2QMJA

Crystral structure of the n-terminal subunit of human maltase-glucoamylase in complex with acarbose
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase, intestinal
publication title Human intestinal maltase-glucoamylase: crystal structure of the N-terminal catalytic subunit and basis of inhibition and substrate specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 274
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2007-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qmjA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qmjA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 2qmjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qmjA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 2qmjA01
1KGXA 1H2JA 1R47A 2EO7A 1BAGA 3B9AA 3WL1A 4TVCA 3DX4A 5BXSA 1A47A 3NYDA 3NDYA 2F7QA 2PWDA 5A2CA 5JBEA 2EQDA 1E0WA 2DIEA 4MNKA 4PCTA 5AYBA 3EJQA 2ZUVA 4PMVA 3AISA 1I1WA 5IXEA 1TQUA 4OZOA 3CO4A 6TAAA 1MFVA 2CEQA 1SMAA 3VTRA 4H41A 5ABFA 1NARA 4HOXA 3A23A 3LPGA 3GXFA 1TCMA 2XJ7A 2GJRA 3FW6A 1X1NA 5LA1A 4HZ7A 4DO4A 1VENA 4HMEA 4QAWA 1UWQA 2WSPA 3QR3A 3WEZA 4ATLA 4X0NA 3ZSSA 2XVNA 4DWSB 5D4YA 5E09A 1GOMA 2PSPA 3AIBA 4Z2HA 1HNYA 1XC6A 3NIYA 1J0HA 2GJPA 3WKZA 1GW1A 4P7NA 5DO8A 1QHPA 1WZAA 1VB9A 4CD6A 3KE0A 4CVWA 1Q6CA 1DHKA 4NX0A 4E8DA 2WB5A 1ESWA 4D6JA 1JFHA 3QHMA 2EACA 4FNUA 4W89A 1LWJA 4HA1A 4Z2IA 3VMOA 2YIHA 1JAEA 1UH3A 2OSYA 2IXUA 4M82A 2WM0A 1E55A 3CZLA 1ODUA 3PTKA 4PBGA 1TVPA 2J7DA 3AZTA 2DPEA 4D6DA 1ODZA 3MMDA 3NDZA 1VFUA 5GNXA 2FH6A 4J28A 1R33A 4QLJA 4AD3A 2E0PA 1UR4A 3GYCA 1QI3A 3H55A 3SUVA 2BY3A 1W2PA 4AZ6A 2PBOA 1JDDA 1C8QA 3IGUA 3ZJ7A 1ECEA 2CBVA 1EOKA 3EDFA 2WWDA 2D0FA 3K8KA 2BV9A 2GSJA 5AYIA 3MUZ1 2ZX9A 4XV0A 1WZMA 3MO4A 1JYVA 1R46A 2XWEA 3WQ4A 1XV8A 2FE0A 2VZVA 1V6YA 5D8WA 1AMYA 4IPNB 1U30A 5CPQA 2AAAA 3CC1A 4WSKA 4M56A 1QVBA 1CLXA 2VX5A 4J3VA 4NXSA 2J8GA 3RM8A 2ESCA 3CHEA 1UH4A 1W1PA 4PTXA 1H09A 2WSKA 4GKLA 2BY1A 1PIFA 1GQLA 2WVSA 3N18A 4GINA 4H8VA 4UQEA 3D50A 1S46A 3GZAA 3A3HA 3EJTA 4AIEA 4XB3A 3VMNA 3EMQA 3FHQA 4DWSC 1QI2A 1CGXA 1R7OA 5DFAA 3ARWA 5ECUA 2OWXA 1E6XM 2J75A 3PZGA 3S6TA 1BYCA 5E6ZA 4X0VA 3U7VA 2YBTA 1E3XA 4D72A 3PZOA 2VUYA 2J74A 2J77A 4W87A 3GXMA 1R8LA 2ZWYA 3A4WA 3WFZA 1MYRA 1JD7A 3W26A 4BA0A 1E5JA 1DWHM 4LPCA 1E72M 4Z2JA 3LXAA 2EADA 2OYKA 1BYAA 1TG7A 3WF1A 5JUVA 4QLLA 1CLVA 3BSGA 2XSAA 3DC0A 3WY4A 2J62A 2WANA 3SUUA 3VD7A 1E6QM 1JAKA 3PHAA 1KGUA 1J0KA 3A21A 2JF7A 1Q6FA 1E40A 5LA0A 1XSJA 4HPGA 4Y7EA 1ISXA 3AZRA 2PWHA 3AXXA 2X2IA 3A24A 1KBKA 3K8MA 2W92A 1WZKA 3VIFA 2XTKA 3SCOA 4JIEA 2WVVB 1QHZA 2YL9A 2X2JA 1UWUA 4AZ7A 5HOSA 4P7OA 3AXIA 3AHXA 4AC1X 2J25A 2XN0A 2D3LA 3WBEA 1E15A 1JYXA 1KXQA 1UD5A 2BNJA 2IUZA 2X0HA 2CIPA 3S5ZA 1QNRA 3L2MA 2VC9A 2VX6A 4KRTA 4NZCA 2D22A 1OD0A 4U5KA 2FHFA 1MWOA 1WAWA 2YLLA 4CUCA 1Q4NX 3WDJA 3MUAA 3GBDA 2WYSA 4UFMA 1J01A 2Y8KA 2UY5A 3PZIA 2JIEA 3GTNA 1ZJBA 4PMZA 1W1TA 3OBAA 1HI7A 2OW6A 3APGA 1DTUA 5DMYA 4D71A 7TAAA 3SCQA 3BVXA 3SCUA 2YA1A 1OSEA 1ITXA 1HVQA 2D23A 4B3LA 4A4AA 1NOWA 2Y24A 4ZXOA 1WO2A 3SUTA 3WDPP 3DDGA 1XD1A 1BG4A 1E71M 1HJUA 2EPNA 3VNZA 3K46A 3W6LA 3HG4A 3VNYA 4JL2A 1C7SA 1HJVA 2O9PA 3TTQA 1N82A 1E9LA 2DSUA 4B15A 4HOWA 1UR0A 1J0ZA 3M6DA 3WDIA 4UQBA 1UKPA 4NRRA 1B3ZA 1HP5A 3UETA 4AD1A 2VMFA 2WMIB 2VCAA 2WC7A 2WC4A 3J7HA 3UEQA 3WENA 4LXFA 3ZSTA 1PCPA 3BAKA 1Q6DA 3I3EA 5EMYA 2WMGA 3ARYA 2J7FA 3WQVA 2CERA 3DECA 1HKIA 4GXPA 4C7DA 5M3WA 3DYMA 2WZHA 2A3HA 2HVMA 2V5DA 1G94A 4CVUA 1E4LA 1Q6GA 2ZICA 4MDPA 4Q22A 1RPKA 3SCPA 2WCGA 1ZBKA 2CBIA 4PUEA 1AVAA 2FHBA 3ARZA 4J7RA 4W8AA 2FHCA 1JDAA 5F7UA 1JZ8A 5A69A 1XCWA 1BGGA 1MQPA 3BCDA 2XFYA 1M53A 2YLAA 3IAQA 3FXYA 3HG2A 2WW5A 3W4RA 1D7FA 2BHUA 3VGEA 1HF6A 4W8LA 1IZKA 5BROA 4D1IA 2XUCA 4CU6A 1G5AA 4C7GA 2WHJA 2PF0A 3GXIA 3SCWA 2YFNA 1PX8A 4UOQA 3BC9A 3VIOA 3GM8A 4OUEA 2TAAA 1VEOA 3AZSA 2ZXBA 4ACYA 5EB8A 1V3KA 4UTFA 4FNTA 2NT0A 1UG6A 1HKMA 3UERA 1G1YA 1G9HA 4ATWA 1PX4A 2XPKA 2YDSA 2XVPA 1JXJA 2CPUA 3VSVA 4WKHA 1QX1A 2PC8A 4F66A 1D2KA 3GNOA 2ZUTA 3MU7A 1UZ4A 2CHNA 4MNLA 1HKJA 1K9TA 1E4MM 4W5UA 1F4HA 2VZSA 2WC3A 1IV8A 3WNOA 2X2YA 3N11A 1AQHA 5E0CA 4MB1A 4AIUA 4P7QA 3VGGA 2VT0A 3IAPA 1L8NA 3RIKA 4S3KA 3AMGA 4XZBA 3WELA 3GDBA 1KCLA 2YJQA 3FY1A 4F9JA 3L4XA 2RGLA 5C8BB 1PZ2A 1Y7VA 5M17A 1C90A 4H04A 1NWSA 3WNNA 4U33A 4D6IA 4ZXLA 3AS3A 3S2CA 3EJRA 3MI6A 4JCLA 1XRVA 3LXBA 1CNVA 3DYOA 3T09A 4M8UA 4DWSA 4J3SA 4EANA 3MMUA 3W37A 3T0BA 3WNPA 3N04A 1JYWA 2QF8A 3AFBA 1R85A 2DSWA 3W27A 2PBGA 4AIOA 2WKLA 2XFFA 3AYSA 1DWGM 3GNPA 3WD4A 1LLOA 3N13A 4XX6A 3NCOA 4FLSA 4F79A 1C8XA 1DWJM 2XIIA 4TOQA 3CZEA 2ZOXA 3W29A 2WCSA 3N1AA 3T0AA 4UOJA 3EMZA 5IFPA 3SUWA 4C7FA 2CNCA 1UR2A 1JNDA 4URIA 2CBUA 2OYLA 4YHGA 1V6UA 3FN9A 3M7SA 3OGRA 5JBFA 1E6NA 2GFTA 4D6GA 1KQYA 2GDUA 2WHKA 4PMDA 2JALA 3VGDA 1M01A 4WJXA 2DQXA 3LPFA 1GHSA 3TTYA 3IK2A 1IT0A 1HJWA 1QNSA 5I24A 3VIGA 4GZEA 1GOOA 3W0KA 2JIWA 4MDOA 1M7XA 5GPRA 2V38A 4P8XA 3HZ3A 2A3AA 1EA9C 4TVUA 1OB0A 4FMVA 2GUYA 2CCRA 2EEXA 4ZFMA 2EAEA 4H8HA 5FIPA 3CZGA 2BFGA 4UZUA 4CCDA 4UQ9A 3M46A 4UQDA 1HJXA 3AI0A 2J7BA 5CPSA 5DEZA 3RJYA 2E9MA 3AICA 3DX1A 1E6PA 5IHSA 3D5HA 3WNLA 4AZCA 3POCA 4V2XA 2ZXAA 3FNDA 1JYNA 3RDKA 4OJYA 3T2OA 3CZ8A 4QP0A 1UD8A 2QPSA 3ZMRA 4GZJA 2DT1A 3ZT7A 3EMCA 3ZM8A 2DT2A 2Y8VA 5E0FA 3TA9A 5ABGA 1E56A 5CLTA 3AOFA 3O6AA 1OD8A 3AYRA 4MB5A 2DSZA 3VIPA 2OWWA 1C93A 4CD8A 2OSWA 1QNOA 1BTCA 3MUY1 1EHNA 1GQJA 4PMQA 4JKKA 1UD2A 8CGTA 2G8ZA 3QOMA 1QBAA 4FF5A 1I1XA 4TUFA 1JZ3A 1X6LA 4RL3A 1B30A 1GUVA 4GO8A 2ALWA 4U2ZA 4EKJA 3NSXA 2O9TA 3ZO9A 1FOBA 1XH1A 4AZHA 2BS9A 3PZUA 1VJSA 4JFSA 4GI9A 3WDRA 2VX4A 3WY3A 4W85A 1UHVA 4CCEA 3WN6A 3K1DA 3WF4A 5FD0A 3IJ8A 5GNZA 2VVSA 3VD4A 3RJXA 2G3JA 3VDBA 1J18A 3H54A 1PS3A 1UKTA 1J12A 3VD3A 4CN4A 1XSIA 3S5YA 1LL6A 3AMCA 2GJXA 4UFHA 3L4WA 4JZ5A 3WUGA 1US3A 1W9PA 3VU2A 4PMUA 1LL4A 2HISA 5A8MA 2WVVA 2X2HA 3CUHA 1CYGA 1TQVA 1KGWA 3UR8A 1PE31 2Q8XA 1GPFA 5AC5A 1CEOA 2EPKX 1W3KA 1AQMA 1YHTA 3D4YA 4AD4A 2A3CA 4UQCA 3GH4A 2ZE0A 1EIBA 3SCRA 4P8UA 3CPUA 1DEDA 2BY0A 3WEOA 1V6VA 3PTMA 2ZX5A 3MSGA 4YHEA 1MW3A 1H4PA 3MV01 3W6MA 4CD4A 4NZJA 4WSJA 1R75A 3THDA 3VM5A 2ZX6A 5E70A 5BCAA 1GONA 3PZTA 1NP0A 2PWEA 3BAJA 4LYQA 4N0RA 1VF8A 1QOXA 1WKYA 3UR7A 3UG3A 1VIWA 1VJZA 1W2VA 1KB3A 1H0GA 1JNEA 2QHAA 2WBKA 5JIWA 5IDIA 5CSYA 1CGVA 4U2YA 1QHOA 1ISWA 4ATDA 1JG9A 3AROA 1EDQA 1B3XA 1QW9A 2E40A 3SCVA 1TMQA 2DSKA 3IJ7A 1UZ1A 4QFUA 4CD5A 2WNWA 3BH4A 4EK7A 4GQRA 3EBVA 3WMBA 3ARSA 2Y2WA 1ITCA 2FGZA 1LWHA 4RE2A 2NSXA 4L4PA 1ISYA 1HIZA 2QPUA 1X6NA 3AS0A 1V3HA 2WZEA 2W4XA 4JHZA 1KWKA 5A6BA 3VPLA 3LRMA 2B31A 3BUDA 2WMIA 7CGTA 1LL7A 1LG1A 3T0DA 2DH2A 1QI5A 1V3LA 1FHDA 4WKAA 5E6YA 1E0VA 4GIAA 4PTWA 1AQ0A 2NT1A 3WMCA 4FK9A 1PSPA 3AIEA 4UZSA 4B9YA 4V27A 4WF7A 5A2BA 1UR9A 1PZ3A 3ZR5A 1ZS2A 1B0IA 1H0IA 2XM1A 4ZENA 2XWDA 1W9DM 3PTQA 1GNXA 3VIIA 3CUJA 3A22A 3RCNA 3AHYA 4RE4A 4JCMA 3OA5A 2W66A 5A8QA 4MNJA 3VOCA 3PBGA 2G41A 3T08A 4MJ4A 4U31A 1F4AA 1TVNA 2X1IA 1C92A 2CESA 3NUKA 2JEQA 3EJUA 5I23A 3VDHA 2YL8A 1G0CA 5BXPA 5A8NA 1JXKA 3MKKA 2D1ZA 2J7CA 2DT0A 3D3AA 1Q6EA 4UFIA 1CXLA 1JI1A 1LG2A 1UA7A 1J0JA 1NP2A 3BUIA 5M5DA 1UA3A 2IXVA 1PBGA 5D8ZA 4LYPA 2D0HA 1CENA 1C7TA 2YDRA 2ZIDA 3THCA 3WH5A 5HXMA 1EH9A 3FAWA 2GVYA 3CMJA 4UQAA 1TR1A 5HNNA 3VDCA 2YL5A 4MAZA 5FL1A 2E8ZA 4JL1A 3FAXA 1OWQA 2F1BA 1O7AA 4KWUA 1HX0A 3BAIA 1CXEA 3KWXA 1FH7A 2NW0A 4BZYA 3ARPA 2X0YA 1HJQA 1ZL1A 2ZUWA 3WF0A 4AZ5A 1V0KA 3AS2A 1EQPA 2XHYA 2J7EA 3WF3A 3VD9A 5C71A 3TP4A 2E3ZA 3ARUA 1UQZA 1PAMA 5HPOA 2WCAA 1GOWA 2PB1A 3VKKA 2W5FA 3VUPA 4U3AA 4E4PA 5HBFA 1A3HA 3N15A 5CXPA 4LGXA 3HMCA 3SCNA 2V5CA 4M80A 1PS2A 5I5RA 5I78A 1HTYA 1WB0A 3VIMA 1UH2A 3WDHA 3POHA 4HZ8A 2XYLA 3SCSA 3CZJA 2VNCA 2CKSA 3WNKA 1TE1A 4FLOA 1UOKA 3F5JA 5EFDA 5D9NA 1U2YA 1NOFA 3K8LA 4ZE5A 3OG2A 4CN1A 1EHAA 1UKSA 3ARVA 4AWEA 1XYFA 1JZ7A 1L0PA 3MS8A 3BSHA 4PRWA 1EDGA 1EXPA 3WQ6A 4HP5A 3WQ8A 5A1AA 4DM1A 3BGAA 3E1F1 3WSUA 2A3BA 1C91A 2CXGA 2BHZA 4E8CA 1KFWA 2ZX7A 2JEPA 4AZBA 3B9DA 1E0XA 1GVYA 2XN2A 2Y5EA 1BF2A 2BHYA 2YA0A 3MSDA 2ZXDA 2F61A 4CU8A 2MANA 3I3DA 1ZBCA 3A5VA 3M07A 5EBAA 2ZUMA 1MFUA 5I2UA 2XG9A 5IHRA 4J3UA 1K9FA 2BVDA 3OB8A 4AEEA 2VR4A 2BVYA 3KL0A 2DEPA 2J78A 2VI0A 3VSUA 2VOTA 4EE9A 3BLBA 4X9YA 3RMEA 2XM2A 3ZT5A 2WLZA 1HVXA 3I3BA 5A95A 5I0DA 4JKMA 3CMGA 3ZIZA 4QDMA 2VTFA 4B3KA 1JFXA 1CXHA 4D6HA 3EDKA 2X09A 4IPLA 1V02A 5BRQA 2XVLA 5A6JA 4B16A 5I3DA 1D3CA 1ZBWA 3U57A 2CBJA 3VVGA 1LF1A 4OBRA 3UCQA 4AEFA 5CZKA 2VZTA 2VCCA 4PMRA 1HP4A 5D9OA 3CZKA 3UG4A 1VEMA 1C8YA 2J7GA 3GXPA 5M03A 4MB3A 1CGUA 3ZJKA 4KRUA 5I6SA 1UR1A 1V0MA 3BUBA 4PUDA 1R87A 1WCGA 3EDDA 4J3WA 3WUBA 3K4AA 5FKYA 3WIJA 1HN1A 3HG5A 3ZR6A 4PMYA 3O9NA 3OGVA 3BUPA 1B3VA 1KR0A 1UD3A 2UY2A 2EXOA 3LRKA 4GPNA 3WL0A 2J47A 3TTOA 4PYSA 4D6EA 1TA3B 5LYRA 2XFRA 1CXKA 4W84A 1WPCA 4WK9A 2W67A 4XZWA 2PWFA 2AOSA 1GCYA 1QI4A 1CGWA 5D9MA 5DF0A 3W28A 3NJ3A 1V6XA 4GZIA 5E1QA 1LQ0A 2ZUNA 3O2LA 4JFTA 1OT2A 2J4GA 2VRQA 4Z2LA 4W5ZA 3OIHA 2OW7A 2W91A 3VGHA 2X05A 4Z2GA 4BQ2A 1YQ2A 5GNYA 4NSBA 3OLEA 2V3DA 2JFEX 2EPMX 3H53A 3BVVA 1E43A 3VDAA 4AMXA 1XHGA 5A6SA 5CGMA 3BXWA 1JI2A 3DHUA 3AIWA 5GQBA 4S3JA 4UOZA 4KGJA 3RM4A 1JIBA 1ISZA 2O92A 1W3JA 4PMOA 2AMGA 5HDRA 1KTCA 3KL3A 4W7WA 1FP9A 6A3HA 3W38A 4HU8A 1WDPA 4MNMA 2QLYA 4MAVA 2XVKA 3GNRA 1KBBA 1Z32X 4LX4A 4AW7A 1B9ZA 4W86A 1NM9A 4DUVA 3HN3A 1UWIA 1HJSA 3AHTA 5JBDA 1HWWA 3W81A 1MXDA 3N12A 3WQ5A 2YA2A 1QNQA 1DWAM 5DT7A 2XSBA 3CH9A 3UESA 1E1EA 1EO5A 2YKKA 3AMDA 4OOZA 1PEZA 1JZ4A 3TONA 4ACZB 1R7AA 3AXHA 1FA2A 1E4NA 4TX8A 3MUIA 3WH6A 3D51A 4H2CA 1XSKA 1UKOA 5FCZA 2J79A 1B90A 1DWFM 4OKDA 3TTSA 1PPIA 4PTVA 2BY2A 1V3MA 5CQ1A 2ZUSA 3QHNA 3NSMA 1B3YA 3AMLA 1B2YA 2G3MA 1XH2A 7A3HA 1KQZA 1CWYA 5A6BD 1W3LA 3MMWA 4UCFA 4AY1A 2VVNA 4J3TA 3WD0A 4JFVA 3BVTA 3F5KA 1NWTA 2XN1A 1SR0A 4QLKA 4CU7A 2W62A 4FNSA 4FNRA 4KGLA 3WDQA 3N9KA 3BLKA 4TXEA 3SURA 3CHDA 2EBNA 2CKRA 5CPTA 1WNOA 4PMNA 1GOIA 1FP8A 3B9EA 2EPOA 3KLKA 1HKKA 4HOZA 2WAGA 5CLWA 2VX7A 1E9TA 1T0OA 3K4DA 2G4FA 2EABA 1GORA 1B1YA 2UY3A 3IJ9A 4CN6A 3CHFA 2YFOA 3L4VA 2GK1B 4OGZA 3SCTA 4OIFA 2VZOA 1CDGA 1E4IA 3PZQA 2G3NA 2O9OA 1WE5A 3EJPA 3FHAA 3T2QA 1V02E 2VR5A 4U3CA 2VCBA 4BQ3A 4TTUA 2FGLA 4HZ6A 4MJ2A 4XUYA 3L4YA 4PEEA 1UWRA 4CCCA 4PN2A 1E5NA 2OYMA 1LJYA 2DIJA 3OZOA 1JZ2A 3L4ZA 5TD4A 1NQ6A 3TV8A 3VINA 3B8SA 1RP9A 1HL9A 4P8VA 4CGTA 1BQCA 2BXYA 3RM9A 1JF6A 2OLHA 3LPOA 1KXHA 4KH2A 4ZEPA 1VFFA 1KWGA 5AY7A 4AZGA 2CHOA 1XH0A 3SIMA 4TTGA 4D6FA 3VM7A 3IANA 4W7UA 3AS1A 3VO0A 3WF2A 3LMYA 1MW0A 2QMKA 4DO5A 4IUGA 4M29A 1ZU8A 1FFQA 1BHGA 1HXJA 1BYBA 1R34A 1VBRA 2J8FA 3ZQ9A 3WUFA 3KZSA 3GH7A 2FH8A 2D73A 1CGYA 2PI6A 2YBUA 1GJWA 1C3FA 1W9UA 3DDFA 1W9VA 3G6MA 3PN8A 5I77A 4QCEA 2JF6A 1E70M 2D0GA 3W82A 4Q7NA 2VQUA 2WPGA 1TQWA 5D9PA 2Y4SA 3CUFA 3EDJA 2Z1KA 1EQCA 1VFMA 1OBAA 5CGTA 1BVNP 3AMKA 1WDRA 1BGAA 2F7PA 3EDEA 2X8RA 4GQQA 1MW2A 3A4XA 4U5IA 1NWUA 3GBEA 4AYGA 4AZCB 3AIVA 3TOPA 1FHLA 2V3FA 3LXCA 1HXKA 5A2AA 1RH9A 4GI6A 3PZVA 1MQQA 5KEZA 2C7FA 1G01A 1QWUA 1WZLA 3WD3A 3EJSA 4WKFA 1XCXA 4KMQA 4N42A 1BVZA 4DUWA 3WH7A 2VRKA 1BPLB 3OLGA 3A6OA 2O9RA 3U5UA 2E9LA 2WHLA 3G6LA 5A6LA 3AIQA 5BXTA 4LQ1A 4JFWA 1WP6A 3HU7A 2WLYA 3BAXA 3VIJA 1IZJA 1WDSA 1H41A 2WVUA 1UWTA 1B31A 2F18A 5ABFB 2W61A 2OSXA 1W3HA 4MPKA 4FNQA 2CETA 1B3WA 1GQIA 3WUEA 3AIRA 4AZIA 1E3ZA 4H7VA 1J9YA 3WNMA 1W91A 5A6AA 1GZJA 4LYRA 4UNIA 4HTYA 4L4OA 3ALFA 3W25A 3DYPA 3T2PA 3GXNA 3BLPX 3F4VA 4TVDA 2D20A 1QW8A 5LA2A 1DP0A 3VIKA 2WMHA 4A3YA 1BYDA 3ARXA 2Z1SA 3WY2A 4AYSA 1OINA 4UFLA 1CZ1A 1UD6A 4HMDA 4OBSA 1H11A 1NH6A 5A94A 2ZXQA 3ARQA 1KR1A 1W9BM 2GJXB 3AHVA 1JD9A 2UWFA 3KEHA 1ZJAA 1UQYA 1W32A 4JHOA 3CIVA 1UUQA 4DO6A 1ZB5A 2F2HA 1SMDA 5A6MA 2E9BA 3VD5A 3CV5A 4MB4A 4WLCA 2ZUUA 2GDVA 3ZJ6A 4F9DA 4W93A 5CG0A 2J7HA 6CGTA 2OWCA 4P8WA 2ZX8A 2QV4A 3U7BA 3BMWA 1GQKA 1BSIA 1KTBA 1ISVA 1CXIA 1V3IA 1V03A 4HU0A 3KLLA 2V3GA 4AMCA 4DWSD 1TA3A 1QPKA 1VRXA 3SEPA 4BQ4A 3VGFA 4H8UA 1W1YA 4UR9A 5BYWA 4W8BA 1W1VA 5CSUA 1MQRA 3U5YA 2F7OA 2W63A 3BAYA 1H5VA 1E73M 1KXVA 9CGTA 4W88A 5EFFA 3HJEA 1UD4A 5BRPA 5A8PA 1R86A 1OCQA 3WBAA 3JUGA 2YOCA 2D24A 4FNPA 2WMJA 5ABHA 4BS0A 3SUSA 1J11A 3ARRA 3BVWA 1DWIM 2VQTA 3LX9A 3A4AA 4B9ZA 4HA4A 3KL5A 5E9AA 2A3EA 4FLRA 1CECA 2UY4A 2CITA 3ARTA 2DH3A 2VO5A 4DM2A 2D3NA 2WZIA 1JZ6A 3MANA 4AD0A 2ZWZA 4JKLA 4AISA 4OOUA 4PMXA 3QHOA 3WEMA 5A8OA 1KXTA 4DUXA 5BWFA 5FOOA 1PIGA 4P7LA 4ACZA 1BG9A 2XIBA 1PJ9A 3WY1A 1UKQA 1K9DA 3BMVA 4PSPA 4BQ5A 1GOKA 1OT1A 5I79A 3F5LA 1OIMA 3DX2A 2BXZA 4HA3A 1O6IA 1GHRA 4EAMA 4NRSA 5IFTA 2VJXA 3GXTA 4RE3A 4M81A 4UFJA 1TFVA 5JIPA 1OGSA 1VAHA 3AJ7A 1E1FA 3ALGA 3CUGA 2XGBA 4MADA 3VMPA 2VL4A 2DSVA 3DX0A 1M04A 4PCSA 1E6SM 1EOMA 2F7RA 1P6WA 3ECQA 1GOQA 4NZFA 3ZOAA 2BVTA 2QMJA 4IM4A 1H1NA 1ZBVA 3VIHA 2WXDM 1E6ZA 1TZ7A 2WMFA 3VX0A 2YDQA 1GVIA 8A3HA 3WFLA 4CKQA 3DHPA 4BCEA 3AQUA 2G3IA 4K68A 1RP8A 5HPCA 3GXDA 4R27A 1J0IA 1O7DC 2YL6A 3OLDA 4Z2KA 2C0HA 5ABEA 3DX3A 2DGAA 3BVUA 1FFRA 2JE8A 3WD1A 5AC4A 3OZPA 2CYGA 2D2OA 1VBUA 3CGTA 3GH5A 1UWSA 4FLQA 1EO7A 1CPUA 4P7RA 3N17A 5KZ6A 1GJUA 4E2OA 1V0LA 2WKGA 1MXGA 1HL8A 2GK1A 1K9EA 3WQWA 4W7VA 1V08A 1M03A 1PX3A 5C70A 5A3HA 2E8YA 3EYPA 3VX1A 1CGTA 3RO8A 1EGZA 4YN5A 1JL8A 1QI0A 2F8QA 3BCFA 1FH8A 2DDXA 2E4TA 4HPHA 1V6WA 1NOUA 1J10A 2DT3A 4TX6A 1I75A 2PWGA 4PSRA 1CBGA 1VEPA 2FDMA 3D4ZA 1UASA 3PZ9A 3QOKA 3D52A 3RPMA 4CD7A 4NI3A 4A3HA 4D1JA 5DT5A 3WD2A 3L4TA 4HMCA 3PZMA 3MV11 2WHMA 1SFSA 1U33A 3A47A 3CLWA 1TQSA 3WH8A 2C8NA 1H49A 2WVTA 3II1A 1V3JA 3VGBA 4AXNA 2F1AA 4GI8A 1W9XA 1XD0A 2VRJA 1WDQA 3UG5A 2VZUA 1JZ5A 1SYTA 3LPPA 1BLIA 3BUQA 4AMWA 1J0YA 3VSTA 4NF7A 3CBWA 3W53A 5A6KA 4NXKA 4D6CA 4ZE4A 1K6AA 2EPLX 3AIUA 1RD6A 1E6RA 2XVGA 4GO9A 2IGTA 3BAWA 2EJ1A 1BFNA 1XYZA 4QCFA 5BXRA 1HT6A 4WIWA 3CHCA 1JF5A 3LRLA 2RGMA 3VILA 4AD5A 3WH9A 1TQTA 3ZT6A 1JDCA 4IISA 1QWNA 1VFOA 3ZJ8A 3L2LA 4R5EA 4JAWA 1US2A 2XGIA 1QBBA 1V0NA 3WMSA 1CTNA 1MW1A 4BF7A 3OGSA 1SZNA 4JFUA 3CZSA 1CIUA 2WBGA 3OLIA 4MTVA 1CXFA 1EDTA 3CZNA 2V3EA 3NSNA 3CTTA 1XGZA 1KCKA 2VURA 4F8XA 3L4UA 1QNPA 3RILA 1FH9A 4ML4A 1NWRA 1UYQA 3W24A 2WWCA 1OGGA 4PTMA 2FYVA 1OGBA 3PZNA 4M1RA 3AHZA 1UR8A 3CUIA 3QGVA 2WK2A 4UFKA 1H3GA 4YPJA 4J3XA 1MVYA 4V28A 1JGIA 2WMKA 1OIFA 4AD2A 4J27A 3HG3A 5CJ5A 1OM0A 4M24A 1TUXA 5FL0A
chains in the Genus database with same CATH superfamily
4HHMA 3QWRA 1XGRB 4KJYB 5HHOE 5IGXH 4A6GA 1AG6A 5I8CA 3HZVB 3PJSA 1FKXA 1QPNA 4MXWH 2YB1A 1H60A 4DNHA 4Y7MA 2OGJA 1G7HB 1R5YA 1ES0A 6TAAA 3GDCA 2XJ7A 1WFNA 4ORMA 4MJID 1P1XA 3JTTA 2WSPA 4K71C 2ZOKA 4DJDD 5BZXA 3ULVL 1G84A 4WGVB 3CAWA 2B7PA 5DO8A 2A0NA 1QHPA 3OQ3B 5DMJB 4E8DA 4GD0A 4PJAF 3NFPB 1CC3A 1G7JA 3NAAL 1AR1C 3S8GB 3BKML 5AOLA 4ZQTA 1JNNL 1VDGA 4WW2C 2Q3ZA 2AJ3B 1JVOA 3Q7JA 2J7DA 2K45A 4QRRD 1R33A 2DW6A 3VKBA 1GTFA 1QI3A 3VWKC 3CFCH 4WTZA 4B9PA 1Z9NA 3RGHA 2GSJA 1NBCA 4Z1YA 1MQKH 1A7BA 4XV0A 5E9DE 5HHVL 3MO4A 1Y5VA 1D5IH 4U6VH 3WFAA 3U83A 4EI6A 4A7UA 5LB1A 2ZG1A 1CLXA 3G5YA 4KROC 3GW0A 4FULA 4PMEA 1ZJHA 1WFMA 4MA8L 1GQLA 4AX6A 3D50A 5DANA 3X1NA 1IEWA 3T40A 4KKRA 2ZYHA 1JJUA 4JY8A 2D2GA 5DFAA 1UCBL 1W0YT 2WNGA 3PZGA 3S6TA 5E6ZA 1E8XA 4X0VA 1HQ4A 4N0YL 1BM3H 1BREA 3MROA 3O6MH 5HHPB 2YN5A 1DVQA 3UTTD 5A43C 4PJ8A 3U6RA 2HT4C 4P2RB 5JUVA 1OW0A 1WFJA 3PWJA 4J3OG 1CLCA 1OC5A 4R4FL 5D7IB 1AYOA 4IOIA 4JKNA 4PHXA 1MFNA 2VFIA 3S46A 1T8XA 3C86A 1EYWA 4EACA 2REQA 1P0SE 5LA0A 2VIRB 4PJ6A 1S8DA 2R4SL 4X98B 3VI4E 4JKWA 2E77A 2FQEA 1GS7A 4WW1B 1E9IA 3W5MA 5C2BL 1EGJH 2DP3A 3WKPA 3WBEA 1E15A 4R97C 2BNJA 3GHEL 3R8HA 2AFNA 4K5MA 3MJ9L 3OJGA 5EU6A 4M02A 3CLMA 1A9BB 4U5KA 1OAZL 4B3ZA 1HXMB 4UTBH 1ZT4B 2IBZX 2BRQA 3HBLA 5CBEA 3KJ6H 4XHQA 3GT6A 3OYXA 2Z31A 1B3OA 5AW7B 4OB5L 1AKJD 4Z7WE 4ZUTA 3QUZC 2CMRH 5I1CH 2Y24A 2HX8A 1QOKA 1A2YA 4M7LH 1N82A 4KVPA 5AG9A 1P0BA 2FO4A 1FCGA 2YPLE 2WWMC 4NQCE 3BKYL 1DKWA 2VDGA 2EKSB 1FWBC 5K59E 4LCQA 2ADGB 5HGBB 1BTMA 1PCPA 1I7TB 3KLSA 2GQ3A 5JOPD 4RWYH 3WQFA 3WS6A 3GTTA 1NGWA 1PY9A 2OEKA 4PGEB 4GXPA 2B5IB 3KCJA 2OKTA 5DJYB 5HHOA 3UZJA 3BPLC 1HH6B 1QO3B 3D39E 2Y2YA 3HPLB 4UAOC 5D4JA 4JBSA 1VZIA 4YIQA 5H4ZA 1GAFH 3LQAC 2ROYA 4YXLL 1CLYH 1FC1A 1XLHA 1G5AA 4C7GA 4PH8A 2F5AL 3W9EA 2G95A 3WFHB 3EX1A 2YFNA 3VIOA 1N0XH 3S2MA 3Q05A 1V3KA 2HBVA 3W11C 3DBXA 3UERA 2DWYA 2XVPA 2JLPA 2TYSA 5F1NB 3ZQWA 5HHMD 3F1QA 4PQXA 1GGOA 1SUJA 3FOKA 4HH8A 1R3KB 1IAIM 5T9CE 1SJEA 5IBUB 4PP2A 4OZ4B 5D7JB 3STBA 4MHHG 3DETD 2VT0A 3IAPA 2R0ZH 1ZIAA 5IQNA 3WELA 1KCLA 1KG0A 4F9JA 1PKMA 2X6BA 3FKRA 4P48A 1OVZA 1NWSA 3LEXA 3WQEA 4U28A 2VXSH 5B8CB 1MIEL 1BVWA 1KJ2L 2BVPA 3LXBA 4JCLA 1LWIA 4O10A 3H3PH 4TPRL 4EANA 2VLME 3MMUA 1TJIL 5BOPA 5I5MA 3WTVA 4PB5A 4PGBB 3JZEA 1OIOA 4XN7A 1DWGM 5K9JH 3ZLHA 4GQ9L 4B5VA 3FCSA 3O0RL 3P77B 3TLLA 1QFUL 3VQ2C 2CNCA 1V5XA 3B8VA 2A1WL 4LVGA 4LNCA 1KFBA 2B1AL 3EGSB 1IM3B 4LQFL 4UT7H 5AVQB 1ZVYA 1YRKA 1LQSR 1LP9A 2P8PB 3U1SL 5BZWA 5EBUA 1A7NL 1OAUL 4TVUA 3GI8L 1DZBA 2BSRB 2EAEA 1KFCA 3CZGA 4PCNA 4HHHA 4JYDA 4UQ9A 4N0UB 2J7BA 5DEZA 3DX6A 3EHBC 2AABL 2JKXA 2AEOA 4JX0A 4WGXA 3VFPB 1IAOA 4PJ8D 3GVGA 3Q48A 4JRYE 5J6HA 5JDSA 3SGUA 1C93A 2FT8A 3SDAD 4NRZB 2WWNA 4FF5A 1UWAA 1A7QH 3PLYA 1X6LA 3U1QA 2AGTA 2VC5A 2PDGA 4EKJA 4AZ8B 3ZKNC 1N70A 1X4XA 3E2SA 2VX4A 3R7MA 1UHVA 4F2ME 1TQBB 3MTWA 3IJ8A 4R84A 1KCWA 3QPXH 1BZ7B 3W39B 4Y9PA 1AZRA 2SEBA 4ZK8A 3W7GA 2RKXA 2RA1A 1F3JA 4H4IA 2KDYA 4ZMXA 3FSAA 1D3HA 4KKNA 2PPDA 2Q1EA 3SY1A 4FQQB 1ZVNA 1G9ML 1BFOB 4A7GA 3TPUA 4C1NB 2XACC 4X7TA 5J8LA 1DEDA 1JS4A 3MBWA 3QRFM 2EYTA 3ZVHA 4TNGA 4ORZC 4NWTL 1S3RA 3KPTA 5HWMA 1FNGA 3FU8A 3IIZA 2ZX6A 5E70A 3S34H 3CSYA 5EO0A 2PWEA 3BAJA 1FN4B 1YYML 4A6YL 1EGMA 1VF8A 3B56A 3DJRA 3WJLC 3CBRA 5C0AD 5LDSA 4YZFE 5CSYA 2OMVB 4PGLA 1BIHA 2CHRA 4WHTB 2EDKA 5I74C 3IJ7A 4QFUA 4CD5A 4D8OA 2CPCA 2YGVA 4DPCX 2QPUA 5HHOD 4AVNA 3MJ8B 4O15A 2B31A 1BAFH 1LTDA 4HNTA 2DH2A 1QI5A 3MX0A 4QNWA 1PZDA 1OK6A 4UZSA 4NRXB 4YTRA 3TMLA 4JO2H 3Q2NA 4ZENA 3L2IA 1U8PA 4HUXB 4HT1H 1UACH 3U9PL 4QITA 4DN3H 4RQQA 3QTGA 3KGSA 4B53A 1DVFA 4G8TA 3WQOA 1NMCC 2OVLA 1H8LA 3FUIA 1NKGA 2BWIA 1ZV2A 1YKWA 1A5CA 3ZFHA 1SXCA 4K9JA 4EDXB 4ODTL 4BYHA 3J8F7 1LG2A 4XN5A 4XP4H 2CHDA 4I3RH 3DMMB 3BWUF 3QRGL 4X9BA 2ZIDA 3QIBA 5J3HC 3UMNA 4ONGH 3OC5A 2XPYA 4F33A 1UWEH 1SYSB 2F1BA 3KWXA 1Z7JA 5FS5A 1RAMA 3BN9C 5E9DD 4UM9B 3MRKB 4DKEH 1V0KA 1WWWX 1UP2A 2Z24A 2HQAA 1QO5A 1S9VA 4B7LA 2PO6B 4E4PA 4R2GC 5HBFA 3N15A 2OA9A 1PCKA 2F84A 2WXMA 1EK3A 3A6BH 2NQ5A 3U6XS 4MZ1A 4LALA 1Q9KA 5D9NA 3OKDB 4L6OA 3RAJH 3K8LA 2PCFA 2DZWA 1E6JL 1IGML 4WRLA 4OGYH 3DU0A 1EDGA 1HZYA 4DJFD 4DM1A 2ZP8A 3QSRA 5HANA 3MZGB 5C9XA 2PN5A 3GBML 1QRNA 2PSNA 4AC7C 3GEFA 5JHLL 1SMOA 2FB4L 2XG9A 3TZVB 3UZEC 2Z2UA 3DGDA 3HE6A 2GHWB 3BLBA 5EZIL 1QLEL 3QRHA 2XM2A 3NEEA 1HVXA 3B2VH 3A12A 2VW6A 3FQTB 2FSEA 5A3ID 5EOTA 1CXHA 3CT2A 2TMDA 5A6JA 2QDEA 3IDIB 1LROA 4ZTXA 1L9NA 1QAPA 3VXTB 4AK2A 3W2MA 5LG1A 3TZNA 2E6JA 1OARH 3HG5A 5CU9A 4J40A 3FLUA 1AZNA 3SODB 3WLHA 2GAZA 5DJ2B 4LHUD 2AJSH 2Q2LA 1KLGA 5HYSB 1AG1O 1XIDA 1Q13A 5EO1B 4N9CA 3OIHA 2W91A 4JN6A 4RAUB 1L9RA 5I16B 2YPLD 4EJ1C 2H45A 4FC3E 3L9BA 4PJGF 3BXWA 2YQBA 3N9GL 3IEBA 1ISZA 1I8KB 5JIDA 2FIKB 3QUYB 4LAMA 3NH7H 1G6RB 4YHIB 4PYGA 1DQJA 4XCYA 1HJSA 3S47A 3N12A 1KEGH 1CFNA 3F3HA 3E0FA 3D39D 1S2EA 4Z78A 1ZCCA 2NUWA 4L4TE 4YE4H 3JXAA 3QHZH 4H2CA 1T1ZB 3MXVL 3IFNH 4OKDA 5AVRB 2EUXA 4JEJA 3ZTEA 2VMJA 2WJ7A 4MXQC 1A8ZA 4PTVA 1LL1A 4U6HB 1WJ3A 1WAUA 5AYUL 4XIMA 1LYQA 3MVTA 3VUSA 1YJDL 1EYEA 4A7TA 3BW2A 4GRWB 4GP8B 2I9LA 2ATPA 4GY7A 3N9KA 2XXGA 3IDNA 5HYJA 1S5HA 4M43L 4NQSA 5EBLB 3LKPB 1KXVC 2Z65C 3V4UH 3VXRE 5GIRB 2Z25A 4O02H 5CLWA 2G4FA 3ZKQD 1OEPA 3WL9B 4PJHE 3KRZA 2GK1B 1MEXH 4WEEA 3SDCA 3TWCL 4MHBA 2YARA 3FQRB 1ITUA 2Q8BL 1AD1A 3VJ6A 4C58B 1RIHH 5EU5B 4HZ6A 2VLMD 3BXNA 1UWRA 4N2LA 3ETBF 2OYMA 1OWRM 4UV4L 2DIJA 3W23A 3ZHLA 1A6UL 2AHIA 3FSUA 2FEEL 3QIBD 2X3AA 3OPZL 2BOBB 1Z3GH 2WQWA 2VERN 1KA9F 5KYYA 5KSAC 5C0RL 3KJ4C 1TEFA 1A64A 5FF0A 3WD5L 4J3OH 4GRLA 1MRCH 1RZ8B 5FUOL 4RVBA 1U3ZA 1XC4A 4YN3A 3BUVA 4JREB 1UZ8A 3PYCA 2EXSA 3EO9L 1BHGA 3PV6A 3TBSA 1GYUA 4CW1B 4ANXA 3DPBB 1NEZB 3FKUS 4X99A 3AUJA 4QR6A 5EEUA 5SWUA 3RX2A 4AXKA 5DURB 5HY9B 3HURA 4QCEA 2JF6A 5L8JB 3GI9L 5JIHA 3FUMA 4L7ZA 5AB2A 1JHTB 2ICWI 3W1UA 3MOBH 3D18B 2QJIA 1A4AA 3QSKB 5ID0A 4JRYD 3ISWA 4JX4A 4NN6B 2J9ZA 4HKPA 4U1SA 1V8EA 2EDHA 5KS9E 3EBHA 2YUXA 2YEVB 2YMOA 3P4MB 1XG4A 5AOJA 5L2KA 3Q4DA 3U5UA 4P57B 5BXTA 4Q7IA 2Y7SA 1TWDA 2CU9A 1O1ZA 1K72A 5AUMA 4O0QA 3I02A 5BQ7B 1PBYA 4MDIB 2L7JA 1GQIA 1FWWA 2DAVA 3I7QA 4U1HA 4KKZA 3OAYK 3O7UA 4XT1C 1EBPA 3NYZA 2NQJA 5LA2A 1J9QA 1NCWL 2I17A 2Y5TB 3SJVB 1AQKH 3Q2DA 3TIEB 1XM3A 2OV0A 1JD9A 3B0UX 1OSZB 4G71B 1LOLA 2H2PC 4WLCA 1T04A 2ZUUA 4UT6L 2BIPA 5HHNA 1HCVA 3W6YA 2VR7A 4TNWK 1X9UA 5AYZA 4HPOL 1SY6A 4L4TA 4ZW6A 1TLMA 2QTVA 5D4QA 1E9YB 2DQ6A 3DXAE 5IROA 3H9HA 2OLAA 3BFQG 5ANHA 3S3JA 3HRZA 3NP3A 1BPVA 3VFLA 4BFAA 2BS71 3JV0A 5C0FA 1J7VR 3UYOD 2X4OB 5JHDE 4AUYA 2KHAA 1NLDL 4D3CH 2J4WH 3G22A 1F3EA 1R86A 3V0TA 3GNMH 2YPVH 2NY4D 4C6BA 1HHGA 2H3BA 4M8QB 1VGEL 2A9BA 4H9XA 2VM8A 3OG3A 1DWIM 3US0A 4KJWD 4Y4KB 1QP1A 5FF7A 1CECA 2VO5A 1H5BB 3S0CA 2J12B 4HQQL 4Q14A 3Q2WA 1XCTB 3T5WA 5DMNA 2AJUL 3ILPA 5C2UB 1SF3A 2G0WA 4PSPA 4PV8B 1GOKA 4MNGA 3HCVB 5FF6A 3O6YX 4NBYB 3UYRH 4XNBA 1AIZA 2R0LH 5E99H 1FH2A 4ZUSA 4IMLA 2J6XA 1E7VA 4EI5D 1GOQA 4EXPX 1YPXA 4WCYL 4O28A 5KITA 2OMBA 4MSWB 5HGAB 3SB3A 1SW0A 4A67A 1JOIA 3GZ3A 3MLRL 3VOJA 3WIFB 4UIKL 3LA4A 3BVUA 1VBUA 4YXKL 1Z69A 3Q5YA 1CTOA 1XLCA 4XOBA 1CPUA 1JCVA 3L3HB 4FJYA 2VLKE 4HV8B 5B38G 3ARDA 2EDNA 1MHEB 1JP5A 2BSSB 1U8HB 2TRHA 5C70A 2G9HB 4NM8L 2UX7A 4HBCL 2GQAA 1YYAA 3TYUA 3LM7A 2PWGA 1NICA 5SWZE 5EUOF 4GRLD 5CLZA 5FA4A 4RJEA 3N43F 3VG0H 1MN4A 4BH8B 2R0WH 3FQXB 5TQ0L 3SKNB 4PY8I 4C6FA 4S39A 4YL4A 1E27B 4YLWA 3IVSA 2AK1L 2X4TB 1A6PA 1BQHG 1SYTA 1JGEB 3BUQA 4NLHA 3S9DB 2UZXA 3TFBA 3NEOA 3W1XA 5GS2D 5LNGA 4RGMB 3FT2B 2EPLX 3KDMB 4GO9A 1BFNA 3MLXL 4LLDA 5BXRA 5MHSE 4G7FA 4HYWA 4ZUVA 5D2LE 4HSQA 3CK0H 4KEUA 3B0XA 3GPSA 1E7UA 1US2A 4P59H 4XO6A 2P8CA 1A7OH 3OAZK 1V0NA 1MW1A 1X5GA 3ZHDA 4NYLA 4YHLH 2O26U 1CXFA 2PMQA 5I30H 2FJHB 1LNUA 3GMNB 4ZSOB 5KVEE 5HMDA 5L4MA 3AHZA 1CI3M 2WK2A 2Z1WA 1N2RB 4J3XA 4V28A 3NRQA 5CJNA 5FYKL 1USZA 2V0AA 3RA7L 5I6XC 4JQ4A 2XQ0A 4M24A 5DVPA 2GITA 3F83A 5IQMA 2ZOLA 4JFQA 4P5TA 5KVGE 1AYRA 1VZHA 4HDIA 2PD9A 4DLMA 5JW4Q 4LMQI 2F7QA 5ESQA 2PWDA 3VXNA 1WFOA 2KMWA 3TJPA 2V37A 2W9EH 5ESVB 3CVHL 4I8DA 4PUBH 2X4PB 1NAKL 1TIMA 3A23A 3UC0L 3DXAA 3IARA 1KGCE 3VVWA 5IJCC 3VFGH 3QR3A 5C9RA 3N19B 5AZUA 3AIBA 4ZCWA 4RX4A 1F07A 4L29B 4L4TD 1TB3A 4ROQA 1SLVA 2EIBA 5IROD 2VLJA 1JAEA 2ZKYA 1DORA 4NHCL 5L88H 1QO2A 4HIEA 2BP8A 2OS7A 4UT9L 1NIEA 2DPEA 1ODZA 1U8NB 5EU4A 4F91B 4CSSA 1P4LA 3MZTA 4K36A 3FQUA 3NZGA 2UXFA 2PBOA 2Z6JA 4DGUA 3IGUA 4DQOH 4IK7A 5C6WH 2P3ZA 2XY2A 3B3BA 3MUZ1 5DCCA 2QJJA 2R29H 1XV8A 5KSBB 2VSMB 2CNZA 3BW4A 1MNNA 2Y7EA 1AJ0A 4QYAA 3F7PC 3VXRD 1TYRA 3BK0A 4I5XA 1PWLA 3CHEA 1Q8MA 3F01A 3NO1A 3DIVA 3K81A 1F1DA 3G1FA 2BY1A 1BF8A 3SKOB 5E51A 4FXKB 4YQXH 4L1XA 4DWSC 2NX9A 2V2TB 4S0TD 1BXXA 4LB4A 4KO7A 1VF5C 1EA0A 3BZEB 1I1RA 3F7KA 2P8LB 3CJJA 2XNAB 3Q8FA 3WTYA 4Y5XA 4OAWB 1E3XA 4D72A 1RUKH 4JO5A 4KHTL 1UC6A 4QRNA 1LHZA 3IIOA 1E5JA 1OGAB 4QD2E 1YMMA 4OLEA 2O7QA 2EADA 5D1QE 3GKAA 2Y1HA 4RDBA 1F4WH 3LH2H 4FFYA 4IFRA 3UXFA 1JAKA 3PHAA 1RPXA 4JR5A 2ID5A 4N8UA 4Y7EA 1M7OA 2Y3AA 1RZGA 5IQ9B 1P7KB 3T4YB 4A1RA 5LHFA 3AUWB 1A5OC 5I09A 2R1WA 4OCNC 1MVUA 4AC1X 3C8FA 4DCQB 3C8KB 3CFQA 4QKXB 3V0AC 1DSYA 4IQLA 1KXQA 3QBTB 4XTRC 1MUJB 5DS8B 3ZL1A 4ZB5A 3GMQA 1AS8A 3UF9A 4JFOA 1IEIA 1MWAA 1SF5A 3TDFA 4NSKB 1DQLL 3QI9C 2FNBA 1DTUA 5DMYA 4LSVL 1JUBA 3W0WA 2E46A 3BVXA 2B2XH 3SCUA 4QRBA 3HI1A 3OR6A 2WYHA 5FKAA 3H2AA 3RI5F 5AYQA 3GKWH 4AM0A 1KOAA 1Z6KA 3SYPA 2MPVA 3H7RA 4JL2A 3W7IA 4XBEL 4GXVL 4HUCA 2GB2A 1HSBB 1OCJA 2UZIH 4BM7A 5E56A 4LXFA 1IILE 2WB7A 4F37K 5D5MB 1XLIA 4Y1AB 2W3ZA 3WQVA 1MCKA 3RWIB 1ZA3B 2J6EH 1MFDH 4DPBX 5TE4H 2H32B 1YPZB 1E2VA 4AG4H 1KCRH 1EZUA 1QLFA 4GAYB 2ZICA 5IEHA 2DVTA 3MCKB 1RJYA 4ROPA 3RRQA 2BASA 3ARZA 5IHUL 4R4ND 1JZ8A 3D06A 1M53A 2NRDA 2QR6A 5HJBA 3D8MA 4NO5B 4W8LA 1IZKA 1NGYB 2NY3C 3D9AH 3VXPB 4LOCA 3BGJA 8RUCA 3V6OC 3QUXB 2QVIA 4ACYA 1UG6A 5LGJA 2VSDA 1ILSA 4HQVA 5HVGB 1CX9A 2B1OA 4P23C 1YN7A 1ET5A 3DXAD 4J1UB 3S35L 3UQNA 2DMKA 3Q2LA 4ECLA 2GJZA 3VXOA 4RPQA 3L1EA 2WQSA 1VADB 5JHDD 2P3EA 2EPHA 3APMA 3Q3GB 3W1ZA 3LHZA 3MBXL 4ZFZB 4AUBA 5M17A 2VEMA 3WNNA 2PXYD 3UFYA 1FL5B 3T09A 3ULVE 1S5TA 3JTBA 5SV3A 3ABGA 1TV7A 3WNPA 5C5YA 4HS6A 3W27A 3KP1A 4CQ8A 3RCMA 4GC3A 3LTYA 5IVZA 4DJEC 3FFCE 3WYZA 1KJVA 3HQNA 3B40A 2EVFA 4OV4A 3KFTA 1V6UA 4HC1A 5FCUH 5IMOA 1OHLA 4GIPD 5JPMC 3PP4L 1M01A 2BIMA 2HJFA 3CU7A 4XX5A 1ICPA 4LLQB 1B54A 2XZAL 2V38A 4APXB 4FIRA 4G1MA 3RFAA 1TTIA 2BK8A 2GUYA 2ZAHA 3HTWA 4POUB 4PG2A 4XAZA 3OD3A 3PJWA 5J5EA 4DBEA 5I71C 1TE6A 2V82A 4QE5A 3GC5A 4AXWA 1FHUA 4XBSA 4XOCA 3ZL4L 1QTWA 3AYTA 2VLKD 3RYMA 3GD1C 3MJGX 5CHNA 3EMCA 3PK7A 3CLFL 3IACA 1TX0A 4EN3D 3W7PA 4C57C 3HG1B 4H1LB 4P4KA 3AACA 2GWNA 4NKIH 1PZAA 1K4CA 2G8ZA 4G56A 1HOCB 4QXUL 5SWZD 3ZDZF 4RV3A 4P0DA 3QULA 1RZJC 1F2JA 4WD0A 3QIWB 2MOGA 3HNTH 1PW3A 5ICZB 4KKXA 1FOBA 3OYZA 4JN2B 3QMTA 3PQYB 5LKNA 5FM8A 4ZMAT 3RG1C 1XLKA 3EYSH 4S0HA 3SBRA 3Q5OA 2DQWA 1NCCH 4AG0A 2XDFA 3O9WB 4GUHA 1U1JA 3RPBA 1AXIB 1LL6A 1S4IA 3VK5A 4BWLC 3NJGA 3S96B 1EMTL 1MCFA 5MHSD 1GPFA 1QBLH 3FT3A 4PBEA 3BVNB 4F58H 3BG9A 2FWLB 3CE1A 4WHCA 3CQHA 4XPHL 3O4OC 4QJ5B 3MV01 1MZZA 3LS5H 5CP3H 1V7NL 4EPSA 2DWSA 2R2HA 5LIYX 4P46B 4CC4C 2MQCA 1U8KA 3X13A 1YSOA 3SCMB 1RBOB 2DI8A 5JIWA 1JGVH 4OJDH 1FNHA 4E9VA 5I28A 5AC6A 3D12B 4Z8FL 1V79A 3W2JA 4J8RB 3GIZL 2N3JA 3JWDH 1OY0A 4V15A 5KVEL 4CVZA 2J2ZA 3FJNA 2P8BA 2I32A 5FX3A 4JFFB 2Z26A 1EJXC 3MQTA 3AAZA 4ICMA 4XCCH 3IDMA 2VWSA 5K4XA 1FVEB 4M6OL 3WMCA 5FB8A 2H5UA 2EYSA 5E4OA 2FPVA 4J4KA 2A85A 3S9YA 4Y2DD 1SSGA 3F5WA 1XF2B 1KGCD 4HD5A 4NQVB 1DIDA 3LKOB 5AOZA 3AHYA 1EWHA 5CSSA 4YBQC 4MNJA 4JY6B 4K9EH 5JO5A 1GY2A 5F1KC 3P74A 3IKKA 2BW4A 2XRAH 2MNRA 1G0CA 5FJUA 3OU8A 3C09B 1U95B 3MKKA 5F1IA 1TRDA 1SBSH 4M7JH 4Y9FA 4I2XA 4XAFA 1W56A 3UY8A 3VFOB 4PWHA 1LQBC 1B0GA 3G6DH 3CMJA 4ZFQA 5EC1B 2WQVA 1OXYA 2ARJQ 3L95A 5DHYB 3B3IB 4JL1A 3WMQA 4PJ9B 3FFCA 3KYKL 4HKJB 3BP4B 4OFVA 3FB8B 1HJQA 3T77A 2W60A 2OMUB 3QC3A 1MNUH 4LUIA 3N41F 5C71A 3ITYA 1RUML 3UTZA 3H42L 3AU0A 1IARB 4LB8A 3KWWA 3DI3B 3S88H 1QWGA 4OF3A 3U9UB 4QEGA 4HZ8A 4QT5B 2VGIA 3OWRA 2FT6A 4MMZC 1QVOA 1SFHA 3DGCR 3M43A 1UC5A 3M1BB 3TL5A 2KDGA 3ARVA 3NN8A 3W71A 2HPMA 2J5LB 3WQ6A 2AXFB 3WQ8A 4JHVA 2QCGA 2F8XC 1C91A 1DFXA 3WQPA 2QGBA 2BHZA 1NCDL 5D1QD 2JEPA 4MKTA 4KXDA 1RERA 3GMPA 3HHRB 2BGNE 3PABB 3ZZSA 3KPQB 2C18A 2EG8A 5G2NA 3I9AA 4YR6B 4UM8A 2KZKA 1P5VB 4MQXD 5I17A 1U2HA 2JQAA 4REQA 4M6NH 2EUZA 4QNPE 2KC0A 2ITEA 3MRCB 2QCNA 1RZIB 4MBOA 1RCQA 4ZDHA 1D3CA 3MBDA 2BX7A 5T5NF 1IXPA 3SB0A 4AEFA 1NAML 3O2VL 3UTTA 4P4KD 2Y6SD 2V30A 5CCKH 2B81A 2CCLA 1YX1A 5JMUA 4MGGA 1L9OA 4GY4A 1NFDB 1A3LL 4BKLA 3DGGA 5KSUA 2KH2B 5GVJA 1KFGA 3LMJH 3QRBA 1OG0A 5IT2H 1KR0A 3M0LA 3VACA 4JLRB 4POZD 4R3SB 4JQ2A 3LTVA 5I1DB 1TA3B 2N0KA 3A9IA 2OL3L 3MJ9A 1LQ0A 4ZFOB 4Z2LA 3V5HA 4Z2GA 5C6PB 5C1MB 1L9SA 4ZZKA 4RSYA 2JGQA 1IQWL 2NW2A 3KAOA 1XHGA 5DDHB 1RUAH 4KAQH 3HHSA 4R85A 1K85A 7ODCA 4KNUA 2ROXA 4ANWA 5BV7H 2QLYA 2VAJA 4MAVA 1F86A 1DBKL 4DUVA 2KKQA 3P9LB 3K2KA 1A7PL 4U05A 4B0MB 1HHIB 4G7EB 4ODHH 1ACCA 2CNYA 3V6BR 4P2OC 2ZPKH 4I5BB 1GG0A 3GSRB 5LNEA 1I9RL 4XVTL 1FA2A 3OGCB 4UTHA 1FWCC 5CD5D 4KWSA 1ETZA 1B90A 4I48A 3X12A 3LKQB 1U9KA 4MVBC 4M93C 5MEPA 3LGGA 5CJQH 2K4AA 4OI9A 2Y5QA 4CRPA 1XH2A 5I73B 5GGRY 5GS0L 1IM9A 1IWBA 3RX3A 3ZDZE 1KNOB 1XIWD 3KLAB 1KENH 3KPSB 3ZDWA 3TN3A 3ML8A 1YNKL 1TG8A 2HFEA 2CZFA 4X7EC 4KNSA 2EBNA 4US6A 2W9LA 1EZVX 1NINA 3U0TA 5EN3A 4M3KB 4HWNA 4HTBA 3QEQB 4OCMC 3FB6B 5FXCH 1MO0A 3WLJA 3ARGD 2NVDA 3ZXWA 5FECB 4PRBA 3SCTA 2A3LA 3URBA 1TWWA 5CWSA 2NXYC 1TVBB 5L7XL 2C15A 4FFVC 1HGWA 3DUUB 3EJPA 4OD2B 4GI4A 3KBJA 3MNMA 1BQRA 2VCBA 4BQ3A 4QRAA 2B59B 3ULVD 3G1SA 4EF9A 1NCGA 3BZ4A 1ET7A 4K39A 4NNPL 3L4ZA 3MBED 2Z64C 1NBYB 4UDTB 3FFCD 5DFVC 3FO1A 4O00A 5BU6A 3QP3A 4RDVA 4AVFA 4Q8UA 3R11A 4LNRB 4QXTB 5K33A 3MYZA 3LMYA 3TEXA 5KYUA 1ZT1A 3CMOH 4DO5A 3G6JA 2X2UA 3RHWF 3WKQA 3QDHA 2P52A 5E2VL 5K9KA 4MG4A 4X6CB 2K9FB 3L5WA 3OR7A 2DB8A 3EOYG 1CL7I 2YBUA 4X4ME 2I07B 5F6IC 1W9VA 4XVUC 3H9YA 2G75B 1T4WA 2YZ1A 1AY1H 3G5ZA 1IL1B 4PI0A 1DIEA 4JHAL 1UQSA 4GY1A 5LNDA 1S7SB 1MCEA 3L7EB 1S9KC 1BGAA 4UWQB 3W2NA 3A4XA 3V16A 5TPWH 3DX8A 4CC1A 4AYGA 4AZCB 2NXZD 4PJBB 3D07A 1U8QA 3L9RA 1MQQA 4HAGA 3G2GA 3WD3A 2A6IA 4G8AC 4HIHB 4KMQA 5FW7A 2DLFH 3CQJA 3HZYB 1YBQB 4BZ2L 3BLDA 4UTLA 2IIJA 4XMLH 3AIRA 4FQ2H 2OJPA 4GKNA 3VI3B 1F6KA 2NR6C 4F0SA 1SQMA 2FVMA 1EV2E 4Y89A 4DF0A 4WHDA 1DP0A 2RFXA 3SDAA 3VIKA 1BYDA 4GUOA 4BD4A 4PB3A 5DR5L 4DPAX 1CZ1A 3UACA 1NH6A 3O3EA 3T65A 4Q9CA 3ZTDC 1BJ1H 1R3YA 1N4XL 4L0ZA 1U3HD 3EFDH 3OP2A 4X6DA 2NY5C 3PBVA 2GDVA 2VENA 4LUTB 4GUQA 2JH2A 1L5GB 3CDGA 3DX9B 3QNFA 2WKJA 1KV7A 4DKTA 2YLKA 2V3GA 5B1CA 4I18A 3ASWA 1MAMH 4H8UA 4KCTA 4HN4A 2PWVA 4Q6JA 2FD6L 3SY6A 4N90D 4A6YA 3XINA 3U30B 9CGTA 3WZ0E 2QCDB 2Z35B 2A5UA 3RDTD 1UD4A 1WOBA 4IL2A 4ODUA 3MUGB 5JIMA 5ESAA 4BS0A 2CIKB 1QEXA 5CPMA 2ZP9A 5C0EB 4Y2OA 1QFWM 4B5ZA 1FYTB 1WRFA 1YMHB 2DH3A 1QMLA 2HK0A 5C0AA 3F84A 1ADDA 2ISWA 3G5VB 4QF1A 1IM9D 4ZS7H 3IIXA 4ES8A 1KXTA 2A6KA 3E12A 5H94A 3VH8G 1C8PA 1K9DA 1HNGA 1OT1A 4Q9RL 4PWEA 2GGJA 4CJ0A 2DIKA 5HGGS 2ZUQB 1O6IA 1XIHA 4HPYH 4ALAL 1T2QH 4UFJA 4LVNB 1Q1PA 2JXMB 1E65A 2GGGA 3UWVA 4NZUH 4IGBA 4BWTA 3CUGA 1UJQA 5BS0E 2XGBA 4JAMA 2D2CC 3V3WA 3BX7C 1EOMA 3ECQA 5HULA 3FNKA 3OHXA 1ZBVA 3BW3A 2G3IA 4BSVA 3S3GA 2HB0A 4R27A 1RCXB 4HGXA 4ORGB 4R88A 5DD0H 3OPSA 1SYVB 4MY1A 1T22B 3U36A 1SDAB 4ZX6A 1S2TA 2V6AA 1AHKA 2ZCLL 4RIRB 3WQWA 2PP0A 1M03A 1GQNA 3DTXB 3J27A 1JL8A 2LTQB 1G5GA 2ZD0A 3S8HA 5CEZH 3X2QB 2DDXA 5D1ZC 3VE0A 1G67A 2LU5A 1I75A 1UASA 4U1LA 3MV9E 3RPMA 2C9VA 4KHXH 1NIDA 1LO5B 3JVGC 1RZKH 4R7VA 4YHNA 4ZAKB 4BV1A 4FQCL 5DT5A 4K8RH 1OTUC 4IMKC 2YRPA 5E9DA 3UU0A 3FONA 1I9IH 2E5CA 3UG5A 1RIUL 1K6AA 1RUPL 4GKSB 2W0KA 3D85D 3V2AR 1QQDA 4RGNB 2WZAA 1T0NB 2F58L 2I85A 3L3OB 3L1OH 2PE4A 3WH9A 4GQZA 1VFOA 1JXDA 1MFBH 3VWJB 2C1GA 3WS3B 1OM3H 1RLBA 2DQCH 3TIDB 4F57L 2V4LA 4DJFA 5JHLA 1V54B 5DY2A 1Z5LB 4DGIH 1FH9A 2DZAA 1TR7A 4TUKH 4PTMA 3TJHD 2BFVH 1UR8A 2XTJD 5E2WH 1DQQB 3UCDA 4A04A 1TUXA 3ZYIA 1H1ZA 2I24N 3VI4A 2FWOA 2R2BA 3WLBA 3LKSA 1I8JA 4UU9A 3Q58A 1DLFL 4PJAE 4NGHH 4GXUN 2VZ3A 4IDJH 3LM3A 5IXEA 2YEZA 3GTIA 1WWCA 1GZGA 4RLIA 1NARA 4GIYA 1U93B 3SD2A 3GXFA 5DZOA 3XISA 1S9YA 3AWOA 5JVLA 1D8WA 1NEYA 4BK4A 1YEDA 4YNGA 1OX4B 4A2SA 4Z7WA 2XVNA 4LHUA 2J27A 2C3HA 3FCTA 2QFRA 3RWHA 1K8IB 4OVXA 1Q6CA 3L3GB 1JERA 3OKLA 4QWWD 3RUGF 2XWTB 4BF5A 3PPGA 1LWJA 4EIZC 3EO1B 5BPPA 1Q3NA 2YPLA 4NQCA 1TQCB 3L21A 1MI5E 3STZB 4OJFH 4MPQA 2NXGA 8PAZA 3O3AA 3VFVA 2PF8A 2R91A 3MMDA 4PE8A 4QR7A 2ACRA 4RR4A 5IQ7L 4BA8A 3P0GB 5ICYB 1AI1H 1C8QA 3WLMA 2CBVA 5F7MC 2Z93B 5AVNA 4FKKA 5CO1A 4UOW0 1QWKA 2ZOOA 5CBAB 4ZW5A 4DF9A 3D39A 5I19L 3P9WB 3WQ4A 3QCTL 4ZOEA 3KPRE 4EBQL 3LZ3A 3RB7A 3LDVA 3THML 5DQ9B 4NXSA 3NQ8A 3VYLA 3WIIL 4K23L 5LQBH 3L65A 4HJTA 4XPFL 3QYQA 4GGHA 4LASL 4KPHL 5EMMA 1BYCA 4AL8C 4IGBD 2UV8G 3RWFB 1YQVL 3RL2A 5IM51 2WMPA 1LD9A 3HAEA 1DO5A 1FZJB 5HPMB 4D0DB 2NYYD 2O0TA 1GTNA 1DVJA 4AQAA 3QG6A 2UWEB 1BXAA 3MY9A 4PBWD 3V4LA 4JJ5A 4GBXC 2HFTA 3A21A 4XNAA 2GYSA 5ECGA 1F90L 4AYID 2XG5A 4XC1H 1SEBA 3IGAA 1H50A 1P7QB 4U4BA 2B9AA 3D1MC 2NZ1A 3UOAB 5BW7C 1O5XA 3T9WA 4Y16C 2J25A 3H6OA 2D3LA 4ZX3A 4LLWB 3R4DA 4H0LC 3F7JA 4MAYC 5D70L 1ITQA 4IKKA 4RLDA 5F3BB 2AJXL 4AWJC 1OD0A 4YIWA 1MWOA 1HIMH 5DEGB 3EGDB 1O9VA 1OPGH 5GRXG 1NGQH 3W1RA 2VXUH 2OT1A 2P45B 5G5DA 2G5UA 2X4RB 1HJUA 3W6LA 2QZRA 1RVFL 3C3UA 4PCPA 2DSUA 4B15A 2IH1B 1H7NA 4BFIB 2VDNL 2ERJC 1RZPA 5A2JH 2B4CC 1NTHA 3E9UA 4YBLB 2GCYA 3GC2A 3H0TB 1DUZB 3QXUA 2CERA 4BBWA 1P9MC 3QGKC 5AHNA 4JRYA 2FTWA 1E4WH 4JVPA 1TPDA 4KO9A 2JKEA 2R8SH 2IDTA 2AVGA 2EDYA 3T6VA 2C4XA 2D8KA 4IPPA 3IJ6A 3WKML 3W01A 4IIHA 3LCHA 2DQHL 3OAYH 3V0VB 4KTEL 3UEZA 2OTUB 4F2MA 4U6XB 3V0SA 4PTTB 5GISH 3IWVA 5CJXA 3DBPA 3BG5A 1A66A 5DRCA 1HHJA 1XLAA 5FYKE 4X4KA 2OK0L 4YFDB 4PAZA 4B50A 3IRPX 3GBNH 3SQLA 4WY7L 3VW3H 2PC8A 1UM4L 2G37A 4P3CL 5FGBC 3LQAH 3ESVF 5EU3A 1QFEA 3H24A 4YSUA 3MZNA 2AQ3A 3DKHA 7REQA 2QAPA 1PTGA 1OALA 4PLJC 1M7JA 4GAAA 3B9OA 3NJJA 3LHWA 3V8OA 1T5WB 5FFGA 3IS1X 4Z7QB 4OFKA 4QO1A 3SDYL 1T40A 4UQIM 1JPDX 4Z7UB 3AS3A 4NQCD 2Q86A 2A6NA 3OODA 4QXWA 1A0QH 4G43A 5LN4A 3TA3C 1B4KA 4OCWL 5TQ2H 1VJIA 1FORH 2R1KA 3HGSA 2XIIA 1KEMH 1KIUB 2ZOXA 3W29A 2VJ8A 3EMZA 3PDOB 1ZHKB 3RKPA 3KEDA 1QYGL 3ITLA 2IWKA 3FYIB 2E7FA 5DHVB 1K4DB 4IIFA 5EZJB 3RX4A 4MFHA 2GDUA 1IBFA 5BS0D 2Y1VA 3VFUB 4ZS6D 3QORD 3TO4D 1RK1A 2O5YH 3JZUA 4MDOA 4AJVA 3HZ3A 2C4FU 1P5UC 5EORL 1EA9C 2FTYA 2GBUA 1R5VB 3V36A 3KS0H 2OMZA 4X2PA 5CPSA 1DDHA 4LVOB 1RY7B 3DFQA 4GW4A 1IFGA 4GOSA 4HGWA 3GSNA 4Z7NF 1VFBA 2P10A 1MCPH 3V18A 3B9KA 1ED3A 2VWEE 2Y8VA 1JPTL 2G2RA 2NNFA 1YZZA 1SNRA 5JLZB 2J8UF 2F15A 4EI5A 4EDWL 4A29A 2FJGB 4AJWA 1RV6X 3GNDA 5I6NA 1DL7H 4W4NA 3MV9D 2P76A 3AYVA 1D6EB 2C1PB 1YN6B 4E36A 1AFVL 3MMTA 4KKAD 3T6QC 2IJ0C 1XMWA 3GSWA 4D0BB 3G08B 2VVSA 4O8RA 1JCYA 2JIXB 3PFMA 2Y89A 5D6CB 2Y06L 1X8FA 4OSUL 12E8H 2BLEA 2HFGL 1G9NL 3O0FA 5D7SH 2E27L 2LR4A 5C2XA 2Q8XA 2YAFA 4ZZFA 2CHZA 5DUMH 1W3NA 5I0XA 1G7MB 2VDPL 5GRJH 5C0BE 4H8WC 1V6VA 3ZGHA 3LEVL 1DXEA 2OZ0A 5I0WA 2VDRH 2JKAA 4WFGE 1RU9H 3MREA 4TMPA 3VB8A 3I6KB 3UR7A 1X5MA 1VIWA 1QK0A 1KB3A 4K7FB 2QHAA 2FNWA 5I1AB 1E0OB 4DTGL 3OAZH 1JG9A 3KBFA 1UZ1A 1ITCA 2FGZA 2EDTA 5C07E 1SXSA 4YK4B 3LNEA 4EXQA 3SPGA 5DVLA 4PTWA 4NASA 4J23A 4QJ1A 2DVXA 4V27A 1AGEB 1OTTC 1T1YB 3ZR5A 2CLRA 3ROLA 1MCJA 4WGHA 3CUJA 4JO1L 2X7VA 3PULA 1A5KC 2ZRVA 4JCMA 1B9KA 3US1A 3EH4B 1QLRA 3UJIH 1U5HA 3VOCA 4O4YH 2AQ2A 1R9FA 5I1IH 3CVHA 2HSAA 2B0SL 3RIFF 3WFBH 3UTQB 2GJ6B 4X7SL 3BSZH 4FQXB 2VC2L 4B9CA 2Z3FA 3UGVA 4FR6A 5BXPA 3FUEA 2PTDA 5I8EA 1HH9B 1MI5D 4EF3A 4GXMA 2FX9L 3SO3B 4WOZA 2D0HA 5H4YA 5CZVL 5FYLH 4NWUL 3SGDH 1SJVA 3WH5A 1PFCA 3BIKA 2GUOA 1VR6A 1TR1A 4HU3A 3OMZA 1KIRB 1GW0A 1QNZH 1S6NA 3AZUA 4Q7DA 4UT9A 1ZLSH 1Q7QA 4D8ZA 5J6GA 3KPRD 2ZNXA 2BODX 2V2DA 5AAWA 2WCAA 5DXXA 3CFJA 5DJXB 3T3MB 4U3AA 2C3VA 4WV1C 3BDXA 1JCTA 1WB0A 5DK2B 5F7WC 2H3XC 3POHA 1C16A 3NQDA 2D9CA 1TE1A 3F5JA 1XBVA 5F72S 2VXVL 3GHTA 1BFSA 3RWCB 3BE7A 2CK2A 4YYFA 3CDZB 2N59A 3VGAC 2A3BA 4HVXA 3T8XA 2OR8A 5U4NA 5LGHH 1I1AB 4ODWB 3VXRA 2AQVA 2VLLB 1MCHA 3QYCA 4YWSA 4XP6L 2E9IA 2HN7A 3GSUB 3GJEA 5FO9A 2HV5A 5AYXA 1ZLEA 4PJHA 3SGEH 1T21B 4N2DA 5C2CA 3KS0J 5ISZE 1ZHBB 1VP5A 1DFBL 5AZ2L 2VOTA 1W1ZA 4BK5C 2WLZA 2EUVA 3IMUA 1UJ3B 3B9KD 3FN0H 1F42A 3ANUA 3KLQA 4E4UA 3FJTA 2EZ0C 1QKZL 1EEYB 1VPOL 2G0KA 3QIUA 3UG4A 5M03A 4K3JH 1CGUA 4PJGE 3NA8A 1II4E 4S2SA 4RMWA 3TBWB 3LNIA 4V1DB 5DLML 3QFJE 3VFRB 4P8QA 2VISA 5CJOH 3PUOA 4DPPA 4FQLL 2INEA 2I5YH 1OC6A 2J55A 2VAAB 3UT0A 3WUZA 2A6LA 2WUCH 4ZNEE 2VRQA 4H6QA 3ESOA 4PR5B 2GBAA 4PREB 2FRGP 3QO0B 4UTTA 4WNQB 2HMCA 3HBZA 4JZOB 4LBUA 3ATBA 2BP3A 4S3JA 1BX2B 3APDA 3KPLB 5AYTA 4Q3MA 5AD0A 2VW4A 1RMFL 1E5YA 5C8JA 4LX4A 1UM6L 3W81A 3K2UL 2I9UA 4APQC 3JTSA 3HI6L 3WFEH 2AL2B 1JWMA 4HIIA 2YAOA 2YKKA 1KB5L 3CUPB 4G7SB 3CXHK 1BVLB 3D51A 5KS9A 5JU6A 4DJDC 2A74B 4DVRL 1PPIA 3QNXA 5ACMA 2L4OA 2IFFH 1OGPA 2CR0A 2QQQA 4XSMA 1SM3H 4ZVJA 1I31A 5DTFA 2E09A 2H4EA 5IG7B 3NT0A 1XF5B 5FYKD 4QTHA 4DGWC 2Q7NA 3V4VB 4G6JH 2JI3A 2CLMA 2IV9A 2MFNA 4LS1A 3QDGB 5DK0B 1RY8A 4AQ8A 3D2UD 1PCWA 1VFHA 1M6JA 4WSGA 1QPOA 2Q6WA 5ADOH 1H3PL 5KZDA 1CWVA 2Q2EB 2XT1B 1R3IL 4K0OA 2HPTA 4CN6A 3VXSE 5FESA 3REQB 1F4XL 1LO0L 1QEWA 3EOBA 1THCA 3EADA 2F53E 3HR6A 3B05A 4K3EH 5DMGC 1G0YR 4U3CA 1I3RA 1F6PA 3L4YA 4DQAA 4PRAA 4JRXE 5I66B 3KS5A 2H1PL 3NIDF 2FYYA 3CWGA 4HU2A 1CICC 3WHXA 1JF6A 1Z42A 1I8IB 3BICA 4LYKA 4LLMA 5JHDA 4E9WA 5IHZA 4MXVF 4R7LA 3VM7A 2XQBH 3DI2B 3F4DA 1TDQA 1Z48A 4F7CA 3IF1A 1VGKB 4U10A 3O3RA 1HGYA 2PXYA 1PLBA 5CAHA 3BKCL 4QY8A 5GGVL 1R34A 3TVMB 5LNUA 1ND0A 4JBRA 2BOFX 3UJTL 4GNVA 4TUUA 1C3FA 1ZEAH 4CQAA 3G6MA 2D31B 3B3DA 4JZJB 3SE8H 3IJEA 4EUPB 3A4FA 4UIMB 2CC0A 5LAXB 2Z1KA 1S1PA 2VD9A 5JQ9A 2NVAA 3UP8A 2ODOA 2RDWA 2LT9A 3ZE1B 3OOQA 3N40P 3WLSA 1XCFA 4GI6A 5FAAA 2GUUA 2BM3A 1QFOA 4TQEH 4Q8PA 2H8ZA 2FECI 5DC9B 4Q8BA 3MRHA 4L8BB 3UZQA 4WY0F 2OSXA 3TT3H 4M1DH 3E2HC 2VLKA 4L1GA 4JDVB 2IG2L 1R3LB 1A1OB 3QIUD 1K3IA 3WNMA 1Q45A 1OP3H 3UBPC 4HIJA 1PL9A 3SI9A 4EN3A 4QYOA 3NQIA 5JIIA 1ZNNA 3IDYB 3PU7A 1JV2B 2E6FA 3BWAB 3MHUA 4AYSA 5SWZA 1CLZH 2XKSA 4YDZA 1DTNA 5C0BD 1UUQA 3CN3A 1NKOA 4LUSB 3MUCA 4C5ZA 5CG0A 1KM0A 4WFGD 1XF0A 2EUWA 5I0VA 2A73A 4MZ2A 3GW3A 2D7NA 2CKBL 1GQKA 4DGVH 4PZVA 4ZSTA 4ZYKB 1HZLA 1W1A1 2FWUA 1AO7B 5ANMB 1T7WA 4ZW8A 1CDCA 5IZ7A 4CAGA 5J7CC 3GVWA 4JM2F 4NHUB 3FO0H 3A0OA 5D2LA 4LRSA 1GC1L 2HWZH 5C07D 2QUNA 4KCWA 5LZLA 1Z6JT 2QADD 1FAIL 4HUVA 2J21A 3D46A 3WO3B 6ENLA 1HQTA 3DHFA 1N59B 2BVWA 2ZRZA 3NIGB 4IX0A 2DJ4A 4M1GH 3GK8H 2GPTA 4L2LA 5IJDC 3APYA 3U4KA 1T20B 4AISA 5A8OA 4Q2ZB 1S7XA 4R5TA 4ACZA 1YE4A 1MFCL 4B7IA 3CC5A 3HC4H 3TX9A 3EA3A 6ALDA 3KPMA 5SWSB 1NDGA 3EX6A 1KCUH 5GSVA 1RZ7L 2VJXA 1IBYA 1NDMB 3PL6B 4EZJA 1OGSA 2DICA 5TDOB 4HAKA 3AJ7A 4BK8A 2F53A 4N8VA 4HHWA 2O4MA 3U2SA 1J05A 4Y2DA 5A2LH 2R0KH 4GUGA 4NM4L 4JNZA 1RBLA 1BWVA 2WXDM 2WMFA 2IMRA 3R8GA 1S5IL 1MUWA 5EUOE 5F8RC 1UFUA 1ZP4A 1J0IA 3HB3D 4PVBA 2AQRA 3QNZB 1DVUA 2YR1A 4WFEE 3CIXA 4GSQA 3GDTA 3FUDA 3WTWA 1CCWB 1EC7A 3HFMH 1BMWA 1FWIC 4XCNB 4GACA 3O0LA 4LEOA 1NF7A 2PDNA 3WLKX 3H23A 1IUZA 1W0VB 2Y6ZA 3WIHH 1NAL1 1HO4A 3U46A 3B8YA 4PU2A 3KPPB 4PJFB 4PJ8C 3VD2A 4IHCA 1OW0C 3B0VC 1S39A 2O30A 4DXKA 4RNRA 1YLBB 1S5WA 3LS4L 3QHTC 3H3KA 3TNOA 2F1EA 3PF2A 4EXKA 3NL3A 3CBWA 3TQKA 1I6NA 1SQ2N 4H8QA 1KPUA 1XWYA 1F6LL 5FKPB 5HNUA 5GGVY 3LRLA 2A99A 3RURA 4LEQA 1J96A 4PJEB 3CDFA 2N1KA 1OCOB 4BF7A 2GG1A 3BZFA 4B27A 1IC5H 1BVOA 1NCUA 5D1QA 2Z31C 3P30L 1S7RA 2VWTA 2IH3B 3T2NL 4XWGL 2JB5L 4WI7A 3PZNA 3UJ2A 3QNYA 3QFJD 3NIDE 2FATL 5KSVB 1NIAA 4OCRL 5JPNA 25C8L 3DESA 4WEBL 5E8EB 4GK8A 1NBVL 5AW2B 5HAOA 5BMFL 2AV7A 1YNYA 2MH4A 5E2JA 3W7OA 4JFEE 3E0LA 3H56A 3LQMA 2J88H 3HO8A 3D0LB 3WS6C 4Y6GA 4MD4B 5DQPA 1SMAA 3VTRA 1OP3K 4D0CA 1H7WA 1DBAL 3FULA 1Q0YH 4HZ7A 4ONHA 4E41B 3FT0A 3ZSSA 3O4LE 2CLHA 5BOFA 4PJXB 3WKZA 2C4FT 4LL9A 1P53A 5HI5D 2DD8L 2XZZA 3URAA 5HGHA 1MJUH 1EC8A 3L3DA 1POKA 5A5WA 3MFFB 4G8GE 3IFLH 3EXTA 2Y36H 4Y96A 1EERB 1UADC 6PCYA 3PTKA 4QIUA 4FG2A 1TWSA 2NCEA 2A0LD 1MEIA 4FQIH 1XGQA 4ZFFA 2NUTA 1EJRC 1UTDA 2VO8A 1ECEA 4NO2A 2ALDA 3OJMB 2FWSA 2VDKL 2OEJA 4KK9D 4O0KA 1YEJL 2XWEA 3L16A 2YYUA 3ONCA 3QZLA 4QS5A 1V6YA 1U30A 2Y22A 4NP4L 4OF6A 3F7YB 1HS6A 1H7PA 2UY7B 1KJMB 4NAJA 4NDMA 2QZQA 3L1GA 5B3NA 3V0GA 1XIWA 5A8GA 3ARWA 3JT0A 2F53D 1XGUB 4Q6KA 2J75A 1OGTB 3RU8L 1H7OA 2L7QA 5TGBA 3WJMA 4J1OA 3SE3A 4C91A 1VERA 4JRXD 4R7NB 3TYFA 2HKHH 1U1HA 1LOQA 3APCA 3M64A 4RAVA 2NLJA 2AEQH 4FP1A 1LM1A 2J62A 1A9EA 3ARGA 3KW8A 3GG0A 3GVRA 1E40A 3SGZA 3EFOA 1BOGB 4TOYH 4R26L 5CIPA 2B1HL 4XKYB 5AW3B 1N9PA 3GUTA 2Q76A 4NNBA 1MH5A 3MBEA 3LMZA 5GGSY 5AVWB 4KKLD 2WLIA 3MUAA 1JDEA 3PSVA 5A3IC 3GTNA 4ODVL 4L8DA 3APGA 1AFSA 2X1RA 4OM1L 5CC3A 2OX4A 1ITXA 4GQGA 2HJKB 3AWGA 4B3LA 4S0SD 1NOWA 3SUTA 4LU0A 4HETA 3IJIA 3VNZA 2Z4GA 2CJUH 1A4JA 3WDIA 3N40F 1VCBC 3JS3A 4FI8A 4OBTA 4QM1A 2WBJA 4ONFL 5FOBA 2OPCA 2YRZA 2X41A 3W73A 5TDPA 5K9CA 5FK9B 3Q67A 3S6CA 2WZHA 2G50A 4XMKH 1FQ0A 4BI7A 2VDMH 5HYQA 3OW1A 3SCPA 5FGCB 3QS2A 1PWMA 1O7SA 1QHQA 3CZFA 4LV4A 2C79A 2LABA 2XFYA 3TXVA 4F0KA 2J13A 4FTDA 2HEJA 4Q4EA 1HL4A 2A9NH 1UCTA 2ZAGA 4DHLA 3NCEB 4X5QA 5F2FA 4XWOD 1PLGH 1F8TH 4XVEA 1N5AA 3ENEA 2AZUA 2O5ZH 1DQVA 2WSYA 4TTDD 1E9QB 2ANUA 4XQ6A 2O56A 4XN1A 4XPGL 5IB4A 1HE7A 1XXXA 4JFYA 3ECBA 4G8GA 2NCMA 3HI5L 2ZUTA 2FJKA 2KYIA 4ACTA 3X3GH 1IKOP 3WNOA 1IBGH 2XXMB 3LNPA 4YX2L 4YLQT 4I0CC 3WLNA 1U3HA 2CLVA 2YJQA 4HUUB 3B0YA 1XR8A 3FUJA 2GEEA 1FC2D 3BL3A 2TPSA 3WXWH 4JKPH 4I5UA 1DVFC 2JKLA 3QXAB 2XFFA 2X53A 4TUOA 4M4PA 1W72B 4IS6B 1C8XA 5KANG 1FZKB 3C6CA 4M5TA 5DRWA 4EE2A 2Q7YB 2JKNA 1UR2A 4LF3A 3NJXA 3RDTA 2CJTA 5I1KH 1XGPA 3ARED 5GS0D 3MNVB 3QIBC 5DQDH 4G7YH 4GSDH 2C9QA 2X70A 3FQNA 4MMYA 3L9YA 1JUFB 2CQVA 3PAZA 3EH3B 1ECZA 2JIWA 5H1WA 3GFXA 4R7DB 1HXYA 1MRDH 4BXSV 3IDGA 1P48A 1PUDA 1CFQB 4KVNL 4KVCH 3P11H 3KBWA 1OYAA 3CEUA 1R9ZA 4XH2A 4KOCA 5IHSA 3SE4A 3FH8A 3IN0A 4WFED 2CUHA 1WKDA 2BSTB 4WU7A 2P42B 2JWYA 4QHUB 2VFHA 3EW3B 1GZ1A 3S5SA 4Y19E 4LIQH 2IAMD 4U7SA 2XH2A 3TA9A 4FGMA 4ZX4A 1P1VA 3BRGC 4NAQA 4CD8A 3MBFA 4WWKB 1PG7W 4AGLA 2Y7FA 4WEMB 2CDGA 1XLMA 1KV3A 4U1GB 2JCCB 4HEPG 2J56A 1G1KA 2G3ZA 5LDUA 5GGUB 4JFSA 3KYNA 5AHFA 1QTSA 3RWJA 2JF1A 3HPSA 4ZMTA 3RJXA 2AV1A 4M7KL 3BD4A 5BRZE 1E8YA 3HE6C 4L5FL 3S5YA 2ABBA 4OLXH 3BRFA 1IMHC 3QJFB 4LJ3A 2X2HA 1KJ2A 3HS0A 2J8OA 3HJZA 1AQMA 1RZJH 5AWNH 3I2CL 3NK3A 2O7SA 3R5EA 3GHBH 1A3RH 4N9DA 5C3IA 3VM5A 1GONA 4PWJA 4F7TA 2I60L 4URKA 3N6JA 3O6DA 1VLIA 2I5IA 4GBDA 1RJLB 3PXLA 4RA3A 3JWNE 1CGVA 4LARL 2WBJD 2MTAA 4DYJA 3D85A 5DGRA 3AROA 3GMOA 1R5IA