO5A 3DHUA 2I9TA 2HSAA 4JHOA 2NVAA 3IFPB 3FJTA 3SQOL 2DBLL 4KI5C 3DOHA 1H5BC 4YXLL 3ZE2F 3F4NA 1R7OA 3QS3A 2ZTJA 2J6VA 4G1KA 2FO4A 3KJ6L 4ZAKA 5C0RH 4RGOL 1U8OA 4RGMC 1TMCB 3QWRD 3L7FB 3KEDA 3UCCA 3LXCA 5IB5A 1BIIB 2R7EB 1AC6A 3NIDB 1K7EA 4JZOB 3MFFB 5GGTA 1KGCD 3PR2A 3QDGE 2B7DT 3U6XA 3NRPA 4HETA 4GYFA 2VW4A 1RCYA 3SDDD 2XBDA 1XCWA 4KZDL 4UV7H 1CVSC 1I9EA 3UX9B 3SRHA 2EEFA 1YBQB 4X4XA 2UY2A 4AF0B 3QNFA 2WXDM 4I89A 4TUOB 4LSDA 3R0UA 1YJDH 1BZ8A 2EYTA 2NQ5A 3WIHL 1P2CB 4K2UH 1XR2A 5T3XH 4LLUA 3CMJA 4TOYH 1KTNA 1XB3A 3DX6A 1X4XA 4CNSA 2VMEA 4RZKA 4G82A 1T20A 4BGLA 4L4TD 4PWGA 3W38A 3RTLA 1MCDA 1U4FA 2VM4A 5CQ1A 1AG1O 3VFWA 2J7DA 2DTMH 3V4PA 1FUYA 1B3JA 4ZMAT 5HHMD 3IDNB 2R8SL 3HBLA 3WBEA 2PW1B 4PJ5B 4W9IC 5F9JB 3B9DA 1AW2A 4FP8H 1K7FA 1L9MA 1CK0H 3KGRA 3OQ3B 4B6ZA