2QMUA

Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the gtp and the gdp states
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 78
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qmuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qmuA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qmuA01
2MMCA 4Q4JA 4K81B 3E2IA 4YXWA 4HE6A 2BCGY 1MT0A 1P2SA 2XTZA 1QHYA 1YJ5A 1SKYE 2ZJZA 5HKKD 1W5SA 1P9NA 1ZCBA 3EPHA 3OF5A 1OFUX 2X77A 1UDXA 2Q9CA 3EZ9A 3M1IA 5E95A 4ON9A 1DAFA 1JNYA 4AF7A 1CR2A 1Z47A 3AV0B 2SHKA 2DERA 1VQMB 5CB6A 4CEJB 2XTMA 2ZM5A 2D7DA 4EPWA 1LS1A 3K0CA 4ABYA 5L3VA 4GOKA 3O8RA 4WZ6A 1ZM9A 2N42A 3QI2A 4B2PA 4LI0A 4LYAA 3SFVA 1JECA 4HEJA 4MDFA 1KK2A 4D4KA 3PR1A 1CJMA 2P6UA 1AGRA 4V02A 1NJID 2IS1A 5B57C 4PPNA 2QP9X 1XB2A 4LGMA 4QKQA 5FUYA 4QOSA 4HLUC 1ZUNB 4A6XA 4JS0A 3WNBA 4IDHA 5AK0A 1AS2A 3RVBA 5D3MB 2RGNC 3W2IA 4Q9LA 2FE4A 4H1UA 1VHTA 3ZDQA 1J2JA 1E2PA 3E1SA 3K09A 1W0KD 5HCIA 1Z0JA 3DPUA 3LLUA 4P4SB 4A92A 5FTKA 2IYSA 3ZZ0A 1BKDR 3QUSA 4Y7CA 5TV2A 1S8FA 3AVOA 4MKFA 1XJQA 2YVUA 2J0QA 5L3QB 4P3YA 2QAJA 4QL3A 2QM8A 4EIWA 4JT4A 1IN8A 3NKVA 5CIWA 1F2TA 3K0AB 1OIXA 1BOFA 4IRUB 3QVUA 2QZ4A 2NO1A 4OYHA 4UXHA 1KDPA 3SN6A 1OKKD 4HZUB 2PLFA 4PTLA 1KI2A 3J81k 4KO8A 2XZPA 1SXJB 3FPKA 3AGQA 5KNDA 5LB4A 4URYR 2WWHA 2V1UA 2WWYA 1KQSB 1XJCA 1WRBA 1C4OA 3DOFA 2XEXA 4JT2A 5D3QA 4KFUA 3CLVA 3HWSA 3IUYA 4FMCF 4KLZA 3JQRA 2ZRCA 1XPOA 2BJVA 3NC0C 1EG7A 1XXHB 2GETA 2QU8A 5JZVA 2OEPA 2JLWA 3P20A 2JJ1A 4WXRA 1ZM7A 3P4YA 4IDNA 2QG6A 2ODEA 4JLJA 3RSOA 1KI8A 5EP1A 1DEKA 2AD5A 2OHFA 4H1VA 4BLRA 1ZNWA 1R5OA 3BFXA 3DKVA 3OESA 4TL6A 1U0HC 4OHXA 2BBTA 1IONA 5AJYA 2Z5FA 4BFXA 4Z1MD 2QQEA 4EKDA 1EWRA 1W1WA 3QIAA 1UBGA 2F43A 1N6LA 4AG5A 2ZJBA 2ZYVX 2NPFA 4QGFA 5F98A 1E98A 1QF9A 4R2IA 2NQ2C 1F2UA 4KVGA 2UVQA 2ZR9A 2F1HA 5AN9A 2NO9A 3VAAA 3WXMA 1TAGA 2OILA 2GCPA 2KBFA 1COWA 5HE8A 3CWQA 1KGDA 3CRW1 2V7QD 1U98A 3OAAA 4C30A 1ZM4A 2XTNA 4WZAE 1SXJE 4KAXA 2IWHA 3WYFA 1BX1A 3EASA 2YOGA 1JA1A 2FFBA 3ZYCA 1E1RD 4LPKA 3VKGA 2UZ3A 4M1WA 2B5OA 4PHFA 1CR4A 3HU3A 2V1XA 3VNUA 4JSYA 4G5GA 2ORVA 1N3BA 5EMNA 2B7CA 2G3YA 1X1RA 3DOEA 4RFSB 2MSDB 3GEIA 1XXHE 4A8JB 4B76A 4Q4AB 4QHSA 3N2EA 5J4VA 3ADDA 4ARZB 1QVGB 3VHXA 4U5XA 1G3QA 1AA9A 1ANKA 4M1TA 4EDHA 2NMVA 3AF0A 2C78A 1XMVA 2BBWA 3ZBUA 1OIWA 2BEKA 3WP0A 2GEVA 4FCVA 4G5RA 4WIAA 1DVRA 4B3FX 2RAPA 1DAGA 3QENA 1ZW6A 4HZIA 4Q4JB 1P75A 4JLVA 1CU1A 4TMTA 2BEJA 4URVR 3AVYA 4LY6A 1Q57A 3EXAA 4MGIR 3RS5A 1YZLA 3RC3A 2QROA 3A58B 1ZVQA 4C2UA 4M4SA 4EH1A 5JMTA 4TQAA 4IEEA 3ND9A 4CYMA 3SE0A 2FV8A 4MKHA 1E96A 3NC1C 3MUFA 2DWQA 3SYKA 1FPMA 4NYJQ 2J9RA 3UXMA 3FFAA 5LBIA 2QN6A 3PCRB 2HF9A 1QVAA 4M1YA 3TK1A 4GP6A 4BFUA 2XNDA 3NWJA 3AUYA 1IXZA 2PJRA 5CK5A 2P6RA 3CCQB 4L16A 5K8IA 2E1RA 2A7QA 3FMPB 2ZTSA 3KUCA 1MRSA 2F1JA 2ZUCA 1RVDA 2PCLA 3K9HA 3JQPA 1OHHA 4LJ6A 1U8AA 5C1BA 5IF9A 3OEED 2Y8EA 4U02A 1PLKA 1GKYA 3TRFA 2WPDA 2KB0A 1VIAA 1TF5A 2FG5A 3KQKA 4Q9JA 1P2UA 3ZJYA 2Q3MA 3W5JA 1OH6A 1X6VA 2GILA 4XH9B 2QTLA 3W34A 4W5WA 1YJ9B 4OI1A 4QM7A 1KY2A 2WSSA 3VKHA 2IUTA 4HB4A 3DKPA 2F3RA 5H8WA 4W9MC 1QHXA 2HYIC 2QBYA 2BMJA 2QORA 4KFSA 3TKLA 4N0DA 1JEDA 4C0AC 1GNPA 3LH5A 5G41A 4US2R 1YIJB 3KZ1E 3UG7A 2VP5A 4TN1A 3AB3A 4MGYR 4Q1DA 2GK7A 2QMOA 1VCIA 3UATA 4I4LA 2NPIA 1VQPB 4MKGA 5C4MA 1SHKA 2FJUA 4AIIA 4CDGA 1E62A 5FI0B 2IYUA 4F4IA 1CTQA 4B6FA 4Z8XA 1F2TB 1GKUB 4LYFA 3SR0A 5SZHB 2Z4RA 3KUDA 5KUTA 2QGNA 2DEUA 3VQTA 1E2JA 1K8RA 3L0PA 2O8BB 1OW3B 1U8ZA 2OM2A 4NCIA 4PHGA 3CONA 4BFWA 1W7AA 3L8YA 3GP8A 2WSMA 1J8MF 4Q03A 3TBKA 2W2VA 3MD0A 3IEVA 1AS3A 5EE5B 4C7OA 2W6ID 2GESA 2Q9BA 3GFTA 5E4FA 3ZIAA 721PA 5EP2A 2UKDA 3MWLA 3S1AA 1IAQA 1Q22A 1C9KA 1XPRA 4B74A 2GTPA 221PA 1T3SA 2FFQA 1JR3D 4B73A 2KI5A 1ZM3A 2QL6A 2VRWA 3C14C 4LJ8A 3CB4A 2PJZA 2CHVA 1I2DA 2F43B 1S1MA 1UADA 2AFHE 5DN6A 5HZKA 4C0JA 1YR7A 1GIAA 2OO7A 3IHWA 2JAQA 3I62A 3FMOB 4LBWA 5EZ5A 1F2UB 5JFGA 2CVFA 4V0NA 4EPVA 3QF4A 2HJVA 1H8ED 2J1LA 1Q1BA 2BWJA 4IDQA 4E03A 2IEZA 3VR2A 4XVUA 2IL1A 2VP2A 3Q9LA 3PXGA 4TZ0A 1DDGA 3T35A 3A6PC 1Z06A 2OCYC 3C5CA 5DLQC 3IO3A 1FNCA 2RGGA 3O8CA 4B3GA 4A36A 5F9FA 4LYJA 2LKCA 1ZIPA 5JJLA 1E0AA 2GAOA 1U94A 5C18A 4XWKA 1DAIA 3I72A 2OXCA 3SJBA 1BO6A 4MGZR 4UJ5A 3EG5A 4RKFA 2I3BA 1KDOA 3JZAA 5DISB 5FOSA 3MMPA 3OFND 5FBQB 2BMEA 2ZREA 3PUWA 1N0WA 4OQFA 4N0EA 3EZ2A 3Q85A 5EE3A 4UQOA 2WAYA 3L0IB 1SVWA 3ZVMA 4KSBA 5IK2D 5AR1A 1SKQA 3KXLA 4ESHA 4QGHA 3PV0A 1SVOA 1WB9A 5H68A 5FL7D 4YDHB 2FEOA 2QGZA 1J8YF 1G6HA 1HQCA 1PUJA 2XOKD 3V76A 3DEFA 3REGA 3CRQA 4C0BA 1NDHA 4MYUA 1XCPA 4YAOA 3CRZA 1CR1A 1XEWY 5AJVB 2C77A 4Q48A 3Q7QA 2GXQA 5FBLB 1G18A 1JAIA 4X8LA 3SBEA 1E2IA 4AI6A 4JBWA 1D8TA 3BXZA 3MJRA 4URUR 1YHQB 1I4TD 1EFTA 1P5ZB 4Q7MB 2R8RA 5TVKA 2ZUBA 4OHVA 2YJTD 1IXRC 2BKEA 2FFAA 4B44A 1ZBDA 2A5JA 4L4UA 4OJKA 2IWRA 3ICEA 5THXA 1XJ0A 1F6BA 3MJHA 1VQ7B 3EPJA 1ETUA 2VSXA 3A1VA 4EPXA 2ONJA 3QKSA 3BH7A 3KKPA 4JBXA 5JLJA 4B34A 2IUUA 1NJFA 3T06B 1BYIA 2WJJA 1TPZA 3TAUA 2QBYB 1Z0IA 4B3DA 1U0LA 4MUBA 5EQTA 1H8HA 3U7GA 1NF3A 4HB3A 4Q1CA 4XOIA 3ETLA 1W4RA 4A2PA 2CLSA 1II9A 3QFRA 3DVLA 1GO2A 2XJ9A 4NP6A 3PFIA 3B6EA 2VIIA 1JQJC 3I61A 4LPSA 4D6PA 3IBGA 2OG2A 3ZD7A 2H16A 3O8BA 4FINA 1KSFX 5LDDC 2H17A 2B92A 4P4TA 4W5HA 4LV8B 2XX3A 3UANA 1CEEA 2FPLA 1OFHA 1FNDA 2YWGA 1DAHA 1M1YE 2VYFA 2F6RA 4C0HA 3BGWA 2XSZD 4Q1EA 3A1UA 1RJ9A 1Q86D 2AHOA 4LHZA 1R6BX 4BLTA 1TNDA 1OGJA 4TSFD 4JLOA 4PPGA 3IILA 4WA7A 4C7OB 2V8OA 1EFUA 1PUIA 3OZWA 2P6NA 1D2NA 3S1AB 1LV7A 2GJ8A 4HE5A 3FMIA 2WV9A 3BK7A 3CCLB 5SZJA 3CZQA 3X2SA 3ZVLA 5F3WB 3FJOA 3IPYA 4XIGS 5FL3A 3CPWB 1TVCA 3R20A 2QI9C 1KI1A 3E1YE 1P62B 3OZXA 4LV6A 4LJ4A 4BFSA 3PJRA 2XGJA 4EQ6A 2IHBA 5HKKA 4BQSA 3A36A 2C9CA 3GFOA 2WJIA 4AG6A 1UEIA 1E0KA 4GSYA 2ZQ5A 1QZXA 2C9OA 1E94E 4QGGA 4KITB 1B23P 4B4DA 3FHOA 5JRJA 2CL6X 2H18A 1R2QA 3BB4A 2OBNA 1W0JD 1YZGA 4MQBA 1DELA 3HJNA 3QF4B 1MABA 3QY0A 4HDOB 2ODBA 1E3MA 2XNJA 3QEOA 3K9GA 3WYGA 1EWYA 5DE3A 2WKRA 5FTJA 4DT1A 4M22A 3D6TB 1AKYA 3DM5A 3BFVA 1GWNA 4DQLA 3QVVA 2CCJA 4V0KA 1M34E 1UJ2A 2IC5A 1L4YA 1TEXA 4FMCB 2ZSBA 3FKSA 4US0R 1YITB 4D4JA 1G4UR 4QBGB 1GAQA 2B8WA 3OIUA 1PZNA 5KSYA 3QJYA 1E9SA 2AL7A 2KE5A 2VP0A 1G3UA 2QMUA 1OLOA 1T8UA 2ZJAA 2DHRA 3KQNA 2QA4B 3A37A 1HE1C 4PC1A 1XMJA 1ZC3A 2AXPA 3BJIC 4ERNA 4F4JA 1IBRA 5H59A 2BBSA 4LJ5A 5LD2C 1KYIA 4LSGA 1J9ZA 1X8LA 4GI7A 4L8GA 2JLVA 1SVIA 1GUAA 1JXOA 4DUGD 5KSPA 5DYIA 2ODNA 2RGEA 2VO1A 4LBZA 4G1UC 4IKEA 2IT1A 3HP1A 3KXKA 4OQMA 2JLSA 4PQYA 3CH5A 3VR6A 1GL6A 5ELXA 3ES9A 4M53A 1XFAA 3TW4A 3EX7C 1W36D 2WHXA 2GVZC 2J59A 3SYLA 1EK0A 3WMFA 3ADCA 1T91A 3HR7A 5KNBA 2CK3D 4BUJA 1UF9A 1BS1A 1G41A 1ZINA 3M4YA 421PA 1IXSB 1J99A 4S2EA 3CH4B 4HAUA 1CJKC 1TQ6A 2GEDA 4ASUD 2QNRA 2BGJA 3ZD6A 1RRFA 5BXQC 4RD2A 1G5TA 2IXGA 5JJKA 1OV4A 1W34A 2J87A 1OXSC 3GJXC 5BWMA 2V6IA 2WIBA 3RLFA 3CZPA 2QA5A 4OHZA 2JJ8A 1GKIA 2QRZA 4FMDF 4HDQB 1Z6TA 4IVQA 1E2FA 4XD7D 2PBRA 3QG1A 1K73D 1A8PA 3CO5A 3U44A 3B9QA 2WICA 3CF2A 2G0NA 4UNNA 1NJGA 1FP7A 2VPPA 3I8SA 5TDHA 1JJ2B 3I92A 4FK8A 3K0AA 3W2EA 1SVSA 2GAAA 2QAGA 4BLOA 4AY2A 1JJ7A 3BOSA 4HZUA 3W3ZB 4Q9KA 3F3YA 1P4SA 2YC4C 4NH0A 5SZKB 5EUMA 3FVQA 1DDIA 2OBLA 3AP3A 1AN0A 1MO6A 2H8KA 3EA0A 2CCGA 3KL4A 3KJHA 4RD6A 1BX0A 1G8GA 1NI3A 4LJAA 3BS4A 4N3NA 4XSGA 5HXBA 4XSHA 3LV8A 4LOAA 4WXPA 2ZSEA 1RJ9B 4GPTA 1KZ7B 1XXHA 1XCMA 1YQTA 2EFDB 2QPAA 3P27A 4KFTA 1NG9A 1QX4A 2G83A 3EW9A 4WZBE 1R5BA 3DHWC 4NONA 4B32A 3DZ8A 1E1QD 3AVQA 2EFGA 3FTQA 3GJ7A 3CRMA 4Y0VA 3W9YA 5J4HA 1G7RA 1OB2A 1HTWA 1A2KC 5GADl 3C8UA 2F7SA 1AQYA 1QFYA 5DGXA 2DFKB 4UAJA 5FUXA 4G3XA 3TLXA 1D9ZA 3QXJA 3T1TA 1CF4A 1A4RA 5FR2A 3U3JA 3WRYC 3A8TA 5DI3B 1VCOA 1OH8A 4TL8A 1KDRA 1KK1A 1Q3HA 4FI3C 4A2WA 4OK5A 3ZGXA 5AUQA 2A3RA 1OIVA 1QG0A 4RZUA 2HF8A 2MSCB 4RD0A 3K70B 4PPQA 2QE7A 4KU4A 2FGJA 3GLHA 1P61B 1TF2A 1MABB 1A5TA 3CXCB 4F93B 2BN4A 1RYFA 2CHGA 2RHMA 3AVPA 3ZQ6A 1T3HA 1QGAA 3CF0A 4PSVA 1NKSA 3OIYA 4LWZA 1PLJA 2ZE8A 4DT1B 2J7KA 1X86B 3E5HA 4JVNA 2FPKA 4Q4AA 5AJWA 4Q1BA 3EZ6A 3H1TA 4YMTA 1GOTA 4C0KA 1BMFD 1CS4C 1N6NA 2GDJA 1OXTA 1G8HA 1TEVA 1U9IA 1T4GA 2BGIA 2G0TA 3CM0A 2BMDA 1X3SA 4TLCA 2RGCA 4RCYA 3FMFA 5CJPA 4GOJA 4CW7A 1VPLA 4JLPA 3RANA 1GVHA 1BQEA 2WKQA 1G5PA 3VX4A 3B1YA 1OB5A 3HYRA 4PO1A 1Z07A 1E2KA 1HYQA 2F1RA 3NH6A 4NYMR 2QSZA 3NDPA 4Q66C 2JLYA 2AKAB 1EX7A 2AX4A 2W2XA 2D7CA 4DSOA 5A5GA 1KKLA 2J3EA 2O0HA 2RMKA 3RABA 1IN5A 3FDIA 3IEUA 5K8LA 1AGPA 3L8ZA 4IFEA 4QG7A 2R6AA 4PZLA 4FN5A 5M04A 3FHTA 5FUVA 3LBIA 1XD9A 3AEZA 4NYIQ 3THYA 3CMEB 5DYGA 1E9FA 1ZIOA 2HUPA 1SULA 2HLDD 1S0UA 2BSAA 3PENA 2JJ2A 3QF7A 2OESA 3KB2A 1WXQA 1KAOA 2VHCA 4IOKA 4KV9A 1NKTA 1H85A 1O87A 2F1IA 1XDBA 1KJZA 1LNZA 4DVGA 3THXA 1ZM2A 1MO4A 3MWJA 4NKRA 4B2LA 3TUJC 3DDCA 3RC8A 1YI2B 2P2LA 1G7CA 3TJZA 2ZI5A 2GBLA 3OEHD 2VP6A 1VG1A 5FBRB 4NCKA 4QJ4A 2C5LA 2OFXA 4P0TA 2C96A 3WRXC 4MGKR 3SU8A 4PSKA 4F7WA 1VIYA 2R6CA 3OIVA 3OAAD 1W36C 2C95A 3VO2A 3PVSA 4C0QC 4M0LA 2QDXA 3QXSA 3AKEA 1KNXA 2O0JA 2KSQA 3TW8B 3ADBA 2CHQA 1ZD9A 3WYAA 2OXRA 3OJXA 3TMKA 3U44B 3K8YA 2F55A 4QBHA 4XJXA 5DIFA 2JLQA 2AWOA 3I1FA 1ZUIA 1KMHA 5EE1A 3A1WA 2XB4A 3CF6R 5B64A 1JPJA 2KBEA 1KK3A 2EFHB 1H8EA 2JDIA 4DLUA 2ZROA 2QAGB 1KOFA 2DR3A 1YR6A 5H5JA 4JVSB 3MRSA 1CIPA 2WTUA 3QE2A 4F4CA 1S72B 4O2LA 4I1UA 4Q47A 5BN4A 2O8BA 821PA 4YDSA 3K0SA 1U8YA 5FOUA 4TWZA 3AUXA 1T0JB 1JXMA 2OLKA 2Q3HA 5G3ZA 4IHQA 3C16C 1G3RA 4O25A 4BWYA 3UPUA 2IYLD 2D74A 1TUIA 2RC6A 1RPZA 1QG4A 3UIEA 1KO7A 1M74A 1JALA 5B30A 4OHYA 1Z0FA 2ZU0C 2CL7X 3GFPA 1RE0A 1WP9A 1YR9A 4GT1A 1Q1QA 3LBNA 3W2GA 5JCZA 2HV8A 4EJSC 1NSFA 2H92A 3O47A 4PHTA 3EIEA 4YAUA 1JR6A 2IUSA 2ZJYA 2YWEA 3GLFA 1MV5A 4TMWA 1N5IA 2ZI6A 3BBPA 4LJ9A 4JL5A 3QKRA 1JAHA 1E9BA 5G3YA 1ZD1A 3O8DA 1T5LA 4IFBA 2GF0A 4MYTA 4PO8A 4YALA 1FOEB 1GNQA 3SHFA 3TE6A 1AQUA 1D6JA 3GD7A 1E64A 4ZCMA 1TQ2A 2ZJ5A 3GLHB 2J7PD 3X1XA 4ZIRB 2Z6VA 4E5UA 3AGPA 4DC9A 1F20A 4RZ2A 1E0SA 3IO5A 1M1KD 4TTRA 3D3QA 3I3SR 3V00A 4M21A 3QSYA 1TX4B 1Z8FA 1HEIA 3OZVA 3BORA 2AKYA 2PMKA 4OQLA 3U3KA 2AR7A 4BECA 1HA3A 1G5RA 1S1CA 1DG1G 2YOHA 3SOPA 1VQ6B 1D1NA 2IK8A 1FNBA 1VYTA 3B1WA 2ZIAA 2YOFA 3LO8A 2ZVQX 5KSWB 2CEAA 4AD8A 2IHYA 1M6NA 2VLIA 2QT1A 3TUZC 3OW2B 1CJUC 1G3MA 3FWYA 5E7JA 4AWXA 2DETA 2VNIA 1R8QA 1SXJD 2HXSA 1Q21A 3JZMA 3SFZA 1XTSA 5IRCD 1VQOB 3NBYC 3W8NA 1IOZA 1XNJA 1E9DA 2R2AA 1UMKA 2N1BA 4TT3A 1FDRA 5FH9A 1KJWA 1TUEA 3CCSB 4HAXA 3EPLA 3QXHA 1KRHA 1UKYA 1XZPA 5KHOC 3SNHA 3UG6A 3GMTA 1Z2AA 5L8VA 1W4BA 4M9SA 3THYB 5KDOA 3GLHE 1JPNA 3LNCA 4BE7B 1NIJA 1KI3A 3LBHA 3EAQA 1XE1A 2XSZA 3VU9A 1DARA 2ZSDA 4DCNA 4DLSA 4F91B 2ZS9A 1XRJA 2RKOA 1DS6A 2GF9A 3AP2A 3B1XA 2V3CC 1X8JA 4JVMA 2J5XA 2AK2A 4MRNA 5JS8A 4M1KA 2RH5A 3THXB 3SHWA 4HUTA 4EPYA 2O8EB 4DSTA 4NE2A 3CKLA 5AWFC 2I1VB 4LHVA 4AKEA 1WQ1R 1Q44A 2VEDA 1Q1ZA 3LY5A 3T5GA 3W6PA 4QC2A 2A5YB 4ESVA 4G5SA 1UFQA 2ZS7A 4E09A 2EWWA 4HB0A 4JJZA 4NDZA 1W2HA 1FW6A 4POAA 1M7HA 1NMZA 2GRJA 1G1MA 2XJ4A 4XVRA 5B2ZA 3SQXA 2IA5A 1ZAKA 2REXB 4YC7A 5J47A 2VNHA 1C1YA 3MFYA 1AS0A 1GM5A 1J70A 3UKDA 1KMHB 2QPOA 4V0MA 1HY3A 5CM9C 1XWIA 3IHLA 2W0MA 4Q7JB 5L3RA 5JWOA 1LS6A 4D2IA 1FZQA 2RB4A 5DH9A 4KODA 4JLKA 4QXAA 2BF4A 1EWQA 1GDDA 2GEUA 2CNWA 2X8AA 1VQNB 1NN0A 2JLZA 4YLGA 2J0SA 4BRUA 2D3WA 2ZE6A 3CPJB 4Q21A 1G21E 2IYXA 3Q3JB 5FI1B 1WDTA 3DZDA 5KPJA 1E2DA 4B43A 2NGRA 3VHLB 4ZDJA 3B60A 1BIFA 4QJ3A 4YXWD 2L0XA 3CNOA 1FQKA 4D0LB 4LJYA 1QDEA 2WMNB 1QHHA 2FNAA 3W5VA 2P67A 3C5HA 4ZGNB 1NVVR 1YZTA 1M8PA 1FRNA 4D0GA 1F48A 2ZRKA 1UDWA 5B58C 3R9IA 4TQ9A 2QRNA 1X8KA 2ZJ8A 4DIDA 3K0FA 5FR1A 4B71A 4JLDA 1FFHA 3W2HA 2OLJA 3V9PA 1JR3E 4KLNA 3TSZA 3GLFB 1XTKA 4FMDB 4DZZA 2PT5A 1GSIA 3CPEA 1EGAA 1EFCA 1WCV1 4HLUA 3QKRB 1QRAA 2OFOA 1CJVC 1J7KA 5CITA 3WMGA 2FWRA 2RGNA 1HH4A 5J4LA 3M0EA 1CP2A 1W48A 5JI2E 4CGZA 2BM0A 3CD6B 5CLQA 3GQBA 1E6CA 4NCHA 4AKGA 1JBKA 2FH5B 2QQ0A 5AJZA 5C46F 2DFNA 4R9UC 1VKJA 3MLEA 4KFRA 4IW3B 1DADA 3MCAA 1SM4A 2B8TA 3BB1A 4HI0E 1II8B 4PANA 4RFVA 4DCSA 1MOZA 2AN9A 4G1VA 2OCAA 2JGNA 1TADA 4UNRA 4Y0AA 1NN1A 1Z22A 1XMIA 5BQ5A 4FIDA 4A82A 1EFRA 1E2MA 2CL0X 2R6GA 2WOOA 2ZRFA 2OTLB 1FRQA 1KO4A 2ATXA 2QMEA 4LC1A 1VYVA 4DLVA 1XZQA 2CDNA 4CEHA 3QNUA 4CIDA 2WWFA 4Y9UA 2VHQA 2OV2A 3BWDD 4O2RA 1VTKA 4G01B 1N2CE 1XD8A 1EXMA 1YJNB 5DI9A 1KI4A 2R62A 4MRRA 1FUUA 2YINC 2AD1A 1QUFA 2DWOA 2FN4A 3LXXA 3B7GA 3RSLA 3GJ4A 1DO2A 1A1VA 3GLFE 3AF3A 3KJGA 1GVNB 4K8OA 2YV5A 3OE7A 2A2ZA 2WWXA 1QFZA 1W2BB 3LVBA 4G0NA 4Q9IA 2BV3A 2J46A 1KZGB 1ESMA 1IY1A 4MKIA 4CEIA 2VYQA 2JJ1D 2V9PA 3MWYW 3W5UA 5AUOB 4AURA 4GMDA 4LHYA 1OFTA 2GJSA 1MRNA 3FPAA 3I73A 1S9DA 1NVXQ 3NVAA 5G40A 2JIZA 1SXJC 1E79A 1Q7YD 4TMXA 3VU9B 3I32A 3QQ5A 2BCJQ 5HTKA 3UMFA 2VBCA 2YZ2A 5EXSA 3TNFA 5BN5A 3UK6A 1N5LA 5A4JA 5KTYA 1TL7C 3TQCA 3TSWA 1A7JA 2IS6A 1VQ8B 2IX3A 2DY1A 3WNDA 2QP4A 4ACBA 3B2EA 1TU4A 4JLMA 2VNKA 1COWD 4FWTA 5DSZA 4PR0A 4DKXA 3CUEF 4TLBA 4M2LA 3ZC3A 2AWNA 3A1TA 4Q00A 2WVJA 1YZNA 1NLZA 4PFSA 4U7DA 1VECA 2RGXA 4TLDA 5UKDA 5JCPA 2CCKA 1US8A 1KC8D 2PMDA 1GRRA 2EFCB 1YJWB 3KKNA 5JJIA 3T34A 5JWRA 5GJVC 4TQUS 2PX0A 3R7WA 2C99A 4NU0A 2BKUA 3REFA 3Q8XB 4A9AA 1NBMA 2VSFA 2FMXA 3CCRB 3AVVA 4IOLA 4OQXA 1KO5A 4W5JA 4YHBA 2YKGA 3AVTA 3HPQA 4MDEA 1HT2E 1E9CA 2GK6A 4S35A 2FU5C 1M2OB 3IBYA 1E9RA 3W6NA 1W2GA 4DLYA 1KO8A 2ZYWX 4DSUA 1YZKA 2DYKA 3AKYA 2QPTA 4MYCA 4A8JC 1YR8A 2GKSA 1AJEA 4CVNA 2OT3B 1QHHB 2Q9AA 4D25A 2WBLC 3KQLA 5HCNA 5CIQA 2DCUA 5E7MA 2OK8A 1OPXA 2ZI4A 3BIFA 5CDFA 3VMFA 3THOA 1YKSA 2R44A 2XITA 3K0FB 2XNDD 4OI4A 3AVWA 3NHBA 1V43A 2Z43A 3BC1A 3LLMA 4D4LA 2XZLA 3RRYA 5DI3A 3CX8A 4GOXA 2Q3FA 1OHHD 3RWMB 5KDLA 4Q1AA 4HSEA 3AVXA 1F3OA 1TLLA 3GLIB 4V0ME 1D2EA 4HAVA 2WPDD 4CF7A 1WBBA 5E3HA 2ZS8A 1S9HA 1DAMA 2HLDA 3QBVA 4JLAA 3X1ZA 3P1JA 1S4QA 3U6KA 1W36B 2C03A 2QSYA 2WSSD 1ZU5A 2JLUA 4BEJA 1GL9B 3W5HA 1O3YA 3NDBB 3KDSE 1E0JA 4KVAA 2YYZA 1ZD8A 4URZR 4HLQB 2OTJB 3K1JA 5FPTA 3X1YA 2PCJA 5LPNA 4DDVA 3VNVA 4A0HA 2AFIE 3CCUB 2FGKA 2YWHA 2VTKA 4PX9A 5FUWA 1U81A 3DM9B 1J90A 3AQ4A 4CEHB 1DG3A 4LC0A 2GNOA 1GP2A 1W0KA 3U3OA 2WJGA 3LVQE 4JMPA 3AF1A 1ELOA 4H9GA 1N8RD 1RC8A 5FA6A 1YVDA 2EW1A 1JI0A 1D2MA 1GJRA 3KKQA 2ZRAA 1ZUHA 2DB3A 3B13B 4ZKEA 2ORIA 2DFTA 3I56B 1QUEA 5FPSA 1Z08A 3THWA 1W4CA 4X8MA 3CPHA 4TMZA 1R10A 2IS4A 5FTLA 3GLIE 4DLXA 2PZEA 5JRZA 1OKKA 3X1DA 3ZIAD 3SC3A 2ZE5A 4CEIB 4U00A 3IDQA 4ZO4A 1RKBA 4TL7A 4BFZA 4BFYA 2W83A 3CIOA 3TVDA 1JA0A 1P9RA 4XTCS 3CRRA 3ICQB 1NRJB 1P7CA 3UMSA 2WMOB 2HCBA 4YONB 2VSOA 1YZQA 3Q5DA 2I4IA 1OH5A 1LVGA 4DB4A 2ZEJA 2VH5R 4GL2A 1TF7A 5DN6D 3EC1A 2OE2A 4NZYA 1N6PA 1NG1A 1SGWA 2ZRDA 3BE4A 3HPRA 2WJHA 4Q4LA 1X1SA 4HLCA 2JA1A 2PH1A 1E9EA 3H86A 4HUQA 5FTNA 4Z1MA 1XTJA 4PSAA 2JCSA 3X1WA 2QTVB 4BLPA 1Q0UA 1XX6A 4AF6A 4F38A 3UMRA 1E9AA 2W6JD 3U7FB 1KKMA 4WOPA 1R8SA 2W2TA 6Q21A 1US8B 4DCVA 1SVMA 4DXAA 5L3SA 2GWHA 1G64A 4DLTA 4KYUA 3R7WB 3U61B 2QMHA 4MA4A 2J7PA 4C3ZA 4ZI2A 2ZJ2A 3RS4A 4F7DA 1DE0A 2V7QA 1VCNA 3LFUA 1CRPA 2PIAA 3CCEB 2N46A 1OSNA 1IN6A 4IDOA 2CJWA 3VFDA 3WMEA 5J4KA 4AYWA 1E1RA 1L8QA 4DQKA 3QOFA 3PEUA 1HE8B 1OXUA 2H1LA 2PZFA 3FFBA 2WKPA 4LK2A 3U6BA 3JQQA 2CE7A 5SZIA 3RWOA 2G1JA 4V0OA 4M9ZA 2QTZA 3EC2A 4KBGA 2HEIA 3WNCA 1OGIA 3LQRA 4FD2A 3V4FA 2B6HA 2GJKA 3TR0A 2GXSA 1U90A 3NBFA 2QY9A 3CX7A 4YQFA 3L43A 4KSCA 2ZAOA 3HU1A 5AJXA 5J5CA 3TQFA 5AUPB 4URXR 3H2YA 2GXUA 3CW2A 4HATA 1NLFA 1QVRA 2ZPTX 2ZRMA 1GAJA 4E07A 2FX3A 2B7BA 2EVWX 1MO3A 3BD9A 3VR1A 1N5JA 4JVLA 4BZXA 4DSNA 2WWIA 4ITRC 4MRSA 5FOTA 4B2IA 5JHGB 3KQHA 2ZI7A 4RY2A 2C2HA 3ND8A 4JYBA 1FX0B 1UBEA 5EUQB 5HE9A 1LF5A 2YHSA 1G17A 4Q19A 3AKCA 3CR8A 1NMXA 3QXXA 1PLLA 2OCBA 4Q9HA 1NBME 2G6BA 3CR7A 4PQRA 5J40A 4MYHA 4DBLC 4ZIRA 1AM4D 3B1ZA 4JL8A 5FPHA 1YHNA 1U99A 3GEHA 2DFLA 4YMUA 5CB8A 4J0QA 1GNRA 3CCJB 2FF7A 1IY2A 2QTFA 1H8HD 2WWGA 1RRCA 1TMKA 2EWVA 3OEEA 2W0SA 2REOA 1K8AD 1IJEA 4QGAA 1RRGA 3IQXA 1B0UA 1FMLA 4IVRA 1Q82D 2J0UA 3EWSA 4TTPA 4JSTA 3I8XA 1EESA 5FOXA 5HPYB 1KD1D 4LHXA 5JWHA 2G1KA 2OSBA 2RCNA 2BPOA 1UBFA 3B9PA 1TTTA 3M6AA 5A0FA 3CC7B 1DAEA 5CDFE 2DBYA 3QXCA 1E2EA 4AC9A 4XTRA 1NVWQ 3EARA 2WAXA 3K9LA 4C2TA 3Q72A 4CZ2A 1QG2A 5TXGA 1H42A 2I1QA 2WWWA 3KXIA 1XTIA 2CXXA 3THWB 3LA6A 1HURA 1CQXA 2XZOA 2TMKA 1ONBA 3ZS8A 1IJFA 2IF0A 3MG9A 4JLNA 3CWZA 4Z8YA 3A4NA 2BJWA 3BH6A 4TYPA 4GFDA 4IXNA 2JASA 5GJWC 3ZLJA 1I2MA 1K5DA 3D8BA 4DJTA 1XD2A 1FL9A 1S3GA 1Q81D 4A4DA 3QKUA 2ZU6A 3ZBTA 2X2EA 2XAUA 4GNKA 1F60A 3W8RA 2EIXA 2W6IA 1QGYA 1SVKA 2O8EA 3AF2A 3GLGA 1XU4A 4TTQA 2X3UA 4TYNA 3BFKA 4LZZA 3LX5A 4GDFA 3PITA 1MH1A 3MHPA 4XVQA 3FB4A 3K70D 4BZPA 4PGOA 2AK3A 2CLCX 4D81A 1Q20A 2NO6A 4FMBB 2Z0MA 4NYIR 1Z0AA 4HUQB 3R9WA 4M1SA 4RZ3A 2P3SA 3CC2B 1IN4A 1JR3A 2IYQA 4IXMA 3C4JA 2Z83A 1W49A 1HT1E 1VG9B 1UEJA 1W5TA 4Q7KA 4B33A 2PX3A 1P6XA 2IBMA 3K53A 4GRAA 1DAKA 1P2TA 3AH8A 4RD3A 3IIKA 4WBSA 4XWOA 2RHDA 5L3SB 3FKSD 4QNMA 4NTZA 3PEWA 1CRQA 4RD4A 4L5BA 5FOWA 2OZEA 3VKWA 1PVOA 3RS7A 2R6FA 1TU3A 4HAYA 2IYTA 3LX8A 2NG1A 4K46A 1HV8A 3SJZA 4KHZA 2CJWB 1KI9A 2QT0A 2IEYA 4NMMA 1ZJ6A 1W47A 1ESNA 3MAAC 4KBFA 1ZP6A 1GTVA 2KJQA 3TIFA 1ZNYA 3GJ3A 2VZLA 5IT5A 4PAMA 2VF8A 3SEAA 3EZ7A 4PHHA 4L9WA 2ZXUA 4PPFA 2A5DA 2EYUA 1ZMXA 3OFNA 1NVUQ 2V4ZA 2O8DA 2ZITA 3B8HA 3IPXA 3OHMA 1FQJA 2ZVPX 1OT3A 2ORWA 3ZH9B 5HZHA 3AM1A 1QBKC 4G5QA 4XWAA 2FZ4A 5FFMA 5IK2A 4P32A 2VQSA 3B78A 4IEIA 5IDVA 4UXJA 3MWKA 2NTYC 3I5XA 5FL7A 4ZDWA 1E2QA 4A2QA 3B5JA 4D4MA 2FPMA 1XEXA 2XOKA 1K6MA 3NEYA 4B3CA 1NLYA 4DRZA 3QPUA 3PG5A 2ERXA 2ZRNA 3NTUA 2FOLA 3E20A 4JKYA 2QP3A 2WJYA 3LQQA 2ZAMA 1NMYA 3AKDA 2NO0A 1M7GA 1AZSC 1S3SA 1CKEA 1GITA 3SJCA 1II8A 1N25A 1XTQA 2BIFA 3KKOA 5FBWB 1AMOA 1LW7A 4O0MA 4I1SA 1R5NA 5GV8A 5KO2A 1N5KA 3F0TA 1EFHA 3AP1A 1Z6AA 4OI2A 4OJQA 2G9NA 2E9SA 3BH0A 5IHPA 2ZRBA 2BM1A 1GRNA 2J0UB 3BRWD 4HAWA 2PZGA 1NY6A 1NP6A 2KWIA 3N5CA 2ERYA 1KNQA 1OYWA 2BOVA 3TAHA 4PC7A 1N6RA 1IN7A 1SZPA 2ZYTX 1ZC4A 4PZYA 3QEJA 2F3TA 3PUYA 2XNCA 4P33A 1P9WA 3GEEA 2GJAA 3U4QA 3L0OA 4M8NE 4OK6A 2REBA 4BZQA 1G19A 2C04A 1R0ZA 3NIBA 3MGCA 3CX6A 4BPRA 1FP6A 3GJ0A 4NPHA 4M1OA 1JJVA 3FYHA 3OJWA 2GHIA 4BFVA 1I4DD 4ACAA 1CBUA 3R9XA 3L2OB 2ZI9A 4MRVA 3IQWA 3ZS9A 3RYTC 5AUNB 1VQ9B 5JSZA 1UKEA 2F9LA 1XD2B 3QBTA 3T15A 3RHFA 3WBKA 3KJEA 3SQWA 1VHLA 1VCMA 4M9XA 1RIFA 3B1VA 4LV5B 4BASA 2HMAA 4GZMA 1R0YA 1ZNZA 4TSFA 3C41J 1GZSA 1A2BA 3QPWA 2FDCA 4AKHA 1YRBA 2ZUDA 4UNSA 2IYZA 1OXVA 1VQ4B 3GLGB 1CULC 2ONKA 4R98A 1DBSA 3NEJA 1IB0A 3V4RA 1XF9A 4B3XA 2EU8A 3U60B 4NCNA 3A4MA 3EIQA 3TGPA 2UZIR 4US1R 1GL7A 4EUNA 3DL0A 2QE7D 4NYJR 5EP4A 4QNRA 5GV7A 1I4LD 1RYHA 4EFNA 3U7HB 3H84A 1KJYA 3WP1B 5BW8A 2VHUA 4B75A 1W35A 1LF0A 1L4UA 2NZJA 3VR3A 2ZI3A 5JECA 3RDPA 3TUIC 4JZKA 2D4HA 1T0HB 2PEZA 2ZRIA 3K9NA 3LVRE 4UNPA 5TMPA 4QHYA 4HYYA 4W7SA 4EFMA 4PAQA 1W0JA 4RJLA 2ODWA 1P3JA 3K70C 1OFIA 3HDTA 2A5GA 8OHMA 4D26A 3DMDA 3RS2A 2NIPA 3T61A 1QGZA 5CK4A 2A9KA 4U9UA 4TL9A 1N6KA 1FNMA 2ANCA 2J45A 3F5FA 5DNYB 4LCBA 1GAWA 4QFMA 2O8CA 3TR5A 4QBIA 2Q0HA 5LD2B 2ANBA 4NL4H 2OK7A 1QHIA 4UKDA 4DDTA 2ZJOA 1N0VC 2PEYA 1NVVQ 3PIRA 5BN3A 3GLGE 1P2VA 3BAFA 3CBQA 4KI0A 3JVUA 3CCVB 3GJ5A 4KXFB 5DO9A 5FTMA 3Q5EA 3PUZA 4P6VF 3Q7PA 3RS0A 2ZRGA 1VG8A 4IOJA 3ZVRA 1T6NA 2GPJA 2O8DB 1A82A 1YU9A 4L9SA 1OJLA 3CNNA 4BGDA 4PXAA 2J0VA 3K0EA 1N6HA 4YMWA 4C0LA 2JJ2D 4WW0A 4ILEA 1Q12A 521PA 4IJMA 4OHWA 1XPUA 3G0HA 1Z29A 5EXXA 2OAP1 2R6DA 1NSTA 1AIPA 4PC6A 3WBJA 4DUGA 4QM6A 4KCGA 4DLWA 1FTSA 3TSOA 2E87A 3GLIA 4E22A 1PJRA 1XEXB 3SS8A 1KY3A 3SI7A 2NO7A 5H70A 3D31A 3WHLA 2Z4SA 1JB9A 2CVHA 3KTAA 1GILA 4KJZA 3T1VA 1UM8A 2FA9A 3KQUA 3PEYA 3MSXA 2JATA 1AK2A 4QJ5A 3C15C 2CBZA 2WZQA 2JEOA 1KAGA 2CK3A 2IYVA 4Q5IA 1KK0A 3GJ8A 4Y9RA 4YAFA 1M7BA 2P0EA 1H65A 4QRHA 3OZUA 4A6PA 3L0SA 2Q21A 1E4VA 4PC3A 2JLRA 3PQCA 4PO9A 2G77B 1GR1A 2YNMA 5EXTA 4ASUA 5EP3A 5JHHB 3QFTA 2LCFA 1LY1A 2QENA 4DDWA 1KDTA 5JI3E 3W2FA 1UKZA 2FSHA 1G8YA 2X2FA 3DMNA 3IIJA 4LYHA 4BEBA 4B6EA 2ZANA 1HQYE 2CRVA 1L7VC 2JDID 2WJVA 1M90D 1YRAA 3NHAA 3FHCB 1LFDB 3QPVA 4FWIB 4AKIA 1G20E 4XD7A 1VYUA 5JS7A 2XXAA 1W4AA 4MRPA 1G3IA 4WQMA 1W46A 4B47A 1E2HA 2IYYA 2W6JA 2ZETA 2VNJA 2ZSAA 4M1MA 3U4QB 2EYQA 5P21A 1VQKB 5EZ6B 2QEXB 1JEEA 1XTRA 2O52A 1G7SA 4ZCIA 1K9MD 2VHTA 3FOZA 4JIMA 1CXZA 1WF3A 4ZDIA 2R6HA 1ZU4A 1F5NA 2A78A 2VHJA 3HR8A 4EPTA 3B85A 121PA 1Z0KA 4OBEA 2NOAA 1T5IA 4EJSA 4JBYA 5ANRB 1IM2A 2QAGC 1WMSA 4CRWB 4G1BA 1RZ3A 4NHOA 4DIEA 3B82A 3IGFA 3WY9A 2ASEA 2H5EA 5TB5A 4EAQA 4R7ZA 2C8VA 5JSZB 4A0GA 5KPDA 2BDTA 2D06A 4DEXA 1R0XA 2NZ8A 3SDZA 4DCTA 2HDNB 2XNSA 2GJ9A 3SZRA 2FEMA 2V54A 2VL7A 1ZCAA 2ZR0A 4PC2A 5F2EA 2GCOA 1KHTA 5EJEA 4I1VA 3RRMA 4YMVA 2O8FA 1E1QA 2WM9B 4B3BA 3I4LA 4C9BA 2QUZA 4UNQA 3TH5A 5GJBA 1JB1A 4TYQA 1V5WA 2BHRA 1Z63A 1G8FA 4JL6A 5KSOA 3N70A 3L82B 2G88A 3KJIA 5BYJA 3VTKA 4Q7LA 3VR5A 3HU2A 2K5UA 4FW9A 1MR3F 2YWFA 1MKYA 1KTVA 1VQ5B 3ZQJA 4D80A 3ZVNA 3SBDA 2IW3A 3GJ6A 3T5DA 2GQFA 2F9MA 3KFVA 3SYNA 1G6OA 4B48A 1T3LA 3EA5A 1WE2A 5FPYA 4TYYA 1XCGB 1U0JA 3BERA 5GJCA 4DB2A 4JLBA 1KSJA 1DPFA 3NH9A 1ZYUA 4LX0A 1G16A 2P5TB 3QG5A 2GZHA 1NN5A 1IQPA 1OYYA 3IIMA 5FOVA 1KI6A 4GMXA 4URWR 2AXNA 4KYIB 1S2MA 2MMGA 2QTHA 2OUKA 2O8CB 3ADKA 5EE9A 3R8CA 4LUCA 1OH7A 1ZNXA 4OQNA 4I1OA 3QE0A 1BMFA 4YAWA 4C43A 2ZRHA 4FCWA 3H0KA 1E2GA 1CLUA 4R2HA 4TT3D 1Z6YA 1QHNA 5G53C 1T8TA 4RSGA 3CRVA 1R4AA 1U9IC 2IXEA 3ECCA 3FKQA 1Z3IX 3GCGA 3G5UA 3LAWA 3KB1A 4AYTA 1II0A 5JBQA 2DWPA 2ECKA 2GZAA 1LB1B 2H7VA 3KX2A 4FCTA 4Q4HA 1KSHA 4GP7A 1KIMA 2GZDA 3W5IA 1YE8A 3W90A 4BPBA 2O5VA 2GCNA 1VG0B 1OXXK 5CLLA 1CR0A 3N2IA 4RKEA 3ASZA 4PAOA 4LJ7A 5EE0A 1EX6A 1D5CA 2R65A 2ZRJA 2FSFA 2BBOA 4TMVA 3EWAA 3F8TA 4OKSA 1FX0A 1MO5A 2HCJB 2D62A 3UWOA 5TARA 5GVSA 5KU1A 4JKIA 1CJTC 2LKDA 4OI0A 1RW4A 2LWIA 3KTAB 4RCZA 4DLZA 1UBCA 1L2TA 2C98A 3JVVA 3K0CC 1Q1EA 1W44A 5KYKA 4GBMA 4MUAA 2DPXA 3E70C 3A4LA 4UXIA 2X1VA 3OIWA 4FXPA 2OFWA 3LWNA 2OCPA 1XP8A 4WVFA 1JQLB 2IS2A 3OEHA 3G6EB 4G5OA 2ZRLA 2IYWA 3CC4B 2J41A 4Q1FA 1YZUA 2ATVA 2B21A 2WOJA 3QKTA 2GBLC 3NXSA 1QVFB 1EP1B 5K8TA 3P26A 4RD1A 4ZV4A 4C0SA 1E4YA 1KMQA 1Z5ZA 1S96A 1Z28A 1DOAA 1P60A 1P73A 2CNWD 1GG2A 2HXYA 3U3MA 1PV4A 1NNEA 2XXAB 3K09C 1E69A 5EXPA 2HT1A 3NG1A 1G291 4DEYA 4PZZA 1XBTA 4QHTA 3RS3A 4HAZA 1VQLB 4Q02A 3PUXA 4GZLA 3T12A 3RRNA 3BB3A 4N1AA 4DWJA 2P65A 5BYKA 1N0UA 4F92B 4A0RA 3EZFA 4EJSB 4EFLA 2VF7A 1U2RA 3GPLA 4BFTA 1FNNA 3UWKA 3EIHA 3LRPA 621PA 3ZZUA 1DTSA 4MITA 4WAUA 4JJKA 1D9XA 2V55B 5DHFA 1E2NA 3RNLA 5C4GB 4D82A 3EPKA 1AZTA 2GCOB 2OBMA 3PEVA 4P4UA 3FE2A 1I7PA 2O8FB 1Y63A 1E2LA 4OK3A 4BLQA 3R8FA 3LW7A 1OE0A 4Z54A 4CEJA 4DDUA 2IF2A 3QFCA 2OAQ1 2EFEB 2BMWA 4I99A 1EP2B 2FFHA 2PLRA 4BLSA 2QEQA 1GRQA 4D0NA 1AKEA 5FBVB 1DO0A 1EP3B 4LRWA 1NL3A 1Z6XA 5LB2A 1LTQA 3NBXX 3U3RA 2R9VA 3KFXA 2GVDC 4X8OA 4LDJA 1RFLA 1BJKA 3T1OA 4AK9A 4TYWA 2V6JA 5D3MA 3AVUA 1EFRD 4ZGQB 2BMFA 1ZRHA 4MH0R 5F9HA 2PT7A 4JYCA 4TLAA 2ZE7A 1Z2CA 3QKSB 1KI7A 3G82C 2P5SA 4II7A 2Q6TA 3U7EB 4LBVA 1R0WA 2A5FA 2D2FA 4P4SA 4V03A 4I81A 4HLDA 3KKMA 4X8HA 3P32A 1CNFA 3W3AA 1KI6B 1SHZA 3QFSA 4ZI3A 1E32A 1ODFA 4TZ6A 4IOMA 1SVLA 4DLRA 5L3QA 4P31A 2FSGA 1BH2A 4TMKA 5CYPA 1UPTA 3DO6A 3OE7D 4RZXA 5CJ2A 3U5ZB 3CCMB 4CT4B 3AF4A 2CMKA 3RRZA 5CM8B 4NBSA 3C7KA 3A1SA 4Q18A 4Q01A 2MSEB 1QHSA 4O3MA 1QH0A 2O0KA 3FGNA 2W00A 2RC5A 3LDAA 1SXJA 1CNEA 3VO1A 5KOYA 2CNDA 1VMAA 4A1FA 4Q4HB 4UJ3A 1K5GA 2ZYUX 4HB2A 5H1YA 3U2QA 5TY0A 3VX3A 1R7RA 1B2RA 2JIZD 1E79D 5GVRA 1QFJA 3G4SB 1FTNA 1TQDA 1NIPA 4Z51A 2RGBA 1HUQA 5JEDA 1XEFA 1P72A 2VP9A 3I5YA 2IXFA 4YMSA 4NCJA 4BRWA 2C9YA 4LHWA 4ZKDA 1G8PA 5JEEA 5TR9A 2HJGA 4DCUA 1Q3TA 2ZRPA 4ZDKA 2ZSFA 1SQ5A 3T1QA 3WHKA 3RAPR 3ONWA 1Y3AA 3H4MA 1IHUA 1E63A 4IDPA 3IKJA 5FPKA 1IY0A 1WA5A 1W87A 2HT6A 2IYRA 2GXAA 4A0FA 4EQ6B 1Z0DA 2H57A 4PQFA 4B35A 2YC2C 2VA8A 2W58A 1SKYB 3I55B 2RGDA 5CYOA 1WBDA 2A30A 3LXRA 5K8UA 3TVTA 4K1XA 2D2EA 4M9QA 1XMSA 2CLDX 1Z6GA 4CT5A 5KSZA 5C2JB 4TLEA 3HYTA 1N6OA 1BYUA 2JLXA 4R71A 1G4AE 4AYXA 1Z83A 4QBFA 5KDDA 2CE2X 2X19A 4A15A 4LBYA 4ZCLA 2HYDA 1NBMD 1QHGA 2VP4A 3D7MA 1GFIA 3PUVA 3P4XA 4NYMQ 1RRPA 2FZLA 4V0LA 3ZZTA 1TQ4A 1E99A 1FUKA 5J4YA 2EQBA 3NBZC 4IVPA 2GA8A 4OL0A 1G9XA 3W6OA 4RFSA 4A8JA 1UAAA 5E7IA 1XEWX 3LO5A 1KO1A 2RGAA 3SJAA 2BVNA 3LD9A 1NN3A 2ZR7A 3G71B 1T9HA 4ZPXA 3VR4A 4ARZA 2FSIA 5HR5A 4L15A 1N6IA 4EPRA 3ASYA 2BC9A 5DHAA 2QM7A 3CMAB 1UKVY 4N3GA 4DHEA 1VDZA 2XB2A 1OF1A 4HDCA 4RVCA 5KNCA 2PL3A 2WIAA 1NY5A 3LW8A 1KSGA 1FMJA 1G7TA 4C4PA 3CNLA
chains in the Genus database with same CATH superfamily
5JJ5A 3H75A 3WWPA 2FMIA 4BQOA 2JFWA 3E2IA 1I4OA 3CKMA 1KP3A 1BWQA 3GAAA 4R7TA 2FEXA 3IB3A 1VPEA 3HL4A 1QHYA 3AIKA 2QTTA 1ADGA 3EZLA 1NJ8A 1P9NA 5JARA 1ZCBA 3X1JA 1T5OA 1VF7A 5AK6A 1L4KA 4Y1GA 5E95A 1Q0QA 4AF7A 1Z47A 2E5FA 2O06A 3PCTA 4R05A 3H1PA 3HO6A 3ZI0A 3C5VA 5L3VA 4EYOA 4GOKA 3KYDA 1VGVA 3QHQA 5BSEA 2PKQP 1ZM9A 4Q7QA 1TIBA 2QZJA 3QI2A 4BC1A 3L7JA 4R2LA 5K3CA 2VT7A 4D3YA 1JIUA 1AGRA 2A0YA 3LDHA 1CSEE 4R9SA 3T9AA 5DXAA 3IPAA 3WSVA 4XOPA 4EABA 4QOSA 1UK7A 4HLUC 1ZUNB 1R9JA 2P6OA 3CB2A 4BGUA 3LCMA 4A6XA 3OCVA 3WNBA 2WAAA 4INAA 1BFKA 4Z99A 5D3MB 5T4EA 3W2IA 1YS7A 4H4EA 1LI5A 1GV0A 1PJLA 3ZDQA 2EFJA 2G09A 4PX2A 2PKYX 1ZCJA 3K09A 1ID1A 1Z56C 5HCIA 2GKOA 3INRA 4K05A 3LLUA 4EA9A 4MJ3A 1GGVA 1O9HA 4CLRB 4IO1A 4BNLA 1J9EA 4MW2A 3ZZ0A 4U8HA 5AW7A 2R85A 1RXCA 1JIQA 3KP1A 1S8FA 4X65B 3HCEA 3N9IA 1XJQA 3VPBA 2J0QA 2AFHA 4UPVA 4NZPA 2EKDA 2HA0A 3HGMA 3WLPA 4RTRA 5KOHB 2Z6AA 3EGIA 1MB0A 1D2AA 3LDGA 1SB9A 3HCPA 3OQBA 3QVUA 4JVOA 2VF2A 4CMGA 2OBSA 3WJAA 4IIVA 2PLFA 3JR7A 3UN1A 1UC4B 1ZGHA 5EG5A 1KI2A 1JRLA 2DUNA 1S02A 1F2VA 1YB6A 1K86A 1PYGA 1LBIA 1M75A 4URYR 2WWHA 1K66A 1QIGA 1SG9A 4U6NA 4XGIA 1XJCA 4JT2A 1HNWB 4K6GA 3DDWA 5L53A 4O0LA 2P2GA 4LIPD 4CM9A 3HWSA 3IUYA 4HQNA 2ZRCA 4LE0A 5B3KA 1Z0UA 3CR3C 3CZAA 3O3OB 1UH5A 5E3JA 5JZVA 3HDGA 3V4OA 3ZWDA 3CY6A 1H6DA 3MN1A 1K3FA 3AHIA 1KMMA 4URHA 3RBXA 4UW9A 3S1LA 4IICA 2AD5A 2YTZA 3P4UA 3W3AH 3JASA 3ELYA 4OHXA 4KNWA 4RWZA 5L7TA 3I76A 2WU1A 1PX2A 3E7DA 3ESXA 1K3UB 4EKDA 3VH1A 3QIAA 3VR0A 3DDHA 3HKDA 1A9XA 4A2CA 2AW3A 1J33A 2AC7A 4AG5A 5HRCA 4BVEA 4LJRA 1Y3IA 2ZYVX 5DHUA 3ODPA 2UYOA 2NPFA 4AN1A 3GRAA 5IUNC 4MPRA 2PV7A 3B7PA 5TX7A 2QM0A 2HX1A 4R9NA 4OHMA 1NF8A 2AG6A 5HF8A 3WKEA 2BEWB 1JAYA 2YR0A 4J16A 5AFSA 2NO9A 3WXMA 2GCPA 3QE4A 1EFVB 1U28C 2NU6B 4L4XA 3UJAA 2XQFA 3CRW1 3ROFA 4A10A 3VGPA 4WZAE 3WYFA 1XLTC 5LVAA 1BX1A 1CEXA 3EASA 5REQB 3MS4A 1E1RD 3C70A 4Z3KA 1WXWA 1X7YB 1CUCA 2UZ3A 2VUSA 2WFAA 4M1WA 4JFAA 1PQYA 2X0IA 4JSYA 3VYRB 4G5GA 3QLTA 5EMNA 1O95C 3UOGA 2XBUA 1E3IA 3DOEA 2Q5CA 2MSDB 3GEIA 3N74A 3UH1A 4A8JB 2QUIA 3I0ZA 3L3BA 3N2EA 1E3EA 2AN3A 3JTMA 1FLAA 1LC3A 2B8NA 4OKNA 5JYEA 4ZAGA 4UOZA 3ANSA 4NV0A 4P54A 1G3QA 1AA9A 5SV2A 3ETCA 2FUKA 4XUCA 3MJVA 3ZHRA 3I04A 4XJSA 4M0CA 4IUYA 4OJTA 2GMWA 1WW8A 1FXWA 3SR3A 3GEGA 3VC1A 4AF8A 3P2OA 4Y2UA 1HZEA 3B89A 3AF5A 4HAOA 1ISFA 1E20A 1UK8A 5TQ0A 4B3FX 2RAPA 3PJGA 2PMBA 1XL1A 2D1YA 4LMBA 1OTYA 1ZW6A 5IP5A 2E4WA 4Q4JB 1PHPA 3TZQA 5JAIA 3Q9SA 1CU1A 4TMTA 1FFYA 1FFBA 2YHIB 4DJEC 1MAHA 3RS5A 2F62A 3GNQA 4M4SA 4EH1A 1P33A 4TQAA 2R1UA 1SXPA 3ND9A 3SE0A 4O5OA 3AOEC 3MUFA 2PX8A 4QYMA 1FPMA 1GPBA 3MNFA 4F9TA 1KH3A 4Z7OB 2QN6A 3LPMA 4YLEA 1H22A 1CQPA 4G5XA 1JTFA 2KS6A 1XYVA 4GP6A 1RLMA 5K6RA 1KZHA 1Q7GA 1C30A 1K6EA 1AUVA 3FMPB 4HNAB 2ZTSA 4MKRA 4HQLA 1OLUA 2ZUCA 4EHBA 3D2BA 3KE9A 3KU4A 2YWBA 4GWKA 4LZAA 4MQEA 1J8QA 4C78A 2Y8EA 1PLKA 2FPPB 2ZRQA 2XYQA 3KETA 1TF5A 2OPHA 4X6YA 2Q3MA 2QR3A 5JANA 2Q4TA 4UM7A 4CF3A 4W1QA 1NV8A 1OH6A 4W5WA 1YJ9B 3T95A 4OI1A 2ZBGA 4IJKA 5AKHA 1WUYA 5L6MB 4CNBA 4GZ6A 4F3RA 4BNKA 3ZY6A 5H8WA 4W9MC 1QHXA 3KOXA 4R2WA 3EEIA 4ES6A 3SHTA 2EQ5A 1JEDA 1NYTA 4US2R 3PNMA 3ZIUA 3GPBA 2AUTA 2ZUSA 1N08A 3AB3A 3R75A 4MGYR 1K2VN 3R7NA 3ZE9A 2PZJA 1OROA 4D0RA 2MHCA 5FHQA 2EHDA 2H9AA 4I4LA 2NPIA 1VQPB 4MKGA 4G0WA 3ROQA 4AIIA 4YFVA 4LRUA 4F4IA 5IWCA 1LRKA 2JAXA 4C4OA 2OVFA 1QO0D 1TO1E 2Q5LA 5KUTA 1R37A 2ID9A 2ZYGA 1QNFA 5DU2A 4O1HA 3OD1A 1K8RA 1JKJA 2EGHA 3H3FA 4UHJA 5TPWA 1OW3B 1PNTA 1WCIA 5KYNA 2R1TA 2PXXA 3V7UA 1PJAA 1IU9A 1CB0A 4NCIA 4MHOA 3EVFA 3G59A 2BW0A 3L8YA 2DOKA 3KKEA 1J8MF 3RC7A 3BVPA 1NR1A 2FSUA 2HWYA 3RHTA 4C7OA 4RDJA 1PKVA 1DRKA 1UIMA 3FWKA 3CLUD 1QU2A 1Y6ZA 2ATCA 3AZOA 3T99A 3TTXA 2C2XA 4J3FA 3JD1A 3A6ZA 4UZFA 2O3RA 2UKDA 3F7TA 3PHHA 4MWTA 3E3AA 3MWLA 3VH4A 3K4QA 4HS4A 5JAUA 2JFYA 2EP7A 5CTJA 3IUPA 1E1NA 2H85A 3K2QA 5THKA 1IAQA 4W82A 3PEEA 3SF0A 4AS3A 3ZHOA 4JI0B 5FORA 4LWQA 2W2LA 1EBBA 1ONPA 5ILGA 3LX6A 1JR3D 1E92A 5EESA 4B73A 1ZM3A 2FSVA 3BCSA 2ZATA 3E3MA 1F0YA 2VRWA 3KRTA 1VKOA 3RBVA 5LNK1 4HR7A 1FRZA 1V0EA 4D56A 1ZVVA 5DN6A 1VL8A 2G1AA 5L9AA 4C0JA 1CIVA 1ABBA 1GIAA 5G0TA 3IHWA 3UH0A 5A4IS 1B1AA 1JT2A 2C5FA 3EVEA 3OOYA 4LBWA 5EZ5A 5CFNA 1DKPA 2CVFA 3LQYA 1O08A 4OOFA 4EPVA 1NQTA 1X1BA 4UTVA 2J1LA 2PMCA 5KNDH 4L22A 4JUFA 3ZJTA 3C4VA 2P4QA 3U1VA 2X4LA 1YJXA 1C5KA 1NYQA 2IEZA 1HE3A 3DULA 2IL1A 4ZT3A 3VR2A 4XVUA 4F8JA 4TZ0A 1DDGA 3T35A 2Q3DA 1FSPA 2IHVA 4IGEA 5I45A 3RU3A 2VYNA 3TTSA 5A4KA 1GZHB 3F6CA 3NTLA 2A5LA 2G08A 4MEAA 2RGGA 1VSVA 4TUYF 1TI7A 4ZT6A 3Q0TA 5HMMA 4AJKA 4HDKA 1OC4A 2JIBA 2UYQA 3K0HA 3V4ZA 1E0AA 2ISSD 4OQPA 2GAOA 4H7JA 3G9TA 5C18A 2CW5A 1K4MA 1KC3A 3Q39A 3AZPA 1TA4A 1WHSB 4K2AA 4NS4A 1WKBA 1VJ5A 4HGRA 4UJ5A 2VRCD 3CESA 4PVDA 5FOSA 5DISB 2VZ9A 4KUGA 3I9V6 3KT6A 3U09A 2Q5QA 1EUCB 3BGSA 2VRNA 3L7LA 3PUWA 1N0WA 3E22B 1AT1A 1I2ZA 4ICIA 2JIDA 3T7TA 4JZKA 1JDBB 5H82A 3Q1KA 2Y1CA 4TVKA 1JFTA 4EJ2A 5CBPB 4ZYTA 3I2GA 3LOPA 2Z6BD 2ZCUA 3W6UA 5JC1A 4IHAA 4EITA 5AR1A 1JW9B 3ZU5A 2PWZA 1P4GA 2O7NA 4ESHA 3F73A 3IVRA 1SVOA 2X41A 4REMA 5H68A 3HP4A 3SZLA 3ZGYA 2I5PO 5K0JA 1HT3A 1MVOA 1LTHR 1HQCA 1PUJA 4KVZA 2XOKD 4UDXX 3NPMA 3REGA 2R7NA 3CRQA 3EG9A 3QHPA 3VV3A 6ADHA 4MYUA 1V3UA 1XCPA 1XV5A 3L01A 4I2NA 3CRZA 2X6WA 2DAPA 2IYAA 2C77A 4Q48A 4B6JA 4E51A 3Q7QA 3F49S 2PGXA 3DL7A 1G18A 4IO0A 5I7EA 4X8LA 3SBEA 2XCIA 1BD3A 5B1DA 1EHYA 3JW8A 1D8TA 3BXZA 3MJRA 4URUR 2NVUB 1TJ4A 4YRLA 3LPLA 1FFCA 2R8YA 3FLEA 3FH0A 2WP0A 2E37A 1EM8A 4AO7A 5KC9A 5JQGF 3IMFA 3ICEA 1FRFS 1ZBDA 4R40A 2ECQA 3TDKA 1D6SA 3GK3A 4L3WA 5BQOA 2JH9A 4I5EA 2C0CA 4J4TA 4NENA 3UBMA 4L6CA 3A1VA 3I28A 4EA7A 2BDEA 3BH7A 4DV4B 2V7UA 4YJHA 1GXSB 2WB4A 3OT4A 2Z2ZA 5AICA 3TIGA 4B34A 1NJFA 3HA5A 3VJRA 1Y1KE 3BTVA 3QVMA 1B8PA 1TPZA 3ZWYA 4DRXB 3OA2A 1PJQA 3U3ZA 5HRUA 4DV5B 1DNPA 1U0LA 1EGHA 1PQPA 2OKGA 4UTPA 1XK7A 3HKBA 2WJ6A 1NF3A 1XZIA 2CSUA 4V2UA 3ETLA 4A2PA 4AUEA 2CLSA 3JY6A 4XLTA 1CETA 3QFRA 2FHPA 1GO2A 2HV9A 4WUTA 2FP4B 3B6EA 1YONA 2J9FB 3R0QA 4HGYA 2WQ7A 1NDUA 1J20A 3WLQA 2W48A 1Y1LA 3I9FA 4P92A 1U5AA 2XUPA 2BYTA 4O2BB 3GN2A 2H16A 4CL0A 1E1MA 1KSFX 2H17A 2FX5A 2PZKA 4LZWA 4Z1OA 3ILHA 2L2QA 1FFSA 4EB8A 3G68A 2O3JA 2EOAA 4MINA 4X20A 1ZMBA 4JI7B 2FPLA 5ILQA 3BHJA 1FNDA 2WYOA 3T0IA 5BR4A 1M1YE 1C3XA 3EN0A 5HQJA 2UYCA 4ZZ2A 1XRSB 5ADVA 1TNDA 5IBCA 4CM6A 3WLJA 4IYRA 1OGJA 4JQZA 4FJ2A 4PPGA 3UJNA 1LX7A 3GSIA 2XA9A 4KR6A 2O5RA 2V8OA 3E9EA 4AJLA 1YZYA 1LDNA 3MBOA 5DEIA 1XHFA 2DLNA 4ECAA 1U5BA 2QN8A 3S2YA 1RLIA 1GQYA 5T8KC 4Y3UA 3E05A 4HE5A 4K6OA 3G0BA 2VPXA 3MC1A 2VG8A 3BQNB 4L0CA 3UB2A 4HNVA 3N8HA 3IPYA 4LJKA 1L5FA 5FL3A 3CPWB 5FF9A 3S27A 4KH0A 3TI9A 3E1YE 3NHRA 2OUIA 1QWOA 4MV7A 2XGJA 4UUAA 1O58A 2YS6A 3AEXA 3VU3A 4AJEA 4BQSA 8AT1A 2C9CA 4PNPA 2C2MA 3WWEA 4FIZA 3JQ9C 5CW2A 1DQSA 4EW2A 1NVEA 2VRBA 1C3JA 3CLUC 4LA4A 1QZXA 2JFNA 4EW6A 1KVSA 4QGGA 4EYSA 4TRMA 4TXJA 2FAXA 4NEHB 4U7JA 5LJLA 3FHOA 5CB4A 1UK6A 4WDQA 4DV3B 1KORA 3HJNA 1MABA 4RS3A 1V11B 3EBPA 5HM6A 2JZOA 1SBZA 4FCCA 2I4TA 2XQKA 1NQ5A 3DT8A 2ZUVA 4PG7A 2QIOA 1C3EA 2WYVA 3HV0A 4CDMA 5KREA 1UFOA 3OLZA 5K6TA 3GNLA 3HRIA 1QCYA 3GR6A 1TM5E 3K9GA 4RL4A 4EGQA 2XADA 5FTJA 2P2SA 2H0RA 4M22A 3TTWA 1AUXA 4YAGA 1UJCA 1M34E 1TEXA 1JLRA 3FKSA 2HLHA 3RC9A 4TKOB 2J4CA 1KZYC 2WZDA 1G4UR 4JJ8A 3G3EA 4QBGB 4A23A 3AESB 3PI7A 2H6EA 1GAQA 1T1GA 2LIVA 1MH9A 1NI4A 1TMYA 3OIUA 5KSYA 1K9VF 1E9SA 1U3UA 2FK7A 5L51A 1ESDA 3DWGA 1HLGA 2I7TA 3I6MA 3EFOA 4N76A 4Y30A 2RI6A 3L07A 4UTRA 2QA4B 1WOMA 4AUMA 3VZRA 3KQNA 1VE5A 2CC2A 2ORYA 1L7AA 5GIPE 4KJXA 3DW1X 1ITZA 1R16A 4N6GA 4HXFB 4OAPA 2C8KA 4P0PB 5LD2C 4LJ5A 5E4YA 1DXHA 4LSGA 3NZEA 5BR1A 1RKQA 3GLKA 4QU5A 1XT6A 2VDWA 1NUQA 2A59A 1JXOA 3HVJA 3OCJA 4DA8A 3S8EA 3CZRA 3M5WA 4G1UC 3VC7A 2QWXA 3HP1A 1NUPA 5LQJA 4OQMA 2JLSA 3ND7A 5AM5A 1DG9A 1GKLA 1GL6A 1JUDA 1ZD2P 1J2UA 4W1RA 1I94B 3L1KA 4QUDA 3RQSA 3TW4A 2WHXA 3M1LA 4XX1A 3EX7C 2AUMA 2ECFA 2F3QA 5T57A 4NH4A 5U4QA 1NW8A 1SWVA 3FBGA 3A8KA 4RGVA 1EPUA 1WD7A 1TKAA 5KNBA 2SKCA 1BS1A 1ZINA 2ES4A 1QOPB 3WDKA 4TZTA 3FJYA 4QLOA 5DWDA 3BIJA 3LP5A 3QPDA 2I2DA 2BFMA 5KYUB 3DUWA 2QNRA 4WZBB 3L1HA 1CRLA 1TKRA 1FDVA 2E2WA 3BCDA 3PWZA 1Z6PA 5BXQC 4YRAA 5BV0A 1IB6A 1OV4A 1RZVA 1T0IA 4JI2B 3VKUA 2H7CA 2A86A 3MMZA 3S44A 2H59A 2EP8A 3CZPA 4OHCA 1OTXA 2QA5A 2ZZMA 4CM4B 4AN4A 2JJ8A 4FMDF 1WO8A 1QC5A 1CZOA 1V7PC 3DVSX 4G09A 1BS2A 3NANA 1UR5A 3S2GA 3UEOA 4DADA 2GM4A 1CP3A 3AFOA 2WICA 3B9QA 3MA0A 3GHYA 4I5FA 4LQCA 4PV7A 3RT9A 4MWEA 3VZBA 3L6OO 1NJGA 4XR6A 3I8SA 2R8OA 1Y8QB 1PVVA 1BCRB 1GCIA 1PGOA 3W2EA 1PJ2A 2OV6A 3NTQA 3IULA 2ZJ7A 4BLOA 1JJ7A 4HZUA 3W3ZB 1LRJA 2YC4C 3DV0A 1XL0A 2OGUA 1CVRA 3IODA 4Y9SA 1RKVA 5SZKB 5JZOA 2HRDA 1DDIA 1U0EA 1MO6A 1SEVA 2CF6A 1H3EA 3KJHA 3MTBA 4LJAA 3OT5A 4YI3A 5K4AA 3RB8A 4E5YA 3HBLA 4GPTA 3FUWA 4JT8A 3K7EA 1KZ7B 3H97A 5KTNA 1XCMA 2YBEA 2QPAA 4HDSA 4M3NA 2XWBF 1PR0A 2WUEA 1H2RS 3I34X 3N2ZB 4TS1A 4CDRA 2PUEA 2PGJA 4U2EA 4B32A 5K20A 3CW9A 5CVJA 3WZMA 4NJMB 4GUDA 2WM8A 3ZHYA 4BQNA 3I53A 4Y0VA 3W9YA 4RPIA 1FXWF 2IUYA 1ZRSA 4UZSA 5GOZA 3QLVC 1HTWA 4X90A 5EIBD 3ZX4A 4MMZB 1RQ7A 3W04A 4EY5A 1YASA 1A2KC 2Y0EA 1UC8A 3R5JA 5ER9A 3RASA 5CLFA 1AQYA 1QFYA 1H2HA 4P08A 1D9ZA 2HSEA 3GJZA 2PFKA 3U7RA 2AQKA 1A4RA 3FFXA 4UUQA 3SQOA 1JV2B 3G7NA 2ZL7A 3U7QB 5KYYB 4TL8A 1T1EA 3UGJA 2H9YA 2RAFA 3K73O 2YDYA 4FYIA 5FA8A 4BV2A 4E7PA 4OK5A 4N0PA 2VXBA 5EIWA 4ZGBA 2B4KA 4RD0A 2OP1A 4XYLA 1L4LA 3GLHA 2Z9BA 1VFNA 2V0CA 1YL5A 1HNXB 1V1JA 1XZKA 1Z2OX 5FUBA 2PLWA 1X8XA 2YWCA 2CHGA 4H0CA 2RHMA 1UODA 1T3HA 1QGAA 5FYDA 2B4RO 4R5HA 4N6NA 2R96A 2NTEA 2X8BA 1A72A 4RSMA 2EJVA 3ISTA 4WESA 8ABPA 5EHIA 3IP1A 4TROA 1TT5A 4BP1A 3LHFA 4C3VA 5B4UA 4MS3B 1X86B 4N5LA 3SSNA 3WLAA 3ZNQA 1MO2A 1VJDA 3ENNA 1HDRA 2FPKA 4LISA 4WE3A 1THMA 1WF6A 5AJWA 2X42A 3H1TA 4G4SP 3RJ9A 3UAOA 5JD5A 4C0KA 1BMFD 4P2GA 3A2NA 3PHJA 1TEVA 2VDKB 3PLRA 2C57A 2BGIA 2PD4A 2BFFA 3F96A 1TM7E 2BMDA 5ALVA 4BLUA 1DKUA 2RGCA 4RCYA 5CJPA 1OT5A 1RFGE 1UP4A 4GOJA 3TD6A 3OETA 1E1CA 2WKQA 1A98A 5L6LB 3KAKA 4PO1A 2B20A 1NDQA 2XMRA 1E2KA 2J3DA 1G6KA 3NM4A 4JGGA 3Q3AA 5JFTA 3VYUB 1EX7A 2AX4A 2W2XA 4RORA 3DPSA 3MLAA 4RKQA 3C6ZA 3RNOA 4Z4YA 4HGZA 2AOUB 2H1FA 4WLEA 4MUYA 3U81A 1O6ZA 3FDIA 4LSZA 3UMCA 3JQ8B 5K8LA 4QVAA 3FGOA 1E7YA 3N05A 1U3WA 2R6AA 1MVLA 2ZQYA 4LRQA 3V8PA 3AEZA 1KR2A 4IS3A 4MGEA 1CT9A 1T2VA 2PSEA 5C7YA 2QZPA 1ZIOA 4Q24A 2HUPA 2MINB 4IIJB 1P4AA 5HDBB 3LTNC 2HU8A 1QLWA 3I64A 1CHDA 2WYUA 1M2HA 3QF7A 1XYGA 3KB2A 5AKLA 1KAOA 4IOKA 4UDOA 1NKTA 5EGSA 5C1PA 4DVGA 1Q7EA 2O5EA 5CEJA 1OTHA 1H94A 4NKRA 3TUJC 4ZI7B 1X80B 4OV6B 3NYIA 3TJZA 1GPYA 1E3ZA 2R84A 1AKNA 5E4TA 4HD8A 4R1MA 5ESDA 3TQRA 4ZDJA 1X0XA 4LXGA 4QJ4A 4RK0A 3PP8A 4PZAA 3MZ0A 4ZHQB 3JRXA 3RHSA 3SC2A 3ORYA 4PSKA 5KNBD 1Z5OA 4F7WA 4W9NC 3OIVA 4W5OA 3ZCRA 4HNQA 4IIDA 5A3QA 5IS2A 3IMKA 5DX0A 1VSUA 1XNRB 4M0LA 3F9IA 4MWOA 1G4HA 3VI4B 2O0MA 2PGOA 3DBLA 4EUSA 1IEWA 3D8SA 2KSQA 3KAPA 2CHQA 3O8QB 3TMKA 3U44B 2F55A 1JVBA 4YK7A 1UK9A 4YIKA 3NWOA 3FCOA 4XJXA 3ZWNA 1CQIB 1F0PA 4MA0A 1DPGA 4ZC8A 3TEFA 1KMHA 5KKCA 1JPJA 2KBEA 4ETIA 1DIHA 1KK3A 1PZMA 1SBNE 1SWWA 3DTYA 3LUHA 2JDIA 1JIJA 4IIEA 3LQKA 1VI6A 2GYYA 1BC5A 3AR8A 3EEQA 1CIPA 2WTUA 3QE2A 1U0SY 4O2LA 4I1UA 5BN4A 2WQ6A 1JG7A 2O8BA 3VV2A 1VGRA 1U8YA 5FOUA 1P5FA 2XWQA 3KD2A 4JBNA 4JU8A 4IG9A 4KXWA 4D57A 5CAEA 4N40A 1JXMA 4CEJB 2Q3HA 3OJFA 3BIXA 1ONOA 4NY1A 1G3RA 1MLDA 3OQOA 1UKCA 1SKBA 2IYLD 1K97A 1U02A 4GOLD 5JNSA 4BXOB 2RC6A 2V7BA 5IUJC 1Y5NA 1U1CA 2J4DA 2FEAA 4L76A 5B30A 4OHYA 1JEAA 4XVHA 1Z82A 4IUCS 4XNFA 1PD0A 4XGKA 4IJUA 1P9LA 1YR9A 1VE7A 4R83A 2W8BA 3WG9A 5HJ5A 3CVWA 5CR9A 4XIFA 5IJAA 1N2CA 3MELA 3PX7A 3QKWA 2E4XA 4X91A 3KUKA 3IR5A 4F0JA 3KQWA 4KLRA 1V2HE 3PTAA 3K30A 2WB2A 1EDDA 1YOBA 2ZJYA 3DYIA 3GLFA 2HCRA 1MV5A 4IJVA 1U4SA 4MWSA 1SD2A 3QKRA 4CLXA 1E9BA 4YAEA 1T5LA 2IV2X 3GIRA 1SCBA 3MWFA 3R3VA 1RACA 4MYTA 2GF0A 4V38A 3TAXA 2UUBB 1FOEB 3DKRA 1VKRA 1MOPA 1E64A 4ZCMA 3LCVB 3ZE6A 1JFSA 1CUDA 1VJ1A 1RQGA 4BZZA 4WOBA 3X1XA 5EIBC 2Z6VA 1SCUA 5DTEA 4DREA 4RTJA 1PNQA 3D6UA 3GP5A 2C7GA 3EMVA 4HYTA 2XUDA 1NR7A 3EHDA 4BCBA 3QU7A 4WECA 3D4LA 5HZAA 1YS1X 2OP0A 3B3GA 3KEQA 1Z8FA 3MCTA 4M21A 1IVSA 3OZVA 1FU7A 3RAGA 2JI9A 2X1HA 2PGLA 4OQLA 4BE9A 1MA0A 3GUVA 2YH2A 1TOAA 1PBTA 4AMYA 3B1WA 3ZNNA 2ZIAA 3D4IA 1Y4ZA 3ZX5A 4NECA 4LGVA 2B9VA 3JYLA 1KVTA 4ROSA 3NXKA 5KSWB 1X2BA 2CEAA 2P8SA 4AD8A 2IHYA 1PU2A 4YRSA 3TUZC 2JS7A 1E3SA 1JIXA 4Y1EA 3UENA 2DETA 3LL4A 4DJDC 5DM0A 3JD2A 4MVJD 3BMQA 4J7XA 4P35A 3QWHA 1VQOB 4PZ0A 3M6FA 3TRIA 2GBCA 4NDAA 1V6SA 1XNJA 4L72A 4QUIA 4ZQEA 4BATA 1UMKA 2IU6A 3IDOA 3R7FA 4ZMSA 4OLBA 1UANA 5A8AA 2B2NA 5CX1B 2FR0A 4ZI5A 4JYZA 3PA1A 2HCFA 1WU7A 3CCSB 2XA2A 4KQWA 4M37A 3TB4A 1M6VB 2ZBUA 3AW9A 5IKXA 3EPLA 1UKYA 2JEYA 3RJZA 3WWZA 2VDMB 3AOGA 4JJIA 5EMMA 3UG6A 4F1KA 1J06A 1Z2AA 3ASQA 1FYDA 1DWPA 2GCIA 1LUAA 2FVXA 2C4HA 3HFGA 4J6EA 4R1QA 5D01A 2J31A 5KDOA 3KQYA 3H6GA 1ODSA 4BMXA 1IRXA 1KI3A 1SK9A 2IW1A 2FG7C 4ZA2A 2PMWB 3EAQA 1ZKDA 2A57A 5ITZA 2BSQA 4B40A 4YJGA 4CUZA 2IPAB 2GZ1A 2Q0QA 2GF9A 3RVDA 3AP2A 3VR4H 2AX3A 1IBCA 1KEUA 4CKEA 2GHTA 3RH0A 2PL1A 2B34A 5IAOA 5F52A 1JYEA 2VQDA 3THXB 5AJUA 1ADFA 2FJ0A 3ZJYA 4HUTA 1DRUA 3NJRA 4EPYA 5BOSA 4RO0A 3KR0A 4CE6A 5FFNA 1HVXA 1NW9B 1CV2A 1HMPA 4CQLB 2COEA 3KQSA 1XZ8A 1Y42X 2B0CA 1Q1ZA 1KYYA 2JFFA 7YASA 3WL4A 5C7LO 1UFQA 2JLAA 2I78A 4E09A 2HPVA 2NZVG 4EELA 3PQ7A 5IARA 2P2YA 1UFKA 3DFFA 3FVVA 2IOQA 1YZ3A 4NU5A 3FCCA 3N5KA 2R4QA 3D8RA 1Q0TA 4POAA 1NMZA 3EK2A 1G1MA 2H52A 4CUKA 3T56B 3FDJA 2NZUG 1ZAKA 1JLMA 4WOKA 3DWIA 2ZXFA 3ISJA 1AS0A 4M0DA 1GM5A 4V0MA 2G9QA 5JWOA 3R0ZA 1RZRA 3WISA 4Q7JB 3SM9A 2P4HX 1LS6A 1CS0B 1GSHA 2RB4A 4MEBA 5AO9A 4KPUB 5DLDA 3ABRB 4JB3A 1GDDA 2GEUA 4RIFA 2CNWA 4P26A 2CGEA 1PJBA 2YWJA 3MWEB 3OSZA 1BMTA 1QF7A 4HL6A 1XROA 1J6UA 4BMPB 4Q21A 1G21E 3Q3JB 1V6AA 1Z3CA 2AN1A 4W5RA 1E2DA 1RADA 1SKAA 2C61A 4TKLA 3RKSA 4QJ3A 2L0XA 2X8JA 2YMPA 3NATA 4WJLA 1PGJA 3N7TA 4X3CA 1QDEA 3DAFA 4O4HA 4Y0NA 3BD6A 3W5VA 3C5HA 1YZTA 4FUQA 1M8PA 4JYMA 1H6CA 4JP1A 2BR3A 1N8SA 4EY4A 1F48A 2X9VA 5BW5A 4QFCA 5B58C 3L41A 4TQ9A 2ZJ8A 3OP4A 4X9XA 4YRRA 5B53A 4TV8A 1E5LA 4X45A 4R8LA 1H0RA 2DPYA 4B71A 3CMCO 3V9PA 4L5IA 4PHCA 1XTKA 1J0AA 1EB9A 2PZLA 4OUDB 2AOWA 4DZZA 2XUJA 3CPEA 2AN5A 1EFCA 3K5HA 3ZJ5A 3AM3A 2QHXA 4HKTA 3GCWA 4DQDA 2QVGA 5U9CA 2RGNA 4RA6A 3SVTA 2WT8A 5JI2E 1VJSA 4CGZA 1EM6A 1I6MA 3ROEA 1VZ2A 3WXBA 3G8CA 2FH5B 4AKGA 4MI3A 2FW9A 3I01M 1YMVA 2DFNA 4R9UC 1BJRE 2DOGA 4GQIA 1F9EA 1DADA 2QZ9A 3UJ9A 3GVCA 3OEYA 3G8YA 5JU6A 1V3VA 2B8TA 4KDRA 3HC7A 2JGNA 2RIPA 1TADA 3AT1A 3F1LA 4MWCA 3BSSA 1XWWA 4KO8A 4WZZA 5BQ5A 1D6MA 2R6GA 1E5DA 4QUEA 1KO4A 1FRQA 3O84A 4LC1A 1VYVA 2DGDA 4E32A 2CDNA 4NEGA 3W5AA 4CEHA 5IT4A 4GSLA 5GZ3A 4GR5A 1E5TA 1O1YA 3V7AA 1WZNA 5H9VA 2DVMA 2HA3A 3BWDD 4U2GA 4O2RA 1TJPB 2V3WA 2D13A 4WT7A 1YVPA 2PSJA 5DI9A 1EXMA 1JQ3A 3VNSA 2R62A 4MRRA 2C4TA 2RIRA 4FGKA 4G7WA 1QUFA 2CLHB 4EG6A 3LXXA 1UD5A 4ZGGA 2ZJFA 4S1NA 4B76A 1OAAA 2ODTX 5LA6B 1COZA 5HGJA 4Q3BA 4BQFA 1XAHA 3DJYA 3IUEA 3SF8A 4XN0A 4BCCA 4CM9D 2C4VA 2CXNA 2OENG 1ZUD1 2WWXA 4I55A 2ZSIA 5EZQA 1RE1A 4AAYA 2BV3A 1JEYA 4CEIA 4M60A 1Y9EA 4ID9A 3TF5A 2VYQA 3WMFA 3U4IA 4Z2AA 5AUOB 3KKZA 3NHKA 3PX2A 3IL2A 5IASA 2Q4DA 1ZKMA 1AZWA 1LPOA 1RJDA 2GJSA 2XI4A 3L6DA 1VXRA 4X6UA 3NVAA 3WB0A 1NXWA 1ZS9A 4RY9A 5G40A 2NUTA 5CCEA 1VHEA 4RPCA 4YT2A 3PNKA 3UMFA 2BCJQ 3S40A 3A6EA 1MGPA 5DYYA 3L1VA 3OWXA 2YXBA 5C34B 2K4MA 2QR5A 3QUQA 5A4JA 1ZGAA 5KTYA 3NNSA 1DXOA 1QGDA 2I3DA 2PD6A 2FQXA 4KUHA 1P2FA 3STVA 3CT4A 4FKZA 2W6ZA 1G8SA 1SZCA 2DT5A 2JAWA 3K96A 4YWHA 1A77A 2ONZA 3H8JA 3SG0A 2QP4A 3ZW8A 5HJEA 2PXAA 1TU4A 1Y4SA 5BSWA 4FWTA 1QCZA 3CUEF 3D7LA 4BX9A 4M2LA 2BHSA 4Q00A 2C4MA 1XF1A 3DWEX 3WGOA 2WVJA 3WHIA 4DARA 1QO7A 4U7DA 4EENA 1QLHA 3DZCA 4P5PA 2QDKA 5UKDA 5JCPA 1UQRA 2EFCB 3ZKWB 3JAKA 1V5EA 3NTOA 1VKZA 3T34A 5FWYB 4CPDA 3R7WA 4OYLA 2C99A 2ZTGA 1KYZA 2HEGA 3REFA 3GB9A 4BGIA 1WSRA 2Z9CA 1GR0A 2IPLA 4J0EA 4YA6A 4RDHA 1NBMA 1SA0A 5T64A 1Z17A 5D2CA 3N8IA 3WL7A 1C9DB 5KTPA 1Z4MA 5A9TA 1RPJA 1ZK3A 4FJ1A 3RF6A 3TR6A 3CCRB 1UL1X 4ARAA 4JNKA 3M4ZA 1KO5A 5HIJA 5I4KA 1AV6A 2X6TA 3AHGA 3HPQA 3RIEA 1HT2E 1SU4A 1E9CA 1WHTB 4EX7A 5EHXA 4S35A 5DXJA 1OI3A 2WF9A 1ODJA 4MDYA 1W2GA 3R3JA 2ID7A 3K1AB