2QMJA

Crystral structure of the n-terminal subunit of human maltase-glucoamylase in complex with acarbose
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human intestinal maltase-glucoamylase: crystal structure of the N-terminal catalytic subunit and basis of inhibition and substrate specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Maltase-glucoamylase, intestinal
total genus 274
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2007-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qmjA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qmjA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 2qmjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qmjA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 2qmjA01
4L4OA 2WMIA 1O7AA 2ZE0A 5CZKA 5DF0A 2JE8A 4JCMA 4Z2GA 3W38A 2WMIB 1UR4A 2V5DA 4UR9A 1MFUA 1V0MA 1BVNP 3L4XA 4AMWA 4H41A 4BQ4A 2VVSA 1GJWA 2WNWA 1H0GA 3K4DA 2W61A 1ODUA 1M01A 2CCRA 2DSVA 2VX7A 4Z2HA 4HPHA 3BVVA 2PBGA 2FHCA 1ISWA 2DDXA 3GBDA 1H09A 2ZOXA 4HOZA 3PZGA 3SUUA 1JG9A 2WLYA 4AWEA 3U7BA 1B3YA 2NW0A 4HPGA 3NSNA 1QWUA 3WF1A 2WCAA 3PZOA 2Y24A 3NCOA 1H5VA 3OIHA 4LYPA 3SUSA 1QHPA 2WHLA 4UOJA 2F1BA 4ATLA 5JIPA 2E3ZA 2W62A 2J79A 1A47A 1OWQA 3GTNA 3VSTA 3EJUA 2EADA 1H49A 3A22A 3WNKA 4XZWA 2XFYA 1OCQA 2CBJA 2YL8A 2CBUA 2PSPA 4AISA 2WC7A 2YL6A 4OUEA 5BCAA 1NOWA 4A3YA 1GOMA 1X6NA 3VDAA 1MVYA 3VM5A 1GQJA 1VBUA 3NYDA 2G41A 1FFRA 1S46A 2E9BA 3WF0A 3FAXA 3HMCA 1J0KA 5I6SA 1PS2A 1E71M 4EANA 2PB1A 2ZX9A 3ZJKA 2BV9A 4E2OA 4TTGA 3ZSTA 1R85A 1V0NA 4XZBA 4KGJA 4RE3A 3TTOA 4TVDA 1YHTA 4XUYA 1UD2A 3M6DA 5HBFA 1US2A 3UESA 3BUIA 4TXEA 1UOKA 3FNDA 1UWTA 1G1YA 1PJ9A 1UKQA 3OG2A 3WH9A 3PZMA 1Q6EA 3ARSA 4B9YA 2XIBA 1NQ6A 3KWXA 2VQUA 2GDUA 4LQ1A 3UETA 5I0DA 5A8NA 3VKKA 1ZU8A 3WQ8A 3EDEA 4WF7A 3EMCA 5I77A 2UY4A 4GINA 2BY1A 3MSDA 1D2KA 2ZWZA 2G3IA 1KGXA 2UWFA 3BLBA 1HJXA 3T0BA 1UQZA 4ACZB 3T2QA 4UTFA 3HG4A 1CECA 2DGAA 3GXMA 2YBUA 2BY3A 1UD3A 1CIUA 5LA2A 1LG2A 1C8XA 1UWRA 4HOWA 3DDFA 3PZNA 4PMXA 4M24A 4CD6A 1H2JA 2CKSA 1ZS2A 4P7RA 4NXSA 2DT3A 4AC1X 1GOIA 4X0VA 5FOOA 1J0YA 1GOOA 4CVWA 3B9EA 2DH2A 4FNPA 1XH2A 1EXPA 1VIWA 3N04A 5D8ZA 4F9DA 1WB0A 3ARUA 3GXFA 1TG7A 2WBKA 1NH6A 3CZKA 3UG4A 4MJ4A 2V38A 3DYPA 2QPUA 3BGAA 1QNOA 4P8VA 1GVIA 1OT2A 4AIUA 3I3EA 2G3MA 1J18A 3VD5A 4UFHA 1GNXA 3GYCA 1GQLA 4BQ5A 3WH5A 3CZJA 4P8UA 4D6CA 3RPMA 4BQ2A 5JBDA 3WSUA 5A6BA 1RPKA 1FOBA 2EXOA 3MMWA 4R27A 3AMKA 1LJYA 2WXDM 2A3EA 3PTQA 1GPFA 4UFKA 1C8YA 2PI6A 1VJSA 1HF6A 3WH8A 4WKAA 4EK7A 2PWHA 2BVYA 1PIGA 2FDMA 1CNVA 1EO5A 4FK9A 4GI9A 3TTSA 3AHZA 4QLLA 4OZOA 1OSEA 1QI0A 3F5JA 3ZJ8A 1UH4A 3VD9A 2D24A 4UFMA 1V3IA 4JHZA 4P7LA 3SIMA 3EJQA 5A6MA 4YHGA 1W3JA 2CBVA 4DUXA 3TV8A 5HPCA 2V5CA 1E4NA 1HNYA 1G94A 1E5NA 1N82A 5A6SA 5I2UA 1HJSA 3GH4A 2J25A 1EGZA 3WFLA 5A2AA 1Q6GA 3CHDA 1HP4A 4PUDA 1FHDA 2YLAA 4PBGA 1R47A 3QGVA 4UNIA 1WE5A 4J28A 3WF2A 1WZMA 4H8UA 1OD8A 4XV0A 2J7CA 2QF8A 1IV8A 5E70A 3CO4A 4AD0A 5FCZA 5JIWA 3VGDA 2VZVA 1VFUA 4HMDA 1OIMA 3LRLA 5A6BD 1E72M 3LPPA 1XD1A 1QI3A 3I3DA 3BCDA 1GQKA 2OYKA 2VCAA 2CERA 1E73M 1BG4A 2BFGA 5LA0A 4WSJA 2QMKA 3VX1A 3AROA 2IUZA 1V3KA 3U57A 2CITA 4QCFA 2FGZA 3WL0A 4L4PA 1UASA 2XTKA 1I1XA 4OBRA 1XSIA 1ISZA 3KLKA 3QR3A 3W0KA 3UG5A 1QNQA 1XHGA 3PZUA 4QCEA 1GHSA 3BLKA 3VD7A 3FN9A 4W86A 3HU7A 3F5LA 5EB8A 3E1F1 2O9RA 5CSUA 1IZKA 2Z1SA 3OGSA 4UQBA 4JL1A 1XSKA 1W9BM 4PMQA 3WDJA 3ECQA 5D8WA 3MS8A 3HG2A 4GI8A 3AXXA 3OLDA 1W2PA 1QI2A 2QHAA 3N18A 5LA1A 1UUQA 3VTRA 3D4ZA 3UG3A 1JZ7A 4W8BA 3W53A 3KZSA 1E0WA 3AZTA 1XC6A 1PX4A 4HMCA 1E40A 1UKTA 3AIUA 1PX3A 4X0NA 1XSJA 1V6VA 1HT6A 1WZAA 1GOWA 2CEQA 1J0IA 1EQCA 4HOXA 3AYRA 1NP0A 4PMUA 3AS1A 3SCQA 1CGXA 3CC1A 3WUEA 7A3HA 2BXZA 3AIQA 1ODZA 3BAWA 2DEPA 3GH5A 3VIIA 3RCNA 3W29A 4IUGA 1Q6CA 2XFFA 3T2PA 1MXGA 3S5YA 4FNQA 3ZT7A 5D4YA 3L4YA 2ZXBA 4IPLA 4PMVA 3PHAA 3PZ9A 1BYAA 4KH2A 1WP6A 1V3MA 1NWRA 4M82A 3VILA 1V0KA 3NDZA 1UA7A 4AZ5A 1UYQA 3BVUA 2WB5A 1UQYA 3W26A 3ARWA 1BVZA 2DSZA 3O9NA 1H11A 3M7SA 3AS3A 5FIPA 4OBSA 5DO8A 3DYOA 4OIFA 3G6LA 3WNNA 1UKPA 4UCFA 2F8QA 2WMJA 2CYGA 2MANA 4GZJA 3AI0A 1LWHA 2XVGA 3RM9A 1VEPA 2YFNA 2Z1KA 4MTVA 5A94A 3D3AA 2E4TA 1Q6DA 2UY2A 5D9NA 1KCKA 1LWJA 1FH8A 4F8XA 4J3VA 4HZ6A 1MWOA 1FH7A 1XYZA 3WFZA 2JF7A 2YFOA 1PAMA 4DM2A 4AD5A 1GW1A 2EPMX 5AC4A 1OINA 3AS2A 1ZJBA 2ALWA 1MXDA 2X2JA 4OJYA 3RDKA 2VL4A 2XFRA 4AZCB 1G5AA 5E1QA 2A3HA 4CN6A 2C0HA 3ZR6A 4PTMA 4W93A 1KWKA 1Z32X 1UH3A 4KGLA 4W89A 4MJ2A 2J7EA 3WQ6A 4MB1A 3JUGA 2ZUWA 1B3XA 1JGIA 3DECA 4GIAA 1OGBA 1KTCA 4J3SA 5A6AA 1E3XA 3QOKA 4CU7A 1XCWA 2WVSA 2XWDA 4W7UA 3D51A 1PIFA 4QLKA 1IZJA 1BHGA 4CD5A 5D9OA 3VSUA 1E70M 2XIIA 3ARRA 1RP8A 3SEPA 2XPKA 3WY1A 5M17A 4RL3A 2F7PA 4PMYA 4IM4A 1D3CA 3VSVA 3ZMRA 1VEMA 1HL8A 1QNSA 3BAIA 3A4AA 1ZBKA 2F7OA 2YLLA 3GM8A 4JFUA 3GXPA 2JIEA 1JL8A 3AIWA 5A69A 5IHRA 4J3XA 1R7OA 3WENA 1BFNA 2ZUTA 4QP0A 4Y7EA 1UD8A 2F7QA 5A2BA 1ZBCA 4JHOA 3U7VA 1CGTA 2D22A 3QHNA 1T0OA 4ATDA 1FP8A 2J75A 1K9TA 2YL9A 1GORA 4QLJA 1UWUA 5ABHA 4J3UA 3CZGA 2CHNA 2G3JA 1KR0A 4PSRA 4ZE4A 2WC3A 4CGTA 3BXWA 2WYSA 3W28A 3CMGA 5E6YA 2ZX8A 1TVNA 4KWUA 5HOSA 4HZ7A 1OM0A 1HVQA 1FH9A 2D1ZA 1SMAA 1JFXA 2J78A 2W5FA 2W92A 4WJXA 1WDRA 3NJ3A 2W66A 1WDSA 1VEOA 2VRQA 1M7XA 4YPJA 3L4VA 4JL2A 5A8PA 2EPLX 2EAEA 1FA2A 1M04A 4GQRA 2FHBA 2YIHA 2YKKA 3WMSA 1TCMA 1QHOA 2GDVA 3CMJA 1TA3B 3G6MA 1W9VA 3QHMA 4U5KA 3EBVA 1CGYA 3WF3A 4S3JA 4Q7NA 3DX4A 1GHRA 1JYWA 3SCPA 3AHYA 3ZSSA 3A3HA 3CIVA 5D9MA 1J11A 2EPKX 3A5VA 1US3A 1JZ6A 1TR1A 1QX1A 7TAAA 2X2IA 5C8BB 4D6EA 2WVVB 4WSKA 1JXKA 3LMYA 3OGVA 2GJXB 2GK1A 3BVTA 4E8CA 3DHPA 2DSWA 1TFVA 5BRPA 3WD2A 5BXSA 2GK1B 1EHAA 3WD3A 1M53A 3TTQA 5ECUA 3AMLA 1WNOA 4J3WA 2XGIA 2F18A 2VRKA 2E9LA 2J7GA 2V3GA 1GONA 1LL4A 1W2VA 4PTVA 3KE0A 5BWFA 2DSUA 3CHEA 4TX6A 2NT1A 3WD4A 3NIYA 1GUVA 3GNRA 1BLIA 2VNCA 3OB8A 4CCCA 3SCUA 4FNUA 1HJQA 3THDA 3RIKA 1UR9A 4DM1A 1E9LA 3ZJ7A 1W9DM 3F4VA 2IXVA 3WDIA 4NXKA 1WPCA 1UR8A 3CHFA 3WUGA 2FYVA 3MO4A 3D52A 2VCCA 3POHA 2VO5A 2WANA 4TX8A 1W9UA 1FP9A 4AD4A 4J7RA 2WPGA 3L2MA 1C93A 3QHOA 3VIGA 1KBBA 1V6WA 3WBAA 4ZXOA 3ZIZA 1H0IA 2YL5A 2EO7A 1TMQA 1WDPA 4H7VA 1NWTA 4X9YA 4U33A 4JFWA 3CZ8A 4FLOA 1HJWA 1XCXA 1E15A 4UQCA 3IJ7A 2VZOA 2X0HA 2XSBA 2E8YA 3AMDA 3B8SA 1BYBA 1E56A 2EEXA 1J9YA 3A4WA 3IAQA 2FGLA 1CBGA 4KMQA 1AQMA 2AAAA 1AQHA 1CLVA 1WZKA 5BXRA 1AVAA 1NARA 3VGFA 3VDBA 1UKOA 3IAPA 1HKMA 5DEZA 3MUAA 3S2CA 2D2OA 2FE0A 2EQDA 2WKLA 4HA1A 3L4WA 3MMDA 3WMCA 3PTMA 3OLEA 1W1PA 1LQ0A 3WEMA 2W67A 3ZO9A 5GNYA 2F1AA 1UHVA 3A23A 4D6HA 1WCGA 3VUPA 5E0FA 1TVPA 4URIA 3KLLA 3W82A 4J27A 1OT1A 4TVUA 1RP9A 3N11A 1E6PA 3WELA 4CU6A 3BVXA 3WIJA 3BUQA 3VX0A 2GSJA 1WKYA 1SMDA 4FNTA 1HKIA 4OGZA 4PCSA 1E3ZA 1AMYA 1H3GA 4B3LA 1A3HA 1DWGM 3VNYA 1R75A 3FW6A 3VDHA 5ABEA 3MUIA 4C7DA 1MYRA 3WY3A 2XN0A 4TVCA 5CSYA 3OZPA 4ZXLA 3IJ8A 3WUFA 2VZTA 3VINA 4UZSA 4W5UA 1E4LA 1CTNA 1KTBA 5FL0A 2DT2A 3DX2A 1HX0A 1JD7A 1GCYA 4JKMA 3RM4A 2PWEA 2Y8KA 4Z2IA 4AZHA 4U31A 5GQBA 1JNEA 3U5UA 1V6XA 4Z2JA 1CXEA 6TAAA 3LPGA 3PBGA 3TP4A 4D6JA 3AHXA 3SUVA 2ZXAA 2CESA 1TUXA 2VR4A 1QOXA 2JALA 1TQVA 5D9PA 3LRKA 2VX6A 1CXFA 1JZ2A 2X8RA 1KFWA 5BYWA 1EOMA 4AYSA 3OGRA 4W5ZA 2DIJA 3J7HA 4MPKA 2VUYA 4NZFA 4AIOA 1OD0A 1E0VA 3MU7A 5FKYA 2O92A 2VR5A 3UR8A 4B3KA 3ZJ6A 2VX4A 1G01A 3GBEA 3N12A 4UOZA 4MNMA 3L4TA 2ESCA 3GXNA 2G3NA 4V2XA 3BH4A 1BSIA 2EBNA 2ZIDA 3ARYA 4ML4A 3VGBA 1W3LA 1CGWA 2UY3A 4AD3A 1CEOA 1C92A 1JZ5A 2ZX7A 2ZUNA 2QV4A 3APGA 2O9PA 2PWDA 1SYTA 1E6ZA 3GNPA 1WAWA 3WY2A 3D50A 4KRTA 4OOUA 1HJVA 1M03A 3AZSA 2WZHA 3NSMA 5BXTA 4H8VA 5AYBA 3ARQA 4R5EA 3MANA 3AQUA 1TZ7A 3N15A 5I5RA 3WEOA 2BS9A 1W9XA 4D72A 1UR2A 1X1NA 2F2HA 4ACZA 1JZ8A 4W87A 1H4PA 2PWFA 2VURA 3AJ7A 1UZ1A 5HDRA 1EQPA 1XH0A 3ZQ9A 4AZGA 2VVNA 1AQ0A 3W27A 4AD1A 3WNMA 4TOQA 2JIWA 1OB0A 1VFOA 4WKHA 1E6XM 1XH1A 1VJZA 2D3LA 2DIEA 1E4MM 2VZSA 4EAMA 4PCTA 5A6JA 3THCA 2OSWA 2AOSA 2VOTA 1J12A 3OLIA 1C8QA 4GQQA 3PZVA 2YA1A 3POCA 1E6NA 3EYPA 4AY1A 2QMJA 5DT5A 2W63A 4DWSC 4DWSA 3M07A 5A2CA 3AZRA 3BSGA 3LRMA 3MKKA 1TE1A 1KXVA 2WSPA 1JAEA 4W8LA 1DTUA 7CGTA 4BF7A 5AYIA 3T08A 1KXQA 1QPKA 1RD6A 5HXMA 1HKJA 4PRWA 1Y7VA 2WM0A 1QBAA 1HVXA 3OLGA 2RGMA 3M46A 2XUCA 1V3LA 2XVKA 3DX0A 1PX8A 4CD8A 4AZIA 1HJUA 3RILA 1D7FA 2G8ZA 2ZXQA 1B9ZA 1W3HA 5I3DA 4HTYA 2UY5A 4NX0A 5HPOA 4PYSA 3CHCA 2XJ7A 4TTUA 1WZLA 3W4RA 5AY7A 4P7NA 2OLHA 2ZUSA 3EJRA 5ABGA 1UD4A 4WK9A 2VZUA 3BSHA 3GXDA 1TQWA 4JFVA 2VMFA 2GJPA 1JDAA 4XX6A 1DHKA 2A3BA 4UFLA 4HMEA 2XVPA 5IHSA 1QW9A 4ZEPA 4BA0A 3PZTA 3NUKA 3WQ4A 2BHZA 3HN3A 2B31A 3ARZA 3SCNA 1NOUA 4W84A 4S3KA 2WSKA 3UERA 4CN4A 4JAWA 4DO5A 3U5YA 1PEZA 2XN1A 4KRUA 3MV11 2ZUVA 1QHZA 5A3HA 2YDRA 1TQUA 3BAYA 3TONA 3SCWA 1R7AA 1CXLA 4OKDA 4NF7A 4HP5A 4GO8A 4LGXA 3KEHA 4DWSD 2V3FA 2WW5A 2E0PA 5IXEA 4U2ZA 2XYLA 4U5IA 3ZOAA 1W91A 1EO7A 4HU0A 5ABFB 1K9FA 1W1YA 1E55A 1ZL1A 2W4XA 5CG0A 4YHEA 4F66A 1PBGA 1KQYA 3CGTA 2WMKA 1W1TA 1JNDA 1BF2A 5BXPA 3KL3A 1K9EA 3LXBA 1KGUA 3GZAA 4M1RA 5JBFA 3GDBA 4U3AA 3D4YA 1E0XA 1QI4A 2X05A 1EH9A 2D0GA 2BNJA 4ACYA 1FHLA 2EACA 1PE31 4MB5A 4HA3A 2XSAA 3BVWA 2JEPA 5IDIA 3WNLA 3WD0A 1XD0A 3A47A 3CZLA 2YDQA 1GVYA 3W81A 5GNXA 3IJ9A 4NI3A 3UEQA 1MQRA 4QFUA 1JIBA 4BZYA 3II1A 4TUFA 1B1YA 1V3JA 1TQTA 5IFTA 3AIBA 3VU2A 1HL9A 2WVUA 3AIVA 1BGGA 4AZ6A 3UCQA 4BCEA 3K8MA 2WAGA 4YN5A 4MNLA 4JCLA 3ARXA 2FH8A 2WMHA 2XM1A 5A6LA 1E6QM 1HKKA 3T2OA 1DWJM 3AHVA 1O6IA 1VFFA 1ECEA 3L4UA 3EDFA 4HZ8A 1H41A 5AC5A 1QW8A 2BHUA 1UR0A 1J0HA 3FHAA 2J8GA 4WLCA 3WD1A 2BVDA 3CUGA 3MI6A 2JF6A 4CUCA 3S6TA 4J3TA 1W9PA 1GJUA 2YA2A 3BUBA 2PBOA 4BS0A 2O9TA 3A4XA 1HTYA 4WKFA 5DFAA 2JEQA 6CGTA 1MQPA 1VRXA 2CIPA 4NRSA 2PWGA 1PCPA 3ALFA 5CLTA 4JFTA 1EOKA 4M56A 1LLOA 1UG6A 3WL1A 2X09A 4RE4A 4FLQA 2YBTA 1CXKA 3WEZA 3AIRA 5KZ6A 2E9MA 2DH3A 2IGTA 1B3ZA 4EE9A 1KR1A 2DPEA 3VMPA 2J7HA 3O6AA 1PS3A 1C7TA 3CZSA 5TD4A 5A95A 5I78A 2TAAA 3ALGA 3WF4A 2D0HA 2D0FA 2EPNA 3CV5A 3EMQA 4DUWA 3MUZ1 1CGVA 4UQDA 1UR1A 1XYFA 4W8AA 4UQ9A 4MDPA 3SCOA 5C70A 4C7GA 2BHYA 3MUY1 3SCVA 2BY2A 2Y8VA 4AXNA 3W25A 4HU8A 1GOQA 3W6MA 2J74A 3LXAA 2A3AA 3AOFA 3OZOA 1J0JA 4ATWA 4MADA 4FNSA 1KWGA 4ZFMA 2QPSA 3W24A 1ISXA 1CPUA 4D1IA 2G4FA 3BAKA 3QOMA 3BLPX 5A6KA 2VI0A 1HXKA 3DDGA 4CD7A 3D5HA 1XGZA 1JYNA 4E4PA 2DT1A 4JKKA 3DC0A 5CPSA 2FH6A 3VOCA 4CVUA 2OYLA 4F9JA 4Z2LA 5C71A 3VIJA 4H8HA 3CH9A 1HXJA 4D1JA 1LF1A 2WHJA 1GZJA 1OBAA 2WC4A 3FY1A 3VIOA 3BUPA 2CETA 1ZJAA 3AYSA 1FFQA 2ZUUA 3VD3A 4H2CA 1MW0A 8A3HA 3N17A 2XVLA 3ZT6A 2XHYA 3TA9A 2C7FA 1C90A 1CGUA 2J7BA 4JIEA 3WMBA 1I75A 1CENA 1VAHA 2EJ1A 2GFTA 4AIEA 2OYMA 3HZ3A 4NRRA 1JYVA 2GVYA 3DHUA 4AMXA 5CPTA 4AYGA 3H53A 2XM2A 4FNRA 1B2YA 4A4AA 3AXIA 3VIFA 4CCDA 4GI6A 4PSPA 1BPLB 3PTKA 2OW6A 3GH7A 3VGEA 3VNZA 4UFJA 2WMFA 4W85A 2WKGA 2WCGA 3HG3A 1LG1A 2X2YA 5M03A 1JZ3A 1ITXA 5LYRA 2V3EA 3VIKA 3SCTA 8CGTA 4GZEA 1CDGA 4GKLA 3SCRA 3AIEA 1P6WA 2Y4SA 1RH9A 2F61A 4XB3A 1OIFA 3HJEA 2WLZA 3S5ZA 3EJSA 3BC9A 2J7FA 1PPIA 4LPCA 3WY4A 1R87A 4CU8A 4FLSA 3EJPA 4RE2A 1U33A 1B3WA 4QDMA 4LX4A 1NP2A 3VGHA 1G9HA 2Y5EA 5CXPA 2V3DA 1MW1A 4F79A 1QNRA 2NSXA 1TQSA 1X6LA 3H54A 5E6ZA 1H1NA 3BAJA 1QWNA 4AEFA 1VB9A 1KXHA 2ZUMA 3WH7A 3VMOA 1KGWA 2WHMA 3VVGA 5A8MA 1ZBWA 2DSKA 2OSXA 4B16A 1BAGA 3BUDA 3UR7A 4AD2A 2X2HA 2J77A 1EDGA 2VJXA 1UZ4A 3CBWA 3CLWA 1L0PA 4CKQA 9CGTA 2WMGA 1BYDA 4ZE5A 1HWWA 1V02E 1V03A 5CPQA 4AW7A 4P8WA 1E1EA 2D73A 4P7QA 5HNNA 5GNZA 1UKSA 1K9DA 4MAZA 1BTCA 3DX3A 4MB3A 4IISA 3O2LA 1LL7A 3CUIA 4NZJA 2WZIA 1JF5A 5FD0A 1PZ3A 3I3BA 3GNOA 4PEEA 3CZEA 3RO8A 1DWHM 1CYGA 3LPFA 2HISA 5EBAA 4U2YA 2CKRA 1IT0A 2ZX5A 4ZENA 4B9ZA 3EMZA 4JZ5A 1E6RA 4B15A 2VT0A 5CLWA 3TOPA 4CCEA 3FAWA 1WO2A 3BMWA 5I24A 1C3FA 2XGBA 3WNPA 1E4IA 5EMYA 1VBRA 3RJYA 1W3KA 4NSBA 4PMRA 3OBAA 1F4HA 3W6LA 2C8NA 4D6FA 1EHNA 4D6GA 1HN1A 1VENA 3WQVA 1XV8A 1UD5A 2ZICA 1CXHA 1UH2A 4MNKA 4GZIA 1QBBA 2E40A 3EJTA 4M29A 2X0YA 1U2YA 1UWSA 2VTFA 2J47A 1C91A 3SUWA 1OGGA 5E0CA 1JYXA 4N42A 1EDQA 1BQCA 3ARVA 2EPOA 1JD9A 2PC8A 1E9TA 2X1IA 1V6UA 4PN2A 1NOFA 4PTWA 2ZX6A 1LL6A 3SUTA 4N0RA 3ZT5A 3K1DA 3WQ5A 1R34A 3SCSA 4W7VA 1E5JA 2NT0A 1KCLA 3CUJA 2XVNA 1KQZA 2ZWYA 1JFHA 4H04A 1MFVA 4JFSA 2F7RA 3L4ZA 2GUYA 4M80A 4U3CA 5FL1A 3KL5A 2W91A 4A3HA 4PTXA 1B30A 5GPRA 3ZM8A 4DO4A 5I79A 4Q22A 1SR0A 1BGAA 4QAWA 2DT0A 1PSPA 4MNJA 4UQAA 5DMYA 1CLXA 2CPUA 5A1AA 2DQXA 2VRJA 3N1AA 1XRVA 1JDCA 1J10A 3AFBA 5JUVA 2OWXA 3B9DA 2J8FA 3LX9A 1R33A 1NWSA 1V6YA 4C7FA 3K4AA 3A24A 3N9KA 5EFDA 1JF6A 4K68A 2J7DA 1UA3A 1F4AA 3AISA 2OWCA 1OGSA 2VQTA 3EDDA 4FLRA 1DWIM 3WKZA 1PZ2A 3K8KA 3CUFA 4GXPA 1ISYA 3VD4A 1DWAM 2E8ZA 3ZR5A 2VCBA 2XN2A 3DX1A 1CZ1A 3MV01 3WUBA 2EABA 1ZB5A 1QNPA 4PMNA 1Q4NX 3N13A 3WH6A 2WK2A 4W7WA 4Z2KA 1VF8A 1B0IA 4M81A 1E6SM 2YOCA 3CTTA 2BXYA 4EKJA 1J01A 4FMVA 2CNCA 5E09A 1V08A 3BMVA 3WDRA 3GXIA 3VMNA 3RM8A 2CHOA 1V02A 1B31A 2HVMA 1DP0A 1YQ2A 4D6IA 4AZCA 3WDPP 3T09A 2Y2WA 1ESWA 4E8DA 4PMZA 4PUEA 1E1FA 1L8NA 2WVTA 3WQWA 2D3NA 1V3HA 4MDOA 1DEDA 2OWWA 4UZUA 3K8LA 1EDTA 2WWDA 3B9AA 3AHTA 4PMOA 2JFEX 4DWSB 3AXHA 1JI1A 3VIHA 3PN8A 3IK2A 4LYRA 1Q6FA 2D20A 1JXJA 3T0AA 3BAXA 1UWQA 1EA9C 2J4GA 4IPNB 4FF5A 2WCSA 1MW2A 1MQQA 1C7SA 1HP5A 3IGUA 1UWIA 3CUHA 3OA5A 4OOZA 3DYMA 2CXGA 3EDJA 3KL0A 1HI7A 3VPLA 1J0ZA 3MSGA 3RJXA 1NWUA 2XWEA 5DT7A 3T0DA 4CD4A 5I23A 3AMGA 1CXIA 1MW3A 4P8XA 1VFMA 3PZIA 2GJRA 2YDSA 4WIWA 4D6DA 4W88A 1ISVA 2WWCA 1G0CA 4D71A 1R46A 3K46A 3L2LA 6A3HA 4JKLA 5M5DA 1W32A 3VIMA 1K6AA 2YJQA 1HIZA 4V28A 3CZNA 4HA4A 3AS0A 1R86A 3IANA 1W1VA 3FHQA 4UQEA 3W37A 5F7UA 3HG5A 4V27A 1KB3A 1JDDA 3H55A 2O9OA 3MMUA 4UFIA 5CQ1A 3BCFA 3WNOA 4GPNA 2OW7A 1ZBVA 5CGTA 4MB4A 2A3CA 1JZ4A 3WBEA 1SZNA 3A6OA 1GQIA 2AMGA 3AICA 3SURA 1B3VA 1EIBA 1KXTA 4LXFA 1V0LA 4UOQA 1QI5A 2YA0A 2WHKA 1BYCA 2VC9A 3EDKA 4AMCA 3A21A 4DUVA 4M8UA 2BVTA 3VO0A 3PZQA 4BQ3A 2OSYA 4AEEA 3RMEA 2RGLA 4NZCA 1JI2A 1KBKA 2XG9A 3WDQA 2IXUA 2QLYA 5ABFA 3WDHA 2VX5A 1DWFM 5A8OA 2BY0A 4GO9A 1TA3A 2WBGA 1CWYA 5M3WA 4MAVA 2WZEA 5JBEA 2WVVA 5EFFA 1B90A 5A8QA 5CJ5A 2D23A 2GJXA 4PMDA 1BG9A 5IFPA 5KEZA 1U30A 4CN1A 3WN6A 3LPOA 2J62A 5BRQA 1I1WA 5BROA 3LXCA 2FHFA 1JAKA 3NSXA 3ARPA 4AZ7A 1R8LA 1SFSA 1GOKA 1WDQA 4P7OA 1E43A 1NM9A 4AZBA 1O7DC 3AMCA 3CPUA 5CGMA 3VGGA 1ITCA 3ARTA 3VDCA 5E9AA 2PF0A 1QVBA 2Q8XA 4LYQA 2ZXDA 4DO6A 3GXTA 1UD6A 3TTYA 2CBIA 3NDYA 3VM7A 3F5KA 3FXYA 3VIPA
chains in the Genus database with same CATH superfamily
1KZQA 2WMIA 3MYPA 2WLIB 4MD5A 1FTXA 3OAUL 5IFHL 1BAFH 2EAWA 3PV7A 2QKIC 2MHAB 3BT2L 3D07A 3MN8A 4RIRB 5DF0A 3G1FA 1J4EA 5C55A 2JE8A 1XGTB 3PP7A 4ZAKC 4Z2GA 4YE4L 3II2A 2X89D 4X8GA 4XSMA 3B8UA 4KITB 2V5DA 1I3RA 2O5ZL 4EPEC 5I6OA 3ULAB 1T2XA 1UQSA 3M1OA 1SM3H 3QZLA 5ADOH 4H8WC 4AMWA 1QUMA 1O95A 1BD2D 3KCJA 4BQ4A 3RWIB 1QFWL 1A4JA 1OF8A 2DY2A 5IMLA 4QJ3B 4Y8EA 3BZEB 5D9SB 4IRSC 3S2MA 5IZ7A 4DJEC 2V9UA 4FHBD 3H6JA 3ABMB 4QHUB 2CCRA 2Z8SA 2HE5A 2VX7A 3L0KA 5LBSH 3BVVA 4NJHA 1I1YB 2NR6C 2Y61A 4XX1E 4OGAC 3BV7A 3EYQD 5CSGA 2L7QA 4TSCH 5IVXE 3LKPA 3QDMD 3L3OC 3LN9A 4YBLC 2DDXA 3BLLA 1UYWL 2ZOXA 3S2JA 4RGMB 4ZXBD 5GRUH 5KVMC 1ED3A 4RGNE 3CH8A 4JRFA 1ZXQA 1JZHA 3UO1H 2XH4A 4P06A 3PBMA 2D4DA 4XNZB 3ZN6A 2H32H 3MR9A 4X4YA 3B0XA 1Q0EA 1EZVY 4LO9A 2GSGA 1A7NL 1ZT4A 4HPGA 5FHAL 5DDHB 5LNGA 2ENSA 4YDKH 2EEFA 5FXCH 3KEDA 1QWUA 3OF6A 1UXMA 1KCXA 2A83A 3WF1A 5TPWH 2Y24A 2CBQA 3TO2B 2V0AA 1DFBH 2XETA 4PJGB 2GSGB 2Z31B 3R5EA 4Q8OA 1JCKA 4YSRA 1OM9A 4YBHA 2J5WA 3QISA 4OZGA 5K33A 4RDWA 1XF5B 5SX4I 1P4BH 3V4VA 5IR1B 4IMKA 3T0CA 4ZUSA 4ENLA 1AO7D 3QIWA 4XN4A 3W1TA 3D6NA 1RU9L 4G6KH 3V7AG 1YHPA 5F4XA 5JXQA 2R14A 4MDIA 3L9CA 1OV8A 3LERA 1X5JA 3DIFA 2IQ0A 2I24N 3LKNB 3F7RA 3MVSA 4DWHA 1Y8BA 4PH6A 3QIWB 4EF8A 3KBHE 5DK2A 1MFEH 2EIEA 5HGGS 2CBJA 4WK0B 1DQUA 5TQ0H 4IQDA 4S2BA 4AISA 5L6YL 3KG5A 1UP0A 2N1TE 2NXGA 2X6AA 2WQAA 1KBJA 4Z6AT 4W6YB 4PFMA 2J74A 1MVYA 5G4OA 1KN4H 2N0MA 5FW6A 2HMID 3BT0A 2GJZB 3DIDA 4QLWA 5K9JL 2G41A 1W15A 3SCTA 3H23A 4YIQB 1VFBA 1S46A 2G2NA 3S5SA 5JQ9A 4PUWA 5E6UB 5AQ0A 3QRBA 3F7QA 3U6RA 3HG1E 2WSRA 1CT5A 3Q45A 3WF0A 4DN1A 5MHBA 3LKQB 4DSYA 3BEVB 2XTLA 3B06A 1AGBB 4JMNA 3C75A 4YSOA 1HUVA 1PYWB 2VZ1A 1TYRA 5DJ8A 3WIFB 3VZXA 2F68X 4JNYA 3MRLA 4XNAA 3ML9A 2HAZA 3IUIA 2DI8A 4E2OA 5H35A 1M5WA 3S2NA 3MRBA 2GCYB 2Z4GA 3FB6B 1JN6A 2V9TA 3BXNA 4TVDA 3S36H 1V10A 3B97A 4O16A 1EXUB 2YXMA 3NFNB 2FB4H 4FQIL 4V1XA 8TIMA 4TMPA 3FYOA 2YUXA 3OKOB 5KSAA 4ZPVB 1IWBA 1BYPA 4Q0XL 5CN3A 1C1EH 3BUIA 2VITA 1PY4A 4RPQA 4UT6A 4TXEA 1LL1A 5DEFA 5AAMA 2G0WA 1UWTA 3D0LB 1XB3A 1P2CA 1PJ9A 5L88L 1V4YA 1Z8AA 3MQTA 4GMSH 5CPOA 2WGNB 3UWYA 2P9RA 4UILL 3C5JB 3ARSA 3IVKA 4Y2DC 1ME7A 2G5WA 2XIBA 4NKMA 4QHMA 3KWXA 5DEFB 3TTEA 1J48A 3IRCA 2V8LA 3IFLH 2EH7H 2CWXA 5K93A 4A37A 2B16A 1GZHC 1YMHA 2DQUH 2BFVL 2A3TA 1NEUA 4KTEL 3RVXC 2HP4A 2XDFA 4AMAA 1JCJA 3L3OB 2XY1A 1GOXA 3FUIA 4WUUB 3ETBF 3T0EC 1F3JB 4ELMF 5FYLD 1R2RA 3OZKA 2X10A 3QH3A 1SW0A 3IB4A 2UV8G 3FOKA 4QD2E 3FGCB 1F4XH 4GINA 4FKEA 4LRIA 4WFFE 4PJFE 4B2DA 4N2MA 5TF1H 1D2KA 1TZHB 4MJIB 3UD6A 3CHSA 2HRPL 1WJ3A 2E09A 4X22A 3W22A 4DEFA 4QRPA 5GSVA 1E2VA 3NTYA 3W3BA 2HH0H 4Y1AE 2W95A 3MNZA 3HG4A 1D5ZA 2YBUA 2NDFA 4CC4A 3MXVH 3C8KB 2BY3A 3QIUC 4FQQB 4IDJL 1KB5A 5B38A 2VR7A 2RUSA 2Y5TA 4LLAA 3JTTA 3ZUNC 3B9NA 5IM51 4OCXH 2LU7A 1W1ZA 1C8XA 5AVVB 5T5NG 2G5BB 3VE0A 3MNWB 2D9CA 3MNZB 1DFBL 4F7CA 2WO5A 1I8IA 2OP4L 3GLEA 3BGGA 3SD5A 3DDFA 3VXRB 4PMXA 5IESL 4M24A 5KYWA 4PB0L 4A55A 3Q2DA 1JK8B 1OLZA 2AQ2A 4A8IA 3QQ3B 1AD9A 4G6MH 1PKNA 4AC1X 2V5MA 1GOIA 3VE0B 3DMMC 4L1TA 3WLBB 1ML0A 4IQJA 4FNPA 3H6AA 3SE4A 4HIBA 4IPJA 1LD9A 4U6YA 1W16A 2ADAA 1XAUA 2PCYA 3BI9X 5F1NB 5A6IA 4X6CA 3CU2A 3H2AA 1U3JA 3ZL4L 2Y22A 3GNML 4BK4A 1CMOA 3PS7A 4J5NA 3GXFA 3SBWA 1RZKH 1FC1A 4OZIA 3EW3B 1KULA 3H4WA 5IROA 2V38A 4ERAA 1IGSA 4OFPA 5K1VA 4BE5A 5GGUB 2H41A 4KFNA 2VDLL 3TH2T 1NKRA 4B16A 3FT0A 4FFVD 3L3IB 4DK5A 1GVIA 5BRZB 3PSWA 1NCGA 1GEHA 1H0DB 2UY7B 4F7EB 1IB5A 5ESAB 4UFHA 3R19A 5K9JH 5DMMA 5KVDH 3C2AH 3GYCA 5HANA 3CM4A 3EGXB 4Q6IB 4AJ0A 2GGHA 2X9YA 5I5JA 2IWFA 1NBYB 3WJJC 2EC8A 3CFBB 3PJWA 4YDNA 2OCCB 1IEBB 3WTYA 1I6NA 3I2CH 3WX7A 5I16A 3WSUA 5A6BA 1ZS8B 3PSVA 2VFIA 4LSTH 1LJYA 1P4IL 4X5PA 4F2MA 5HMDA 4HIIB 4PLOB 3SPGA 4BY3A 1MELA 4BKLB 2PI6A 2IPKB 1OK4A 4HK3J 1G7JA 3ZTEA 1RV8A 4UIMB 4XI5C 1GGCH 1PE1A 3PB0A 2ICEC 1MCHA 1XZWA 1OC7A 1UA6L 1RZIB 2NUTA 4KVPA 3N2JA 2NY4C 4WI8A 4XNUH 1F56A 2A9BA 2P52A 4EK7A 3L9YA 4UT9L 3PGCA 1YC7A 4OD2A 1KTDB 1B4TA 4ODWA 4OZGF 1ACYH 4GI9A 3LYRA 2Q6WA 3TTSA 2DVTA 4MMYB 1XBXA 1EEZB 2IQAB 5IOPB 3PNZA 4I5UA 5FF0A 1QTSA 2G3ZA 4Z7UB 4OZOA 3DFHA 3GSWA 5M5DA 4QR6A 4OTXL 4MWFA 1CF8L 4N90D 1QT1A 3ULSA 1S1RA 4M7SA 2VSKB 5EMUA 1CICA 3EBGA 1T6MA 1NFDA 1P7QD 3FQXB 3MJ9A 4IIQB 3WN5A 2LT9A 5AG8A 1EHXA 4D0BA 4US5D 3EWCA 3SIMA 1MDTA 3OZLA 2Z24A 5FJIA 1HU8A 5A6MA 4HIJB 2B2XH 2CBVA 4OM0L 2P5WD 2X1PA 4K9JA 3EUDA 4LL9A 4DI8A 1A4BA 4N9CA 4Z0XB 5DANA 2EDMA 4XK2A 1YEFH 4C1LA 4IIQA 4PS8A 1SJVA 4G1EB 1H7OA 3W70A 1G94A 3ZW3A 1W0WA 5H37H 4ZFFB 5ALBL 3C5ZA 1MXSA 1NAL1 3FSUA 1SU5A 5F7EL 5F6HJ 2VJ8A 5I07A 5EU9A 4A39A 2JB6B 1Q6GA 1BBJA 3UBXA 3EYUL 3DFTA 4EXAA 3RPIA 2EYRB 1KCSL 1YAIA 2MNJB 4M8VA 3VFUB 4UXDA 2YLAA 4HIHA 2EDWA 4DGIL 3ZLGA 3F12B 1U36A 4BH8B 3WSQL 3JWOH 4M6OH 3D47A 1E42A 4J28A 1A4MA 3O7UA 5IJDC 1AHWC 1NGYA 4HSOA 1NIBA 1IV8A 3EXTA 1BX2A 1DVFA 4WDXA 1A1MA 5FCZA 3D05A 4EDWL 3QBUA 5KVDL 2V0TA 1I4FB 2NY2D 3TX4A 3IDUA 1DQKA 5LGJA 1KCBA 3RRXA 3S35H 3VA6A 3MOBL 2C6QA 5EOTA 1KT2B 2LTQC 1NGYB 1AP2B 1OARL 1YZZA 2ADGA 2B0SL 3ILPA 5A6BD 5CG7A 4LLUB 4OCSH 2HNEA 3PUGA 1DJNA 4FHKA 1XD1A 4LCRA 3IFLL 1VH7A 2VUOA 3EG9B 3BCDA 3RLHA 3VTTA 2MCPL 1L6WA 4ICNA 4S1SH 5EU6B 4Y5YA 1QZ1A 1RHHA 2FGWL 4QLRA 1OGTB 3U7WH 2WJFA 1HWHB 3I4KA 4LLUA 1YSOA 4XMTA 2OZ3A 3BTNA 1NICA 5CMAA 1RZ7H 2AJYL 2ZP8A 3FO1A 4OF5A 2JKJA 4Y4FA 1W1IE 4PR5B 2P76A 4S0TD 4DTGH 2QV5A 3MCG1 2WQUA 3BWUC 4LVGA 1MUWA 2JELH 3MLSH 4JQVA 4UC5A 5CC7A 2YB1A 3VYOA 3IMTA 4TRPL 5T3ZH 4JICA 3GKZA 4GSRA 1U8HA 3NQKA 3R7QA 1BECA 4LLVB 3SDCB 5D2XA 4X9BA 5E24E 4J40A 5EO9A 4BI6A 4Y6GA 4XPAL 1JPDX 4A6GA 3BP4B 3UG5A 1JDFA 3O6KH 3PZUA 3VAEA 3B0UX 1TO3A 3QJQB 2IGFL 1GHSA 3PVFA 4GY4A 3O11B 4M7ZB 4IDJH 2DDQH 3HE6D 2G5UA 3O2DH 2VFDA 2B7PA 1W0VB 4OCXL 2GEQA 5AFDA 4WO4B 5EB8A 3NJJA 1G1OA 4HWBA 5BXFA 4XBKA 1IZKA 3UJTH 1Q0YL 4HCRH 4O02A 2HVOA 2Z1SA 2UWEA 3FFCB 4B4HA 4UQBA 2XTJC 1N64H 4YDZA 1XSKA 3MBEC 1W9BM 1NCCH 3S1UA 2AABL 5DCCA 4YOKA 4Z78B 5C0RL 4LGSB 3ECQA 3BOLA 3OYXA 1A0DA 1SGKA 3LKRA 4K5MA 4GI8A 3IFPA 2UZXA 1T5KA 1CFNA 3D3VE 1QI2A 3QUKA 5TF1L 4L56A 4P4RB 4G8GA 4IMGA 3OOQA 4EPBC 2R91A 3L5HA 5FGCB 4MJMA 2I07A 5C6WH 1ZHBB 3AREA 4PJCE 1GY2A 1PX4A 1ACXA 4DP4X 2K6WA 3HFMH 1O94A 4PJ7F 4EVNB 5FWRA 1NTDA 2R1XB 1BLNA 2YRPA 4XXDA 1AL8A 4LEXL 3SPVA 4JY5L 4DO7A 4Z7OF 2B1HL 5J3HC 5LNSA 2NUPB 1KZYA 3D25A 5CO1A 3BOXA 4M5PA 4PTNA 4FIQA 5IG7A 1WAAF 1PKQA 2BWGA 1T7VA 4WO4C 3FJTA 5CKAA 4P3DA 5DHVA 4ONFH 3TBVB 1NP0A 5IBTL 1ITBB 3GY1A 3IIXA 4RKAA 4BEUA 1N5YH 3AU2A 3R25A 4MWAD 4UR8A 4KJPD 2ZZUT 3LLXA 3HTWA 1ZIAA 2BIQA 3LEYL 7A3HA 1A6WL 2XQYG 2ZSWA 1S7XB 2BXZA 2DBLL 1CFVH 3SDCC 4U1HB 3FSAA 1NEYA 3AIQA 3CDZB 5TPWL 3D0VA 4Y90A 1FG9C 4HFUL 4L4JA 4PS3A 2OXNA 1LQAA 2QQKL 3P3TA 1Q6CA 4IUGA 1FNHA 1OFQA 1DN0B 4BYHA 4WGKA 3QJXA 1EQWA 1J79A 1L2UA 4A3UA 2ZXBA 5FYJL 1IIKA 3LNHA 3CDZA 4Y9PA 4KUZH 4JY8A 2PLKA 4X7TB 3SQOL 3CFIC 3SO3C 2DQDL 5EOCL 4CBZA 4ECNA 1BYAA 3PZ9A 4AXKA 2G0KA 2WOYA 1V3MA 3HB3D 1Z3RA 4ORIA 4XMKH 1V0KA 1MN4A 1DJGA 4NJGA 3CAFA 4R7DA 2PP0A 4X6FB 2K6YA 4RWYL 2VDPL 2YPKB 1IGCH 1F2QA 2LTQB 4AZ5A 2E9JA 5HYQA 3GHEH 4X4MA 5DHYA 3IS1X 2C3ZA 2ZG3A 1QMUA 1DN2A 4OGXH 5ICUA 3TC7A 2JK5A 4MMZC 4XCCH 1TWIA 2FEDC 2DSZA 3O9NA 4LIQL 4G43A 4KXCA 4H20H 3P77B 4XWUA 3MX0B 4K55A 4DETA 5I19H 3FXGA 3M7SA 1H6TA 4X99A 2GKIA 4YC2B 5DO8A 5AOKA 4TL5A 1E6JH 2A21A 3GW0A 4TULH 4YUEL 2NW3B 1OAQL 3WD5L 1W5MA 2MQCA 3TIDA 1A3WA 1N4XL 4P5UA 3RZWA 2XVGA 4LRNH 4AC4A 4UB0H 1I7RA 5TJWK 3EX3A 4FTVD 2Z1KA 4DZAA 4O4YL 4MTVA 4RZCA 3WHE0 4AJYV 1OTSD 3JV4B 3NIFF 5ECJE 3CXFA 3T4WA 1O75A 4IIBA 2PTZA 5JMRA 3PAZA 2EG8A 3NQMA 2JH2A 4F8XA 1SJEB 1IGMH 2FT8A 1NUGA 5F9JB 1MVFA 3GVGA 5J0BA 2FQIA 1KGJA 3K80A 3LQZA 4YWGH 4E3VA 5CC3A 1KRBC 3GR7A 4QRQA 2JF7A 3BLDA 4IJBA 8FABA 1JWUA 1Y1UA 1ODAA 4AD5A 1RULL 2EPMX 3EYQC 2FL5A 4A7GA 1W1A1 4ZVJA 4JHWL 1QEWB 3AS2A 3H4FA 4TSBH 1E4XH 5KG9B 3K2MC 2XXFA 5F8RC 2A79A 2KS0A 2X2JA 1UXWB 1PHQA 5ISZB 4JIIX 4BQBA 4LFHG 3DXAB 3PB2A 4C5YA 2EDQA 1TPB1 1F1AA 4KO6A 2DORA 3G5XB 2ZUQC 4MDJB 6PCYA 1M6JA 2XZ7A 1DUZA 1XTMA 2Y1YA 4X50A 3RKDC 3ZR6A 1OK6A 1KWKA 3KBJA 4L6HA 3VCCA 4E4FA 3H7BB 8RUCA 2ZOOA 1D9KB 2UV3A 4MKTA 4N0FA 2H2SC 4BZ2A 1DXFA 4M4RA 5KVFH 2H26B 4AVNA 7REQA 4MJ2A 4BI7A 1ZHNB 1SJAA 3W11C 3ZE0E 3KLHD 1LK2A 4XNQB 5A6TC 5A2IH 4X7EC 2ZVRA 4A35A 4MB1A 3V4VB 5EZIH 3W56A 3ET9F 4F33A 1JGIA 3P69A 4PV8B 5IR1A 1S2AA 2GJNA 4INFA 1FH9A 4GIAA 3D0AA 5D30A 4TS6A 5EEUA 1UJ3A 1PU0A 1E3XA 5LGKA 4GABA 1D8CA 2PLMA 1Q13A 3VG9B 2WVSA 4Q14A 2YD4A 4O9HH 4I7UA 2XWDA 3O0KA 5EZOH 2FJHA 3FKUS 1QKZH 4P2OB 3G3MA 3LHVA 3TR9A 5J6GA 3B8TA 4NI8A 4Q4KA 4WXZA 2CLZB 2LLNA 1E70M 2L4OA 3ARRA 3SE9L 2VIRB 1I8UA 3SEPA 5J57B 3GC3A 2XPKA 3WY1A 5C09A 4IPPA 4MXVE 4C1NA 3GU1A 1WBZA 2F7PA 3NA9L 4IOTA 3TZNA 5A2FA 3QNYB 2QTEA 1CG9B 2XWXA 5KANG 4IRZA 3DI0A 1NFGA 3WCZA 5EF1A 3FMGL 4QGTA 1JFQH 5JR1L 3U2CA 1QNSA 1TJHH 4XBPB 1SZRA 3HBQA 3PE9A 1NMBH 4Q7DA 5F9AC 4QIUA 3S8WA 1PG7W 2ED9A 1MAKA 3GK8H 5XIMA 1ALDA 4Z7QE 5H1WA 2ZWNA 4XMUA 5FHBH 4KF1A 4GG6F 5I8KL 4Q4RA 5IHZB 1QOKA 3GXPA 4NBYB 2VXQH 3KBPA 2JIEA 1T41A 4M5YL 4J1UB 2BVQA 5E94B 3WKPA 3AIWA 4P3CH 3FIGA 4BWLC 1U8QB 3GJFH 4FA6A 3AREC 4J3XA 2LGNA 3DK2A 3E8UL 2O6CA 4O0QA 3AT9A 4Y5VA 3ARGA 5JW4Q 4Y7EA 1CLYH 3MBEB 1A7BA 5EU4B 4ERIA 4OZGE 1RIUH 4ZPVA 3RCYA 2V7HA 5B8CB 1UEYA 5FJOA 3QDJA 1ZBCA 3DX6B 1FDYA 3BWAB 5G1TA 4LAQL 3K6SA 3U7VA 1WA2X 3U6XA 4QEGA 1EF3A 3P4OB 1PXGA 4O2EB 1XWYA 4EQ2A 2BNUA 1UZ6E 3EX1A 2HWZH 3QHNA 4ATDA 2Z1WA 1T0OA 3Q67A 5KVEE 4L9XA 1FBAA 1K9TA 5LAPA 2VXUH 2EF9A 2YL9A 2ADFL 3C60B 4FXRA 1BQKA 2EXWC 2HLAA 1WCQA 3C5JA 3DX6A 2WNGA 3L1FA 4FYSA 1U93B 4AUBA 3AUOA 3V0VB 4G9FA 1AHMA 5ABHA 5D8JH 2IMMA 2CHNA 3S5LG 5M95B 3MRIA 1JCXA 1TQCB 4KVNL 4UOW0 4ISVA 4PSRA 3DN5A 3T2NH 4ADIA 2FKPA 1PCXA 3NCWA 2G9HB 2LLLA 3NZQA 4FQXC 4W9FC 4LNYA 3FFCE 4LCUA 4EDXA 2P7TA 3DK0A 3OAYH 2KLSA 4WQOA 2AHIA 4M1CC 2NXIA 3CMGA 2J4WL 1KY6A 3CSTA 4CNIA 2FMNA 2GOKA 1FFPA 3IDGA 2IDFA 5EZIL 3U4BH 3GSXB 4KWUA 1TVNA 4LIQH 1E27B 2WBXA 3QZOA 1HVQA 3Q4DA 4UUIA 4L3ED 4EUPG 1XGPA 5JNYB 2WWNA 5F7YC 3I9GH 3PXJA 2WAQA 2O6PA 2G97A 4WY0F 1QWGA 1CDIA 4M5ZL 3BN9D 1XYLA 4LGRB 4B5XA 4FFYL 2W92A 4XHQA 4Z7VB 4WJXA 3NIDE 1E28A 3HPSA 5HYJE 5FO9B 3NQIA 2VRQA 3NQAA 3W39A 4I7WA 3QDJE 2YCKX 4JL2A 2NXYD 4WCYL 2EPLX 5C9ZA 2EAEA 1FA2A 3WTUA 4WTZG 2FHBA 3ZVVA 3HMXA 4PRPA 3A67L 3MJ7A 4APXB 4PBFA 5C08E 3RWEB 3L3DA 1DVFC 4A67A 1RL1A 1DE4A 1RULH 3N1FC 3RBSA 4GW4A 3UJIH 2GDVA 4FSAA 3G6MA 4A2RA 3WLBA 3VXMA 4G2DA 2J8TA 3ME0B 1W9VA 4M03A 3RNKA 3N1GC 1FXPA 3QHMA 2NNXA 1Y5VA 2B4CH 2PLCA 2J24A 4JDZA 1GG1A 1NIFA 3PAVA 1Y6NR 1R17A 3RDTD 5E99H 5ICXB 3DX4A 5D7IE 2H9GA 5EUOE 1LCOA 4NM4H 4E6MA 1OCWL 1MIEL 3A3HA 4R9OA 3HLAA 4PRHD 4RGOH 5HI4C 2B0MA 3F7VB 4NNPH 1HH6A 3FCTB 3CIVA 1TCRB 4KROB 3QIWC 2QF7A 3A5VA 2G4JA 3VOIA 4CQ8A 4GBXD 2IANE 5ESAA 4GNVA 3LGGA 4XZIA 1HZYA 1LDPL 4BS0A 4G8GE 2YWYA 1ET5A 1Z5HA 3KRUA 1M05A 1HL5A 1SF5A 3TN0A 2X2IA 1XLHA 4N9GB 5J56B 3TNMA 2WVVB 2YMXL 4ZTEA 5AC6A 5CC6A 3RY5A 1XIWB 4N20A 5DD3H 3LMYA 5L2KE 1OLLA 2GJXB 3G8RA 2D8KA 2GK1A 3WJWA 3BVTA 3MRDB 3V7MA 4X6DF 3AWNA 4I6KA 3TO4B 5ICZA 3U2IA 1VFLA 2Y7SA 3LHZA 4F2MB 1JPMA 3WD2A 4EOUA 4IMAA 4WQ6A 3IIZA 1IGJB 5G2NA 5C6TH 1EEYA 1SMOA 5EC1B 1INEH 4ZQRA 3WD3A 2P45B 1DSYA 4CADB 3TTQA 3C6EA 4MRBA 1OP5H 2CRMA 3QEQE 1II4E 1UM6H 3PQYE 2W8CA 1N64L 2XGIA 2PRLA 3BICA 3JVGC 4S23A 5HJXA 5I3HA 5JPMA 2Q7AA 4DP1X 5TE7H 4AEIL 5MF5A 4PTVA 2XWZA 4ZW5A 4F0MA 3D87B 1MREH 3T0WA 3UYRH 4N1EA 25C8H 5FFGA 2DSUA 3FX4A 3O0FA 1S5HB 2LHAA 3WD4A 3TZVC 5MEQB 2VNCA 2QZQA 4KFZC 5TE4L 1GUVA 3QMRA 3S3JA 4JREC 4RA3A 4DGVH 1Y5WA 3NABL 4JX4A 4HKBB 4FNUA 4ZMOA 5HHOA 3THDA 1HCFX 4X83A 1MCRA 2QQKH 3RIKA 4CGUB 4JEJA 3NCEB 4FFVC 2JWYA 1F2JA 2WKJA 5CKSA 4MMXC 1IEAB 1H61A 35C8H 2JELL 3MLSL 1TWWA 4Z1AA 4M6NH 4CVZA 5IEHA 2XN9E 3BK0A 3DFYA 4LEFA 2WOQA 3TFKD 4X6BB 2J88L 4KMLB 2TMDA 4YL2A 1EBAA 1CI3M 3MO4A 5CBJA 5KJ7E 1KTJA 1SUJA 2JQMA 4OZFB 2X7LB 1F3DJ 2ZOTA 5IK3A 1AIZA 1QA9A 3HHSB 4O58H 5ERWA 3FU8A 4UTBL 1AKJA 2AV7B 3V6ZA 1PL9A 4QG8A 4JS3A 2IAAC 2WPGA 1N19A 2VLKB 2WV3A 3L2MA 1KBBA 1OE2A 2QSQA 5LO7A 5FB8B 2APTA 3DMMB 5DQJB 2KDGA 3O3BA 4OLWH 5D38A 4DP2X 5FUCE 2CXKA 2YL5A 1HZHL 1TMQA 3P0VH 4MNQD 1INQB 4GAJH 4H7VA 5E4IA 4PMJA 4F57H 1U58B 1T3FA 2WNZA 1I8KB 3TT1L 4JM2B 1MCIA 4DP5X 1MEWA 4JFWA 3CZ8A 4KKPA 4JO8A 5FSDC 2DEWX 3BZFB 5A16B 1YEJL 3S1WA 1KPVB 5EIIG 3O6LH 4JZOB 5HYSA 1B9KA 4UQCA 2VZOA 3IJ7A 2QUTA 2X0HA 2FUTA 4XP4L 3W5NA 1BVWA 1XRFA 3B8SA 2XSBA 3AMDA 4IFRA 2EEXA 2E27H 4KJQD 4Q8BA 3BGJA 1BZ7B 4KMQA 1KLUB 1XZ0A 2CLRB 5DUBA 1VPYA 1CLVA 1WZKA 5BXRA 1AVAA 2D2GA 4OD3H 4HK6A 3SKUD 2FIRT 3WEBA 3ZO0A 5DS2A 3Q6FB 1XISA 5JQHC 3EFOA 4J4PA 1LT7A 4NQXB 2FTPA 3BH8B 2VDGA 4C4KO 2BOBA 4HA1A 2Y25A 1IBDA 1NPJA 3TJHD 2B4CL 2OZ4A 2C3WA 3MMDA 3PTMA 2J2ZA 3S9DB 4PR5A 1LQ0A 3IETB 3QXDA 4DQAA 4LUTA 3WEMA 3EKZA 4HUXB 4NBZB 4HHAB 3TZVB 3GZKA 3SPIA 3ZO9A 5GNYA 1ZZMA 3W2JA 2V2WA 1T4KB 3A23A 4LLVA 2XZAL 4D6HA 4KKCC 3VUPA 5F1UA 1E8YA 2VLMD 3B9KA 3G9VA 3VXSB 3LKPB 2ZQKA 4DN3H 5BQ7B 4HA0A 4HU4A 1IAOB 3W74A 1RP9A 4TQPA 4ZR8A 3WELA 1VPXA 5ACZB 5AB0A 3T81A 4MJZA 3FO9B 5HDBE 3APDA 2P26A 2W9DH 5DSCB 5I00A 2OZ4L 3C8NA 1YNLL 1BVLA 1ZPUA 3NH7L 3EBIA 1FAIH 4PS4L 3PYCA 3SYOA 1LOSA 2Z65C 1NU5A 3WG6A 4PCSA 4GXFA 5ACZA 3VW3H 1J5TA 1E4XI 1A3HA 1SXSA 3VNYA 3LKNA 5CP3A 3QZPA 1XR2A 4EF9A 2C1PB 1BVLB 3STGA 1BZQK 4AQ1B 1Q6OA 3MUIA 1NPNA 3IU3B 1J5OL 1EV2E 1MYRA 4XAZA 5JVLA 2XN0A 4MXQD 4HJTA 5TF0A 2J9XA 5D5ME 4RV8A 4WX2A 2AXJA 4P4RA 1FIGL 5D71H 4ZXLA 3GHPA 4IW4C 4U4IA 4YX2H 2EYSA 4IKKA 1UC4A 3WQDA 2GITA 4I3SL 3H7UA 4U7KA 1E4LA 4PLNC 1A5SA 1UVQA 5AN7A 1ND0B 2YZ5A 1CL7H 4XGZA 3WUWB 3DX2A 4YTUA 3MLWL 1E8ZA 4ZX5A 2GTWA 1WTLA 1W3IA 3EF7A 1I7ZA 4U31A 2VXTL 4Q4MA 1EJOH 2Z7UA 3U5UA 3QGAC 5F7EH 1CXEA 3CVIH 3P2DA 4K8RL 2EKCA 2Z6JA 1AGBA 3QR2A 4N2KA 3TP4A 4M61A 3NH7H 3T1FA 2KMWA 4DN4L 2A9NL 1WFTA 4NJJA 4LAZA 2VR4A 2OMXB 4DIXA 1CDBA 2JALA 1DFXA 1AODA 4JFYB 3FN3A 3KM8A 1M41A 3W07A 3P11L 5GS1A 5FHBL 3NCBB 3T0VA 2J88A 3LRKA 2YB4A 4HVBA 2ZYFA 3M4HA 1CXFA 1UOVA 1JN6B 5JMUA 4IOSD 3VQ1C 1AJ7L 3PWPB 1KELL 1KM3A 3B5TA 1MLBB 2EC9U 4NFBA 9XIAA 3MBED 5KS9B 2Q3XA 2V37A 4JY6A 3OGRA 1PLBA 4PB0H 2VN7A 5AOLA 4PJ9C 3Q9PA 1KBLA 4MPKA 3I9PA 2VUYA 4QCIA 3T8MA 4AIOA 3WKQA 3EMCA 4JG0H 1RJQA 5DJZA 3RPBA 5KMYA 4KK9C 3DTXA 3MU7A 4PJBA 4P61A 3UR8A 2VR5A 4DZ8A 3NZPA 4ZJ9A 3LJ3A 3U0WL 1QO2A 1IQWH 3S4SB 4XD4A 3C3NA 3A3WA 4BFEA 4MNMA 3L4TA 3KYNB 4X98A 5AZUA 5I0XA 3G08A 1WXZA 1AJZA 5I1HH 5CP3H 1QFUH 4ODXA 1KEMH 4Q4EA 4X80H 1PB0A 1G7MA 3U30C 3GS4A 1BEXA 5D72H 3UAJC 1GG0A 4V2XA 4YXHL 3D18A 3C8DA 2JJTC 2M1KA 2SODB 1FCBA 4M6PA 4YXKH 4RDQG 1BSIA 5AYZA 4RETB 1EWHA 4GH7B 1N2VA 1NL0H 3ARYA 4ODXB 1E7VA 3BYYA 4FP1A 2C4XA 4ZW7A 3CSGA 4R3SA 4K3ZA 1MCEA 5TDOB 1W3LA 1SDDB 1ZT7A 4OQTL 4GA8A 4UI2A 2OS7A 4OI7A 3OAYK 1J87A 2GUOA 2X4TA 1MQKL 4FJZA 3H2PA 3NCFB 1C92A 1CEOA 2BMBA 4BQCA 4I7VA 2A0LD 2PWDA 4LLWA 4NOBA 3VWKB 2O9PA 5CM1A 3EA2A 1B0RB 2WW8A 3MRHB 1RPXA 2XY2A 2R1MA 1I9RL 2EYTB 3WY2A 4ICXA 2YQGA 3RAJL 4MJID 3RI5K 5DWUL 1KM0A 4KRTA 5B7YA 6REQB 1ORQB 3VZYA 1R9YA 2ZA2A 3NSMA 3V4UL 1IE4A 3B6SB 2NSMA 2BIIA 5F0LB 5C08B 1RUPL 1KSRA 1P0EA 3ARQA 3P0WA 1A1OB 2DM3A 2YBRB 3GRGA 3NK4A 1CICD 4LSVL 4ACPA 1R3LB 3CDFA 4BD4A 4Z76A 4FXJA 4DJEA 2GFBA 3DOSB 1U3NA 5I5RA 2X4RA 4JG9A 3P5YA 4KEVA 1C08B 1H3TA 1FZKA 4ZODA 1MNZA 3B2VL 4D0CB 3ZJ7A 3FUDA 4KKCD 4Z7OB 4FEIA 5LBSA 4GG6A 2F2HA 1UR2A 2ZQ0A 4HKZB 3M43A 3NIDB 2J66A 1K85A 3UAEA 2BNQA 1H4PA 1YEEH 4KWVA 3F4NA 3U7YH 1UZ1A 4QTHB 5H37A 1NANI 4DXKA 3GK8L 4X6CB 3ASNB 3UJJL 4M43L 5C0FB 1YNKH 1VS1A 3ES7A 3MNWA 2O30A 1NMBL 3GM0A 1AQ0A 3HPLA 4AD1A 1OQFA 3X3GH 1VZIA 1K8DB 3WNMA 5CAKA 1NWOA 2O4EA 3O16A 4H9MA 4JQIA 2QJNA 1H0DA 2UY7A 2R0LH 4FFZL 2DIEA 5D70L 1M57B 1BMWA 1H3WM 2GDQA 2R1WA 5H8DA 3UX9B 2AOSA 4UU9B 4LHUB 3OLIA 1XXXA 3EHBD 5HHOD 2NX9A 3KAOA 4Y1SA 1C8QA 1F13A 4GQQA 4ELMA 2VUKA 2YA1A 3HFFA 4YDIH 4BXVA 1E6NA 2J56A 1QMLA 5DT5A 4P57A 3FQTA 3M07A 5L6YH 2DRUA 2MOGA 2VKZG 3BSGA 1BJMA 4RRPG 5CWSB 3MKKA 1MFEL 4HC1L 1TE1A 3HR5B 1QU4A 4FNLH 4PY8J 3WBYA 2Z2BA 4UTKA 1PV8A 3Q1SL 1FLRH 3W75A 1W37A 3T08A 3FQTB 1UATA 4A3QA 1SN2A 2Y1ZA 2YPVH 4JDVA 3UXDA 4W9ZA 4L29B 3QORA 5HXMA 2PTWA 1X5ZA 2CO3A 1AQFA 3UTTB 5BS0A 3GAKA 4ONGL 2VIRA 2QJIA 3RWHA 4WY0A 1OG6A 4U1KB 1BWMA 2ENQA 4NSKA 2RA1A 2Y06H 4JTTA 2WQXA 3U9PH 3NO1A 4QO1A 1Z2KA 4Z7VF 3URBA 2ZUQB 3SKOA 4GC4A 5GXBB 4U10A 3M0IA 3QZWB 3HRZA 5ICYA 2RGMA 3WFEH 1J9RA 4D0BB 4ILDA 2NUTB 2ISSA 1YX1A 5DEGA 3DX0A 2D4FA 5HNRA 3SKOB 4WHTB 4WDWA 5LIXX 3L7FB 2P28B 4CD8A 1Q9LB 3BFOA 3IGAB 4NNYA 1RJLA 3WHXB 1FAKT 3L95A 4E36A 1RAMA 2A6IB 2OSLA 1FL6B 3ZKXC 5HK4A 1OYBA 1B9ZA 4AVHA 3LCGA 4HTYA 3KAAA 3CHOA 4U1NB 1W0WB 3WQEA 4EPDC 4JTJA 5J04A 1Q9LA 5DR5L 1N0LA 4U6VH 3B7UX 2DJLA 1UOZA 3ECUA 1PY0A 2XQYK 4B9KC 4ZFOA 3VZZA 1CIDA 2NY4D 4BWUA 5CEZL 4JFDB 4F0HA 2ARJQ 1TQWA 5KW9L 1W1B1 1HS6A 2EXSA 4O8RA 5F4WA 1IJNA 3F2DA 4IRSA 2Y06L 1S3KH 1JDAA 3P4OA 4WWKB 5TDNA 1OM3L 4DJDC 1DHKA 4NNAA 3UTZA 4GRLC 2A3BA 5L9FA 1TWDA 1Z9SA 1UB5B 2XVPA 5IHSA 4EI6B 2ON3A 2DI7A 3AY4A 5GISL 1XIBA 4ZEPA 2HMIC 4ERSL 1N8ZA 4HYTB 2HBVA 3ZWSA 2NZ9C 1V8EA 1QSEB 3O45A 1G9EA 5HJYA 2BHZA 3M1BB 4IKJA 1JMZA 1A49A 1WT5A 3M1CA 3HZMA 4HCRA 4O02H 3M0XA 1E5YA 5F7DA 4H3DA 4JN7A 4TULL 4NRXA 4NRZA 1H3PL 2PDBA 4JDBA 5E2VH 1FZMB 4HT1H 5HI5C 3BISA 3H0TA 3GG0A 1NDZA 3HMWH 1QHZA 5E8PB 5HA7A 3KCPB 2YDRA 1YQVH 2ADJB 2OOGA 3N6QA 3TONA 4C4BA 4F80A 5T26A 4HTBA 3SCWA 1TWSA 3QJUB 5TDPA 3DOIA 1A6ZA 3BWSA 1CXLA 1U4EA 3FH5A 3HC4L 3FO1B 3DURA 4G80B 3ZDWA 3KLQA 3MXWH 3QA3B 4YDVB 1XP3A 5TIMA 3ARFD 4JFQA 3KNBB 2ZNWA 1MI5D 5IVOA 3WKYA 2AQWA 4L8BB 4BRJA 5F0JB 5EOTB 3SO3B 3KEHA 4U1GC 4DWSD 2E6AA 3VCLB 1V93A 4OFYA 1BZ8A 5AW2B 4P46C 3PLYA 5GZOD 4YLCA 3K1GA 4GJJA 3E2RA 3EG9A 2I60H 1ZGLB 1C12A 3ZOAA 1PEWA 3K3QA 4HU0A 5ABFB 1F4YL 4Q32A 3UJJH 1ZL1A 3CAKA 1MFAL 2H7WA 3P8JA 4XBGB 5JO5A 3L3JA 1P4CA 3IJDA 4KRMB 5D2NE 3V5HA 2P5WB 3ARDA 1KFKA 1GC1L 2WXKA 2K9UA 2YPLB 3LZQA 4LSUH 5TK2A 3QEQD 1XS2A 2MNRA 4C59B 3HIJA 4GO6B 5F7NC 3U36B 1XM3A 2ACUA 5KUMA 4K7PH 1KQYA 4TU1A 3CGTA 4XBGA 4ELKA 3CDGB 1BF2A 3NP3A 4FMFA 5GRVK 4F7TB 2F7FA 5LSMA 1KGUA 4V1DE 4KS0A 4M8QA 3OVUB 2ZA3A 5JBFA 4U3AA 2AANA 3WGUB 4L8CA 1BMGA 5E4EC 3D4YA 3PRZA 5DO2D 2LABA 3RX8A 3VXTA 3UDWC 4DY1A 4HK3N 4ALDA 4MQ7B 1QI4A 4PRNB 3OP2A 5HHPB 2OKOA 5IB1A 3KVDD 4ACYA 4PGCA 1C8PA 2UWEB 3FFCA 3ML8A 4FNLL 4FCAA 3BV4A 1Q3NA 3DSFH 4JKWA 3T2NL 1IM9B 4X2PA 4ZYKA 4Z78A 4MB5A 4JANA 3DO7B 1BLNB 1KTKE 1MCDA 3VYNA 1COBA 5I8EA 3OVRA 4NYLB 3IDYB 4EDWH 2GJ6E 5LHFA 4X4KA 2JTYA 4DZBB 1KCRH 1UUMA 4O12A 3WNLA 4YHOL 1XT5A 5T3ZD 1XD0A 3A47A 3CZLA 4RH4A 1KMGA 3TO4A 3OZMA 5I66B 4C6BA 3TN5A 2ZKHH 4PP1C 4PWEA 1GVYA 1EZWA 4RW3A 2GJ6D 1CU4L 1PSKH 1OPGL 5FUOH 3SDXA 4IJCA 4BFKA 1E0UA 4BZYA 3W7NA 1RUAL 4OCWL 2DLEA 4OW6A 3IACA 2WUBH 1MVUB 1BVKB 1TQTA 4S1QL 1QUPA 1C5BL 1VBGA 3AIBA 3VU2A 4BINA 5BV7H 2RAMA 3HJZA 3AIVA 1BGGA 1FRGH 1LO3L 1R3KB 2CG9X 3CK0H 4LCCA 4X7TA 1ZLUH 4OCRH 3T44A 5ESVB 3TLRA 4YN5A 4HKJA 4QRPE 4UV4L 5GRXG 5T1KB 3ARXA 3VXSD 5IB2A 2FH8A 1E4XL 1Z9OA 3GMLA 3L12A 7PTDA 2ATPA 3VWKD 4D8PB 2Y89A 4KCTA 1RZ8B 3GZ3A 3R13A 3GIQA 2Z92A 5IW1A 1D5MB 4WNQA 3GR4A 2A6KB 3MCKB 4K38A 2Q8LA 1ZDSA 4Y19A 1ECQA 2NLYA 3Q6GH 1XMWA 3TF7C 1O6IA 3GMLB 2HKHH 5KSUB 1YKWA 4IP4A 2GJJA 2VDQL 2ZKHL 2YLHA 1ECEA 1JHKH 5DLLA 3T3ME 3GLAA 1YW1A 3TUUA 3Q8EA 1LGVA 1T40A 3S1XA 1V7ML 5CD3B 3NEOA 3NBNA 3GRWH 4DN4H 3MRNB 5KYUB 5BOEA 3LI1A 2ZUXA 5BV7C 4DAIA 1HEZA 2BHUA 3EB2A 5G55A 1J0HA 2OTWA 4L23A 4ZX4A 1QSFD 3DDMA 2CZNA 3F64A 1EJOL 1XH3B 1H3PH 3WD1A 1T83C 4QYAA 1EC8A 1BGXL 1INQA 2PDNA 1MI5E 4Z7NF 2CE6A 2GQAA 4NC2B 1W9PA 2KX9A 2PBOA 3ETSA 4PLKC 4B97A 1SDAB 2ZRVA 4WKFA 1DBKH 3EBHA 1ETA1 1M9HA 4KBXA 2XA8H 1DBMH 2COQA 4EBQH 4YX2L 2E6FA 3WQFA 1VRXA 1S7SA 4NRSA 2CQVA 4L9LC 2VEMA 1P1ZA 3GZOA 1ES0A 2YMOA 3KM2A 1OM3H 5B38G 1ESOA 3ULUF 2GPTA 5F9JA 1EOKA 2JKAA 1BCIA 2IF7A 1UG6A 1YJDH 2Z00A 2X09A 4XE0A 5CFAA 3LNMA 4RE4A 3V7PA 5CJNA 1JWUB 3WJXA 5L7XH 1TPDA 1OZUA 1GMIA 1GMEA 4LEOB 4S3FA 4GLEA 4XAWH 1TPEA 3EH3B 4JG0L 1FBIH 1ZSDA 1IM3B 4K07A 3ESNA 3SPHA 4DAFA 3MT1A 1KB5H 3QI9C 4FS0A 1CE6B 2CKBA 4M6MH 4YN3A 2IGTA 1OZMA 3EKGA 5CINL 3R8GA 1MRQA 4OH2A 3CUPB 3VMPA 2NX5D 2PN5A 1SVZA 2WLNA 3O6AA 2W88A 4IOFD 4HK0A 4R5VA 3UXFA 3CZSA 4X7SL 5IQMA 2CO7A 5HHNB 3PCYA 1JPGA 4NT6A 2YEZB 4DNMA 4W9EC 3KW8A 2ITEA 3WF4A 4GXUM 2BCMA 2D0HA 1VPOL 3CV5A 3PHSA 3VFPA 1MUMA 2WOBA 5CCJA 2E5EA 3CSBA 3EFDL 4NNXA 1E4KA 3TEZA 4W8AA 1CK0L 3FOLB 4U1MB 4N0CC 3SCOA 3DIFB 5C70A 1LUCB 7ODCA 1Y65A 2YGPA 2J1XA 1IGYB 4MJJA 1K8IA 1QFPA 5ES4B 3MUY1 4D8ZA 3SCVA 4YTSA 3P40A 1C5DA 2B7OA 4TLUA 2P5EB 1UQZA 4C56A 3FN0L 5IROD 3P73B 4MXWH 2I5IA 4JB9H 4X6DE 4H2AA 4YL9A 3LXAA 4UZGA 2A3AA 3FT2B 1FJ1A 2GK0B 1NWPA 1ZOXA 3KXFA 4JZJB 3QPZA 1KWGA 4FFYA 3E3QE 1HHGB 3HFML 3RPKA 2DUXA 2QLVB 4MYPA 2VWSA 3UNDA 4XVJL 1DSFH 2CLZA 2ZONA 4AY0A 3UT0A 1BFOA 3BLPX 3O6LL 3X1FA 2DYPB 1TUPA 5I0ZA 4J3BA 4UDTA 3G1DA 2VI0A 4CNSA 2RCSH 1HXKA 2OX4A 1KIUB 2QZRA 3U1SH 2UY6B 1GOHA 2BP8B 4APQD 3CQHA 4YO0A 5JQ6H 1JYNA 4XNBA 3GC5A 2JKWA 2F5BL 1AGEA 3BUTA 4PREB 3O6FB 5DJ8B 3GHEL 1UG9A 4JRXE 4UMSA 3VH8A 2DT1A 3L9RA 4JKKA 3DC0A 3HHRB 5C08D 3ULVC 2FH6A 3N1PC 3P81A 5CPSA 3VOCA 2XWJA 1PKMA 4CVUA 4ZW3A 5F1OB 3BIKA 1R3YA 3N4AA 2Z27A 1QQDA 4Y4HC 4Y5XA 3EWZA 4F9JA 3HUJB 5TK4A 2VC2L 2YRBA 3FUJA 5C71A 2HA1A 4UTIA 1O9WA 5E6IB 5SV4A 4BWTA 4H8HA 1A9VA 3MW7A 2XWBA 2XFXA 1UJ3C 1UWEL 5T1JA 1HXJA 4YDJB 3RWFB 4Z9KB 3NRPA 2WHJA 3VFGH 1H5YA 4KKAD 3RTQC 5I26A 1QAPA 3WQOA 5JH1A 3U79A 2CLFA 2WC4A 4RESB 5BWAA 4LHUG 5D1ZC 4NUMA 1P5UB 3BUPA 3QIUB 1T99A 1ZJAA 3DIVA 3HS0A 1XCTA 1BOGA 1A7QL 3IEBA 3K13A 5MENE 1M56B 3QFWA 4NKMB 1AFVH 4H2CA 8A3HA 2ZYRA 3QKZA 3CDYA 1JBJA 1L2QA 4PRAA 2Z8WC 2HS6A 2I7GA 4L8SB 4C4UA 5CZXC 5IBTH 2V2TA 3QIUA 2QL1A 3TA9A 2R27A 4Z7WE 4NWUL 3WFCL 3BRDA 3CFTA 4POZC 1PS9A 2J7BA 3RUGF 2RALA 4Z7AA 1I75A 3HPXA 5F6IC 1CENA 3QH3B 3OGOE 3QQ4B 5E2WL 2YZRA 3Q2VA 4PJ5D 3GI8H 4NZUL 3PPCA 1JVOA 1RVFL 3G6DL 3BIAX 4AIEA 3KPOB 2G9HA 3HZ3A 1KYAA 3RX9A 3T6QC 1Q45A 3DHUA 1ANUA 4AYGA 2F8VA 1A3XA 2DY3A 1NBZA 2ZWKA 3H53A 5LNDA 3O81A 4PJ6A 1L7IH 1LP9A 4IGBD 4ZS7L 4F57L 3GS6A 3M44A 3QC3A 5A3IC 4N0YH 1FH5L 4N8UA 3HTLX 3MWAA 1KBGH 1B2YA 2HLAB 5JXEC 1J6OA 2X2GA 3W7JA 3RP1A 3RLVA 1R9XA 2OM5A 1NIEA 5LBGA 5MP6L 3N25A 4HSHA 4O53A 3KPLB 3TQVA 3KLAB 1QFUL 3BPNC 4X80L 3BHBA 5CIPB 3VVWA 3FB7A 3EGDB 1K6WA 3PTKA 5FJTA 9XIMA 2V82A 3GH7A 2AITA 4LOUD 3RUBL 3FTGA 1OF0A 1U8PB 3K6IA 3RGVD 2WKGA 1OGAE 2YXVA 3P0YL 5HHMD 3RDJA 3DU0A 1MI5B 3LNPA 4KTDL 3QY8A 5C08A 1JRCA 3X11B 1HZLA 4U0RC 1JZ3A 2EIKB 2WUCL 5LYRA 2H32A 1R3LA 3S37X 6FABH 4I4WA 3OMZA 4GKLA 5JHDD 4PB9H 3T65A 1LD9B 4KEMA 1UC6A 5AB9A 4MF4A 3RWEA 5D2YA 1R1CA 5DU7A 2BO0A 4JGDA 5D33A 1KIPA 2QCLA 4YGAB 2IPUG 2XPGA 3VXMB 1S38A 3SSZA 3FTXA 5TE4H 3T3MB 3IWVA 5GZNA 3CH1B 5EUOA 4BKTC 2DJUA 4HWZA 1M7IB 3ITLA 1U2CA 1BXNA 3W7IA 1M3IA 3B43A 2E7HA 1R87A 1B54A 4UTWC 4QRUA 1FBIL 2PCQA 3L67A 1JRHI 2JJVA 4HD5A 1DQDL 3TPKA 4DFIA 1ZP3A 2PU0A 5G4EA 2LR4A 4M6ML 4FALA 2FLBT 1IBYA 4TSCL 4Z42C 3ABZA 3MSYA 5DRNB 4KEZA 3CEUA 1REIA 4ZUVA 2AJ3A 1KJ2L 5J89A 2BVUA 1QCWA 4QEHA 4R7JA 2NY5H 3TV3H 4V1YA 4KJPC 5IEKB 3P30L 3VGHA 3GIVB 3ZTJG 1M05B 2V3DA 5GGUA 5I30L 2Y07H 5FYJU 5LKNA 3QPKA 5AALA 3KGSA 4E5XA 1XYCA 3UJEA 4F79A 1A5FH 4LOUC 3O05A 4QISA 3F6JA 1YVLA 2W94A 3KBEA 1D6EA 2P5EE 3X1BA 4NIRA 4PH8A 4GBXA 1EHLH 2IDUA 1W0YT 4P2OD 4PRTA 1KM2A 2EE3A 1QRND 2FZ3B 4OZHB 2VENA 3CPGA 3C61A 2PO6A 1SM9A 2MTPA 2YAHA 3GSOA 3NN8A 4ZSOB 3VMOA 2KKQA 2ZT9C 3AABA 3QFJB 3QIBC 2WXHA 3N9SA 3EOBA 4XVTL 4XAKD 2PP9A 4QXTB 3DUSA 2WLKA 1EEZA 1MEXL 2XACC 2IQAA 1ULVA 1ZBWA 1UZGA 1KM1A 2DSKA 5DK0A 3UPBA 1DL7L 1FLTX 4P4KD 1WICA 4H0LC 1ZANL 4G7SB 1IRAY 4ODTL 1NOAA 3P60A 3NQVA 5I8CB 1J1OH 1NFDB 3CLWA 3FQXA 3NCYS 2VXUL 3NPZB 1L0PA 5D2LF 4DVBB 1UOLA 4FA7B 5HHOE 9CGTA 1KLZA 2F53A 5HYJA 4ZE5A 2JB5H 5F9DC 5CPQA 4IFKA 1LK3L 1FWBC 3MB9A 3MKVA 4KQ3H 1UP3A 1WVZA 1YUHA 5FHAH 2Q6WB 2X28A 2CZFA 1KCZA 1CFBA 5FYLH 3T0EA 3N2TA 2AKMA 3JTSB 4OLZH 1A6AB 1IUZA 1Z0MA 3R18A 3DX3A 4MB3A 5G4NA 3BYTA 3WHE1 3NFPB 1QSFB 2MNUA 1G69A 3TW6A 4CVZB 5IEHB 4IISA 2ADYA 1FSKB 4KMTH 1XR9A 3QEUB 4NZJA 3OKEA 4YHPA 1L7TH 1WYJA 2HX9A 3CWGA 3GO1L 4KDTC 3WN5B 4M19A 2QJHA 2PUZA 1S5HA 3W83A 4HIJA 1TX0A 4NO2A 1IC0A 2ZG1A 4NO5B 4PYGA 1OCOB 5J9PA 1H7NA 3CYJA 2FWOB 4J6RH 3KPMB 4NN5B 2YPLE 4M5ZH 2A2IA 2FEJA 2D3VA 1ZV5A 5C2UB 1JPFB 4M3JA 3CZEA 5D04C 3V4BA 2ZE3A 1DWHM 1BX2B 1DVFB 2QR0B 2FBJL 5FF2A 3VRIB 5HNUA 1F6AA 1TPXB 1V55B 2CK0H 2XC8A 4IOIB 2C9XA 4Q7BA 3DWTA 1FGVL 4HCLA 3GTFA 4PCFA 4YYFA 1LNUA 4FEMA 4ZOBA 5T1MB 4JQVC 2UZYB 2V5SA 3RPIB 3UWUA 4JTIA 3WZ0E 4E0CA 3VRIA 1P0NA 1LRNA 2VOMA 3UAJA 2P44B 2DYPD 4XCEB 4NAJA 2CDGA 2BP0B 3CQPA 4EZMA 2Y7EA 4UMCA 5EU6A 4B9ZA 3W7LA 3LCYA 3N34A 4JZ5A 2XVBA 3QFDA 4WI0B 5IKCB 4AWUA 1E6RA 4QHLB 4IGHA 4B15A 3O3BB 3S3PA 3AJXA 3REVA 4MLJA 1QOQA 4ZDHA 4H0IA 5D9SA 4JQ1A 4I6VA 3DPBB 3G04B 4YHIB 3DO3A 2HJPA 5F1VA 3BGFC 1UEMA 3ZQXA 4MCNA 4NKDA 3W71A 4LAQH 1NAMH 4GRLA 2RFGA 1C3FA 4ZOAA 3V9FA 1E4IA 3FQNB 5EUKB 1VBRA 3QQXA 4PJXF 1W3KA 5D7EA 3H56A 1OP3K 4GIEA 4NSBA 4HHAA 3TZVA 4TSAL 3HMJG 1F4HA 1T1ZA 2YBVA 4POCA 2CLHA 2UX7A 3LY6A 3H9HA 4PJEE 1JV5A 1KLFB 2NUWA 4G6ML 1QRKA 5GS1C 1FCUA 3WIHA 4B95C 5ABDE 4NI6A 2C8NA 4JHVA 3SDDA 5GIRA 2DUZA 2XGZA 3IJYB 1L3NA 1S3RA 4D6FA 1VENA 2WMPB 4GLRI 4I0PC 3UXAA 1RZKC 5AFAA 1XV8A 1HKLL 5JO5B 2H2PD 3WQVA 3GDTA 1NUDA 2F8IA 2YZ8A 4IGBA 3VACA 4PJXE 1DVZA 3QUZD 4IBQA 1NY1A 2AK1H 1XYAA 3HPFA 2PXYA 1QBBA 4FO4A 2C9VA 4J2MA 2J1KA 3NJFA 1FNFA 3ARDD 2OBGA 1ADSA 3ZE1E 2E40A 1X5KA 5LWYH 1R3SA 3QJOA 1TF4A 4GS7C 5I3IA 1P43A 3O9WB 3F84A 1AZVA 4TYUA 2P88A 5BXFB 4GY0A 3URQA 3EYOB 4DIAA 1WGOA 3PS6A 5DC4B 2MTAA 3NDYE 2KERA 2SEBB 3KZPA 4XD6A 3G6AB 3SRFA 1BRLB 3S3DB 1C16B 1OAKH 1ZTXE 3FU5A 5LNWA 1H1YA 1ZANH 3VNMA 4FXKB 2W38A 3A3XA 4KFOA 1FNEB 1A3RH 2WJZA 1LO2H 4UR7A 5H2ZA 2QQNH 4DQOL 1IXOA 3DRTB 4G70B 1H9DA 2NX5B 1I0DA 2EHHA 3V3WA 4PL1A 1R3JA 4ZUUA 4X7FC 5D32A 3L7RA 3W72A 2ZJSL 4FXKA 1X7QA 1QPPA 3FDKA 5DGQA 3HA1A 3NCMA 2ZTBA 3M45A 1U8NA 1C29A 4QOKE 1TU2B 4U6HA 4R4BB 2YDAA 4KFPA 1R34A 4LBAA 3GMPA 4HQQL 4I5BA 4G8FA 3MLVL 4XC1L 5HHXH 1E5JA 2C18A 4QDPA 2PPAA 1AR1D 1EZUA 3KWWB 2ENJA 2DWEA 2VRAA 5DZPA 2K8QA 3TBWB 1KJVB 2ZWYA 2XVNA 2V33A 4Z77B 5F2FA 5CILH 4JFSA 2RAGA 3L4ZA 3NCJL 4U1SA 2CUIA 2A9MH 5IW3A 4M1DH 1IX2A 4A3HA 5GPRA 4PTXA 1GEQA 1ZAGA 4YDKL 4OU3A 3GGWB 2HVKA 4PCPA 5DUPH 4AVIA 5DTFB 2KZBA 3VXPB 4CW1B 3PNWA 4QAWA 3WKNA 4H25B 3U0HA 4N6RA 1PSPA 1Z0NA 3UR2A 3QUZA 4OLXL 1G67A 4X9IA 3DTXB 3OAWA 1N18A 4YVPA 3LDBC 1IAIH 4ZO9A 5HHVH 2QIIA 4K36A 4IHCA 1XRVA 4QSFA 4I5RA 4WGHA 1J10A 3AUVA 3KYNA 4X98B 1ITUA 3VCRA 3FVMA 2OWXA 1QO3B 3P77A 2HFEA 1M7UA