2QMUA

Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the gtp and the gdp states
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 78
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qmuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qmuA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qmuA01
1E2QA 3CX7A 1RFLA 4DLTA 4G5SA 1R0ZA 3TAUA 3UATA 3RWMB 3GP8A 1DEKA 2NO9A 4WZAE 5KDLA 1W34A 1NKSA 3CW2A 1I4LD 1W2GA 3IQWA 2DWQA 1YZKA 3Q8XB 3UMRA 3KXKA 1FDRA 1GAJA 3A58B 1COWD 3AV0B 3W3ZB 4WVFA 5JRZA 3B1ZA 2FV8A 5ANRB 2DERA 4M22A 5A5GA 2RGNC 1H42A 1FNNA 3AVVA 5BQ5A 1A8PA 5HZHA 1OXTA 3X1XA 3WP0A 1PUIA 1XEFA 3CH4B 4JT2A 3TR5A 4MGZR 3ICEA 2WOOA 2D7DA 1GNRA 2VA8A 2F43B 2PT7A 3EC1A 1NVUQ 2YVUA 3LQQA 1OV4A 3LW7A 2EYQA 3X1WA 2QTVB 4JBXA 4AKGA 2OCAA 3NBYC 5D3QA 4OHYA 3K1JA 3OZWA 2IYTA 3FMIA 2BMWA 4Q4JB 1OGJA 2BIFA 2JLXA 2ZJ5A 1R6BX 3AB3A 4AKIA 2FZ4A 4QFMA 4G01B 1K8RA 4OQLA 2FF7A 4Q7LA 5FI0B 2ZANA 3W3AA 4JLPA 2HXSA 1E9DA 1Q1BA 1YRBA 4NCJA 3RS4A 1E2DA 4JT4A 3ND8A 2VP6A 3EPLA 1E9CA 1MH1A 2IX3A 4KI0A 1Q12A 1IN4A 3IILA 1SXJD 5DO9A 2HT1A 3IBYA 2ERXA 1ZNWA 3GLGE 1KAGA 1XZQA 2QY9A 4WXRA 1E99A 5KUTA 4MRRA 2ZRIA 4BLPA 3MCAA 1F3OA 1G16A 4ZIRB 1M2OB 3FMPB 2OV2A 1P61B 2P5TB 2XNDA 2YJTD 2ZJZA 1CXZA 1XEXB 3QE2A 3KDSE 2AWOA 1YE8A 3NH6A 4WOPA 3T1OA 1KIMA 3GJ8A 1JJ7A 3W2IA 4PC7A 3CCRB 5EE3A 5DI3B 1E94E 3W2FA 1VQ8B 4JLAA 1ZM4A 4TLBA 1JR3A 3ADKA 5EP3A 5GV8A 4KJZA 3NKVA 5FFMA 4QGHA 5FTJA 1E9BA 5FR1A 3TKLA 3T61A 4LJ4A 5HCNA 4LYJA 2OAP1 4Q18A 1BYIA 4FMCF 1KSFX 5JMTA 1G17A 1BJKA 4XWOA 1L8QA 3VX3A 5J4KA 1TL7C 2OE2A 2YKGA 1QG2A 4BLTA 4UQOA 1ZU4A 5HPYB 1NVXQ 2FSFA 4MRPA 5FL3A 3DEFA 4NBSA 3AVOA 3CM0A 4B74A 1W36D 3RSLA 1U98A 4XD7D 3ECCA 4WIAA 4A0GA 3QVUA 3ZBTA 4FXPA 3ZZTA 2O8CA 2BKUA 1VCIA 2QSZA 1M7GA 3AKEA 1T8TA 2JJ1A 3O8RA 4Y0VA 2XXAA 5SZJA 5EP1A 1JAHA 4L5BA 4QNRA 4A2PA 1NBME 2A78A 4TMTA 1GM5A 3TVTA 1MV5A 1ZBDA 3B7GA 3QFTA 1G3IA 5BN5A 3WBKA 3U44A 4YAOA 2G83A 1GNPA 3EZ9A 5JFGA 3RC3A 1KO4A 1Z28A 3LWNA 3Q72A 1TEXA 1YR6A 4WZ6A 1IXRC 1HE1C 2QZ4A 4OI4A 1G21E 2QE7D 2QM8A 4Q1BA 4AG6A 4F91B 3CD6B 2XGJA 3LRPA 1EX7A 3ASYA 3SC3A 4B34A 2Q9AA 2ZR9A 4Q4HA 1MR3F 1H65A 1U0HC 4I81A 2DCUA 4JLDA 4TLEA 3TVDA 2V8OA 1KDPA 2QORA 4UNNA 5FR2A 1JR6A 2IYRA 4HZUA 2NO1A 5DYGA 3CO5A 3I72A 5G3YA 1Z5ZA 3W6PA 2JIZD 1JXMA 4XSHA 3S1AA 3GLIE 1II8B 4CEHB 2XNJA 1GIAA 3AUYA 3EA0A 1TPZA 1XXHA 1GOTA 4OYHA 4OI0A 3OZXA 1QUEA 2RCNA 3C5HA 1I2MA 4FCVA 4A0HA 2P5SA 3KQNA 5EP4A 2P65A 4D2IA 1G3MA 4B6EA 2RAPA 2GXQA 1N5IA 4JLMA 4ZGQB 4TTRA 2JAQA 1R8QA 2W2TA 3KJEA 1RIFA 1Z6GA 4IJMA 2IC5A 3QUSA 1ZIPA 3LQRA 2QP4A 3CX6A 4P31A 2HLDD 4CVNA 3T34A 5JJLA 1XX6A 3CNLA 4TLCA 3QEJA 3KQUA 2O8EA 3QKRB 4YQFA 2B7BA 1DBSA 3BFKA 3EWSA 2YINC 4G0NA 4ACBA 1U9IC 2DHRA 1UFQA 1VIAA 2QEQA 4NYJQ 2FU5C 3QXJA 2FZLA 1G19A 4D4LA 4CEIA 3CUEF 1NY5A 1OXXK 2ODBA 1CJMA 4IFEA 4QXAA 2FGKA 3K0SA 3RABA 4Y9RA 1R0XA 1OH5A 4IW3B 5CJPA 2BM1A 1Q3TA 2W6IA 5FH9A 4TYYA 5KSWB 3K9LA 4DCUA 4DT1B 4TT3D 1N6RA 4E22A 4JZKA 1H8EA 1P6XA 1EK0A 1FUUA 3Q9LA 4Q9JA 5E7IA 2PZFA 2HYIC 3QXXA 1KI2A 3AEZA 3G71B 1UPTA 4PSVA 1GVNB 3GFTA 4FWIB 4OI1A 3PCRB 5C2JB 4I1OA 4LPSA 3AGQA 3F0TA 4C2UA 3U3MA 1KSJA 2WV9A 1XD8A 4AD8A 1N6OA 4DEYA 5DN6D 4B33A 1KNXA 4ZI2A 1PJRA 2H18A 1R10A 4OL0A 4V0KA 2C9YA 1WBDA 3U6BA 3V4FA 3A1VA 2UKDA 4B48A 1N5KA 2PJZA 3VFDA 4GOXA 3FWYA 3K0AB 5CYOA 1IJEA 3RSOA 1E2HA 1VECA 3SHFA 3U4QB 4LYHA 1PZNA 4BFYA 4DLWA 3VX4A 1NLFA 4G5QA 4XWAA 1AJEA 1G7CA 5KO2A 4AF6A 2VHUA 4TQAA 3ES9A 2O8DB 5EXPA 3EPHA 5GV7A 3NBFA 4B32A 4OQMA 1JNYA 3KJIA 2DFTA 3FKSD 2AD1A 1Z47A 4PHGA 3AGPA 2K5UA 3N70A 1LS1A 1T8UA 2WWIA 1NP6A 3MAAC 4PO1A 1S0UA 1X3SA 2ZJ8A 1II9A 1E96A 4RKFA 4PPNA 1DAFA 1J2JA 1KK3A 1B2RA 5DSZA 4LYFA 1OFHA 4EPYA 4PAOA 4Q1CA 5FUYA 2E87A 3BC1A 4PHHA 1SKQA 2KI5A 4QJ4A 2XJ9A 4DLZA 1EFRD 1DAIA 1M7HA 2WJYA 1E2KA 4DSTA 1OIWA 5EXXA 3SNHA 1X6VA 4RVCA 3RANA 1NJID 4P0TA 2R6HA 4NMMA 2GESA 1AM4D 3GLHE 1WMSA 2Z4RA 2ZM5A 1ZM2A 2RGBA 2DFLA 3E70C 2NPIA 3LA6A 4KSCA 1DS6A 1S9HA 4QC2A 3U3OA 4L9SA 2EFCB 4XVQA 1G4UR 1P60A 1NJFA 3GLFA 4NHOA 5J4HA 1G8HA 2VHCA 3LLMA 2DBYA 1P75A 2PMDA 2QUZA 1E9RA 3UANA 2XEXA 3NEJA 1BKDR 2ANCA 3LX8A 1VCMA 4KFSA 1D9XA 3I73A 2CJWB 2WIAA 5CYPA 1MKYA 1P72A 1Q57A 1FRNA 1GWNA 1KMHB 3ZDQA 4F92B 2QPTA 3BXZA 2GF9A 4JLKA 4UNQA 3RRNA 2AK3A 4CT4B 2CCGA 3EW9A 2X8AA 2QENA 3CZQA 4FCWA 4EPVA 5TV2A 2FGJA 2ZSFA 1E2PA 3OEHA 1VYVA 3B1XA 3NXSA 1W4AA 3ZVLA 4N0DA 4Q4LA 1H8HD 1VQ4B 1Q3HA 4M1MA 4RD1A 3QKSA 4TMVA 5EUMA 1RPZA 3G6EB 3L0PA 3GPLA 3HR8A 3REGA 2WBLC 4A8JA 4J0QA 3SS8A 1ZMXA 3LAWA 1US8B 4RFSB 5G41A 5IT5A 1W87A 3CC2B 4R2HA 5FTNA 3HR7A 2A5YB 3NBZC 1K8AD 2C2HA 3CPEA 2REXB 3X1ZA 4YAUA 4RZ3A 4DBLC 3W5JA 2GJSA 1OFUX 3U7GA 2VL7A 1VQ5B 5C4MA 1G18A 3MLEA 2AL7A 4RY2A 2C04A 3QFCA 3A6PC 3BE4A 2JEOA 1W4CA 1X86B 2ZRHA 1E2JA 1DO0A 3DM5A 2X1VA 1E32A 3KUCA 1IN7A 3FHOA 4JBWA 2I1VB 3AVXA 1A7JA 3AVWA 1G6OA 1Z8FA 1XCMA 1Z6AA 4RCZA 4M0LA 3L8ZA 4M9XA 4CDGA 2YWHA 4DSNA 3U2QA 2JLUA 4IDOA 3AVQA 2A5DA 4YXWA 1BX1A 5GJBA 1P7CA 1G64A 1G1MA 2JJ2D 4KSBA 2WZQA 1E2MA 2EFHB 3MJHA 5FOUA 5C18A 1OHHA 3WRYC 2RH5A 1Q7YD 2BSAA 1NDHA 2FNAA 3LBHA 3EZFA 4RFVA 1RRPA 2O8FB 2ZRAA 5FUXA 5FPYA 1XFAA 1D2EA 2VLIA 2DWOA 5KDDA 4C43A 1YITB 3E1SA 4AKHA 1AA9A 4I1SA 2G1JA 3CMEB 4ASUA 3PENA 5HE9A 1ZD8A 2WWGA 3ZJYA 1Q44A 2Z0MA 3CIOA 1TX4B 1D8TA 2NO6A 3M1IA 3T5DA 5AUOB 1KD1D 2ZI7A 3OESA 4BASA 5CLQA 1JB1A 1NMYA 2GCPA 3CC4B 3WYAA 1Q1QA 2VHTA 1A82A 1ONBA 1G8YA 1K9MD 1YZTA 1JA1A 3T15A 4DCVA 3R9WA 3K0CA 4DDTA 1W0JD 2J45A 3W2HA 2WJHA 1IN5A 1YZNA 1KI9A 2I1QA 1YR8A 4NYMQ 3PXGA 3T06B 3CCQB 4Y7CA 3VU9B 4NONA 5JSZA 4AF7A 2C03A 2PCLA 1OKKD 1I4DD 4GMDA 1E9EA 2O8BB 1NLZA 2WWHA 4E09A 1BQEA 1IXZA 1ZCAA 3Q7PA 5L3RA 4NYIR 2Y8EA 1OH8A 4YONB 4IXMA 4AYXA 1E9FA 3SI7A 3CONA 421PA 3QXCA 2ODWA 5L3SB 3K09A 2R9VA 1OF1A 3LD9A 4FD2A 4D0LB 2WSSA 2OUKA 4HB3A 4JLVA 3QXHA 1IN6A 1IOZA 3G82C 4HDQB 3TUZC 5CB6A 2QRNA 3TW4A 2B8WA 1AIPA 1GRQA 2FE4A 2GPJA 3X1DA 1G291 1XBTA 2FMXA 4N3NA 4UAJA 4LI0A 4LV8B 3JQQA 1WF3A 1LV7A 1GRNA 4WA7A 3SBDA 1EFTA 3EASA 4PANA 1C9KA 2R65A 4TL7A 4URYR 1XMSA 2CE2X 1E64A 5LB4A 4LJYA 1VHLA 3P27A 1JA0A 4G1VA 1VQPB 3LXXA 621PA 5DHFA 4OHZA 1NI3A 2C9CA 3OJWA 2VHJA 3N2EA 4WZBE 5BWMA 5GVSA 4EDHA 4B3XA 3CCUB 2DETA 2DEUA 3D8BA 4A1FA 3WNBA 3MG9A 1LTQA 3QPWA 4Q66C 2AFIE 2ZQ5A 4W5WA 4BFWA 2OFXA 4DIEA 2B7CA 1CLUA 2KB0A 1CJKC 3LLUA 4P4TA 1F20A 1Z2CA 5FBQB 4F4JA 3ZQ6A 1OW3B 5H68A 3SYKA 3DKVA 1UBCA 1VQ7B 4TL9A 4DLSA 2ZSAA 2GBLA 3LO8A 2YZ2A 1GL9B 2ZTSA 3ZD6A 4YLGA 2EQBA 3EAQA 2J87A 3EX7C 5JHGB 1ZUHA 3MGCA 4NCIA 3W90A 3DOEA 5K8IA 1WXQA 4A82A 2IK8A 3U7FB 4JLNA 1S8FA 3U6KA 1A5TA 2O0JA 3BH0A 1QGAA 4GP7A 2OLKA 1GKIA 1WP9A 3K9HA 5EE9A 1JR3E 3OHMA 4L8GA 4EFMA 4G3XA 5E4FA 3FFBA 3B8HA 3U60B 1ETUA 3QY0A 2QAJA 1TF7A 3IUYA 5G40A 1E0AA 5TVKA 2MSEB 4MKGA 3AVYA 1K6MA 1T3HA 4Q4AA 3QSYA 3UG7A 1X8KA 1Q1ZA 1QFYA 2GJ8A 4EQ6B 2JLWA 2ZRFA 5B57C 3L0OA 1Q1EA 3P4YA 2F1HA 5B2ZA 3KTAB 3MFYA 3UMFA 1CTQA 1G41A 5JI2E 3O8CA 2QA4B 1E0SA 3Q7QA 3HU3A 4HLQB 3VHLB 4Q21A 2BBWA 2F9MA 4X8MA 1EFUA 1CNEA 2LKDA 3CKLA 1G8FA 1MABA 2NPFA 4GMXA 4A4DA 2DR3A 2JA1A 3R7WA 1DG1G 3GLIB 3QVVA 1TVCA 4MGIR 1XD2A 4K1XA 5UKDA 5SZKB 2AHOA 1C4OA 1TTTA 1CEEA 1GFIA 1RE0A 4LJ8A 3MWKA 4AYTA 1I7PA 2B5OA 1R5BA 2WM9B 2F43A 3DVLA 4Q02A 1HTWA 2ZS7A 3VR5A 1QGZA 3GEHA 4MRVA 1G5RA 3OFNA 4GPTA 4CZ2A 3QXSA 2RGNA 2GAAA 1N0WA 1I4TD 2Q9BA 3OIVA 3HP1A 2GXAA 2ZU6A 1H85A 3C8UA 4M1WA 4WW0A 2IS2A 4PR0A 2PX0A 5KSOA 2F9LA 5AUQA 3ZQJA 3BS4A 1JQLB 2NTYC 3DO6A 4AURA 1XXHE 3PIRA 3BB3A 3LO5A 4ZO4A 1IJFA 3RS7A 1F60A 1SXJC 2WICA 4IDQA 1VDZA 3LVQE 3A4MA 2CL6X 2YWEA 3KFXA 3SDZA 2OBMA 3UXMA 5B64A 1Z0AA 1IY2A 4V0LA 2BKEA 1NF3A 4JKIA 1P2SA 3NHAA 1SXJB 2FFBA 4H9GA 3AKYA 2P0EA 4EPTA 4AI6A 5J40A 5H59A 4EJSB 1ZM3A 2RKOA 1X8JA 4KITB 1N2CE 5FPKA 1KI3A 3GJ3A 4D0GA 2ZI4A 1XJQA 1W44A 4URWR 5JEDA 3W5IA 3DZDA 3L82B 1G8PA 5IDVA 3SHWA 1SHZA 1VQKB 1RRGA 4V0NA 4XIGS 5CK4A 4W5HA 3TK1A 4CRWB 5KOYA 1G3UA 4QHTA 5AUPB 1YZUA 3BOSA 2J5XA 3CBQA 3MD0A 4JVMA 4W5JA 2XTZA 3FMFA 5DN6A 2ANBA 3THYA 1BMFD 2IXFA 4D4KA 1D5CA 3SBEA 2G88A 1S1CA 1JPJA 1FUKA 5C46F 2QAGC 4ZCLA 121PA 1DE0A 1W4BA 1W36C 2F1JA 3K0FB 4FW9A 4B3BA 3KQLA 4MUAA 4PSKA 4LHVA 3W2GA 1E1RA 1NBMD 3PUZA 4LY6A 3TBKA 2OT3B 4B4DA 5AR1A 2CVHA 4LUCA 5DH9A 2H8KA 4C7OB 3W8RA 4MYUA 3KKPA 1W36B 4DDUA 4Z1MD 2ZYTX 3I56B 3CF6R 4Q1FA 2BEKA 3NC0C 4LHYA 3IGFA 3SQWA 3DPUA 3C41J 2XZOA 2FFQA 1QVAA 4OQFA 1E0KA 2FFAA 2PIAA 4FIDA 3Q5DA 1RKBA 1ZUIA 3NHBA 2VNHA 3LW8A 4JYBA 1P73A 1JJVA 1IHUA 4XH9B 4DDWA 1II8A 4HAXA 1GAWA 3MMPA 2IYZA 3H2YA 3OEED 2VO1A 2XJ4A 4HAVA 4IOMA 4LV6A 4CEHA 3PEWA 2J0UB 4B2LA 2J46A 2N42A 1ZNYA 4ZPXA 1EFRA 4B6FA 2WIBA 2MMCA 3GLHB 4KFRA 5HTKA 2ORIA 4O0MA 4C0BA 2OBLA 2FJUA 2PMKA 5JCZA 2XOKD 2YV5A 4IFBA 1R5OA 4HUTA 1FMJA 4TYPA 2VIIA 1CRPA 4XTRA 3T1VA 1D2MA 1KOFA 2VF7A 1W2HA 4U00A 2JLYA 1N6PA 4HZIA 2YHSA 2X19A 1N3BA 1G7RA 1IB0A 3HWSA 3IPXA 1CF4A 4YHBA 3QKRA 4Q9HA 2QTFA 5FPSA 2IYUA 2ORWA 1W35A 1AGPA 4YALA 3GJ0A 4EPWA 2ZYVX 4PO8A 1CR2A 1Z07A 2PLFA 1UAAA 4HI0E 4JL8A 2VTKA 2Q0HA 2BCJQ 3LV8A 2GZHA 2IUTA 3OIYA 4JYCA 4DSOA 5LPNA 2ZRNA 1U9IA 1LS6A 1QG4A 4CT5A 2BDTA 4XTCS 3A1SA 1Q81D 4HE6A 1KNQA 2O0HA 5EE0A 4B35A 4B2PA 4DCSA 2R6CA 4K46A 1OE0A 2IYSA 4LJ7A 2RGDA 1XDBA 4O2RA 1UM8A 1ZD1A 1OJLA 1S96A 1ODFA 2GAOA 2IF2A 3LFUA 1DO2A 3AF4A 4MGYR 3AH8A 1V43A 4EUNA 5KNCA 2OXRA 4YAFA 1K73D 1R8SA 1TU3A 3B82A 1VQNB 3B13B 3BIFA 3LH5A 4TSFD 2HDNB 4AKEA 2V1XA 1GO2A 5GJCA 5IK2D 1OIXA 1EFCA 1DAGA 1YRAA 2GEUA 3OF5A 5B58C 1AKEA 1FTSA 3B1YA 2J9RA 3OAAD 4OBEA 1W5SA 5H8WA 3UPUA 3K0AA 4LJAA 2GCOB 2IW3A 1X1RA 5KNBA 4DB4A 5CDFA 3U4QA 3C5CA 3WMFA 2N1BA 2F3RA 2NO0A 3RHFA 2HCJB 2ZJAA 1F2UB 4P3YA 4OJQA 5F9FA 4LYAA 5GADl 4YMWA 3I5YA 3TAHA 2H17A 4A2QA 1UKVY 1RW4A 2NG1A 2GXSA 5JECA 4LX0A 1CR0A 2JJ2A 4ARZA 2YOGA 2EFGA 4M8NE 4NE2A 4QOSA 4HAZA 4LRWA 2G0NA 4PQYA 4PZLA 5K8TA 1SVKA 4X8LA 4MH0R 1VG8A 2YC2C 2IYVA 2VYFA 3LVBA 5L3QA 1Z6XA 2V7QA 4DB2A 1E79A 4LBZA 2AFHE 1JB9A 1E69A 1W47A 3CC7B 1VG9B 1W4RA 2Q6TA 4FINA 4LHZA 3KKNA 3LBNA 3X2SA 3AF2A 3SYLA 1KI1A 1ZCBA 3CR7A 3I4LA 3OE7D 3REFA 1S4QA 4NP6A 4HAYA 2CLDX 3ADBA 1E4VA 1KKMA 4B2IA 2ZI9A 1NG1A 3G5UA 1J90A 1N6NA 4DEXA 2CVFA 4B47A 3IHLA 2RC5A 4A0FA 4GBMA 3KJGA 3BGWA 3GJXC 3FTQA 3BBPA 4EKDA 1E1QD 4V03A 5KDOA 1JI0A 2CJWA 4BGDA 4TZ6A 4ZCIA 4O3MA 3CR8A 2QMEA 3AP1A 2VHQA 1KMHA 2QMHA 4BEJA 1GL7A 1NY6A 2L0XA 2HYDA 4A92A 1O3YA 3KQHA 2PZGA 2R6FA 3R8FA 4M9ZA 1GP2A 2BM0A 2RHMA 3E2IA 4BLQA 5EQTA 4L16A 3QNUA 4M9SA 4QNMA 4UXHA 5EP2A 4JVSB 3CCJB 1S3SA 2X3UA 4RZUA 5IHPA 4QGFA 2P6RA 2XB2A 3E20A 1OB5A 3AF1A 3RC8A 1VCNA 2GTPA 5CIQA 1OT3A 1WA5A 2FPLA 1US8A 3HYTA 4DDVA 4TL6A 3P32A 5JWOA 4F7WA 1GILA 4DCTA 4FMDB 2J7PD 1F2TA 3TGPA 3W6OA 3EPJA 2V3CC 2R62A 2CNWD 2IYQA 1R0WA 1HY3A 3AP2A 3Q5EA 1KSHA 5HKKD 5KU1A 5KPJA 1S2MA 2AN9A 3FFAA 2VP4A 3D31A 4BFSA 1SVIA 2E1RA 1YU9A 2ZI3A 4D4MA 5AUNB 1OFTA 2BMEA 5FA6A 3I92A 5KYKA 2Z83A 4B3CA 4MDEA 1RJ9B 4RD0A 1KYIA 4Q7JB 4GI7A 3BK7A 3JQPA 5H70A 2VP5A 1ESNA 2O5VA 3C15C 4JVLA 2J0SA 1W0KD 1T0HB 3R8CA 2ZU0C 5DYIA 2CHGA 5JJIA 3MHPA 1IXSB 4FI3C 1WBBA 2EWVA 2AXPA 4U7DA 1LNZA 1P2VA 2H7VA 4PX9A 3TE6A 1RC8A 4EIWA 2O8FA 1WRBA 1L2TA 5AJYA 4PGOA 3NIBA 3U5ZB 3CZPA 3VR6A 3HPRA 2OEPA 1EP1B 4QG7A 521PA 2IEZA 2MSCB 4NU0A 4MYHA 4C2TA 3CCSB 4JMPA 2G6BA 4DLRA 3JZMA 2V9PA 1FNBA 2JLRA 3HDTA 3WXMA 1KZ7B 2EWWA 2XSZD 3HPQA 3QJYA 2IWRA 3LXRA 3THOA 5KPDA 4DC9A 1ZYUA 3CB4A 3W9YA 4LHXA 3RAPR 3I5XA 1RRCA 4URUR 5THXA 4QRHA 2G3YA 5G53C 4UJ5A 5F3WB 2XXAB 4L15A 4TMWA 4KLNA 3ZVNA 4KBFA 5FUWA 4OKSA 1T5IA 2P6UA 1VQ9B 3U61B 3D7MA 1IAQA 2D2EA 5DHAA 3SN6A 3WMGA 4QJ3A 3U44B 2OSBA 5C1BA 1JEDA 4KYUA 2O8BA 1GRRA 5FOXA 4EAQA 2EFEB 2CK3A 1C1YA 4U5XA 4AWXA 1XTRA 1Z6TA 4KVAA 4MUBA 1ZM9A 3JVUA 3ICQB 1PLKA 1SVWA 4Q4HB 4TMKA 4BUJA 1AK2A 1TUEA 2QT0A 4PXAA 4KO8A 4QHSA 5KSYA 5K8LA 4HZUB 3EIQA 5ELXA 1YJ9B 3K70D 2XNSA 1U90A 2D2FA 1YZLA 3CCMB 4BEBA 5BXQC 3S1AB 4GFDA 2BBOA 3K0EA 3CCVB 2X2EA 2VZLA 2SHKA 2WSMA 4C0HA 3BJIC 1XXHB 3DL0A 3B9PA 4DQKA 1KO1A 5D3MA 2OFOA 5FOSA 5BN3A 3RRZA 4ZV4A 2WJIA 1QGYA 2ASEA 3BORA 3HU1A 4OK6A 2YYZA 5EXTA 1TQDA 1W2BB 1N6IA 2W2VA 2P3SA 3ZVMA 4ABYA 2NOAA 2BEJA 3H84A 2ZUCA 4IOLA 2A5FA 2WPDA 1AS0A 3O8DA 4NYIQ 2HMAA 1LFDB 3MWLA 1HUQA 2W00A 2OK8A 1HQYE 2IHBA 4U9UA 3N2IA 1KY3A 4HB4A 3EPKA 3F3YA 4BLOA 2GRJA 4Q9IA 2CNDA 4D4JA 1D9ZA 2VNIA 2ODNA 2OFWA 5DGXA 5LD2C 4YMTA 3BRWD 4V0MA 5FOTA 4DWJA 1GKYA 1Q20A 2HF9A 2NZJA 4D82A 1S9DA 1G4AE 3VNVA 1QF9A 2VBCA 2CL0X 4G1BA 2QQ0A 2XB4A 2ZSDA 1KI6A 3M4YA 4KXFB 3FOZA 3B5JA 3PFIA 1OIVA 1KC8D 5JBQA 3VKHA 5LD2B 2IS1A 2CDNA 2QT1A 2IHYA 4OHXA 2D4HA 2DWPA 1ZM7A 3ZIAA 1X1SA 1XNJA 2FWRA 1W46A 1W49A 4KV9A 1GNQA 2BJVA 2IBMA 721PA 2ZE6A 3WHKA 4Z51A 3QIAA 4RD2A 1FOEB 4PZZA 4EQ6A 2EU8A 2BV3A 2ZSBA 4JLBA 4MGKR 1BOFA 4JLOA 4ESVA 4CEJA 1KMQA 2HEIA 3U7EB 3I3SR 3JVVA 2JJ1D 2WJJA 1N8RD 3O8BA 1WB9A 2DYKA 5EMNA 2ZR7A 1NMXA 3C16C 4HAUA 3AVPA 1TEVA 3DM9B 2B8TA 1T9HA 2R6DA 5GVRA 2RC6A 3TLXA 3NDBB 2VSOA 4DJTA 1RZ3A 2JASA 4PSAA 2QSYA 2Z43A 4DHEA 1HA3A 1ZAKA 3A8TA 1SKYE 3L2OB 5CM9C 1QHNA 4A15A 3OIWA 3B2EA 3H4MA 1OLOA 1E2EA 1ZJ6A 1JPNA 1UKZA 1EWQA 1RYHA 2J1LA 1NN1A 5TARA 2ZS8A 2OCYC 4DVGA 1TAGA 2WWXA 2ZPTX 1GUAA 3TSZA 1UEIA 1COWA 1GDDA 3CRMA 4D6PA 2WAYA 4OJKA 2A30A 3KUDA 1EGAA 3QF4B 4KVGA 3ZBUA 1VQOB 1VG1A 2ZREA 2GHIA 4GT1A 4MITA 1Z2AA 2XOKA 2XTMA 4L4UA 3GEEA 3K53A 4QGAA 3IDQA 3NEYA 2QP3A 2WJGA 2QNRA 1NLYA 1SZPA 2Z4SA 1KY2A 2ZRBA 4GNKA 2PJRA 5J4LA 3GEIA 3KZ1E 4HUQB 3U3JA 3VTKA 5HCIA 2JLVA 4M1OA 2QL6A 4Z8XA 2EW1A 4YMSA 1Y3AA 1U94A 2F1IA 4FCTA 1XZPA 1KJWA 2ZUDA 1HT1E 5KSPA 3V9PA 4D25A 4Q19A 2W2XA 4F7DA 1MT0A 2ZI6A 2JDID 1AQYA 3ETLA 2CE7A 2AK2A 2J7KA 5AN9A 2ZRMA 2RGEA 3VAAA 3GLGB 1SQ5A 2AXNA 2XZPA 2QM7A 4JL5A 3RS5A 1N6KA 2CL7X 1SXJA 2D3WA 4UNRA 1HV8A 1NN3A 4B3FX 2ZS9A 4B43A 4TYNA 3R9XA 1NIPA 1UMKA 2WVJA 1Q86D 2ZRLA 4TYWA 1U0JA 1XTIA 3CPWB 3PR1A 4ERNA 4MDFA 2VSXA 4P4SA 5DI9A 4GDFA 4LHWA 1G7TA 1T3LA 2YC4C 3HU2A 2QBYA 1FNDA 3VKWA 3RLFA 2VEDA 2ZRDA 1UDXA 1DAKA 1SM4A 3ZD7A 1W48A 1XWIA 3KX2A 1QHGA 3FPAA 2D62A 2CEAA 3RS0A 1TQ6A 3RYTC 1NNEA 4DQLA 3R9IA 1H8ED 4Q48A 3R20A 4NPHA 1NIJA 2E9SA 1GTVA 2ZE7A 3QKSB 5IK2A 2DFKB 4F4CA 8OHMA 4NDZA 1UKEA 1QG0A 2ERYA 3K0FA 1Y63A 1U0LA 5AK0A 1KDRA 1ZP6A 1BYUA 5TMPA 5DLQC 4RCYA 1OH7A 4GRAA 1M1YE 4CIDA 3IIMA 3SJBA 1XMJA 1G3QA 1JQJC 2VPPA 4PPGA 3T1QA 2OK7A 2QDXA 1VIYA 4PQFA 3DMDA 3GFOA 2QAGA 2ZRCA 4XD7A 4Q9LA 4G5GA 1FQKA 3GFPA 1AZSC 4B3GA 1VKJA 3D3QA 1JXOA 2BPOA 2RGXA 1VYTA 3UIEA 4N3GA 1DARA 2V54A 1NKTA 2ATVA 2QTHA 3PQCA 1XTKA 6Q21A 1TNDA 3KXLA 3NTUA 1KI7A 1G3RA 1KRHA 4XVRA 5CDFE 1ZC3A 1ESMA 3TRFA 1QH0A 5F9HA 1BH2A 5FPHA 2G0TA 3ADCA 3P4XA 4Y0AA 1NSTA 2QE7A 3QKTA 3T1TA 3J81k 2PH1A 1RRFA 2H16A 2WWWA 2J0UA 4HDCA 4D81A 4XVUA 4W9MC 1UEJA 4II7A 1VHTA 1L4UA 4QHYA 1GJRA 1XCPA 4JVNA 4YDHB 3TR0A 1FRQA 1XEWY 2HUPA 3CXCB 3GLHA 4R2IA 2FEOA 3GJ5A 4HB0A 5CM8B 4DKXA 2JLZA 3BFXA 1FFHA 2FG5A 2P6NA 1T91A 4O25A 2JIZA 1QHYA 3HJNA 4P33A 1YJNB 4FK8A 1JBKA 2ECKA 4R98A 1KK1A 1F6BA 4ZCMA 2ZVQX 4GL2A 4UXIA 5JEEA 5JHHB 5CK5A 5TDHA 1T5LA 1CU1A 4JJKA 3H86A 4LJ6A 4I1VA 1E6CA 4Q4JA 3RVBA 1YVDA 2BJWA 2G1KA 3MRSA 2H1LA 1FNCA 3L43A 4LZZA 1E9AA 2ZIAA 3ASZA 3A1WA 2C5LA 1XB2A 4RJLA 1AN0A 1OYWA 2GEDA 1NVVR 2HLDA 1KK0A 1N5LA 2OTJB 4G5RA 2IWHA 2GJAA 3SZRA 5FPTA 3FPKA 1HE8B 1U8AA 1TQ4A 2ZAOA 3AQ4A 3MUFA 4BPRA 1QDEA 1VQ6B 1OXVA 1PLLA 4EJSC 3K9NA 5JWRA 4FN5A 4ZIRA 1KI4A 3IO5A 1YKSA 5JSZB 3THXB 3CX8A 3B60A 1XEXA 1ANKA 4CW7A 1VTKA 5DI3A 1FP6A 4TWZA 1XRJA 2PT5A 2QMOA 3NVAA 1CR1A 2ATXA 3OEHD 4G5OA 2F6RA 4A6PA 3E5HA 3WNDA 1KJYA 2XAUA 3RRYA 3SU8A 4TT3A 2FN4A 5JWHA 4LV5B 4ESHA 1WDTA 1M74A 2F7SA 4QJ5A 2ZYWX 1KHTA 2EVWX 2GNOA 1A2KC 1IY1A 2V55B 3BH6A 2CLSA 3O47A 5KSZA 1B0UA 4DXAA 3ND9A 1CR4A 4TLDA 4CYMA 1D1NA 2ORVA 1P9NA 2Z5FA 4FMBB 4EFLA 2GCOA 2ODEA 3W2EA 5AJZA 2PEZA 3RS3A 5HR5A 4URZR 4PHFA 3LX5A 3NH9A 4RKEA 2OZEA 1G5TA 1IONA 3OIUA 5AJVB 2AX4A 4IVRA 1DG3A 5JJKA 5FL7D 2GKSA 1E4YA 4U02A 2OCBA 3THWB 2RGGA 2C95A 2Q3HA 4DSUA 5DISB 1FMLA 1HT2E 1W0KA 4KCGA 4KHZA 1VG0B 5C4GB 1KSGA 3VQTA 3IHWA 4PHTA 1MOZA 1EFHA 4I99A 3CRZA 1IBRA 2HJGA 4PPFA 3TUIC 4KODA 4Q01A 4RZXA 2QTLA 1HURA 1II0A 2PEYA 3D6TB 3CRVA 4HYYA 5AJXA 3TSOA 1TADA 4PZYA 4YXWD 2QN6A 2AKAB 3FMOB 3FKSA 4LCBA 2PLRA 1VQMB 3B1WA 2QGNA 1N25A 4DLUA 4E5UA 3LNCA 2V4ZA 3L0SA 3U3KA 2NIPA 1TMKA 2ZR0A 2IYWA 2R2AA 5H1YA 1QFJA 2ZRJA 5CJ2A 4ZDIA 3G0HA 1KDOA 4W7SA 1MO5A 1N6LA 2J41A 2D7CA 5JRJA 5SZHB 3C7KA 1WQ1R 3BB4A 3KKMA 3BFVA 4I4LA 2LWIA 4ASUD 5HXBA 1KK2A 5H5JA 3EIEA 4Q4AB 1S1MA 4V0OA 2Q3MA 3ZGXA 2V6IA 1SGWA 3FYHA 3B1VA 4MKIA 3QE0A 3IPYA 5IF9A 2QI9C 3B85A 3UWOA 3WNCA 1E63A 3PG5A 4LJ9A 1IM2A 4ON9A 3GJ6A 4Q1EA 3WHLA 3RNLA 4DUGD 4EH1A 1Q21A 2W6JD 1IY0A 1HEIA 2KBFA 1NG9A 3EZ7A 2CXXA 1MABB 4Q5IA 3VR3A 4US2R 5K8UA 1I2DA 1F5NA 3R7WB 2QTZA 2YOHA 3QENA 2YOFA 1XD2B 1Z83A 3WRXC 4LC0A 1FX0B 3HYRA 2QGZA 1R0YA 4IDNA 4NH0A 4Z54A 1GL6A 1K5GA 1WE2A 4A9AA 1QHHB 4TZ0A 1T3SA 1KGDA 3W5UA 3L8YA 3GLFE 3CRRA 2QPOA 3SYNA 1NN5A 4FMDF 2MMGA 1QX4A 3VNUA 4M21A 4OK3A 3A36A 3CF2A 1ZW6A 3SFVA 1E62A 1UJ2A 1G7SA 2WSSD 2NO7A 4DT1A 1H8HA 4MRNA 4MKHA 2RGCA 1XEWX 1ZRHA 4HEJA 1VYUA 4YAWA 1TLLA 4TTPA 2Q21A 2IYYA 2BHRA 1CNFA 3TJZA 1E2IA 1NJGA 1JAIA 2EIXA 1AS3A 3C14C 4QL3A 1QBKC 3NG1A 4BFXA 1Z63A 4IXNA 2N46A 1TF5A 1NL3A 1P9RA 1KTVA 2A3RA 2CLCX 4Z8YA 2WMOB 4C0QC 1RJ9A 2AR7A 2ZJBA 1Z6YA 3W6NA 4HATA 4X8HA 5AJWA 3GCGA 2DB3A 1GG2A 1R4AA 1GR1A 4C0JA 1XPOA 2YWGA 4YMUA 3I1FA 4TMZA 2FFHA 1QRAA 1EP2B 1DVRA 1XU4A 4DLYA 2C77A 4BQSA 1ZINA 2A7QA 4HLUC 4R71A 2WMNB 4OQNA 1FW6A 1Z0IA 1BX0A 4QM7A 1CJTC 3B6EA 3TMKA 2O8DA 1LF0A 2IEYA 3CPJB 1TF2A 5KNDA 4P6VF 4BRWA 4PO9A 2VP0A 2BF4A 2UVQA 3ZH9B 1M8PA 2H5EA 5JZVA 4QGGA 1FQJA 4LBVA 4V0ME 2C98A 4UKDA 2DFNA 4MA4A 2IUSA 4KU4A 1IN8A 1CKEA 1XTSA 2QA5A 2UZIR 3DDCA 2NZ8A 3PUWA 2QROA 4NCKA 2WKPA 2WJVA 5EE1A 2ZUBA 1A2BA 4P32A 3THYB 1KO7A 1UBEA 2PZEA 1KQSB 2G9NA 5KHOC 2BGIA 1G6HA 3PEVA 1QHSA 1SVLA 3CCLB 2HV8A 2GEVA 3CMAB 5E7MA 2KBEA 3P20A 1SKYB 1Z0DA 2ONJA 2CHQA 3WBJA 3UG6A 3QI2A 1SHKA 1W7AA 3ZC3A 3FHCB 3QEOA 4JKYA 1XMVA 4NZYA 4F4IA 4YC7A 1WCV1 3GJ4A 2QEXB 1KO5A 5EJEA 3AM1A 1GZSA 1JECA 2HCBA 4BLRA 1W0JA 1NRJB 1U8YA 3IO3A 4O2LA 4GOJA 1P62B 2REBA 1KDTA 2ONKA 3VR1A 5G3ZA 1J9ZA 2FEMA 1OSNA 5KTYA 1XTJA 3IEUA 5CITA 4TTQA 1OKKA 1QFZA 1YIJB 3K70C 4PTLA 2GK7A 2BN4A 2QMUA 4XOIA 1OXSC 3CF0A 1X8LA 3FGNA 2FSHA 2D74A 1Z22A 3WP1B 3T12A 4K8OA 3G4SB 4RD3A 4M53A 3DHWC 4DZZA 3KKOA 2GF0A 1UADA 2VH5R 1E0JA 2ZRKA 3OFND 1AMOA 1Z0FA 1IQPA 3H0KA 3K70B 4LWZA 3RWOA 3CNNA 221PA 2GQFA 2FA9A 2IYLD 1M1KD 3VR4A 1YR9A 2IYXA 4ITRC 4IOKA 1CJVC 5E95A 3P26A 2JDIA 5FBRB 3UKDA 3A1TA 4YDSA 1E3MA 1GKUB 4RFSA 4AC9A 4KLZA 2Q3FA 5EXSA 2HT6A 2ZROA 3L0IB 4A0RA 4OK5A 4RSGA 2ZXUA 1XJCA 1TUIA 1ZU5A 5BW8A 3A4LA 2FX3A 1PLJA 2OHFA 1B23P 4ZGNB 1DOAA 3OZVA 4KFUA 3AVUA 4DCNA 4P4UA 3SE0A 1VCOA 2ZRPA 4AIIA 3W8NA 2YWFA 3VO2A 4C3ZA 1R2QA 2AWNA 4RD6A 4JL6A 2ZEJA 4EFNA 1FL9A 3PITA 2A5JA 2ZE5A 2CCKA 2JATA 1NSFA 3FDIA 3ZYCA 2VF8A 3I8XA 4OI2A 2GXUA 1SXJE 1TU4A 4GSYA 3ZVRA 3NBXX 2QU8A 3ONWA 3QF7A 4QBHA 1E2GA 2GK6A 3IEVA 1XCGB 4BZPA 3CNOA 4HSEA 1PV4A 1VPLA 1QUFA 4Q7MB 3DOFA 5E3HA 1M90D 4BECA 1P2TA 1G9XA 1YZQA 3I55B 3KQKA 3SOPA 4UNSA 1YI2B 2J0VA 1Q0UA 2ZRGA 3IKJA 4M4SA 4JIMA 2IS4A 1N0UA 3PVSA 1RYFA 2WOJA 4AK9A 3MSXA 1PUJA 2A5GA 1XD9A 2GZDA 2Q9CA 1E1RD 4FMCB 4QBIA 2FDCA 2ZITA 2NGRA 4I1UA 2OBNA 4ZDKA 5JI3E 5FOWA 2LCFA 2RGAA 3PV0A 4MYCA 3UK6A 2HF8A 4URVR 5DIFA 4Y9UA 5F98A 3PEYA 2O8CB 3BD9A 4V02A 5LBIA 4Q1AA 1L4YA 2FH5B 3TUJC 5FBLB 4UJ3A 1OGIA 1QZXA 3Q3JB 4B76A 4IDHA 3AUXA 1CIPA 4ARZB 1FZQA 2W0MA 1V5WA 3CLVA 3QF4A 4C0SA 3VU9A 2GZAA 1HH4A 3FE2A 1YJ5A 2BGJA 2IL1A 1Z3IX 1JEEA 1NVWQ 1YR7A 3IIKA 3KKQA 5EE5B 4C9BA 5M04A 2AKYA 1XPUA 1D2NA 1UF9A 3IIJA 3EG5A 5L3QB 1KJZA 4B73A 5BN4A 4HUQA 1W5TA 5L3SA 2A9KA 3TNFA 1DAEA 1ZVQA 4PC6A 1AKYA 2GVDC 4LBWA 2KJQA 4URXR 4NYJR 4HB2A 1S3GA 1A1VA 1QHXA 1DAMA 2CMKA 1ZC4A 3MWJA 3KB1A 1U81A 2BMDA 4KAXA 5FTKA 3VO1A 1DELA 5SZIA 4TQUS 2GJKA 2IUUA 2OG2A 1VQLB 3JZAA 2GJ9A 4US0R 4WBSA 4LDJA 3GLGA 5DNYB 3AKDA 4H1UA 1CQXA 4H1VA 1Z06A 1SULA 3LY5A 1YHNA 1YJWB 2I3BA 1KZGB 1YZGA 2VQSA 4OQXA 3GQBA 1J7KA 2WTUA 4KBGA 5L8VA 2FPMA 1J99A 2FOLA 2WKQA 2WWFA 2B21A 4WQMA 2I4IA 2OESA 1E2LA 4PPQA 4BLSA 1EWYA 4FWTA 2O8EB 1FP7A 1AQUA 3V4RA 2QRZA 3OJXA 3VHXA 5FTMA 1OB2A 3ADDA 1GSIA 4ZKEA 2XNDD 3V00A 4CEIB 3QPVA 1GITA 3QKUA 2ZAMA 2KE5A 1M7BA 3KXIA 4XWKA 5EZ5A 3QBVA 4UNPA 1A4RA 3H1TA 1UBGA 4IDPA 3SJCA 3U3RA 1G8GA 3BWDD 3GJ7A 1XJ0A 4PC3A 4LPKA 2JJ8A 3F8TA 1JR3D 3PUYA 4LSGA 3PEUA 3EIHA 4PQRA 3OZUA 1S72B 1F2TB 5FTLA 1BMFA 1AZTA 1P2UA 4POAA 1P4SA 3WYFA 2C78A 3AVTA 5TB5A 3VR2A 5FL7A 4B75A 4L9WA 4D26A 1O87A 1Z0JA 2IA5A 3DZ8A 4C4PA 4TMXA 1W1WA 4Q9KA 1NBMA 2JLSA 1MRSA 2BCGY 3A37A 5BYKA 3QPUA 4IEEA 3BERA 4M1SA 5EZ6B 3EC2A 5IRCD 2OILA 3W34A 1J8MF 2VP2A 4B3DA 2C96A 1SVMA 2QQEA 2OXCA 3T35A 2IS6A 3KTAA 4Z1MA 2R6AA 4BZQA 1MO3A 4LGMA 1XP8A 2FSIA 1DTSA 4IEIA 4F93B 4TYQA 3M0EA 4D80A 1T0JB 2WWYA 4N1AA 2WAXA 4Q47A 3QFRA 2B6HA 4WXPA 1ELOA 2ZJ2A 4ZDJA 1U8ZA 1SVOA 2DY1A 3FVQA 1CBUA 3B78A 4TL8A 3ZZ0A 2OM2A 5LB2A 3GLIA 1EESA 1T6NA 2EFDB 2R8RA 2W58A 2BVNA 4QBGB 4NL4H 5E7JA 5J4YA 2C9OA 1G20E 1TQ2A 3MJRA 1DPFA 3OEEA 4LOAA 5JS7A 1XTQA 2KWIA 2V7QD 3SJAA 1E79D 4BFZA 4E07A 2BWJA 2IT1A 5GJVC 1ZNZA 3FJOA 5FBVB 1CULC 4KYIB 3VMFA 3IBGA 1LY1A 2CCJA 2QG6A 4HE5A 4PC2A 3CRW1 3EARA 3I32A 1KKLA 5P21A 2OLJA 3SFZA 1BO6A 4PFSA 4NKRA 3EA5A 2BBSA 2X77A 4B71A 4RZ2A 2BMFA 3OW2B 1XF9A 4DUGA 4M1YA 3JQRA 4DLVA 3SJZA 2J3EA 2W6JA 1R5NA 3N5CA 1LW7A 4QBFA 1T4GA 2P67A 1VMAA 4ILEA 1PVOA 2R6GA 3RDPA 2VSFA 2VRWA 2VYQA 2QP9X 4BE7B 1Z29A 4OHWA 3P1JA 3TQCA 4UXJA 1ZIOA 2HJVA 3THXA 4IRUB 3QFSA 4AY2A 4M1TA 4ZDWA 5HE8A 3GLFB 5BYJA 5JS8A 2PCJA 1CS4C 4TN1A 5CIWA 3PJRA 1AS2A 2IXGA 4X8OA 3I62A 3X1YA 2RB4A 4EPRA 1CRQA 3DKPA 4EJSA 3NC1C 4CF7A 3Q85A 1OYYA 1FNMA 4R7ZA 1CP2A 1FTNA 2A2ZA 4BFUA 4M2LA 2XX3A 4OHVA 2GDJA 4K81B 2OTLB 3TIFA 5FUVA 2BMJA 3AKCA 4NCNA 2GETA 2ZYUX 4A8JC 2W6ID 1NVVQ 1QHIA 1OH6A 5TY0A 1KO8A 1YQTA 2H92A 5D3MB 1HQCA 4TSFA 4JSYA 5TXGA 1QVGB 4M9QA 4QM6A 3K8YA 3UWKA 5EUQB 4DIDA 4ZI3A 1FPMA 1BIFA 3A1UA 3ZS8A 4IHQA 3OAAA 1P9WA 5CLLA 3THWA 4A8JB 3LVRE 1Q82D 1M34E 1MO6A 3BB1A 2P2LA 1DDGA 4DLXA 2B92A 5JCPA 3W5HA 1EG7A 4HAWA 4D0NA 4A2WA 1OFIA 2UZ3A 1KAOA 4C7OA 1KI8A 1EXMA 4LK2A 1Z08A 3KFVA 4RD4A 4JSTA 2NQ2C 3M6AA 3TH5A 1ZNXA 5GJWC 3A4NA 4BRUA 4BWYA 3I61A 2F1RA 1UKYA 4E03A 1JALA 4CGZA 2Z6VA 1R7RA 3CH5A 4HLCA 3WY9A 1DAHA 2GA8A 1KI6B 1GAQA 3BH7A 2CBZA 2RMKA 2C99A 4WAUA 2W0SA 4JJZA 4ZKDA 3UMSA 3GD7A 4YMVA 3WYGA 3FHTA 3QG1A 4F38A 4PC1A 4Q00A 3QOFA 4GZMA 1E98A 1LVGA 1D6JA 4GP6A 2V1UA 5J47A 3FB4A 4NYMR 5FI1B 1SVSA 1P5ZB 5F2EA 3DMNA 3MWYW 2JGNA 1M6NA 4CEJB 3LBIA 4BFVA 3OE7A 2BC9A 4DRZA 3CWZA 2BBTA 1OXUA 4NTZA 3EWAA 4ACAA 1CJUC 1UDWA 2RHDA 4XJXA 3SR0A 1U2RA 1QVFB 5J5CA 1F48A 3KJHA 2FSGA 3TSWA 3EZ2A 4GZLA 4B44A 1BS1A 2REOA 1E2FA 2QPAA 3K0CC 4MKFA 4GOKA 4HDOB 2XTNA 1YHQB 1E1QA 2C8VA 2TMKA 4MQBA 2J0QA 3RS2A 1E9SA 2PX3A 1NN0A 1G5PA 2H57A 1FX0A 4A36A 2VNJA 2DPXA 2OAQ1 4G1UC 4R9UC 2CK3D 1N0VC 1QHHA 3KB2A 3E1YE 4BPBA 3V76A 1EWRA 1K5DA 3CRQA 4JLJA 4C0LA 3I8SA 5A0FA 4AYWA 4XSGA 3K09C 4IVPA 2YNMA 4MRSA 2EYUA 5JLJA 2HXYA 2ZJOA 1XPRA 2IF0A 3FKQA 4QKQA 1J70A 2WHXA 3B9QA 2ZETA 2O52A 2GCNA 3BAFA 5L3VA 4MYTA 2XNCA 3ZLJA 3SEAA 2PBRA 4C0AC 5J4VA 3T5GA 1Q22A 4JS0A 1XE1A 3EZ6A 2J7PA 5AWFC 3TW8B 2LKCA 4TLAA 2J59A 1RVDA 3QQ5A 2CNWA 3SQXA 2XITA 5HKKA 4IVQA 4HLDA 3CWQA 3IQXA 1J8YF 1EP3B 4S2EA 4LBYA 2WPDD 1OPXA 2IXEA 3AF3A 4PAMA 821PA 3TQFA 3GMTA 4S35A 4KFTA 3F5FA 2G77B 4Q03A 5B30A 3AP3A 3CCEB 2VNKA 2ZVPX 1E2NA 5DE3A 5HZKA 2V6JA 4C0KA 1F2UA 4US1R 2WKRA 4TQ9A 1N5JA 1Z0KA 2ZI5A 1ZD9A 1GVHA 5A4JA 3W5VA 4P4SB 4LC1A 4NCHA 3U7HB 1JJ2B 3PUXA 4N0EA 3ZZUA 2GBLC 5CB8A 2GILA 4BZXA 2QBYB 2FPKA 1MRNA 3QG5A 4A6XA 1UBFA 2AD5A 4HLUA 2X2FA 1EX6A 4BFTA 2CHVA 1P3JA 4LJ5A 3ZS9A 4PAQA 3VKGA 4JBYA 1MO4A 4M1KA 2JLQA 4IOJA 2XZLA 2CRVA 3PUVA 2F3TA 1U99A 2GWHA 3CPHA 2NMVA 2D06A 2ZSEA 3ZIAD 1DDIA 3EXAA 4IKEA 4Q1DA 2BOVA 2R44A 2VP9A 3AF0A 3QBTA 4C30A 1L7VC 5LDDC 1OHHD 3K9GA 2XSZA 2ZE8A 2MSDB 2PL3A 1N6HA 3RRMA 2KSQA 2F55A 2GVZC 1LF5A 3WMEA 3KL4A 4EPXA 1ZUNB 1NMZA 2JCSA 5TR9A 2QAGB 3NWJA 5FBWB 1QVRA 1HYQA 2OO7A 2O0KA 2W83A 4Q7KA 1LB1B 1DADA 1XMIA 3LDAA 1AGRA 3C4JA 2ZJYA 4AG5A 2OCPA 5FOVA 3NDPA
chains in the Genus database with same CATH superfamily
4B6GA 3CX7A 1C7IA 3KWFA 1RFLA 2XPCA 5AH0A 1W25A 1R0ZA 4JUBA 3OCXA 5AQ1A 4PNHA 4K8RB 1ATZA 5BR1A 5ENZA 4R8SA 4RHTA 4WZAE 1XRLA 3K96A 4WA8A 5KDLA 2BGGA 2XDQA 4RHCA 1YWGO 2CXPA 2QQGA 1W2GA 1DXOA 1FQWA 2BMVA 2FCRA 2PA0A 5F4ZA 2Q7DA 5ISMA 2DWQA 1YZKA 3MGBA 3U3DA 3OE5A 3KXKA 3RUFA 1FDRA 2WHPA 3I9OA 1COWD 4N18A 1N2EA 4PSUA 4F8JA 4WVFA 3PSAA 1UPBA 1KEVA 4O5OA 5I4BA 2CDRA 3B1ZA 2FWPA 2CGEA 5H83A 4LOLA 2FV8A 1NF9A 2YXDA 5ANRB 2DERA 4M22A 2X9LA 3D3NA 3HFJA 3UK1A 5JXIA 2NYAA 2BDUA 3K9WA 1CUDA 1J0AA 3D0RA 3WP0A 3T1YB 3SYRA 1L8LA 2WOOA 3AI1A 2D7DA 5HRCA 1U1EA 4FD3A 4F12A 5C34B 4ZYWA 3TLGB 1IVNA 1VHOA 1SOWA 3EEYA 1XLTA 3IQHX 4OHYA 1O5TA 2P8SA 3B7PA 3ZKAA 4UPEA 3FMIA 2IYTA 4FHGA 2BMWA 2HXGA 3TQQA 3UN1A 1AMNA 2EJTA 4H0CA 4XX1A 2X6RA 4QFMA 1H2RS 3EUWA 3UYKA 1K8RA 3B1FA 1M5TA 2B61A 1YKGA 1C4XA 1XRPA 2HREA 1RR6A 3G85A 4RNDB 4XR9A 1H3EA 2HXSA 1JDZA 3D6AA 1YTUA 1FU4A 2E1BA 3BWCA 2ODPA 4JT4A 1CJCA 1E9CA 4KI0A 4A10A 1SXJD 2WFLA 4WPGA 3P9NA 3IBYA 3WLAA 3VPHA 3GLGE 1NR5A 5LMNB 2FMKA 1WDKA 1NBHA 3KSDO 1E6WA 3O4JA 2ZRIA 5K3AA 4JK3A 1F3OA 1G16A 5HEKA 4PRZA 4JASB 1Q19A 1T9BA 2OV2A 2P5TB 2YJTD 2ZJZA 5EP1A 2FZWA 3ANMA 2AWOA 4UEJA 1WCIB 4UEQA 3THRA 2WI8A 1KIMA 2XGSA 5K05A 1JJ7A 2VXCA 5EE3A 4AJJA 5DI3B 1WHTA 2VF4X 4KIJA 1GFWA 3S0JA 1NZFA 3JASA 3IUEA 3V1KA 1DAPA 2FXVA 4KJZA 3NKVA 2Q4BA 3ELBA 4S1TA 5FTJA 5FR1A 3WMXA 4PG4A 3TCXB 4S24A 3DL4A 4NV0A 1BYIA 4GXQA 3DE3X 3V4VB 5JMTA 1PJ6A 2H2HA 4RELA 1G17A 1BJKA 4XWOA 1L8QA 3VX3A 1PDWA 3L0ZA 2YWCA 4B9EA 1TL7C 2I7TA 3F6EX 1L5OA 5FJIA 4BLTA 4OEHA 3MF4A 1NVXQ 3MUNA 3DXZA 1JV2B 2ZJFA 3DEFA 4XIIA 3T99A 3NIDB 4FYVA 4N5DA 4BAZA 3OUUA 1YUNA 2DTDA 4UFOA 1U98A 4XD7D 1OC4A 2IIQA 4N65A 3VDNB 3QVUA 2OOKA 2PMFA 1DEXA 5G0SA 4F9TA 4IDDA 3Q12A 1BLIA 1T8TA 1WDWB 2BFFB 2AN5A 3AIMA 2J3HA 2LW7A 3KZVA 5ER6A 4CG2A 5I01A 3O8RA 1JAHA 2QX7A 4L5BA 4BQIA 4YUYA 3IV9A 4CIYA 2DWUA 1UC9A 1B8PA 2A78A 3BQ9A 2AQIA 2WMYA 4R1MA 6NULA 3MIZA 5DGDA 4F97A 1OA1A 1JMKC 4O4IF 4R1PA 3VZDA 3KQPA 4UAVA 1R4MB 3KDPA 5TMDA 2G83A 3ZN2A 4O4IA 2IODA 2IE0A 4ABTA 1KO4A 1Z28A 5LZ2A 3WNVA 4MPRA 1BE0A 2CLFB 4QYXA 5J2TF 3EPPA 4Q1BA 2QM8A 4AG6A 1YLOA 3CD6B 3LRPA 1EX7A 4B34A 5J2TA 4XCQA 2Q9AA 3EGOA 4JJGA 1MJGM 1UZUA 3CZMA 5CVVA 4L5JA 1MR3F 2KHZA 2OYCA 1NRWA 3TVDA 4BQOA 1ZMRA 1KDPA 2OB2A 3G1WA 1U9YA 3NASA 2X58A 3OTQA 5I7AA 5M3BA 1PW7A 3GN1A 5DYGA 5A5EA 5LUAA 3CO5A 4JB2A 4R7GA 5G3YA 2FP4B 4M0UA 4F6LA 1Z5ZA 3GY0A 2JIZD 1JXMA 1V7CA 1WZIA 4TWIA 3S1AA 3JW8A 3HSYA 4AX4A 1ZRSA 2P2ZA 4IICA 1RBMA 2Y93A 3KPVA 3CSDA 1EK5A 3RUAA 1GOTA 2NO5A 4OYHA 5KTKA 5KTNA 3KTOA 2G06A 3C5HA 1X1CA 2PGOA 3I52A 1C8BA 4FCVA 4I4CA 4D46A 2BISA 2P65A 5IX8A 1G3MA 1YIOA 2RAPA 3DGFC 5E7QA 2GXQA 3C6YA 4JLMA 1I5RA 1KJ8A 4D9CA 3BXOA 4FFMA 4QUDA 2IH5A 2I2CA 2W2TA 1KDZA 3KJEA 1Z6GA 3C6XA 1GZ7A 3R3YA 2IC5A 3JU3A 4EGQA 3ODGA 4CUZA 1ZIPA 3RRXA 4ZTUB 3T7JA 2CF4A 3DTVA 3L7LA 4RM2A 2LCQA 1EIZA 5FWNA 3K05A 4OHMA 1XX6A 4OO3A 3WJ2A 4GM1A 3CLUD 4YQFA 2EGUA 2JZOA 2YINC 3TXAA 4ACBA 1U9IC 4NE9A 3RE1A 4HTFA 5FJJA 2GX6A 4NYJQ 5IAOA 3V1UA 3KL2A 2OHVA 1NRXA 2FZLA 2WINI 1G19A 3AWDA 2P0YA 2PUJA 1OXXK 2ODBA 3CUEF 4GI3A 1C8VB 4AG3A 4RDHA 1E7SA 5IASA 1SG0A 2FGKA 2GZMA 4KL8S 3SOZA 3NWEA 1K3UB 1OH5A 1N7JA 1SUEA 2XB9A 2P9FA 2YVLA 3KOUA 3Q10A 4EG0A 2BM1A 1Q3TA 3PXXA 5IN4A 4XWYA 5JCOA 3QVLA 3ABQB 1H4QA 2ACWA 3TQSA 3RJMA 1H8EA 2IOFK 1EK0A 1FUUA 3FCAA 3Q9LA 4M87A 5EESA 3T5CA 3TN7A 1H9AA 4U0JA 4Y9SA 1GVNB 3GFTA 3M89A 1N3LA 5LLTA 2PUVA 4OI1A 1BGWA 3PCRB 3T7SA 1G59A 3REOA 1V5EA 4GPBA 5IDQA 2ONCA 3HKBB 1YS7A 2WNIA 2WZNA 2VZ0A 3D4BA 1NW7A 3F78A 4DEYA 3JQGA 4Y2VA 4C76A 5LNK6 4B33A 1KNXA 3RFXA 3EDQA 3JPWA 2H18A 3K6JA 4XCVA 3U6BA 2NSLA 4MUHA 3RSHA 3S8YA 4XDYA 1N5KA 2CSUA 1ILWA 2IVZA 3QVWA 5IULC 4F5ZA 3DWFA 4TN5A 3NRCA 1IJEA 4HOYA 1SHJA 4IUCS 1DHRA 4FFLA 5I3ZA 1VI6A 4ARIA 3CUSA 1PZNA 4LYHA 4V2UA 2B83A 1FMFA 2XA1A 3TQTA 3VX4A 4DLWA 4DCCA 1JWLA 4XWAA 4PU0A 5I9TA 3SEJA 1G7CA 1O95D 2VYVA 4AF6A 3HUUA 4XM3A 3ES9A 3HXLA 4JT8A 4TQAA 5EXPA 4WUVA 2B9EA 2R1TA 3H17A 1S2IA 4L8JA 3I2GA 5A89A 5AVJA 5CCEA 1T3TA 4PAWA 4IIEA 1ML4A 3K6SA 3FKSD 2I4MA 5KYYB 2IY8A 1GXSA 3ZJUA 3CT6A 5DVZA 5B1HA 4R1QA 1T8UA 3IAS1 1OUMA 5ALIA 2Q8QA 2WWIA 3MMZA 3H05A 1KZ6A 2ZPAA 3Q40A 4TV8B 5DMHA 2G7MC 3SS7X 1S0UA 1ZRNA 2DT5A 5BVHB 5TIIA 1II9A 2QVCA 4W7HA 5DASA 4RKFA 1B0AA 1Z56C 1S7CA 2AC4A 4J4BA 1M6VB 3L8EA 1P1KA 1EUCB 4EOGA 2BL4A 3BC1A 1RWMA 2Q3DA 4R2LA 3L4BC 1UIRA 4C6TB 1C4KA 1L7BA 1E2KA 1FQOA 3BGIA 1EHYA 1V11A 2BW0A 3V3TA 3WK6A 3ZJ5A 3RANA 1E3JA 1H2YA 1PSDA 1A71A 4GKBA 2GESA 4NMMA 1K3FA 1UD3A 1PZHA 1H5NA 1WMSA 2YHBA 1ZM2A 2RGBA 2ZM5A 1MH9A 3NCHA 5H7XA 1XZJA 3NM6B 5JAMA 1XTTA 1MAHA 1SC1A 2EFCB 4L9SA 4PW0A 4XVQA 3UJHA 3N8KA 1LWOA 1P60A 3DF7A 1NJFA 1TUGA 1RWVA 4KK3A 4P38A 2B98A 3TTXA 2QVGA 3ZBQA 2FPIB 1R9JA 4H6VA 5K3EA 5KKAA 2QUZA 1E9RA 3RVSA 2YFHA 3NEJA 3LX8A 3JARB 4II3A 1TGVA 1OREA 1WOYA 4KFSA 4Z3DA 1D9XA 5DTMA 5TEVA 5B55A 1A69A 4HS9A 1E3QA 3HVKA 1MKYA 5ARBA 2W2QA 4PV7A 1SQSA 3RY8A 4CWAA 2GKOA 1NT2A 3JQ9A 4F92B 3BXZA 3PGLA 3RRNA 3COJA 3DE0X 2P90A 1R0SA 2A92A 3TOVA 3EW9A 1BS2A 1M6HA 3ANYB 4WXMA 3OEHA 3B1XA 4PLCA 3HDGA 3TNLA 3SICE 4RK1A 4EFDA 1V1RB 1VQ4B 5KWIA 1Q3HA 4Z0PA 4RD1A 8GPBA 2Q9UA 5EUMA 1BJRE 2V6FA 1YJ8A 2CBXA 3JWPA 3L0PA 3VH3A 1BMTA 3GPLA 3HR8A 3W5CA 1YB6A 2VKQA 2Y76A 2VDUE 2CJFA 3R0VA 5ESXA 3WGOA 4X7MA 4K0RA 5HOEA 1KP9A 1QSGA 4JOBA 2OWEA 5BWBA 1YK0A 5FTNA 1KOJA 2Q5CA 4IZOA 3H1AA 1K8AD 3ENZA 2C2HA 3P0EA 4BNUA 4YAUA 2NSHA 1UWCA 3W5JA 4HF7A 1DEOA 1OFUX 1QC5B 2EW8A 4EA9A 1P33A 5DM70 4DUYB 2AL7A 1AVTA 3QFCA 2VAWA 3PI6A 4D9HA 3A6PC 4B3RB 2JEOA 2VVTA 1I3CA 1W4CA 1X86B 1T8RA 2VATA 1MTOA 2ZRHA 1DO0A 1F17A 3A1NA 4KR9A 2X1VA 4M37A 1GPBA 2HJWA 1E32A 3PWKA 4FGJA 1EA7A 4IJKA 4MR9A 4D43A 4HN9A 4RVSA 3FHOA 5IZ4A 1VE5A 2I91A 1FS4A 1RI2A 1I80A 2NU9B 1HG0A 4OTZA 3AVWA 2A3NA 5IKMA 3BCFA 4K9PA 1Z6AA 3EJ6A 4E15A 4RCZA 3JZDA 4L5IA 1USIA 2WQ7A 3HDJA 3LE8A 3OG9A 5H0IA 5KNDD 4WLNA 3J81A 1RQGA 1UPXA 1STOA 2QRGA 4FYXA 4YXWA 2A5DA 2H48A 2LCIA 3FPPA 3AFNA 1I3KA 4GVXA 1HOXA 1BXZA 3QTTA 5CIYA 1G64A 3AI3A 3D8TA 3UMCA 1KYWA 3AINA 3QX9A 4QQFA 5FOUA 4PYKA 1SUSA 3QE3A 2Y9MB 1Q7YD 5A9TA 2FNAA 1NZDA 4RFVA 5LDGA 1TZKA 3EH1A 4R9RA 5DWDA 1D2EA 1WXEA 3COYA 1M2VA 4R8KA 3V33A 2X13A 2VPYA 4NC9A 4CKCB 1B1CA 1N2OA 3B51X 4XGRA 2OGWA 3D1VA 3OMWA 4GO1A 1RJWA 4I1SA 2G1JA 3CMEB 5C5CA 2V8BA 3R6JA 1YRWA 4IX1A 3F1LA 4WKOA 3PENA 1VXOA 2YHIA 1N4DA 1JIJA 2WLTA 4G6IA 3A9WA 1FTGA 3HXKA 4J8PA 2AN3A 2FX2A 2PZ8A 2JB9A 2PAAA 4BASA 2WUDA 2AMJA 3CC4B 1KYZA 1P9OA 3OZBA 3U9SA 2A1UA 3FNBA 1DEHA 1ONBA 5D87A 4X7RA 3WK5A 1YZTA 4EHHA 3HXQA 1SCUB 2PO5A 3T15A 4DDTA 4BUZA 2C3MA 1W0JD 4LCEA 3L8CA 2WJHA 2JJQA 5AIAA 2CLOB 5LP6F 3JQAA 2GREA 1YAJA 4I50F 5FWAA 1HI9A 5DNCA 5D01A 3SR4A 3PXGA 3VU9B 3VPSA 5LP6A 4I50A 2B8JA 1NAHA 3QX7A 1KC1A 1S3IA 3FPJA 1I4DD 4GMDA 4KDCA 4GNRA 1NLZA 3P19A 2PR7A 4PSCA 3SGLA 3DVRX 3Q7PA 4G4SP 5L3RA 1V7ZA 4NYIR 3RARA 3KHKA 1B1AA 4ZAXA 3V8RA 4YONB 3U1TA 3VBCA 3X1MA 2PKQO 1ZK3A 1UJ5A 2PKCA 5FNVB 3CONA 1A8IA 2ODWA 4U7FA 3VUEA 1VFPA 2VRBA 4HNUA 2OUKA 3N0XA 4X3CA 1RJDA 4JLVA 3FRJA 3VVBA 5CX4A 1JEYA 1VJSA 3EXFA 5E6TA 4HDQB 5CB6A 2P6MA 1EFAA 2JK1A 4MVJF 3M1LA 3MS7A 3SIRA 2Z2JA 2E55A 2QRVB 2FE4A 4CM8B 3OZ7A 2OQ2A 4MVJA 3ZNPA 3IQIX 4TWBA 4N3NA 1I6KA 1A9XB 1FVXA 1W1IA 1U4NA 3T7EA 4KXWA 1LV7A 1GRNA 4QECA 3SBDA 3TX6A 2VXBA 1C9KA 2QXUA 1H2HA 1XVIA 3ULKA 1JDJA 1Z4OA 3GPDG 1XMSA 2CE2X 1XFDA 4OIMA 3UAGA 4O08A 2PUCA 3P27A 2P79A 4G1VA 1SFRA 5DM60 3RYCA 1N2HA 5DHFA 4OHZA 3G9XA 2HK8A 3N2EA 3CCUB 4Y6SA 1XA4A 4Q82A 4A1FA 4M0FA 2R8OA 4U9HS 3LA8A 1ND6A 3MG9A 4DNFA 5BR8B 1LTQA 1RZRD 4Q66C 4R2JA 3JQBA 4MHTA 1B26A 5DW0A 2ZQ5A 3ETEA 2HMUA 1KVQA 5FADA 2XVZA 4W5WA 2UXCB 2GK3A 3RJTA 2PE3A 5IAAA 2B7CA 1UOEA 4D4GA 4JR1A 1Z2CA 4IF4A 4FLMA 3X3HA 4QIHA 4F4JA 3O3CA 1NF8A 3N9IA 1XAJA 2CL5A 5H68A 1EX9A 3DKVA 3SZMA 2IYFA 3VHXB 4NJEB 2BYTA 1VQ7B 2VTVA 4TL9A 3SXUA 1EXDA 2OC4A 1K7SN 3WNZA 2ZTSA 4C06A 2DOGA 3A2NA 1SUIA 3EAQA 5A4DA 3CLHA 4ZU6X 1FW8A 1JBEA 1ZUHA 3JQ7A 4IGKA 3DOEA 5G4LA 1WXQA 4IIFA 5B2EA 1AUOA 4L7QA 4A82A 1FXWF 1YASA 2IK8A 4N7RA 2YN4A 4V24A 4C7MA 4UOEA 2N75A 3ZV5A 4EG4A 2XRFA 4JYPA 3BH0A 1FXWA 1ZUNA 2H6EA 3PPIA 1SH7A 1GPAA 2XMPA 1QJ4A 1ULBA 1FJXA 2G04A 4CU2A 5FO0A 1UBSB 2Q45A 5LA6B 1AZWA 9ABPA 4UUOA 2RH8A 1KEZA 3B8HA 3BY1A 1RYNA 1TK3A 1C5KA 3I53A 4CL3A 1ETUA 3WK8A 5EJ7A 3U60B 1ZHOA 4HBGA 4DJJA 5G40A 1E0AA 5L40A 4XQ9A 4O8ZA 5TVKA 1MOSA 4J3NA 4Q4AA 3UG7A 1GGVA 2X8WA 4WNCA 2GRUA 4JLSA 2DY0A 3AR2A 1TJYA 3DNPA 3TO5A 4D5GA 3BC9A 2CZGA 1Q1EA 3P4YA 3GSIA 3HB9A 4M0KA 1TM1E 4RE6A 3MFYA 3IBTA 1JLLB 1UDBA 3UMFA 3H6HA 3LT1A 6LDHA 2J07A 3IAXA 3NKFA 4J6EA 4JGBA 4GR5A 4ND2A 3SZOA 4UASA 4BMZA 2YV3A 4YRGA 3Q7QA 3PX3A 4AX8A 3WHIA 4CM5A 2R6ZA 3DDSA 3BE6A 3GGCA 3PPYA 1WG8A 3NALA 1QS0B 5ILQA 2H85A 1T6ZA 1VJ0A 4N7MA 5BQOA 5U1PA 5KJ1A 3IE1A 4A4DA 3SZGA 1E3IA 2GI4A 2XQFA 3DVQX 2F00A 2ZTVA 3IEIA 3AJ8A 3QVVA 3VDXA 3WGMA 3C98A 3G9UA 4E33A 2BKAA 2Q62A 1XD2A 5A6VA 4Z7OB 5LU8A 2Y1XA 4RPKA 1MFZA 5L7WA 1RE0A 3LPNA 4BBAA 4Q3EA 5FO1A 3N0RA 4DA6A 2B25A 4GX5A 3OZCA 1R5BA 3LYLA 3DVLA 4Q02A 4WN3A 4U0KA 1BVUA 3N2NA 5EJ2A 4BJHB 1C3LA 3IULA 3GEHA 4MRVA 2HW8A 3UKOA 3O0DA 1JHDA 1HZJA 2XKBA 1AZLA 2AW5A 2RGNA 5IUKC 2H52A 4JC5A 2GXAA 1QCCA 2HF2A 4NR0A 1H85A 3QXGA 2GT1A 1P1IA 2PKQP 2IS2A 1YBMA 4YPFA 4P3IA 4PR0A 1GLNA 4R2XA 5KSOA 2YN2A 4UUBA 5CDTA 4RKYA 1EUDB 2EZTA 5AUQA 3ZQJA 5LQDA 3UV7A 4C29A 3A2LA 2NTYC 1QONA 1CVIA 2C2BA 3UMJA 1ZI9A 1SURA 3DMHA 3EOBI 1CRZA 1F60A 1NXVA 4IDQA 4PZ0A 5CJJA 3NHRA 1T43A 3LVQE 4I4NA 2HBZA 4KGXA 1GPMA 4L22A 1D6NA 5T8KA 2YWEA 3KFXA 4XLCA 3SDZA 3ZHXA 4CU5A 2PK3A 1ZUD1 5CLJA 3LP8A 3PEFA 1PZFA 1NF3A 4OQ4A 3PF9A 2QK4A 2G70A 4DR5B 2FFBA 4JJ6A 2OUIA 3AUFA 2UAGA 1U2QA 3E7XA 4NY1A 4QRIA 4ZVVA 2RKOA 3PQ8A 2C4HA 3A2MA 3Q3CA 4GPAA 1PR2A 3G2IA 4CCAA 5KOHA 2ZWVA 1W93A 5JH7F 3LRTA 7REQB 3VNQA 5I8PA 1OV6A 3QLVA 5ARDA 4ZCQA 3W5IA 5JEDA 3IIEA 4HDRB 1EJBA 3EDOA 3EISA 3HKCA 2XMBA 5JH7A 4RTSA 5IDVA 3SHWA 1YDEA 2QMZA 3Q4GA 3ZWBA 4EY5A 4JI4B 1DEAA 3M1AA 4P58A 2ZIWB 1H0KA 1U2SA 2PD6A 3MD0A 4JVMA 3VNRA 4C4TA 3M83A 5DN6A 1QYRA 5A5DA 1NVAA 5A2QA 1GQ2A 1M8FA 1Y5MA 2QR5A 3THYA 2ES4A 4C0WA 1VBFA 1HOTA 2H00A 3AUTA 1JIVA 1N92A 1S1CA 3NUGA 4ZCLA 121PA 4LMPA 1W36C 3GEMA 3KQLA 1N1MA 2KYRA 1NW6A 2UYYA 1YDFA 3W2GA 2ZJ7A 1FA9A 1NBMD 2PX2A 1KIFA 1XMPA 2D4AA 3AERA 4XUCA 5EKSA 4BNDB 1QLHA 2D5IA 3D4NA 2EDCA 4LY6A 4JFRA 3TBKA 1PF7E 3A9TA 2OXFA 1EGHA 3Q5GA 4FEAA 2CVHA 4LUCA 1O6BA 1P8AA 2H8KA 4MYUA 2XYHA 3KKPA 4PS0A 4UCXA 3AEKA 1W36B 3IERA 4U2EA 2ZYTX 2RK4A 3KEWA 3I56B 3OCUA 3S44A 5EY5B 3R3HA 4FDLA 2D0OB 4A23A 4EUEA 1LDEA 1WQ4A 4HGZA 3C41J 5CH3A 1U7PA 4WERA 4CM4B 7ADHA 3LUAA 4QBTA 1RRMA 2FFAA 4RPHA 2UXDB 2PIAA 4FIDA 4N39A 5JASA 3V8PA 2WYWA 3LW8A 4KIWA 4CMIA 2F67A 2GM9A 2CHEA 2PUFA 1D0SA 3ZDBA 1JJVA 1HDEA 3IMFA 1JYFA 5D7NA 2QW0X 4LTDA 2IYZA 3OEED 1JR6A 2VO1A 5AVUA 1Q6ZA 4G37A 3FUXA 1E9VA 3GFVA 4KXYA 1ZNYA 4J7AA 4Z9FA 5DPMA 2JFHA 3RK1A 4HNHA 1ZOOA 3S2SA 4C0BA 2YS7A 1PNVA 2PMKA 1AKNA 1NVFA 1RPJA 1EGQA 3G13A 3PFCA 4NZPA 5JCZA 3U19A 1WPGA 5TSDA 1O1YA 1I33A 5HQ3A 5KZMB 1QGED 1SQGA 2V0GA 1CRPA 4UZSA 1ES9A 5BV7A 1OFUA 5K3OA 1KOFA 2H11A 2Q1XA 2JLYA 2IOHA 1N6PA 4FZ5A 2XQKA 2I4TA 2YHSA 3BJRA 4WUTA 2D2IA 4EUFA 1VLOA 3IPXA 4HY3A 1QK3A 5IKEA 2HTEA 3QKRA 1KRXA 2HU5A 2VS1A 5FPSA 3ZWXA 1RP7A 2VJPA 3AONB 3QUCA 4MVJH 1X0XA 4OX9Y 2BE9A 3F71A 4I8XA 3Q6RA 4P9SA 3QITA 1CR2A 4K9KA 4R3UC 4W5QA 4KWTA 2CW5A 1FTWA 4YT8A 3HB1A 2E4XA 3T3DA 2FPGA 2OD2A 2Q0HA 4U3JA 2JAOA 2IUTA 1XCLA 4JYCA 3T95A 5LU9A 3RODA 2ZRNA 4LXTA 2FI1A 2Y77A 2FZ5A 3RYHA 2BDTA 4XTCS 2WKWA 3A1SA 13PKA 3PE3A 1T3GA 4B35A 2VBTA 3CUTA 2IYSA 4LJ7A 3I09A 3R0IA 1XZDA 4O2RA 1LU9A 2XTAA 4DQXA 2E6UX 2LBPA 5KI6A 1WM1A 1OJLA 1NU8A 1ODFA 4IIJF 5HF8A 2GAOA 4N3BA 3KVYA 2FVGA 2YXPX 5ARCA 1D4AA 3AF4A 3ECAA 4IIJA 2JGKA 1V43A 3A1PA 2BY4A 3GYGA 2OXRA 4YAFA 2HLHA 2NAPA 3OLQA 5FD8A 1TU3A 3B82A 3B13B 1O57A 3ABSB 4AKEA 4EGAA 2HDNB 3TPCA 3D64A 4BMDA 3UENA 1EM6A 1VE1A 1OIXA 4ZVKA 1DAGA 3OF5A 2MSWA 1AKEA 2QLMA 3TRJA 3B1YA 3FNGA 3KEOA 3OTGA 3H1GA 5H8WA 1RXIA 4LXQA 2Z95A 4OB8A 5K6TA 3K0AA 2A67A 2H2GA 3DE4X 1U4OA 3F6CA 4LJAA 4UVEA 2IW3A 4O6VA 5EIFA 1XWFA 5KNBA 1ZZEA 5CDFA 3B1JA 4DPKA 1MA0A 4K26A 2NVUA 3VKUA 5KC9A 4NZ9A 5FUQA 1D7OA 4MW4A 4OJQA 1C3OB 2C20A 1JTFA 5GADl 5F9FA 3C3EA 3W7AA 1DRJA 3D43A 2VUTA 5KQLA 4R5HA 4D79A 3I5YA 4HEA1 1UKVY 1SBQA 1VJTA 4YRPA 5EERA 3LHFA 4LFCB 2GXSA 5BW5A 4HDSA 4HS4A 3G0IA 5HIIA 1XEAA 1DXHA 4EHJA 4EMSA 1EVEA 2VHWA 5CP8A 3AETB 1U2GA 4IDFA 4JI7B 2YOGA 2EFGA 5JALA 3KEQA 1M75A 3FIJA 4M8NE 1Q5PA 2PJUA 1LPNA 1JXQA 4CF4A 2HFJA 4HAZA 5IBPA 5IDWA 4PQYA 2G36A 3K1ZA 3IQEA 1L5NA 4DAOA 3KM0A 5JO0A 3GPIA 4X60A 1SIUA 2IYVA 3LVBA 1H5QA 1IBMB 2V7QA 2OC9A 2XKKA 4DB2A 1EINA 2AFHE 1E69A 1VHDA 2Z2ZA 4YAEA 2PQ2A 1W47A 3CC7B 1W4RA 3Q87B 1X15A 2BZSA 3OT1B 4KGZA 3LBNA 4DCPA 4X41A 1LXCA 1C8KA 1ZCBA 3SYLA 2VSNA 4A91A 5JSUA 3OE7D 1ZR2A 4NNOA 2NU6A 4G1CA 4AU1A 2CY0A 2UVPB 3I34X 3AEUA 4HAYA 2ZYRA 5AK5A 3KZMA 1YB5A 1G8MA 1G2IA 2E4UA 4FGLA 4DEXA 5P8WA 2CVFA 4MSUA 3IHLA 2CC2A 5KQSA 2GBGA 1NWCA 3KJGA 4RK7A 3FTQA 3BSYA 5ALJA 2I4NA 2X0NA 2CKMA 2XODA 4TZ6A 3L7CA 1IRXA 4QD3A 5DFAA 1SHTX 4D6XA 4ZCIA 5CDSA 1ZMOA 1PJ7A 4Q9DA 2AEMA 1SC9A 3L8FA 3E22A 4DABA 2P9EA 2RHWA 2VOEA 1Q91A 1NJ1A 3CZCA 3W9SA 4GF5A 3H2GA 2HYDA 5G2OA 5CPFA 1VPWA 2PZGA 3EJWA 2DPLA 2R6FA 3GRKA 5A0TA 2J09A 2Y99A 3ZBPA 4WZKA 1JFLA 4E1BA 4OOFA 1OGYA 2BM0A 4QEZA 1ZSVA 2H4YA 4L16A 5EQTA 3P4UA 1YT5A 1PWYE 3T56B 4A26A 4ALKA 2JVJA 3CCJB 2X3UA 1H23A 1K75A 1UWKA 2JVKA 3C7DB 4YLYA 2MSKA 3E20A 4MINA 2GTPA 2OSVA 5JY6A 2QW1A 2ZG6A 2FPLA 2J4DA 3HYTA 4ZOLF 5ERXA 4TL6A 4DDVA 5JWOA 4F7WA 4DCTA 2Y0DA 1KH3A 5KWEA 4ZOLA 1QAMA 1UP6A 3TGPA 2X6XA 4OOEA 2V3CC 1W30A 1CQJA 2R62A 1I5OA 2FRDA 4IH9A 3AP2A 1R0WA 1I6MA 3P2MA 5HKKD 4WMLA 2NV4A 4N7JA 5M29A 1AMUA 1FTYA 4ALNA 2JAUA 2PYIA 1ZK2A 1J8DA 1XQBA 1PR6A 2ESRA 3D4OA 2FW1A 3UPDA 1YU9A 1M10A 3ZU2A 5KWVA 5FA6A 2UU9B 5KYKA 3V1MA 4PRYA 4MDEA 4FX5A 1CJBA 4HPWA 4BVBA 1WD7A 4L0CA 3PGMA 1YUBA 3JQPA 5TE9A 4IO1A 2CXOA 2C2YA 1SR8A 5H70A 1UBJS 3UFBA 4E14A 3TEJA 3FDJA 5MN4A 1LA2A 2PUHA 3W5BA 1PGJA 2H9AA 4IYRA 2IXDA 4JVLA 2ZU0C 3VPAA 4D3YA 5ITZA 1QO0D 2HBYA 2MTBA 2JGDA 4OOVA 1BCRA 4KJXA 4N5MA 4WBNF 1WBBA 4CDRA 4AKSA 1WXGA 1FP4A 4TTAA 4WBNA 1RC8A 3V1NA 1WRBA 4NEQA 3H5RA 1QOZA 3KCNA 3OU2A 1EP1B 3IUNA 2IEZA 1BC5A 2MSCB 3NJ4A 4PXSA 4NU0A 2NQ8A 5E1MA 2OD9A 4C2TA 4HNAA 4E0BA 4HFJA 3WRYA 4TZTA 3N87A 3PL5A 3NYQA 3P2EA 5JBIA 4C4XA 3ITDA 2XSZD 4BO8A 3TDKA 4JJIA 1QHEA 1IUOA 4R16A 1N7HA 3EIUA 3LXRA 3L4JA 2XT0A 5KPDA 1U3GA 4HBZA 4DR7B 1AQIA 1M0WA 2UYGA 4GOOD 5LJIA 1XKLA 1TVMA 2A9FA 3PCXA 4KKXB 3OMLA 4NU5A 5ALLA 1L0BA 2GARA 1ONSA 5AW5A 5YASA 1HE2A 4URUR 4QRHA 4IHJA 2ZBRA 3MT9A 5BSWA 3KXPA 1KJNA 1LBIA 4UJ5A 4RETA 4RK4A 5U4QA 5DT2A 4H60A 3C85A 3P0IA 4UZFA 1PL0A 1PZGA 4L15A 3ZVNA 3ZCXA 3OCJA 3E4DA 1UXKA 2IOQA 4OKSA 3OX4A 1T5IA 3RK4A 3VNAA 3E9QA 2P6UA 3V34A 1DKLA 2ACEA 2PVCA 1P0MA 2DTXA 3TCKA 1J21A 4YI5A 3BH4A 1I3NA 2J5KA 5BRNA 4BVHA 3DA8A 1W19A 5HZBA 4ZAYA 2EFEB 3ONFA 2PRSA 1GQOA 2DG2A 4KXVA 1Z6TA 4KVAA 1MJ5A 1LBEA 5FULA 5BUSA 5ITVA 1ZM9A 4E21A 3JVUA 2XUJA 1SVWA 4RHUA 4ZO9A 4P92A 4BUJA 3KETA 3GLTA 5BSXA 2AJDA 4Q7QA 4UBJA 4MVJM 5KSYA 2NVOA 4R5MA 3EGVA 5K8VA 2PS3A 3EIQA 4P7KA 5B3LA 4MUJA 1U90A 4ZDJA 2D2FA 1YZLA 4BEBA 3H4VA 1XALA 3NDJA 1PJ4A 3F5SA 1PFKA 1XZGA 3S1AB 3EXG2 2VZLA 2FPWA 2GRAA 1JSZA 4UM7A 3BJIC 4BNGA 4DQKA 4FKBA 4U7WA 1RACA 1KO1A 4KXNA 5D3MA 2OFOA 2YJ6A 5CDYA 2HNKA 2O48X 3OOCA 2OWDA 4I4IA 4OK6A 1HTTA 5CDHA 3PX2A 1JHUA 4MDYA 4KDFA 1TQDA 5H16A 4Y1FA 1HDGO 1UWLA 4AW9A 4G4JA 3ZVMA 2WD7A 4ABYA 3ZHZA 1KR5A 2WZBA 1MU0A 1N8NA 2XVMA 3H84A 2B30A 3KLOA 2A84A 4C21A 2H3EA 2OZVA 4GX0A 3W4KA 3QU2A 2HMAA 3CJTA 4UFPA 4QXPA 1XHFA 3DTVB 4QT0A 1TTQB 1Z2NX 2P5YA 3N2IA 5LBTA 2UUOA 1SUFA 3EGIA 4HB4A 4ZQEA 3UUEA 3EPKA 3GXBA 1NP3A 1J97A 2D0IA 3RR2A 4YBRA 4ARBA 3C6BA 3R3ZA 4HTFB 3CVYA 2Y66A 1XZMA 4TXLA 4XW2A 5HUJA 4YQZA 1NV9A 5KNBH 3DW3X 1KRWA 9ATCA 4DWJA 1GKYA 1MQAA 1XRRA 3HNPA 2NZJA 3NZEA 2ZKLA 1S9DA 3I9KA 3VNVA 4CR6A 2VBCA 3ROKA 5I7HA 5KYWA 4B5KA 1O6CA 2V5AA 2XB4A 4KN5A 1XQ6A 4AO7A 4DM7A 3DEAA 2WQ6A 1O94A 1TT5B 1OIVA 1YV9A 3C1AA 4MS3A 5KIAA 4F3KA 5JC8A 2CDNA 2QT1A 5IFLA 3IMEA 4M9UA 2DWPA 1ZM7A