2QMJA

Crystral structure of the n-terminal subunit of human maltase-glucoamylase in complex with acarbose
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
864
structure length
863
Chain Sequence
b'VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase, intestinal
publication title Human intestinal maltase-glucoamylase: crystal structure of the N-terminal catalytic subunit and basis of inhibition and substrate specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 274
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2007-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qmjA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qmjA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 2qmjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qmjA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 2qmjA01
1KCLA 4XX6A 3RM8A 3MSDA 3WEZA 1GONA 3VD7A 1F4AA 6CGTA 2QMJA 1GOWA 1NWTA 3ZJ8A 1BYCA 1QHOA 3OGSA 5A8OA 3BXWA 5A8NA 3CMJA 1U30A 4D6EA 3CV5A 2UY2A 4V2XA 2FHFA 3DHUA 4A3YA 3AIVA 2V5DA 2GJXA 2EAEA 3RPMA 1HNYA 4AZCB 1K9TA 1JYVA 2VRJA 2D3LA 3AZSA 1PZ2A 4GXPA 3WNLA 3L4UA 2PI6A 5CSYA 3B9AA 2VNCA 1R7AA 4P7LA 1PS3A 1R34A 3HG2A 1QW8A 5KEZA 2CXGA 3AISA 2ZXAA 4PTVA 1BYAA 4H2CA 3EBVA 5I5RA 1TZ7A 3VU2A 4OBRA 1HF6A 2CBVA 4OJYA 3WSUA 3M46A 3AIBA 4FK9A 4HU8A 1DTUA 1KXVA 4JFSA 3VIIA 1XHGA 3CUHA 5E09A 2FHCA 1KTBA 3ZR5A 4CN6A 1GOMA 1NWSA 2CERA 4F9JA 1H41A 2V3FA 5A2AA 5M3WA 3CC1A 1LL7A 4BQ4A 5LA0A 4A3HA 1AMYA 4J7RA 3UG5A 2ZUNA 4WIWA 4M82A 1B3XA 3GH4A 1UR2A 1C93A 3WD4A 3HJEA 4ACZB 2PC8A 4C7FA 3BGAA 1K9EA 5HBFA 5D9OA 1TQWA 1CGTA 3WNOA 4H7VA 1HJWA 5DEZA 1BYDA 3KL3A 5EFFA 2ZUUA 4WKFA 4JFUA 4Z2IA 4ZENA 1VFUA 4MJ2A 1OINA 1KXTA 3S6TA 3AXIA 1GQIA 5CLTA 4U3CA 3W53A 1KBKA 2XFRA 1B3YA 3VDAA 3BUPA 3U5YA 2WC4A 2WHKA 3EJRA 1X1NA 4V28A 1BGGA 4ZXLA 4B9YA 5BXTA 4BF7A 2C7FA 4CU6A 5IFPA 4LYRA 3AQUA 1VENA 1UH3A 5HPOA 3AHTA 2X8RA 2WW5A 4XZWA 3WBAA 3AROA 1MW2A 2W5FA 4AD3A 4U31A 3ZT5A 4Z2LA 3VD9A 2WMHA 1EDGA 3MUY1 3DX1A 2VX5A 2QPUA 1R33A 4QDMA 3AIEA 2O9TA 1SYTA 2F61A 2J75A 3EMZA 1E9LA 3CZNA 5E1QA 3ZT7A 2VRQA 3BVWA 4X9YA 1JI2A 4OIFA 2WLZA 3N17A 5E0FA 1FOBA 3OB8A 4EK7A 1KBBA 3VPLA 4U3AA 2E40A 3WFZA 2XG9A 5TD4A 3ZJ6A 1D2KA 4BQ3A 4ACZA 3VIPA 1TCMA 2XVNA 4W5UA 9CGTA 2DH2A 3BC9A 2Y8KA 1O6IA 3CMGA 4E8DA 4OBSA 2BHZA 2D0GA 3WN6A 4J3XA 1C92A 4W7VA 4JKMA 4UQ9A 1LLOA 4M56A 4TX6A 8A3HA 1JG9A 2J7FA 1ECEA 1W1VA 4W7UA 3BCFA 4DWSC 3IAPA 1E73M 4RE3A 2DSWA 4AD2A 1Q6GA 5DF0A 2ZX8A 5DFAA 3AICA 4QCEA 3CZEA 1MW3A 1PJ9A 1XCXA 3D50A 2WBKA 1PS2A 1U2YA 3WNNA 1HKJA 1HX0A 4GI6A 1TFVA 1QPKA 1W2PA 2D2OA 1J0HA 4QFUA 2DSVA 1VFOA 3WD2A 4J3UA 2BVYA 2W92A 4D6JA 3ZO9A 4BQ2A 5CZKA 2WVVB 1NWUA 1PX4A 2F8QA 2VZTA 1LG2A 2BNJA 5DO8A 4UQDA 4B16A 3EMCA 3K4DA 1HXKA 1IV8A 4UCFA 2CIPA 5A69A 3GZAA 3WKZA 4GQQA 1C7TA 4AEEA 2WPGA 4AWEA 3QOKA 4HA1A 2YBUA 4ACYA 5JBDA 2BY0A 1GCYA 3MUAA 2ZX6A 2YDRA 2CBIA 3SCWA 1E0XA 3BAKA 3CTTA 5D8WA 1UUQA 1EH9A 5EMYA 3WQVA 2D23A 1GQJA 1GOKA 4WK9A 1QNOA 1UQZA 3OLEA 1V6XA 3AS0A 5GQBA 1FH9A 4AD1A 2UY4A 4N0RA 1XYZA 1JI1A 2J47A 1HP4A 4M1RA 4QAWA 3BAJA 4U2ZA 4H41A 2CCRA 4XUYA 2WMFA 3H53A 4MNMA 2WHMA 4AMCA 3LPPA 3KL5A 5A8MA 5FD0A 3D4ZA 3VMPA 1JZ6A 1B30A 3ARSA 2PWHA 4XB3A 2WZIA 4HMDA 3DC0A 2WMIB 4JFTA 4UOZA 1NOUA 3BUBA 3PZTA 1FFQA 3CUJA 2ZUVA 1V0LA 1AQMA 1JL8A 1WNOA 4HZ6A 3FHQA 1R7OA 4FNSA 1V3JA 1VBRA 2OWXA 1QBBA 3HG3A 1BF2A 4XZBA 3GYCA 3SURA 1CECA 3CZ8A 3MSGA 2E4TA 3S5YA 1QHZA 5I23A 3U7BA 1CWYA 1OB0A 1GORA 2WLYA 5GNXA 1E43A 2CYGA 2WVVA 3CZSA 4H8VA 3SCNA 2X0YA 2EABA 3AS1A 2XSAA 3ZT6A 4NRRA 5ABFB 4LGXA 3FAXA 4AIOA 1E5NA 1TE1A 1W32A 3NUKA 4JHOA 4IPNB 4HU0A 1DHKA 1G5AA 3HN3A 5BRPA 2J25A 2VX7A 3A47A 1HN1A 3IJ8A 4JZ5A 2XGBA 1AVAA 4FNUA 2D22A 4ATWA 4GZEA 3BAXA 3UESA 5D9PA 4E2OA 4TTUA 3EDKA 1UYQA 3THDA 1ISZA 3D5HA 3G6LA 3W6MA 4AMXA 3VIOA 3BLPX 5E70A 1C7SA 2A3AA 3ARUA 3FNDA 3POHA 4DUXA 2DQXA 4QLLA 3SUVA 1O7DC 1E6XM 3FN9A 4KGJA 1E6ZA 2YIHA 3ZR6A 3E1F1 2ESCA 1V3MA 3K8KA 4NI3A 8CGTA 1WDSA 2WMIA 3BLKA 2X2IA 4W7WA 2QPSA 1MVYA 1OIMA 4GI9A 2DGAA 3A3HA 1XYFA 4CD4A 1GJWA 3N15A 3W25A 3B9EA 1J9YA 3CZGA 2PWGA 5CPTA 3GXNA 3THCA 3L4XA 3ZM8A 2D0HA 4HZ8A 1BG9A 3GNRA 1MW1A 4AD0A 1FFRA 2YDQA 2DSKA 2QLYA 1VEOA 5CPQA 3WIJA 3A5VA 4CD7A 4MB5A 2DT3A 4W87A 1JXJA 1R46A 3AS2A 5ABFA 1UD4A 1PEZA 2DH3A 5D4YA 3VGDA 3MU7A 2BHYA 3L4VA 1W91A 4OGZA 2CHOA 3VIFA 1MXDA 3L4ZA 2PSPA 1E3ZA 1X6NA 1OT2A 3I3DA 4IUGA 4HOZA 2J4GA 1DP0A 4EANA 1TVPA 2X09A 3OA5A 1J10A 4Y7EA 1V3HA 2YA2A 3ARYA 3K8MA 5M5DA 1E6RA 2ZIDA 4M80A 2XN0A 1EO7A 3VNYA 1V08A 4MB1A 1BVZA 1PX8A 5HPCA 2HISA 2VZVA 4GO8A 1CEOA 1MYRA 1BVNP 1EO5A 1DWGM 4UZSA 7TAAA 3K8LA 3CO4A 2XM1A 4GPNA 4C7DA 3FXYA 1XH1A 3PTMA 5HNNA 4DM1A 1JIBA 3AS3A 2UWFA 4TVDA 3LXAA 3EMQA 3N9KA 1A47A 3BVXA 3WQ5A 3BH4A 3O2LA 4PSPA 3VD3A 1ISXA 1TQVA 4M24A 3ZJ7A 2EPKX 2ZXQA 1JD9A 2JIEA 4F8XA 5AYBA 4UFLA 1OGBA 1BAGA 2J7HA 1UZ4A 4TOQA 2RGLA 2E0PA 1SMAA 1KFWA 4TVUA 1JF6A 1MFVA 4PSRA 3AIWA 3GM8A 4J3VA 4GQRA 5A3HA 4JL2A 2BS9A 3D52A 2EPMX 1R85A 4RE2A 2VX6A 3VGGA 2YFOA 4P8WA 3GBEA 4H04A 1HWWA 3ALFA 2WAGA 1RP9A 2PWEA 3A4WA 3AXHA 3G6MA 2EPLX 3LRLA 3CPUA 3L4YA 5A6KA 2GJPA 2VR4A 3WENA 2YA0A 5DT7A 3GXMA 3WY1A 3VINA 4B15A 1GOQA 1MQQA 5GNZA 4DO4A 4BZYA 2W63A 4ATLA 4FNTA 1C91A 3WDQA 4AD5A 3A4AA 3N13A 5GPRA 1VJZA 2CETA 4PMOA 3BVTA 5I24A 1W1TA 4FLQA 5ECUA 2J79A 1M01A 2WZHA 2IXVA 3AMLA 5BROA 2BXYA 4L4OA 3H55A 1E72M 4U5IA 4Z2JA 4Z2KA 1KQYA 4HPGA 3ZQ9A 1ZL1A 3AJ7A 4DM2A 2F7QA 4UFKA 1UD6A 1JD7A 1QWUA 3CZLA 2F7PA 1CLXA 1J11A 2W91A 1ZJBA 5D9MA 5A6MA 2WWCA 3NDZA 1UOKA 5A2CA 1L0PA 3SIMA 1J0JA 4P7QA 5CSUA 2W67A 2HVMA 4CU7A 4YN5A 3AXXA 1HP5A 2IXUA 1PE31 1SFSA 2Y5EA 5JIPA 4B3KA 3UEQA 1W2VA 2EADA 1MW0A 3CZJA 1HI7A 2WVUA 1XRVA 2CITA 2FHBA 1E1FA 2G4FA 2ZWYA 3NSNA 3GXDA 3TP4A 4RE4A 1DWJM 1VB9A 2FGZA 4CVUA 1Y7VA 4MNLA 2XHYA 2EO7A 1E6QM 4QP0A 4PUEA 4HZ7A 1V6YA 2VZOA 2ZUSA 2VQTA 2EJ1A 1E4NA 2J7DA 3RDKA 2G41A 1V3LA 2X2HA 3OBAA 4D72A 4IISA 2ZICA 1QVBA 1HL8A 1UQYA 1CXEA 3OLIA 1W9XA 1R87A 4X0VA 3WQ8A 1EDQA 5I79A 1MQPA 2CNCA 1CENA 2J62A 1W9PA 3L2LA 1W9DM 2FE0A 3SUTA 1BSIA 1GQLA 3A23A 3EJQA 3NIYA 1XH0A 2F2HA 2GFTA 3VOCA 3A6OA 2G8ZA 3LRKA 1W9VA 1E4IA 2CEQA 5A6JA 4EKJA 1BLIA 2PB1A 1QI4A 4UFMA 1P6WA 4N42A 3U57A 3QOMA 3TOPA 3S2CA 5CLWA 1B3ZA 3VUPA 3WF3A 2FDMA 3ZSTA 4W84A 3PZMA 3M07A 3CUFA 4AZCA 5I6SA 1XD1A 1UWIA 1QNPA 2WB5A 2ZUTA 1ZJAA 2WSPA 4KGLA 1PZ3A 4CD8A 4Z2GA 1W9BM 4D6HA 1GPFA 5IDIA 3AMKA 1M53A 1R8LA 1ZS2A 1JFHA 2EPOA 1JZ8A 1BG4A 1TQSA 2XVKA 3K1DA 1BYBA 3AHVA 2XVGA 1WZLA 3GBDA 2C8NA 3JUGA 1IT0A 1XCWA 5I77A 2J77A 3SCPA 3BSGA 3A4XA 5C8BB 1Q6DA 3MS8A 2UY5A 2DT0A 4LPCA 1NOFA 3VGHA 4J3WA 5CXPA 5A6LA 3SUSA 3DX4A 1KQZA 2AOSA 1VFMA 3IGUA 2VRKA 1V3IA 3T0AA 2Y24A 4PMZA 4HP5A 1SMDA 3AZRA 5E0CA 3ALGA 3SCVA 3GXPA 2F7OA 3LXBA 2VC9A 4QLJA 2BY3A 4J3SA 2UY3A 2IGTA 2JEQA 2ZUWA 1FA2A 3BAIA 3BUIA 4WKHA 1LJYA 2BVTA 4A4AA 1H0IA 2XWDA 2V38A 2AAAA 4P8UA 4D6FA 1E4LA 4P7OA 1AQHA 2YL8A 4MAZA 3OIHA 3VMNA 3VGFA 2WZEA 2ALWA 1MXGA 3CZKA 4L4PA 3PZOA 1KCKA 3AHZA 3WF1A 5AYIA 2VMFA 4PMYA 5FL0A 3VDHA 4TVCA 2OW6A 2XGIA 4JKLA 1EQCA 2D20A 3PTKA 4W85A 3WDIA 2YL5A 1IZKA 2ZXDA 5A2BA 2TAAA 1W3HA 1UWTA 3DYPA 3D4YA 4CD6A 4GINA 3WUBA 1QNQA 2CBUA 1V6VA 1D7FA 1D3CA 1C8QA 1BHGA 4MAVA 4W8BA 4JFVA 3TTQA 1KR0A 1CGXA 3T2PA 2PWDA 4WJXA 3VGBA 4JCMA 4UR9A 4GZJA 3W26A 3PZQA 3KLLA 4FLOA 4UQAA 4D1IA 3L4WA 2WHJA 1TR1A 3W37A 1CGVA 1UH2A 1G9HA 4FNRA 1W9UA 1JGIA 4Q7NA 3ECQA 2G3JA 3KE0A 1K6AA 2GUYA 2YA1A 1EGZA 1VJSA 1E55A 4IM4A 1PCPA 2JF6A 2DSUA 5IHRA 3PN8A 4YPJA 1VEPA 4ML4A 1KXHA 2DEPA 1QI0A 1QI2A 3EDEA 2X1IA 4MPKA 2WC7A 3DDFA 2PBOA 4TUFA 1WE5A 3TTYA 4KH2A 2BVDA 1V0MA 5BXSA 4D6CA 4PRWA 2WMGA 3FY1A 2EACA 1JNDA 1MWOA 2BFGA 2YBTA 4CCEA 4ATDA 3BVVA 4U2YA 2JALA 3OG2A 5LYRA 3WD0A 1G0CA 1CGUA 3TONA 3IJ7A 3CH9A 3WQWA 2GVYA 1TA3B 2RGMA 2Y8VA 3AFBA 3MV01 5BYWA 1GOOA 3OGRA 4QLKA 3B8SA 2G3MA 3J7HA 1UWSA 2CPUA 1ODUA 1E71M 4KMQA 1OD8A 5EFDA 3ZIZA 4HOWA 3OGVA 5I78A 4H8HA 4EE9A 1GHSA 3WBEA 4AYGA 1WDQA 1G01A 1UR0A 3MI6A 1R86A 5E6ZA 4FNQA 1FH8A 1JZ4A 1JYWA 1H11A 2QF8A 1EIBA 4FLRA 3F5LA 3SCOA 4PUDA 1E6PA 4IPLA 3RJYA 4AYSA 4HMCA 3RO8A 1CGWA 1KB3A 2ZX7A 4CD5A 2WCSA 2A3BA 4LYPA 1U33A 3BAWA 1WZMA 4OUEA 1JZ2A 3N04A 1XSIA 1E6SM 1NWRA 1B31A 3SCTA 1CLVA 1V3KA 2W66A 2VJXA 4MB3A 2FGLA 4BCEA 2QMKA 1CIUA 3DX3A 3WH7A 1CXIA 5FCZA 1JZ5A 5I0DA 1OSEA 5ABGA 2XN2A 3T09A 2ZXBA 1B1YA 1I1XA 4NSBA 3VTRA 1NARA 1QNSA 1C90A 4AZ7A 3MANA 1VFFA 5AY7A 1KGUA 4RL3A 4ZE4A 2JFEX 2BV9A 5M03A 1XSJA 1KTCA 4MDOA 4E4PA 3AZTA 4KRUA 2XPKA 2ZUMA 2WVSA 3ARXA 3GDBA 1UZ1A 5A8PA 3D51A 3ARVA 4AXNA 3WUGA 1GNXA 1H5VA 2FYVA 3BUDA 3ARPA 2AMGA 3SCSA 2WKLA 1JDDA 2VTFA 1TA3A 2VI0A 2VX4A 5A6BD 3TA9A 3L2MA 4AZ6A 1HJQA 4C7GA 3WMSA 1B2YA 1CYGA 3VDCA 1J0YA 3POCA 4ZXOA 5C70A 4HOXA 1LG1A 2XSBA 1PX3A 4E8CA 5FOOA 3WEOA 3HG4A 2VCAA 2B31A 2A3CA 3OZPA 1UKQA 3WQ6A 3WF2A 3W82A 1JDCA 4PMUA 1VIWA 3AIQA 1HIZA 4LX4A 1ZB5A 4M81A 2J8FA 1EOKA 5JIWA 1GVIA 3W29A 4M8UA 1QI5A 1N82A 3LRMA 4GIAA 3S5ZA 4WKAA 1LF1A 3T2QA 1S46A 2OYLA 3CGTA 4D6GA 3W27A 3AMGA 3PTQA 1UD5A 2XVLA 2Z1SA 1EHAA 2X0HA 3DECA 3WL0A 2JEPA 4PCSA 1UD8A 3UG3A 1EDTA 1GQKA 3LXCA 3KLKA 1CPUA 4W93A 2GJXB 4BQ5A 2XFYA 2XM2A 4UQCA 3FW6A 5FIPA 2WK2A 1H4PA 1QWNA 4KWUA 1SZNA 1WB0A 1V03A 3GXIA 1MFUA 4PYSA 3N18A 1NP0A 3W81A 1JZ3A 4S3KA 1DWHM 2OLHA 2F18A 4H8UA 3HMCA 4DO5A 3I3EA 2OYMA 3ZOAA 1M04A 4ZE5A 4J3TA 1GW1A 2WMJA 1NQ6A 1ODZA 4NZCA 4DWSD 2GDVA 4CGTA 1Q6EA 2J7BA 2X2YA 1I75A 1RD6A 1OM0A 2DT1A 2G3IA 2D0FA 1M03A 1E40A 1KR1A 1UA3A 1UKOA 4W5ZA 3MKKA 2DIEA 2YDSA 3WY3A 1VRXA 4WF7A 3SCUA 4PMDA 1CGYA 1CXKA 5HDRA 1M7XA 2XN1A 3VX1A 2V3DA 1C3FA 3N11A 1ITCA 2D73A 5A6BA 3VKKA 3H54A 4YHEA 5CGTA 2J78A 3CUGA 2YL9A 1RPKA 4WLCA 2VOTA 1R75A 3ARRA 1WZKA 4DWSB 2FH8A 3A21A 1LWJA 3QGVA 3PHAA 1WKYA 2OSYA 3PZGA 2V5CA 1UR1A 3VSUA 4GI8A 3VX0A 4UFIA 3VNZA 1CBGA 1EXPA 5F7UA 4JHZA 1QBAA 4JAWA 2OWWA 4GKLA 1YQ2A 3UR8A 2VURA 3HU7A 3F5JA 1XGZA 5A6SA 1OIFA 1WP6A 1BTCA 4GO9A 2XWEA 1JYXA 1C8YA 3RILA 5GNYA 1OGSA 2BY1A 2E9BA 3MUIA 5A95A 2BXZA 4AZGA 4HPHA 5EB8A 3GNPA 4U33A 5KZ6A 4PMQA 4UQBA 5A94A 1E0VA 3AMDA 2WCAA 1E5JA 4DUWA 3MMUA 4JKKA 2FH6A 4HMEA 2E3ZA 1Q4NX 5IHSA 4W8LA 1UKSA 1O7AA 4F79A 2CKSA 2XVPA 3SCQA 1JDAA 1R47A 3APGA 1CNVA 3M7SA 1UHVA 2VVSA 1QNRA 3ZMRA 2J7EA 3A22A 3MV11 3CIVA 2OYKA 2GDUA 1UWUA 2VR5A 3AOFA 3BSHA 1GJUA 1WDPA 3RIKA 1TUXA 2GK1B 4AZBA 3MMDA 2E9LA 1E56A 1UKTA 5D9NA 3VDBA 1I1WA 2YLAA 3WF4A 4OOUA 2Y2WA 2A3HA 2PF0A 2VCCA 4MNKA 4P7RA 5IFTA 1LQ0A 2WVTA 3VVGA 1H3GA 4MJ4A 2X2JA 1ITXA 1UWRA 1E9TA 4P8XA 3SUWA 4Z2HA 4TXEA 1UA7A 3AIRA 4DWSA 3BAYA 3GH7A 1UH4A 3EJTA 4HA3A 3ZSSA 2Y4SA 2BHUA 3TTOA 4LXFA 2WCGA 4AISA 1H1NA 5CG0A 3T0DA 3AI0A 1WCGA 3DDGA 1RP8A 3K46A 2XUCA 1YHTA 4ZFMA 3IK2A 3EJUA 1TVNA 3T2OA 1PIFA 3W24A 3N12A 3CUIA 3LPFA 4P8VA 3WH5A 5IXEA 2CKRA 3L4TA 1EHNA 1TG7A 2XTKA 2F1BA 2W62A 3KZSA 1X6LA 4AW7A 1OBAA 1LWHA 4UNIA 4DUVA 4UTFA 2OSXA 3B9DA 3QR3A 3WH8A 4AZ5A 3ZJKA 3W38A 1Q6CA 4YHGA 1W3LA 3NYDA 5CPSA 1OCQA 1KWGA 1OT1A 1E70M 3KWXA 3M6DA 1JXKA 1WDRA 2YOCA 3SEPA 4OOZA 2OSWA 1JNEA 1WAWA 4CCDA 4PCTA 3D3AA 2VCBA 2EEXA 4J28A 3EDFA 2PBGA 1EOMA 5M17A 3NSXA 1TQTA 3U5UA 1DEDA 2XJ7A 3A24A 2GJRA 2GK1A 1W3KA 2E8ZA 3CHFA 1UWQA 1J0IA 3F4VA 4R27A 1PBGA 1HL9A 1H49A 3AHXA 1J12A 3VIMA 1NM9A 4AZHA 1PAMA 2WBGA 4AD4A 1G94A 1V6UA 2F1AA 3CHEA 3VM5A 3EJSA 2WSKA 3WH9A 3VSTA 3EYPA 4UFHA 3AYSA 5D8ZA 3T0BA 4WSJA 2VUYA 1B90A 4KRTA 2EBNA 1OD0A 4NRSA 4PTWA 3WDJA 1GOIA 1E4MM 4JL1A 3CHDA 4TX8A 4WSKA 4PTXA 2ZX5A 3WD1A 2OW7A 1XC6A 3MMWA 3SCRA 2PWFA 4PTMA 2J7GA 4D71A 3LPGA 2YKKA 3OLDA 4CVWA 1OGGA 3SUUA 2J8GA 3GH5A 1US3A 3AMCA 4D6IA 4U5KA 4AIUA 1XH2A 3DYOA 4ZEPA 1H0GA 3BCDA 1J18A 2WXDM 3RM4A 2XIIA 1E6NA 5EBAA 3WEMA 3WY4A 2ZWZA 3BMWA 2JE8A 4OKDA 3ARZA 3QHMA 1ZU8A 3W4RA 5ABEA 4PMVA 2VZSA 1FP8A 3NJ3A 5BXRA 3DX0A 3W6LA 1F4HA 2DSZA 3LX9A 1JFXA 1JAEA 2VQUA 1OWQA 4B3LA 2Q8XA 4FMVA 3RMEA 3IAQA 5CGMA 4AZIA 3WNMA 1VEMA 1WZAA 1A3HA 1GZJA 4URIA 4S3JA 1UD3A 3WNKA 2YL6A 3VMOA 1E15A 1IZJA 3VSVA 5ABHA 3W28A 4DO6A 1V0KA 2J7CA 4MNJA 3UG4A 1HT6A 4M29A 1FH7A 5I3DA 3O9NA 3WDRA 4NX0A 3IANA 1DWAM 2EPNA 5LA2A 1E1EA 1HKIA 2YLLA 3AHYA 2V3GA 2WM0A 4AC1X 5BWFA 1K9FA 2ZX9A 3VGEA 3LPOA 1UD2A 3VM7A 2DDXA 4R5EA 3TTSA 1V0NA 2W61A 3UERA 2QV4A 5FL1A 2C0HA 4TTGA 1ESWA 3PZVA 3CLWA 1UR9A 1XSKA 3GXTA 3K4AA 3O6AA 2ZOXA 4W8AA 2DIJA 3NDYA 3N1AA 1HXJA 1CDGA 1B3WA 3WMCA 2OWCA 2A3EA 4V27A 2WKGA 1KGWA 4J27A 2QHAA 1ZBKA 1US2A 1FP9A 3RJXA 3GNOA 2BY2A 2VVNA 3ARTA 1JZ7A 1WO2A 7A3HA 1C8XA 1H09A 5E9AA 4CUCA 4UOJA 3U7VA 1L8NA 4W88A 1HTYA 4PMXA 3VILA 3AYRA 4NXKA 1BQCA 4F66A 1PIGA 1E3XA 3WQ4A 1V02E 3NSMA 4UZUA 1ZBVA 5BRQA 5LA1A 5HOSA 5CQ1A 5A6AA 1HJXA 1JAKA 3CHCA 7CGTA 1HKMA 2EQDA 1VF8A 1HVQA 1K9DA 4CKQA 3NCOA 1W1PA 2NW0A 1HVXA 2WWDA 1PPIA 4LQ1A 1CZ1A 2O92A 4X0NA 1J0KA 2XIBA 3II1A 4NZFA 3BLBA 2WC3A 1JF5A 3PZNA 5DT5A 1KXQA 1QOXA 4XV0A 1CTNA 3VIJA 1W3JA 3BMVA 4OZOA 1VBUA 3VIGA 1ZBWA 4PBGA 5JBFA 5CJ5A 4BS0A 2WMKA 1G1YA 2YFNA 3QHNA 3FAWA 1ZBCA 2JF7A 4EAMA 1E0WA 1BGAA 5HXMA 1ISWA 3PZ9A 3LMYA 1WPCA 1MQRA 1NP2A 2IUZA 1QW9A 1TMQA 1UG6A 1H2JA 1FHDA 3HG5A 3T08A 1KWKA 1HJUA 3BUQA 3WELA 4D6DA 4FNPA 1RH9A 1JYNA 2VZUA 3FHAA 4CN4A 3PZIA 3WUEA 1V02A 4CU8A 6A3HA 2YJQA 5JUVA 3EDJA 4PN2A 4Q22A 2D3NA 3DX2A 1AQ0A 1ISVA 1DWIM 1NH6A 4MB4A 4CCCA 1UKPA 2CHNA 1HKKA 2D24A 1EQPA 4W89A 4MTVA 4HA4A 3VD5A 2EXOA 1HJVA 4PEEA 2NT1A 2O9RA 5FKYA 3ARWA 1FHLA 1NOWA 3AIUA 4PMNA 2NSXA 2V3EA 1GUVA 3TV8A 2WYSA 5AC5A 3VD4A 3GTNA 1Z32X 1DWFM 4D1JA 3WF0A 1V6WA 4NF7A 1T0OA 1BFNA 3WD3A 1W1YA 3PBGA 5JBEA 1Q6FA 2MANA 4NXSA 3PZUA 1UASA 3MUZ1 1XD0A 1GHRA 4UQEA 3RCNA 3ARQA 1B3VA 5BCAA 4FF5A 2XFFA 2W4XA 1LL6A 1LL4A 3DYMA 2E8YA 2WANA 1QI3A 3KL0A 1EA9C 1XV8A 3WY2A 4W86A 1HJSA 1QHPA 3BVUA 1TQUA 2GSJA 3HZ3A 3OLGA 1SR0A 3DHPA 4AIEA 2XYLA 1CXFA 2VL4A 2O9PA 3WDHA 1GVYA 2G3NA 4AY1A 3EDDA 3UR7A 1UR8A 1B0IA 4AEFA 2JIWA 4JCLA 5C71A 3WMBA 3F5KA 3CBWA 1PSPA 5A8QA 4F9DA 2VO5A 5E6YA 3UETA 2ZE0A 4CN1A 3KEHA 4LYQA 2WHLA 4UOQA 3GXFA 1CXHA 2O9OA 4B9ZA 4HTYA 2VT0A 3UCQA 2DT2A 3IJ9A 1ISYA 2CESA 2DPEA 4PMRA 3VIHA 2WNWA 2Z1KA 4AMWA 6TAAA 3WDPP 4NZJA 3WNPA 3QHOA 2X05A 4QCFA 4UFJA 2J74A 5A1AA 4GZIA 1CXLA 4FLSA 4MDPA 3W0KA 4P7NA 1B9ZA 3I3BA 1BPLB 3VO0A 3VIKA 3WUFA 3RM9A 3WFLA 2NT0A 4JIEA 4JFWA 3WH6A 2F7RA 4K68A 1VAHA 1QX1A 2CBJA 2D1ZA 5DMYA 3EJPA 3WL1A 4MADA 2E9MA 1J0ZA 4BA0A 1KGXA 5AC4A 3OZOA 5BXPA 3MO4A 1UR4A 1J01A 5I2UA
chains in the Genus database with same CATH superfamily
1T3FA 1Z9AA 2CGYA 3F83A 5MKGA 2DMGA 3QIUB 3B0XA 1QHOA 5C54A 4M3PA 1KB5A 1BSLA 4OLEA 2WTRB 2OODA 2G97A 3RPMA 3H56A 3RTQC 5FO7A 3EYQC 3RGVC 2QJMA 1EMTL 1T20A 2JKXA 2GJZA 3EW3B 4RNFA 4HMNA 5HHOD 1R5VB 4CBPA 1VLWA 3QPKA 3JXAA 4WX2A 1UUSA 2VN7A 5C07D 3OOQA 4N3TA 3V0GA 2HRPH 5E9NA 3VU2A 5IHUH 4K94H 1R24A 1GTFA 5HHXH 3H42H 3M46A 3AIBA 1ACYH 4N2CA 4KCUA 1WIOA 1P1ZB 2FDSA 4F9JA 2CR3A 2CM6A 3APFA 4LVDA 1QU4A 3K3QA 3UG5A 1L9MA 4K7FA 5D38A 4L1WA 4R7XA 5L9FA 3C52A 1SOQA 5IHLB 4JG0H 4NO2A 4LLUB 2J71A 3KR3L 5HJBA 4IPIA 3PR2A 5AL8A 2QVNA 2Z91A 1OINA 4G7VH 5ALCL 4OJAA 3RVXC 5T3ZH 1EGVA 3W11D 3GMMA 4WKZA 1XG4A 3C5JB 1U8HA 5HSFA 1HHJA 3CL8A 1PZDA 4BF7A 1I7RB 2WJ5A 3M47A 4MFDA 2I7SA 1TEFA 3U0WL 3PHQB 2R1WA 3CDFA 4O5LH 2B2XH 4ETQB 2ZOUA 1QBML 2PXYA 5BW7A 4WQOA 1XGQB 4M5ZL 1FORL 5JHBA 1DN0B 3PPSA 3MV7D 3SJVA 4MXVF 1HI6B 5PCYA 3NNTA 2E40A 3PAJA 4XBKA 2J21A 1Q6RA 4O18A 3U1SL 4W5UA 4DJDA 5F4XA 3CWHA 4W7VA 4X80L 5EN2A 2YPVL 3RBGA 1Z69A 2H8PB 5E2UL 5G4EA 4QUOA 4C56E 4P3CL 4TLSA 5CCGE 2CMRH 3M16A 4PLJC 2AVFA 3WD2A 4I7WA 1O6VA 5EBLA 5I6MA 4P2YA 3CN0A 2JCWA 3K4DA 1HE8A 3OODA 2X6MA 3NCJH 1C7TA 4XNUL 3IJYB 1RZQA 5TIMA 4U6XB 4PJDF 2NX5B 3RDTC 2HBXA 4JFZL 2AANA 5FJOA 3IRCA 5EMYA 2D23A 4CC0A 3PDDA 1GOKA 1CK0L 1S2UA 2G5RA 2XRAL 4Z78B 1TRDA 1RSCA 1NBQA 4ZW6A 3Q67A 3SJNA 3SO3C 4HU3A 5F9JB 35C8H 5F3FA 2XIDA 3X1NA 1UQSA 3K4ZA 4EI6B 3QLDA 1V0LA 2Y1YA 4X83A 5GISH 4HC1H 1P7BA 5DUPH 2GDQA 1GTEA 1I8IA 1CZ8H 4ZMVA 5D7KD 2ITEA 4L4TA 3OTTA 1DQLH 2EABA 3DKJA 4X6EB 5IUCA 3IFOA 1ZS8B 3NUKA 4H8NA 3FB7B 4P5SA 1N64L 3UH8A 3LIZL 5TK2A 4NZTL 4GZEA 4LAZA 4EIVA 1DEEA 2VFEA 2PDUA 3EWYA 1G4TA 4H44C 2K6ZA 1T1WA 5I8KL 4QYOA 1KLUA 1IT9H 4FF9A 2O72A 2ACSA 3D48R 2I5YH 3VA2C 1XB6A 2EXYD 5DJ0B 5F9OL 1UM6L 5DJ2A 1NDZA 4I5BA 3LKPB 2QPSA 3V4UH 3RG6A 3D30A 1LRNA 2B3RA 1IGCH 1QP1A 4HWZB 5DJDB 1IFGA 2BZ7A 4KXZH 4XN7A 1A6WL 3NAAL 3IPBA 2PS2A 5F7EH 5EPMA 2YDQA 3PGFL 3SQOL 5T26A 3LA4A 4F2MB 3LERA 3NXLA 4P3WA 2PSPA 1E3ZA 4LBEA 2OS7A 1TVPA 3CIAA 1A7NL 3S0PA 3IKCB 1BXUA 1V4YA 4HUKB 4J3ZA 3EHBC 5IMMB 4DP1X 4I2XA 2PLCA 2O1AA 3NH7H 4IRZH 2EICA 1UJPA 3UPRB 4ZFGL 2WQDA 4CQBA 1OGBA 1IEBA 3OKMA 4KDVA 2G95A 4TVUA 3KUMA 2L3BA 4R4FL 2UY7B 4ISVA 1FZJB 1JWSB 4H2HA 4QRUA 4H25A 2Y36L 1G7MA 2VXVH 3AXHA 3WUWB 5CJ8A 3TZFA 3A3YB 3ENEA 4A8NA 3UCDA 2YA0A 4OH2A 1BOGB 2DW7A 4WWKC 2YXXA 1W1TA 4K3DL 3N85L 1AQKH 1R3RA 3A12A 2NY3C 1I45A 2MKLC 2PYFA 2YGOA 5BQDA 1ADQH 1IFRA 3V0UA 3PJSB 1W72L 1DQQA 4HSCX 3QXUA 1A6TA 4G2DA 3E6HA 2BTMA 3WXWL 4NVTA 4P7QA 3CVHL 4FP8L 1FFOB 3W1TA 3QO0B 3N0PB 1KRMA 1XRVA 3RP1A 3HZYB 5LSMA 4Y16A 4OAWB 3WNIA 2AFNA 2WXNA 3MA7A 1N12A 4CSPA 4PUEA 2HTMA 3ABRA 1NCNA 2GGJA 5AG9A 3VFGL 2PDWA 5DHDA 3P4MB 4KCVA 1M57B 3OLIA 2YXWA 4E6MA 3BWZA 5F7HA 3QORC 5IROD 4U7MA 4N2IA 1XH0A 3C2AH 4K9EH 4C91A 2V5LA 2BNRE 1ZLSL 5KSAA 1JUFA 3TMLA 2PB1A 4UT6A 4MDIA 4Y9MA 3NCXA 4DFIA 3GW3A 1ET8A 2HQAA 2EDWA 1AGDA 1GVFA 3E02A 4GJJA 2QV5A 2VMDA 1D3HA 1NGPH 1Q2SA 4BGLA 3VG9C 3NJHA 5FI8A 4CD8A 1W72B 1R8LA 4CNIB 3FN3A 1YAIA 3RTLA 2R0WL 1CDJA 5HDQH 4EIZC 2BWIA 3JUGA 3KVKA 5I77A 1JZEA 3CVHB 4RKAA 4PB9H 2WN3A 3JZEA 2NCEA 3RWGB 3TBYB 3JWDC 4UAHA 2XJLA 2GABA 3OR6A 3Q94A 3S3BB 1QVOB 1CN4A 3MOBH 5DRNB 3L5IA 1KKRA 3WTYA 1UXWB 2EDNA 4PV1C 3U7AA 4N90D 4LBAA 2JQAA 2YAFA 3RIFK 4FA6A 1KTDB 1Q0YL 4JO5A 4J3SA 1U3ZA 3IBOA 3GI8H 2FL5B 1SJHB 1NDGB 2JJUA 1MNUL 1H0IA 1MEIA 1R3TA 1SBSH 2V38A 3UO8B 3WTXA 3HNSL 2H3KA 4Y4HB 1PYFA 5AB2A 2UYLB 5IM7B 5F71A 1FL5A 4UTAH 3ES7A 3UQNA 4M7ZC 4OCXL 1S7QB 3D07A 3L1EA 2FAUA 1CDUA 2NZ1A 1OTSD 3T42A 4XMPL 1S2CA 4KUCD 2YAHA 1S7SB 4Q9RL 3DUSA 3QT2A 4NJAH 2CBUA 2EKSB 1D3CA 5HYSA 3MREB 4MCMA 2E7FA 4NJHA 1I85C 3O2DH 1X9LA 1F4YH 2FLRT 4OGQC 4H8PA 2C9QA 4FOJA 3QDMB 2RFXA 1TR1A 2L04A 2Z26A 4KOBA 4X7SH 3U36A 3IRZA 3QFDB 2YAOA 2X3AA 3P1VA 3EOAB 2YBVA 4PH8A 3G5YB 2VMEA 4TOYL 1NMBL 3QJXA 4F8QA 1BVWA 1KXHA 1AG0A 2PBOA 1KJMA 2QGDA 6XIMA 4K38A 2ZXCA 4A29A 3AWFA 3WCZA 4GKSB 1V0MA 4FDWA 1AL8A 4RPQA 2WMGA 2GKIA 4XO9A 3OG2A 3HO8A 2JELH 1CGUA 4TM9A 2X4PA 3OAZK 1X7FA 5TQ0H 3W11C 2CPUA 1CD9B 1V7YA 2BVEA 2XKNB 1E71M 4LCCB 5FSDC 2HJPA 4FQ2H 1FNGA 2QADB 2HTKD 3CN3A 3QRHA 5IVXE 4IOTA 3BAWA 3O3AA 3CUXA 5FKPB 2X7LA 3W2DL 2FJSA 5IB5A 2G2NA 3CFMA 4PJFB 3UBPC 3ZVHA 3WIAA 1OGTA 5DURD 4MJIB 4OCRH 2B14A 5EEXA 1VFAB 3ML8A 1NARA 1SFLA 4U1GB 3AUVA 2FQFA 4N6FA 2F9BT 4N0FB 4EF3A 2FYVA 3Q2NA 1BKHA 2GY7B 5TK4A 1JDDA 3EOTH 3HFFA 4DN4L 3TA9A 4NO0A 2Y5QA 2VR3A 4H88L 1R3WA 1B2YA 3P74A 3P9WB 5D7EA 1A9BB 1MHCB 3KWWA 4S1RL 3ZDYE 1FVDB 5FOOA 4KKLD 1OFPA 3D39B 1T0MB 1UKQA 4AGQA 3APDA 3S5LA 4E9XA 2PPAA 1A7PL 3UJFA 5HHME 1E0TA 4N2MA 1A2YB 2MEJB 5AN7A 3VGAB 3C2VA 2XV3A 3Q2CA 3CV7A 5IGXH 3O6DA 2J8FA 4TMBA 1J5CA 1GGBL 4OGYL 2HJKB 4R0LA 4JDYA 3T4AC 4EN3C 2B4CC 2DBJA 4G1EB 1JWUA 3AG1B 3UO1L 5FYJL 3AXMA 4XNAA 3WL0A 1QASA 4PCSA 3P0XA 2DVXA 1KC5H 2DLFL 3Q5TA 4NO5A 3U2EA 3QCVH 3VFVB 2XSKA 2DORA 3CVBA 5ACZA 5LGZA 3L3GB 3OGOE 1QWNA 2OZ4H 1RUAL 3KDPB 3IETB 3FOLA 4QG6A 1TF4A 1MFUA 2WQUA 1HEZA 2AS5M 3OKDA 3L6FA 2WXQA 4GLRH 3BOXA 2XIOA 3GS4A 5AYYA 4DYKA 5KTLA 3A64A 2VAJA 3SO5A 4ZR8A 2D8KA 3DOSB 3Q6FB 3RVUC 4AZ8A 4ZAKB 4AYMC 1OCWL 5IHBA 2D73A 2A77L 4YTQA 2IG2H 4F3HA 3PZGA 1MVFA 3OG4B 4JHZA 2MPAL 2C1PA 3OXRA 4GKLA 3C0JA 2GJ6E 4QY8A 1YDYA 1CDHA 5FYKL 3ULUC 1BTCA 3QPQD 3S2LA 3GHEH 1C8YA 2X4TA 4IH3A 1BWMA 2R23B 4LCYB 32C2A 4HPHA 2EXYC 3C5ZB 4U33A 2P80A 4KZ0A 4PMQA 2HT2C 5A94A 3KFTA 3UGVA 2AK4B 1YDOA 2J6EH 4ZMYA 4L1HA 3LCLA 3RNKA 3CPRA 4LCRA 3HG1D 5C0FA 4N3UA 2BM3A 1Z5LB 3APGA 4Y8EA 3MV11 3GDRA 2GDUA 4NWUH 3OD3A 4NZ4A 1WDPA 1TUXA 3FHEA 5DCBA 2YD4A 4XN4A 4XP4H 4PR5A 3B9KB 3QUXA 5JNYA 4OOUA 1YMHA 4GJ1A 3N2XA 3EYUL 5LHEA 1H3GA 3UYCA 2Z24A 1ZRQA 3P8JA 1T89A 1UA7A 1P4IL 4LRNH 3UA3A 2OMZB 1F74A 4KXCA 2X4SB 1QT1A 3RRQA 3I7RA 4KFPA 4WEEA 2BZDA 4AE1A 1XEDA 1E30A 1VCGA 3CVIH 5IBUG 2ACQA 1OBAA 2EHHA 4ZSOB 4ZUTA 4G6AD 2OXNA 1U95A 4XH2B 1Q6CA 3H26A 4LVAA 5CD3B 1MPAL 3T2NL 2K4AA 5I16B 1TSIA 1MHEA 4MVAA 3CPLA 3EO0A 5CILL 3T7VA 1PIIA 4RXFA 3U5UA 2IADA 2GK1A 4UT7L 1HL9A 3RA7H 4HXAL 2DI7A 1NAL1 3V5KA 3VFOA 1SQMA 4HULB 4Q6JA 4PP2B 2FT8A 2I9LB 3C6LD 4WO4A 1E5CA 2VERA 2GYSA 4NRSA 2NR6C 3F4CA 4OSUH 1M05A 3WJWA 1SUHA 3QCTL 4F0RA 3QZWB 4N2AA 2WOQA 1MJ8H 3OQRA 5I07A 2CU9A 2YKKA 3SUUA 2GG1A 3RUGB 4GRLD 4TU1A 4U5KA 4X61A 1OZTG 4NDMB 4PFEA 5ANMA 3R5EA 2RDWA 1YNKL 4XPGH 1E7UA 2ZWZA 1AHWA 4D9QD 3CSBA 1NA8A 3TXZA 4MQXD 1E4KC 4PAZA 3RCMA 5BXRA 3JZ7A 1F4HA 4I48B 4GSRA 1AP2A 4JJOA 3RMEA 3DX8A 1JZDC 3PV7A 3WNKA 2KYIA 1IZJA 3T77A 4NNXA 3QMSA 1SJBA 2DYPD 3QJHB 1HT6A 3HUJA 3N3MA 4QXIA 2AKZA 2EPNA 1AW1A 3JTTB 1W5MA 1REQB 1JGDB 4GYPC 1KXQE 3BPOC 3LH9A 1JV2A 4Z7QE 4LLYB 1S9XA 4ZFOB 2B77A 2PCYA 3GXTA 1EF3A 3QDJA 3O6AA 2Z1PA 4NRXB 1IC7H 1T0NA 5IROC 5DK3A 3DROA 1K1DA 1I8AA 1ZBKA 1P6BA 2WXFA 3RJXA 3RJOA 2BY2A 4B4HA 3HPSA 2FR4B 5KVGE 4ZXBA 5F0MB 4W88A 4AT6A 4A6YL 3AYRA 4NXKA 3TN0B 3B8VA 2N7SA 3VXNB 4X8JA 5SV4A 4MA1C 5E94A 1K9DA 2IDCA 1IQDA 1E4JA 1DBMH 4FXKB 5DJZB 2ZD0A 4X0NA 4WI0B 3U46A 5GJSH 3CYVA 1D5RA 2OLAA 1TJXA 1EUNA 1VBUA 3ZRSA 1RUPH 3NZSA 3VFPB 4M00A 4AB4A 2WMKA 4BI6A 4BZ2A 4KK5D 3MUGB 4UM9B 5HHVH 3ARGA 1RHFA 4QOKE 4YVXA 1FHDA 4XMLH 1WA0X 5IT2H 1HJUA 4C65A 5A43C 1JYNA 3N6QA 3FTZA 4UTWC 5DJCB 1Y18B 4X4KA 1D9KB 2P8LA 3RB7A 4O2EB 2YEQA 1A5BA 2Z7UA 3QJUB 3EDJA 1IL1B 3R6IA 4MB4A 2CHNA 4E0CA 4LY4A 1ZPLA 5KSBB 1T40A 2F53B 3VD5A 3WLTA 3SKOB 3C09C 1X8CA 1OCNA 5G5DA 5F7YC 4GEIA 3WHE1 1P43A 1D5XB 3UYRH 3GSRA 2AHIA 1I3GL 4ZMOA 1V6WA 2F6AA 5H4ZA 3O4OB 1KGIA 3T0EB 4A6YB 4P4KB 4Q4QA 4ELKA 4W9HC 4S39A 4G8GD 4H19A 4MA3A 5D4HA 3CXHK 3HS0B 4AQEB 3BPCB 4HUXB 2VSKB 5J12B 4JG1H 5BCAA 5T1KB 1Y1UA 4L6OA 1LL4A 1QTYT 3U4BH 1WFMA 3EXSA 2DQTH 1OGAA 4HIXL 1YG9A 2Q7YA 2GJJA 4JDTH 4P2VA 4WSGA 4OZFG 3M0ZA 1FRBA 1J8HA 3F5KA 4P99A 4RGNE 3IV8A 3KTXA 4LNRA 3NJKA 1SN0A 1UJTA 3GKZA 5GRYA 1N4XH 5JHLH 5GGRB 1XO8A 3PJWA 3RUBL 1MOEA 5KBLA 5FXCH 2CLPA 2JQZA 5HHQB 4UFJA 2FUTA 3KPSA 3HE7D 3R43A 4QRPA 4ZNEA 3VIKA 3QQXA 4NCDA 2CLZB 2PGEA 3IWUA 2X40A 2PP8A 4LCUA 1W6LA 3SM0A 2XOTA 1AO7E 5DD3H 3T6XA 1T5XA 4I1RA 6CGTA 1AS6A 4N20A 4JRXA 3BI9X 3OGSA 4UINH 5DZ9A 4OKVB 1R4XA 2NYYC 4WV1C 3JW7A 1Q9WA 4MXVE 2HJLA 5ERWB 3UTPE 4PRNB 3U1QA 4GXPA 2VEMA 4MNQE 5IBTL 4HPJA 5EZIH 3TXVA 1E9OA 5T1LA 5A2LH 5DMGD 3AISA 5IMKB 4RZBA 4H2CA 4RNJA 4FMKA 4OBRA 2H90A 4YUEH 4HU8A 4M6PA 3VG0L 1GOMA 3L3OC 1X38A 4ZMZA 3CNYA 1LL7A 3WKYA 5LAXA 4J7RA 5HDLA 4WIWA 4ACZB 4C7FA 2PC8A 2GK0B 5JQ9A 3O6LL 2C91A 4S3BA 5IESH 1QQDA 1DE5A 1LDCA 2IS7A 2R4RH 3ZMEA 4X9BA 4PUKA 2XBZA 4F40A 1JRHH 2R7EB 4N0YH 4Z2IA 4I6VA 4XVOA 4Z7NB 1GGCL 5EDSA 3LV6A 1TQXA 3U5YA 4PJDE 2FATH 3CFDB 4ZXLA 5T3ZD 5ICZB 1OCZB 1F58L 3ECBA 4PYHA 1HQRA 4CNNA 1JPDX 5PAZA 3S37H 1CD8A 4S10A 1RAMA 2A2QT 3DHFA 1G6RA 4QEHA 2VIRB 3GYEA 4C56D 2M2DA 4PJBF 4OIFA 5AVNA 1LNUB 1DSFL 2C9PA 5HVGB 3U9PL 5D7LE 2GAZA 1IGJB 1FO0H 3OKOA 2C3HA 3WQEA 2DJSA 3DV6B 4S3EA 1ZTVA 4E8DA 4QHPA 3RNQB 4ZW8A 3WJLA 1F86A 4YFEA 1LLOA 1IGWA 4YXGA 3UU0A 1XL4A 3SBWA 1ECEA 1JGLH 5SX4H 4ONGL 5F9WC 1PVHA 2PR4H 3UMNA 4K23H 2HT3C 1I3RB 2XXFA 4Y88A 4Z7WA 1NUFA 2XG5B 4GSDH 4PIRF 4D6JA 2R2BA 3LZFL 4LLVA 1D7KA 1DUZA 4P2OB 1SLWA 3ISWA 4IMKC 1NBZA 1W1B1 4LVHC 3NPSB 3M0LA 2C3WA 2YDRA 2IAMB 2FO4A 7PCYA 2Y0SA 5DJ6A 1MUJA 4HUNB 5GQBA 5E00B 1RZJC 4PTUB 3DSNA 5GS0D 4XBGB 3PBYA 3FC8A 4U10A 4M1RA 5C9JB 4P9HL 3X1BA 4AMCA 5CAYB 1CE6B 1XZWA 2QSVA 1EWEA 4UM8A 5E1AB 1I7UA 5J4MA 4Q9QL 2J4WH 2ZRYA 4X3ZA 4X7TB 2JGYA 4KQ4L 3ARDA 3FA5A 4PODA 3CG8A 5J0BA 4FXJA 5FK9A 3QXDB 3S5YA 4UYQA 3K6IA 5GSRA 1NKGA 5FAGA 4W6XB 4YDMA 4H8VA 4NO3B 3DMMB 4J6IA 4LASL 5DTFB 2O4EA 2W9DL 4AUUA 2OK0L 1S2AA 4RDQF 3O3DB 3BHBA 5CWSB 5BV7L 3ZKXB 3ZDWA 1HN1A 1WICA 1VPOH 2QQNH 4IHOA 1FWNA 3VSQA 2X30A 4EVNB 1Z3NA 4AEIL 4B97A 4W9LC 4Q4IA 2YXFA 1IAIL 3ARUA 3KHDA 2P0OA 2DQXA 4QLLA 3UJIH 2RR3A 3CAVA 4R97C 4JIIX 4KGJA 3HI1A 1E6ZA 1Q90A 1U5HA 2GW5A 2BOBB 1NFDF 2ISVA 2VN3A 4Q4RA 3EO9L 5L4FA 1NWPA 5JPNC 4AQZA 1E9YB 1IKNA 4AQAA 4XBEL 2CIKB 1UXSB 5D1XD 3DJSA 1KFCA 1VCVA 3CZGA 2PWGA 4XVSH 3H2QA 5HQEA 5AOLA 3WLKX 1TVHB 2IXQA 1JPSL 2GHWB 3KWUA 1SXZA 1ZV2A 4C60A 4W87A 3AS2A 4X4ME 2DQWA 1JR1A 4YSCA 4U1LA 3I3DA 4JAMA 2JI3A 3PNRB 3G04A 3HMWH 3RX8A 2I9TB 4BSWB 5C55A 2ZIDA 5IB2B 3Q4DA 1I9JL 2WJEA 4JFEE 4YO0B 2HISA 4JPWL 4HAFA 4B3EA 2FZNA 1J93A 5BV7B 1XLJA 3UTQA 1FJ1B 2DDQL 4MQXC 2FJKA 2NQ3A 3Q3GA 3RLHA 1JD9A 3NGBC 4OZFH 2P44B 3TE9A 3VXTA 4HNLA 4HS3A 1PD1A 2UZIL 4LOUD 4PSRA 2Y6SC 3EYOB 4KXDA 5LGYA 1JNHB 4MUZA 2UXTA 2RBLA 4MKMA 2YFOA 4L0PB 5DYOB 3I84A 4OLWH 4LUSA 2YRZA 2RALA 5IVXF 5F4SA 4LNCA 1C91A 4KJYA 3VKDA 3WDQA 4E0RB 4KEUA 2CETA 2ZKMX 2XZZA 3WKQA 1YBQB 1QLEH 1E27A 1QFWM 2I7GA 5E4EB 4TXVB 3G1XA 4FSAA 3E8UH 5LCVL 3LJ3A 2IGFH 1SDYA 1JD7A 1V27A 3UY7A 3AFLA 4UWQB 4TV5A 3QQ0A 5IBXC 1TPVA 4JHAL 5CSUA 5C0CB 4PLNC 5DBTA 1BQLL 1A4BA 3GM0A 2ZUQB 3KDMB 1W2VA 3TBBA 3ZDYF 1GKEA 2BNRD 3GSXB 5C0JA 3MLVH 3MJ9L 4CVUA 3TYCA 1QLRB 3CQPA 4AFYA 4KK5C 2E7CA 3ZIMA 3URAA 5LXEA 3PWPB 1UJ3A 2WXRA 4NT6A 4IP5A 4LAUA 3V6OA 2OO0A 1W9PA 3FX4A 3NJVA 2G0WA 4NP7A 5CCZA 4ERAA 3L2NA 1ZVSB 4F0HA 1BAWA 2N59A 4YDIL 4B0MM 1N10A 3AQDA 4E9RA 3KS5A 5A6JA 1ZA3B 4UFMA 1P6WA 5M1TA 4C54A 4YQXH 3QV9A 3UR5A 2FDMA 5CBAA 1D8CA 4RDWA 5D2TA 5I6SA 4GKNB 3F85A 5LG6A 1ZJAA 1IGIH 3QTPA 2XZAL 4AG4L 4HX1B 5D2NA 1TTIA 3WLWD 4MY1A 5HYQB 1CLKA 5REQB 1Y6KR 2XVKA 1JWMA 4K36A 1SO4A 3OA3A 1G1CA 1BREA 5M2FX 3UBXG 5C8BB 3WXVH 2MUCA 1GTHA 1C1EH 4A04A 1QRKA 4HN8A 4WEVX 5TQ2H 1RZGB 2FLMA 5HI4D 2A74B 3ASNB 3AY2A 3RLSA 1HC1A 3ALGA 4AGMA 2XFXA 2RTTA 3LXBA 2I5IA 1YY8A 3I6LE 2OZNA 5SWSE 2CSPA 1YTKA 3Q6GH 3M45A 3Q2VA 4D6FA 1NQBA 4YDVB 3ZDXB 3HE7C 2R15A 5HPMA 4N0UB 3MYJA 2HSIA 3IE4A 1UM5H 1M6OA 4X5WA 4ZNCD 3Q8BA 1PG7L 1CGSH 3WQOA 4LJ3A 1MFBH 3RPTA 4LL4A 2NNFA 3MCKA 3FO0L 1GGOA 5I1EL 4J4PC 3HQOA 2BP0A 1YEWA 4G1MA 3FRUB 5LWYL 4WHCA 4DLMA 1T03H 5ID0A 3WOVA 3WJMB 3MRHA 4XBPA 2GUUA 3ALPA 1GMEA 2K9FB 2PWDA 1YEEH 2NX5E 4MAYA 1SLXA 5FEWA 3DHJA 3W5NA 2CHXA 5EZLA 3PWLA 4MBOA 4Q7NA 4EQ3A 4IU3B 5DMGC 4YXKL 4S2SB 3TYDA 4KITB 1I9EA 5I0VA 2YD8A 4JBSA 4L8SA 3S96B 4L5FE 3KAOA 5HWNA 4CL7A 4YPJA 4JM2C 5CAHA 3FSZA 5LUMA 2IPKA 4BWUA 3LNDA 2KZKA 4WI7A 4MPKA 4K94C 4TUFA 4M6OL 2A9BA 4N8CL 3TTYA 5INCB 3QLLA 4PUWA 1DVSA 1WCBA 5GGTA 1EGJL 1RLBA 4PRWA 5ISZE 1MEXH 1Z0NA 4JPVH 3S2AA 2DYSB 1NDTA 3ILEA 3FQRB 3O6CA 3ICJA 4DVRH 3RWIB 1SEBA 5EN3A 4N2DA 5IHWA 1UWSA 4E38A 4IMCA 2PCFB 4HHAB 1NFGA 4XNYL 2R0KH 3VWKA 5BPPA 5SWQA 3PUOA 2C3VA 1KJ3L 1I8MA 3WK2A 3BVNA 4AYSA 4A35A 2DZSA 2ADIA 4CD5A 4WUUB 4XPHH 4BK5C 4C5ZA 3HKFA 2W66A 5H94A 1XLEA 1GOXA 2GVEA 2P28B 1YIXA 2FYYB 5FCZA 4QRTB 1YKWA 2ZA3A 1S7RA 3FZUD 1KM4A 1BP3B 3C5SA 4GABA 5D2YA 4F4RA 4DI9A 1FWSA 4Y19B 1R3VA 5HHMD 3UBXI 3E2SA 2ZSVB 2WVSA 1USZA 1A5FH 1AQDA 3DV4A 3DKLA 5IF0B 4OJDH 2WINA 3OYZA 3IDUA 4LPTA 1XQLA 4B5EA 4AGPA 3TA3B 3G3DA 5BRBA 2N1TE 1QATA 5B4MC 2KHAA 1NM4A 4OFYD 5LXXA 4IU2A 3E6FA 4Z7QF 3SAZA 3BP4A 4O9HL 4JEJA 4NNAA 3WEOA 1K8CA 2HT4D 3JWOL 4JRYD 2XI9A 4XHJC 4I7UA 4U1MA 4X9HA 4Y96A 2NY2D 4H9XA 4CNSA 4I8YA 2QL1A 3GBNL 3U8GA 1KCSH 5E2TH 3AIQA 4BD4A 4D3CL 3O41B 1L9SA 4DZBA 4M8UA 4YHLH 2ZCZA 2ZA1A 4GIAA 3T2QA 3TF7C 3O4LB 3W27A 3LN4B 4G70B 3EFDH 4JQVA 1BZOA 4HLZH 3I50L 3GSUA 4XC3L 3HB3D 5GZNA 1X9UA 2X4NB 3ZLQC 2B8OT 4F7EA 3TNBA 1X5XA 2Q8AH 4F37K 3W81A 2B7NA 2JK5A 1MCWW 2AQNA 1FKXA 4U1KA 5I76A 2NUYA 1ZAGA 5EOCL 4O00A 2AGJL 1CT8A 2AZUA 1GW1A 1CD1B 4HHGA 4OF3A 1QR1A 2X2YA 2GJ6D 3ZL4L 5LAPA 3BCJA 2VYRE 3FS9A 1FWGC 2RKXA 4PY7A 3BQVA 4RX4A 1ONQB 1DVUA 1MCKA 2X2UA 3NEHA 1CGYA 4NQ1A 1M7XA 1U6AL 4LRIC 5AW3B 2EZ0C 3WIIH 4YHEA 5I1IL 3FKKA 1E9ZB 3GMNB 1VADA 1JZJA 1BZEA 2CO2A 1BRLB 3LZ3A 2V17H 2AXGB 2OQJB 2AXJA 1QFHA 1VGKA 2XXCB 4RAVA 3LKSA 1CL7L 3HU7A 3F5JA 3R13A 5E95B 4XMTA 4WU5A 1C9WA 2CHRA 4ZS7H 4P4RB 4Z9KB 4JM4L 2GBTA 1EZ2A 4MCZB 4FQ1L 4JO4H 4PJ9B 3BE1L 4DKFL 2NZIA 1J4EA 3N4AA 3NR0A 5D1XC 3TZVC 4Y1TA 5CJOH 4HK5A 4WU7B 3ZL1A 3NCYS 1UIOA 2WBJB 2GQHA 4TQ8A 3W1XA 2VXQL 3SDAC 1I1WA 2YLAA 2A6DB 5HGBA 3VXUB 2H1PH 2CK0L 4ODTH 4AQOA 5F72S 4XVJL 4XN8A 1UH4A 3LTPA 2BHUA 4IUOA 3IAGC 1H1NA 4XZNX 5CG0A 4MTMA 1AS8A 3P7YA 1I1AC 3QC3A 1PIFA 3CUIA 6FABH 1Q9KA 3REWB 3CQKA 4MQ7A 3TBCA 3R0MA 2W62A 1V7NL 5CIPB 1JN6B 4RDQG 1KGYE 4F1SA 3THAA 1F8TL 5I1CL 4DJFC 3IXTB 4F0SA 2QFPA 1SOXA 4LOUC 2DZWA 4M93B 3HB9A 5I73B 4PB3A 3BLEA 3G9AB 4N8VB 1DEDA 2J55A 2APVA 1BX2B 3GBMH 1J0IA 3CFCH 1E1CA 3QZBA 1MFDH 4FD0A 1I31A 3N91A 4FQHB 3MRJA 2NW2A 1EERB 4F7MA 1C9DA 1XF5A 2UZ9A 1B90A 3WFDL 2N0KA 4RGMC 4YWGH 3QJFA 4GYFA 5EOQL 4PTWA 3CHDA 4K3GA 3VB8A 1RUKH 3KMDA 1GW9A 3O6FC 4XR8C 2J7GA 3VXRD 3NDYE 1YEHH 3GH5A 3RVVC 2OR9H 5CR1A 2WXDM 5H37H 5EBAA 3WEMA 4XPAL 3GWJA 1FVPA 4Y2DD 4CC4C 3FEQA 4HCGA 5KMYA 3V0DA 4FG6D 4S11A 4E2BA 5I3FA 5LBVA 1JFXA 3ABKB 4Y9GA 4JG9A 2YSTA 2ITDB 5DQDL 3WK1A 3SE8L 1MCNA 3T8VA 5D93C 3MA9H 5GS0H 4XPFL 5IOKA 2YXVA 3FO1A 3FYIB 1KBGL 4ALAL 1Q94A 2P5EB 1L3NA 3R89A 2QCFA 1FDLH 1ZSHA 2ZAIA 2XH4A 3FCSA 5BOZG 3ZJAA 5EB9A 2R69H 3F62A 2WKGA 4I9AA 4J27A 4Z1DA 1AYRA 4XCEA 1ZV9A 4OD3H 3QXVA 3SYAA 4AKPA 2ZKHL 3P9LA 4K9EC 4PJ7A 5E7BA 1E50A 1TETL 3JR2A 4K2UH 1E4WL 3GAYA 5D2LB 5C86A 1WHOA 4M1GH 5FIEA 5C09E 4FI6A 4QOKD 3EIFA 1HVQA 3RURA 3WS6C 4Y4FD 4PRRA 5KOVC 3WLWC 5DJ8B 2XIBA 1AZRA 3Q58A 4ML9A 3MUHL 4FQPA 1NEZG 2Q0ZX 3SE4C 4MRCA 4LY8A 5DT5A 4Q6KA 3H23A 1MFAH 3N40F 1RZ8A 4IOIA 5HYJA 4HFWB 1B4JL 1XIWD 4L9DA 3QHNA 2CR6A 4G82A 4FTVE 4PJFE 3UAJA 3IJHA 4G6KH 2R29L 3TNOA 4NAMA 1NP2A 1QW9A 3D12B 3BP6A 1DO5A 4G8EA 3BUQA 3Q8AA 3SGDI 2W65B 2JMRA 3LIUA 4FXGA 2NQZA 4ADUA 1MZRA 3NQDA 3V75A 1HKLL 2XUWA 2YJQA 2ZRUA 4WENB 3DX2A 3VZYA 3MVTA 5MP6H 1UKPA 1EJUC 1FWAC 2WQAA 2G3XA 3LNMA 5K3VA 1ZXKA 5IWLA 2IBZX 4QRRA 2Y07L 3SCMB 2NXGA 2V3EA 1KM2A 1QTWA 1JVKA 3GTNA 5D1ZC 3IJSB 2BBFA 4QXUL 2EH8L 4RGND 4O02L 1H5BC 3H3KA 5LNDA 4KTYA 2X0SA 4XAFA 4LRSA 4PRHB 4YXLH 4F2TA 2YEZA 1VCBC 2DBLH 1YRRA 3FU8A 1KCXA 1JPTL 3GJFA 3BQUB 1XV8A 3WY2A 4D0DB 5BRZE 2ZOTA 3WD5H 2H2SC 2ZZUT 3XINA 3T9WA 1CXFA 4IMFA 3AXLB 1TIWA 1H3WM 1PZ1A 3CBWA 2RHGA 1NAML 3QXAB 3CFBB 3UETA 1AO7D 2YWYA 4PJEA 2EE2A 3GRWA 3UCQA 1ISYA 4FYTA 3VIHA 4OZHB 1A7RL 4NZJA 3QUHA 4JY4A 4BKTC 3QHOA 4EZKA 5CSZA 2J8UA 4GZIA 3UTPD 2MHAB 3OMIB 4LVNC 1KM3A 4KXAA 3L9RB 4MNQD 3OG3A 2CBJA 4ODBD 4AAJA 1O1HA 2P3ZA 4XSLA 4JTJA 2F15A 1OEZW 1IC4L 3LDVA 4PTNA 4ICMA 3R0KA 3WAJA 3EX1A 3VCRA 1TPXB 3MRGA 4PJBE 2WQWA 1UB6A 3DHUA 4O02B 3BG3A 1CI3M 4M1DL 3RWDB 2A83A 2O6CA 1HDMA 4GY1A 1KYOJ 4H2AA 5B38A 4RIRB 2YN3A 1XMWA 2HCVA 1WBXA 4NNPL 4PJ8B 1H8OA 4NZ5A 5EFIA 1YYLL 2HUHA 2CBVA 3AT9A 4OD1H 5JQ6H 1NPUA 3WJJA 1NAMB 3OZKA 1H41A 5M3WA 4BQ4A 1T7LA 4Z1YA 1XH3A 4U6YA 5I8OH 5D9OA 2VDHA 4H7VA 5B7FA 1B6UA 2IKHA 3MSPA 4MCYA 1HOEA 3ROOB 3AB0C 2BSED 4NUMA 4QG9A 4XNMA 4ZENA 1MJ7L 3SR7A 3QUZA 4DQOL 4LAJH 1KCWA 3OJGA 1R6VA 3C60A 4M7SA 5D7LD 3TC3A 3CN1A 3QXBA 2FB4H 5IFPA 2VHLA 1WUFA 5L7XH 5HPOA 1NMAL 2X8RA 4F57L 4M6QA 1TJHH 1XGUA 2TYSA 5ITBH 1MW2A 4L9LA 2WMHA 2ZSWB 3VNKA 5JW4Q 2J8HA 4ZSOE 3DCPA 1SFTA 3UTTE 3GSQB 5C2BL 1G7PA 1Q0XH 4ORMA 1X96A 1LO4H 4N2YA 1RK7A 5FYKE 3HB3C 2O6FA 5D1QB 2ZBTA 2IW0A 4OBSA 4D8AA 1KFLA 3NJLA 3IVUA 4JKMA 5EC2A 3K2IA 5DSCA 3STBA 5JLZA 5E8DL 4J2PA 1A5CA 4N85A 4AJYV 3IAPA 3NZ8B 2DSWA 1OX6A 4XMXA 1XCXA 2WBKA 1PS2A 3MI3A 1XLHA 1HX0A 4IIBA 3GHUA 4K7PY 4LPWA 3LK6A 3VXMA 4X4YA 2DZXA 5KS9A 5I26A 4IOFD 3LS4L 3RUGE 2DUZA 2HX9A 1K8IA 5D9SB 4K1GA 4I18B 1NFDE 4RZ6A 3VE0B 1RALA 4JFDA 1TCDA 4PUUA 4AXWA 1DJGA 2GIMA 5EO0A 4X0KB 4AJWA 3KPQB 2H32H 2ZYSA 3R19A 1T1ZA 3KYMA 4Y4KD 2J6VA 1DBJL 1RJYB 5CF3A 2ZC1A 1MMFA 1XYZA 1JI1A 3NQ2A 1KEMH 2A4EA 1EJ7L 4H41A 4EF8A 5FD0A 3C0QA 2JCCA 3IF1B 1UCWA 4QEGA 3EAUA 2PP9A 2WBWB 1TIUA 2XWTA 2QW5A 3LM7A 2WLLB 3FHQA 3GG0A 2YPLB 1AZNA 4LQFL 4XMZA 1GVQA 2JIXB 2P1FA 3U7BA 2O5ZH 3OZ9L 1RUQH 1D2PA 2XSXA 4EF9A 3JVGC 1UA6H 3VRIB 4JZ5A 2UXGA 5I6LA 3SDDA 5EU6B 3RU8H 4FTDA 3STGA 5FS5A 5LQBL 4ZOAA 4CA4A 1LD9A 4IOSA 4LPUA 5INDB 4P46D 5B1AB 3BOVA 3QNXB 4XBJA 5TDPB 1XBVA 4MX7A 4DUXA 1VFBA 1N7KA 2V2WA 3FN9A 1E0UA 1HQ4B 1P0DA 3LYRA 3L3HA 3OVQA 3SKJH 4YXHL 2DGAA 4LEXH 5DD5L 1DIOA 4JFED 1SM9A 4FALA 3SGGA 5C5YA 1BG9A 3MACH 1Y0LB 1NOAA 4LSVL 2HRLA 2DT3A 5F1NB 1UD4A 1PEZA 2FZBA 1CS6A 3WIHA 2XDFA 2ZG3A 5KSBE 4IUGA 2F53E 3T1FB 3GPEA 4FFYL 2AQOA 1EO7A 2H26B 1BVZA 1KBIA 5HPCA 1MYRA 2H6UA 4UZSA 5K33A 2VZ3A 4GPNA 5B3NA 3MO1A 5B7YA 4Y2DC 4DM1A 4XAGA 1SW7A 5FYLH 4M3JA 3EKLA 4PSPA 4J2QA 4FG6C 4O2FB 4C6QA 2D9QB 2JIEA 3N19B 1ND0B 1F3EA 1BAGA 3B8WA 2NXYB 1IM9D 3MTRA 4GQRA 4JL2A 5KVEE 1YEIH 3VXQB 3OR7A 2Y1ZA 4L4VB 3CS2A 1ZK9A 3K2KA 3FQWA 1U92A 2PU1A 1RUML 1I8KA 3AY4A 2XWJA 4G6JL 1I6NA 2GJPA 4IJCA 4CEUC 2J66A 3WY1A 1LO0L 1A0EA 4CCZA 1I9IH 3K0YA 1H50A 5A2FA 1PCSA 1MVUA 4KDWA 1JGMA 1ZTMA 1OC5A 5FYLE 4PRBA 2YO3A 3CK0H 4WNQB 1PKLA 1L7IL 3CX5K 2PP0A 1UM4L 1QO3A 5AKVA 3MTWA 2F74B 2GGEA 3QV7A 2VEKA 1X5AA 1W15A 5B8CC 2V6HA 2Z31A 1F3WA 3P3BA 1JDEA 1J11A 5DEJA 5C0BA 2GQ8A 3SOBH 3ETBJ 3T6VA 3NDZA 3BDYH 4ADIA 3DRQA 4Y4FC 1J0JA 1HP5A 2IXUA 3SRHA 4NQCE 4N2KA 3HZMA 3R8HA 1BBJB 3BZDA 3L13A 2ZWYA 3S3PA 3TP4A 5IR1A 1JCKA 3KPMA 1XIWC 2HFEB 5BS0D 3V6FA 5H2BA 5ICUA 5C9WA 1IXOA 3RKPA 3N1PC 1TQCC 2J7DA 2X2HA 3M64A 3GIVB 5EMJA 2J57A 2W38A 3QNZB 4KKPA 1GGYA 3WQ8A 1T5AA 4ZQKB 1YN7A 1CENA 4MM1A 3SUTA 2FWOA 3A23A 5GGVH 4FL4B 4JUTA 4MLSA 4OQTH 3IV3A 1WT5C 4MYAA 2AK1L 2FUQA 3H7BB 1H3UA 4PW4A 4ZT1A 4Z7NE 4G80B 3IK4A 3C8KA 1ZSDB 5BZXA 2PTVA 3W9DA 4G71B 4QTFA 1A4JA 3I6LD 5IOPA 1LTXA 1T99A 3DFHA 1ZS2A 1YNTB 5SWSD 4QRNA 2BSBA 1VCFA 4ONFL 2C8NA 1UC5A 1VD6A 1UVQB 4H26B 5CMAB 4XSMA 5DRXA 4OTXH 3ZZ1A 3NRQA 1H6EA 5DHXB 1TDQA 3RZCD 2JTDA 4BIKA 3T0AA 2B0SH 3RR1A 1QRNE 4JN8A 1G1OA 3I9PA 3AZRA 3GMRB 3MRPB 1W6TA 4Y90A 2IOMA 5AAMA 1R1CA 5JXED 1A3RL 3E3QC 1RERA 4LEBA 4WCYL 4Z3FA 4LSDA 2B59B 2OOGA 1E4LA 5A2IH 1TLMA 1OK4A 3ATDA 1SEQL 1K2DA 3T44A 2NX5D 2K70A 3WF1A 2XA8H 1WZ1H 1PV8A 2ARWA 1P1MA 1P4UA 2DY3A 3V79C 2E7HA 2A4AA 4KVCL 4C6MA 4WR3A 2PWVA 1ZP4A 2ZRZA 2E5BA 1MWAH 4N9DA 3MRDA 5C0AD 1HSBA 4RSVA 5A2BA 4X22A 3MN8A 2QVIA 3RX5A 4D8OA 1C8QA 3UTZB 1EXUA 5ISZD 4FIQA 5DLML 4AF0A 4FLOA 5KVGH 2PPCA 4XCNA 4FNRA 2UWEA 3KPOB 4GNKB 1XXDC 2OMTA 1EEYB 4H0LC 2FMOA 5DA0B 3WEAA 1PCPA 4GC4A 3IMRA 2DTSA 3G1SA 2VLRB 5E5UB 2W9EL 5H8DA 1KB9K 3IGFA 4KH2A 4B95C 1CF8H 1W0VA 2VC6A 3C3UA 1RK1A 4E4FA 2L7QA 3RL1B 4WY7L 4U2YA 1CLZL 3QQ1A 3BZGA 5K9JL 2Q2LA 4GKZA 3X3GH 5K1NA 3TONA 5B1KA 3QW9A 4I77H 3B8SA 1UROA 5J6HB 4FFWD 1RFDL 1RK5A 3QUMH 2OM5A 3MGOA 4KEMA 5DFVD 3TQPA 4WDWA 1CICB 5KZDA 5D4QA 1UR0A 4URKA 1G1KA 1GYLA 1EIBA 2BC4B 3BFWA 4KCWA 4UOW0 2V7HB 2BVPA 1BWLA 3N04A 4XAYA 1R5IB 3MRNA 5C6TL 4DBSA 2VJXA 4BCEA 3CQHA 6TIMA 4FS9A 5ID1A 1SUJA 5IQ9B 3FSOA 2QCDA 1IGML 4NS0A 4HWEL 2ZJSL 4AGOA 4C59B 4WNSA 1U2CA 4RL3A 2JF1A 3KEDA 4PV8A 1T22A 3USBA 3OAWA 5T9BG 1GZQB 4A63A 2ZUMA 1RZ7L 3CUZA 2NQCA 1MHPL 3EH1A 1B0RA 3ARPA 5D70L 1U5JA 2VITA 3S9YA 4C4KT 4F1ZA 2P9RA 1M1BA 1AA1B 4M8QA 3RL2A 4S2CA 1A1OB 4BHUI 2QR0B 4JGDA 3MVSA 4IOFC 5L8JB 4IGMA 1MCFA 1OTSC 5DC9B 1JDCA 3HRZC 3G08B 2FPTA 2X9XA 1IXPA 3HBPA 2OYLA 1AS7A 1TO4A 2DQCH 3VUAA 3H0TA 5AVRB 2Z1SA 1EHAA 3DECA 3OVRA 5F4WA 2YQBA 4QHKJ 3VXPA 3QRBA 4C6DA 5G1MA 3SPHA 1SZNA 4OFKA 4BCYA 4S1SH 3N18A 3X11B 4UB0L 3HMCA 2NNCA 4KTGA 2DTML 4GAFB 4J3TA 1DFBH 4P23A 4NZCA 5AW5B 3VZZA 3QCUL 3EGSB 2E6FA 4TNVK 4PJFF 3NZGA 3OL2A 1UKOA 4W5ZA 3V0FA 2YDSA 5TPWH 2VLKA 2V3DA 1ZVNA 4BKLA 1CFQA 4JO1L 2XV6B 3S2JA 2YL9A 2HROA 4KFNA 4LFYA 3FOKA 2P24B 2PMZA 3VSUA 1CBGA 1EXPA 1G9NL 1ZT4A 5EEYA 1PKQA 2HTKC 2IWEA 3GSOA 4P46C 4TV6A 3QTGA 4ZBCA 1A5AA 2OAAA 1JPFB 4H4IA 1HHIB 3U1PA 5A95A 2J20A 3UTSB 4AZGA 4W9TA 3M8OL 5T5FA 5K9DA 1SSGA 1JE6A 4IKIA 3CZFA 3MMUA 2D7NA 4PGBA 1QAWA 2JB5L 4HT1H 1W8GA 2VISA 1Q4NX 3KYAA 4WDIB 4E9SA 5DHYB 3T6CA 3PWPE 4UANA 1AD9A 2HKHH 1SXNA 4UTBL 1I2RA 3BT2H 2BMKA 1UWUA 4MAUL 5C08A 4DHLA 4I3RH 4KWOA 3L66A 2PC4A 4HIJB 3VDBA 1KG0B 3URNA 4YHYC 4MNKA 1QUNB 4HPXA 4P7RA 1LQ0A 3VVGA 2WOBA 3IDXH 1PY4A 2V37A 5DHEA 3KCLA 3GH7A 3EJYD 1UOVA 3FFSA 4HYTB 1U22A 2EE9A 2YB1A 5B39B 3AI0A 1WCGA 1RP8A 4KKLC 3E6EA 1R6WA 4L1LA 5IMLA 3T07A 1DBBH 2CLMA 5XINA 1MFCL 4TLTA 1DVYA 2J8OA 3H7UA 1NBYA 2B5IC 4ZD3H 2SFPA 2XWBA 3L7EA 5MEPB 4M7KH 1BVNT 4UNIA 4DJED 3CQIA 2IGLA 4EAYA 4UTFA 3QR3A 2NUXA 2QQLH 1VPYA 3T4YA 4MPQA 4A38A 4OGXL 5F88A 1RZPA 3KVLA 2QT3A 2VCBA 1HXYA 4KJWD 5GJTL 2L0DA 3LS9A 2Q6ZA 2YZ5A 1TQTA 2YRLA 4PRDA 2P48B 2GJRA 3S34L 2QKSA 2IANB 3GDKA 5EA0H 1U8NB 4CSZA 1M1XA 1XLDA 4GRMB 3BGFB 1HU8A 4YGVA 4IGNA 3WLNA 5EIIB 43CAB 1IM3B 4A2LA 2E1WA 1F02I 1I2OA 3ZDXE 4JL1A 3RWEB 2WTOA 3SGKC 4N0UE 1H8NA 3UX9B 3O45A 1ZJHA 3TC7A 3CFTA 2W07A 1NIEA 1EFXD 2R1XA 1NUDA 4UDUA 3WY4A 1A9EA 2FDBP 3KLHD 4CQDA 1MLBA 2XX0A 3MJ6A 2AERT 2G75A 3WAKA 3W6LA 2AQVA 3V4VH 5CGMA 1WZAA 3L3JB 4U1JA 2Y72A 4MYWB 4IRJA 4PJ5A 5FW6A 4MNJA 4LK4A 2RGSA 4MWFA 1S7XA 3QPQC 2C9XA 5BZDA 2W59A 4F33A 3IANA 2R56L 4R26H 3MLPA 1ZP3A 1KACB 3S3DB 5C09D 3VGEA 4LCQA 3VM7A 4YS1A 2W61A 1OM3H 4FC3E 3ITCA 2ESVB 1Z42A 1B3WA 5DMNA 3V5HB 4UUJA 3FSAA 2B4GA 5J5DA 5AVTB 1FP9A 4C4BA 4GGHA 2Y3AA 3HHSB 3KVDD 1FYTA 1C8XA 1M71B 3ARBD 1JZGA 3S98A 3SPJA 1W2KT 4FTVD 3QS2A 4PJGB 3F7VA 4V1XA 3CHCA 1NMCC 4H7ZA 1PQZA 4EOWH 3ZLHA 5L88H 1OB1B 4GH1A 3UJTH 1KB5L 4OLVL 3BLIA 1R0MA 3AGVA 4JOMA 3F04A 4OF6A 1QYGL 4G6AC 3RUGF 5T8GA 1XU6A 1G1YA 1MEWA 2R91A 2OJ1A 4DIXA 4JREC 2E46A 2HKFH 3E1ZA 3V95A 1P69B 1H2JA 4GISA 1KWKA 4G6FB 1F1DA 2A4CA 3RRAA 2V4LA 2JQMA 4J2MA 4MIMA 4PU2A 4J1UB 4FXSA 5E8OB 3CCHB 1V02A 4L4JA 6A3HA 3W2LA 1AQ0A 3IU4L 3MRKB 2E9IA 4IG2A 5BRZD 4P5KA 3C6LC 4HQVA 1RY7B 3W88A 5E6SB 5F44A 1T0OA 3FQTA 1AGFA 4GRLC 5L4MA 1ONEA 3DURA 3UC0H 2F2KA 1T3FB 4GPVA 3LH2H 3B9VA 1WFIA 5MKGB 2W4XA 1M2OA 3WUWG 2X10A 1QI3A 1KB5B 1HJSA 2MNRA 2R6OA 1PCXA 3EOLA 4F3FA 3O4LE 4PZVA 5FO7B 1U83A 1NANI 4KX9A 3UR7A 1T20B 1B0IA 4QSFA 2H4EA 2GJZB 2YK1H 3MCG1 4HAGA 3OVPA 3TBSB 1IKFH 2ZE0A 5TFSH 4YHOH 4FA3A 3LD8B 4LIQE 4G5ZH 1XGEA 4N6QA 1R24B 2Z1KA 3PP4H 1CX9A 1S2WA 2WSRA 1JK8A 4H8QA 2NRDA 1B9ZA 5HNTA 1Y5XA 2DZVA 4XT1C 3G8EA 2R51A 3OO2A 4MADA 3WLSA 1U8MB 3C5ZD 2OVLA 2FTAA 2HRGA 3BPWA 1KCLA 2Z91B 3RIAF 4Y9CA 3TNNA 1AXTL 3VD7A 4ABWA 3GFXA 2QMJA 4AXKA 2DW6A 3L5HA 3GMMB 3SHSA 4K7YA 4C6OA 4WKZB 4OLUL 1G5GA 1U8HB 1Z7JA 2GHZA 5KSBF 1HHJB 3PPFA 4H6RA 4P9MH 1JYVA 1PB0A 2BVUA 4MMWA 4PHZA 1XGDA 3AWNA 1AZ1A 2R1WB 3L9EA 4QQ3A 1H7PA 4NPYA 2ZXAA 5FGBC 3J8F7 1D6VL 4O58L 2O26U 2PXYB 1BXXA 2QKFA 1EANA 4OJYA 3FCPA 4JN6A 4HNOA 4FK9A 4FFZA 1DTUA 5E09A 4KXBA 2PABA 4PBXA 5HDOA 2V3FA 4A3HA 4FX5A 3WD4A 1U3HA 1EYEA 4B41A 1VRSA 2DIBA 1CGTA 3C6EA 1KV5A 1Z9OA 2HAZA 3UTTD 4DERA 5EN2B 1KXTA 1FC2D 4ANVA 1BWVA 4FQQA 3FGCA 5AW7B 3TT3L 5FYKD 2EO9A 2IPFA 1XINA 2BB0A 2YKLH 2WLNA 3BV4A 4IXXA 4Z8FL 4B6ZA 2P53A 4LYRA 3LN9A 1REIA 2W5FA 3ZMNA 1XIGA 5EBLB 4C1KA 4AQ8C 4QE5A 2QHRL 3NK3A 1BD0A 5HVWA 2DLIA 3WKPA 5EV7A 1GR7A 3ZT7A 2BK8A 1Z89A 1ZCCA 3MBEA 4PPTA 2VGIA 4KTDH 4KFOA 5E0FA 3FA4A 3RNDA 2MQCA 4QXTA 2XG9A 2I60L 5IUSA 5CEYA 1I4NA 4UTLA 3IPEA 3ZBMA 3PBUA 3M88A 2EC9T 1PY9A 4QGCA 4HIEA 4KEVA 1W54A 1DJHA 5GZOD 1IGTA 1TT6A 5D4IA 4TQPA 5IHHA 1UZHA 1W1VA 1WQVT 4I0PD 3MXWL 4WGKA 1UQSB 4AD2A 3T0CA 3U0WH 1GC1L 4XAPA 4Z08A 1BQUA 1MW3A 3XIMA 2YXGA 2NY5L 1I8IB 1ZA6A 1J0HA 4A67A 5ALBH 3M0JA 4L5FH 4M5ZH 1FORH 2QGBA 4L4TB 3WO3B 2V5BA 4B16A 4YL2A 1I7TB 1DJIA 3IFOB 5F7LB 5J1SC 3GVWA 4GQQA 2FSEA 5CAKA 2ZYFA 4DVOA 2ZOKA 1GCYA 3E2RA 4Z7NF 1DEEB 1W56A 2D03H 2Q3AA 3G3LA 1W1A1 4JIRA 1T1WB 2NY6B 4QYOB 1KLUB 5DQJA 1QG3A 3MTXA 1XIFA 3IJEA 4P3CH 2CM5A 2OQYA 1DN2A 5FSEC 4KH9A 2P5EE 5DJ2B 4KNSA 5AHMA 4HA0A 2IH1B 4I5BB 1I2NA 1TKKA 2GB2A 5LBSA 1BM7A 3U4FA 1R7OA 3NZPA 2BCKA 1CECA 3A4DA 3MSGA 4OCLC 4XNUH 2WLYA 5EPMB 2QT6A 3W7PA 3CZSA 1F05A 1MY5A 2JH2A 2XSAA 1GVRA 4JFZH 4JIPA 3EJYC 4Z7VA 4LSQH 1CK0H 4BWWA 2AJUH 1EJVC 2ICCA 2B1AH 4JANA 4IGSA 1KUMA 3F58H 4EE2A 2CZEA 2EEBA 3D87B 4XPTH 4AKOA 1M41A 4OLYL 4HJJL 3QEZA 4UF7C 4I2XB 4GXWA 4G7YL 3HBZA 2HWZL 3ZR6A 1BMGA 1IEBB 3OKMB 3A3HA 4XKYA 3GZKA 1XYFA 2WIIB 3ZM8A 4XNZB 4QRUB 3PUDA 4HBKA 4TRPH 4H25B 1N64H 1G7MB 3R18A 3S5OA 2AI0L 2BHYA 4EKXA 1JVOA 3ZE2B 4UT6L 3TYBA 1WA2X 1C5DA 1OW0C 4F2ME 2YA2A 1E6RA 2E5DA 3KBEA 3BICA 3HTLX 2PYFB 1YLVA 2YMXL 5F9OH 4RLDA 1INDL 2WNNA 3CO4A 3NQFA 4C7DA 3FXYA 3PTMA 3SPCA 3KLHC 1SJAA 5K9OA 3BVXA 1J9QA 5H6HA 1A6TB 4M24A 2EIMB 3E6HB 2FEDD 4WI8A 4WGWB 3CWGA 5FYLD 1ML0A 4PJGF 3BSMA 2IDTA 1J9CT 3QWRA 2P50A 3FB8A 4ZTXA 3N06B 3SQOH 1A4MA 1OAZL 4Y16B 1NIAA 3NL2A 1BJ1J 4WWNA 1S9WA 5GS0C 3MA7B 2WUCL 2YAMA 1KN2L 1GGIH 5HJ3A 1H1YA 4R3SA 4L9XA 4NQCD 2CXKA 3H2CA 3O2WL 3O8XD 4D2JA 2E5CA 1SW3A 1VGAA 3BD3A 2WQXA 2J79A 2W60A 4O53A 4BUGA 4V1DA 4ZFGH 2GJLA 5KSAB 3DGGB 1JUFB 1ITBB 1G9ML 4MDIB 5E9DA 2Z2BA 5I1GH 4EX4A 1BZ9A 2F7PA 1AGDB 1XIEA 2IPTH 3TFKD 3P2BA 1L6WA 5CU9A 4B9JA 4OF5A 3CAWA 3H2OA 1IBDA 4LAQH 4ZBJA 3M6YA 3Q1SH 2BOCA 3QQWA 2NQ9A 1P4LA 3N85H 3RDKA 3ALWA