2QMUA

Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the gtp and the gdp states
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
total genus 78
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qmuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2qmuA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qmuA01
3H2YA 1F60A 2BDTA 3EIEA 4IFEA 4ASUA 1GOTA 1F48A 1G1MA 3KTAA 4JKIA 4JVLA 4P31A 4DIDA 3J81k 2ERXA 3A1TA 2QPOA 5KYKA 1LTQA 1OIXA 1JXMA 2F7SA 4CEHA 1WDTA 4Y9UA 1UM8A 2I4IA 4BLQA 3DMNA 4DB2A 5TXGA 3U6KA 2YOHA 3T1QA 2J45A 5K8TA 4KJZA 4OJKA 5FUWA 4NYIQ 1X3SA 1CKEA 2H17A 1XJCA 4HAVA 3VR1A 3FKQA 4MDEA 3VKGA 1J2JA 1F2UB 2BCJQ 3GEIA 2WPDA 2GWHA 1E9BA 1TADA 1EP2B 2YHSA 3LD9A 3PVSA 3TRFA 3VR2A 2ORWA 2C98A 3FTQA 1Q22A 2WSSD 1WA5A 3MFYA 3TQCA 1JEDA 1GKYA 5LB4A 3SC3A 1ZUHA 3IIKA 5EE5B 3HR7A 2WJGA 3MMPA 5JZVA 1U90A 4B6EA 2FFHA 4EJSB 2W2VA 2UZIR 2J7KA 1DG3A 3I8XA 1DAIA 1XXHA 3VQTA 1IY0A 4DCTA 4K8OA 2YINC 2OXCA 4JJZA 4LBZA 4W5WA 4F4IA 1R6BX 1FNDA 1KZ7B 2KI5A 1W44A 2ZRLA 3WY9A 5HKKA 1VQKB 5EJEA 2LCFA 1E1QD 3GEEA 5UKDA 4IRUB 1CR4A 5G41A 3CX7A 1KAGA 1UKYA 1OH6A 2V3CC 3IIMA 4DWJA 2J0VA 3PUVA 2XTNA 4G1VA 5JWHA 4DEYA 3CCVB 4Y0VA 5HE8A 3A4LA 3PR1A 5TMPA 4BPRA 1R4AA 3X1WA 4PZZA 2VYFA 1KMQA 1KDOA 2RKOA 3AQ4A 1H8HD 2BM0A 5IT5A 1GZSA 3NKVA 4JLMA 5EE9A 4YAUA 1YJWB 5GJCA 5TARA 2NTYC 4PHHA 2H16A 4OKSA 4JT2A 421PA 2O8EA 1VPLA 2PMDA 2ZVPX 4KLZA 4WQMA 3I4LA 4F93B 2IEZA 4BLRA 3DO6A 2CVHA 1UFQA 5JI2E 1Z06A 4US0R 2DETA 4B74A 3HYTA 4ABYA 4HB2A 1EX6A 2ZJZA 1TLLA 4FMBB 2YWGA 3TR5A 1NIJA 2FWRA 1E2JA 4RSGA 4YQFA 2EU8A 3BJIC 2KE5A 1OHHA 3W6OA 2QZ4A 3EZFA 2BBWA 1YZNA 3LVBA 2H1LA 4URXR 1NMXA 4WZ6A 2IXGA 4A1FA 1XXHB 2DB3A 4HLUC 1YZKA 1IOZA 2XZPA 4N0DA 3WMGA 4YMUA 1NLFA 4EAQA 3WXMA 2YOFA 3OZXA 4LYFA 4A8JC 3PENA 3U4QB 2NGRA 2VHTA 4B73A 1XD2B 4DHEA 2OXRA 1A82A 3B1YA 3CPEA 4R2HA 4C43A 1E96A 1CIPA 1GAQA 1E2FA 1YR8A 4IVRA 2DFKB 2GJ9A 1DELA 1VIAA 4OHWA 3GJ5A 2ZI6A 1EXMA 1VQPB 2ZR9A 2HV8A 4H9GA 2ZJ8A 1COWA 1YJ9B 2ZR0A 2VF8A 4LYHA 4AURA 3T61A 1WP9A 2OCYC 4CYMA 3CXCB 2CEAA 2F6RA 4QGHA 2RHMA 2RC5A 5AUPB 2IS1A 1LVGA 1K5GA 2WSSA 2JLVA 1E2PA 1AJEA 2OSBA 2D06A 3CF0A 5E7IA 1ZCAA 1KI3A 4JBYA 1NY5A 4G5GA 4C7OA 4B4DA 5CITA 3RC3A 2SHKA 1OFUX 4AKEA 2QMUA 2EW1A 2QORA 5HCNA 4LV5B 3CONA 5IDVA 3WBKA 4RKFA 3MCAA 1BH2A 2J5XA 3W6PA 1VCMA 1XE1A 1KAOA 4BFSA 3QVUA 5EZ5A 3RVBA 4P4SB 2GZDA 3SU8A 5JMTA 1WBBA 1QX4A 1ZNZA 3KQUA 1E99A 1B23P 2CMKA 1E1QA 3W2EA 3QXXA 4OYHA 4TZ0A 5DLQC 2VP5A 2ATVA 2KJQA 1GVNB 2JGNA 2OG2A 3UG7A 4QKQA 4B47A 1Z0KA 4B2IA 2V6IA 5F3WB 3BH0A 2XSZD 5CJ2A 1AMOA 3FE2A 1TX4B 2JJ2A 1VKJA 1NBMD 3B6EA 4JBWA 2QROA 2WJVA 4YMWA 5LPNA 2JLUA 3QEJA 4G3XA 5A4JA 1KTVA 3CNOA 2GCOA 2RGAA 1S1MA 1DO0A 4ZIRB 1E79D 3SEAA 4PO9A 2RAPA 2R6FA 3C5CA 3P26A 4AC9A 6Q21A 2AK3A 1Z29A 1Z0DA 2EYUA 5JHGB 3TLXA 4A82A 2QAJA 2QENA 5GJVC 1TEXA 3CMEB 1XB2A 3BIFA 4DCNA 2BKEA 1Z6YA 2BMEA 3UKDA 4IFBA 1P75A 1II0A 1JPJA 1QHIA 4B32A 4F91B 3W9YA 1FNMA 4KVGA 2GPJA 4ITRC 3AF4A 5FI0B 1S9DA 1MO6A 2HF8A 3EAQA 4JKYA 5FUXA 4FK8A 1QH0A 1KO5A 1KNQA 1ZAKA 2OHFA 3R9IA 1XCGB 2AWOA 4LHYA 4K81B 4Q1FA 3ICQB 4MKHA 2BPOA 2WKRA 2GF0A 4YXWA 1BS1A 2XEXA 3NBYC 2VRWA 5EE3A 4DCUA 1DDIA 3I1FA 2IS6A 4CT4B 2A2ZA 4BLPA 1Q44A 1BJKA 3PEWA 3AB3A 2FFBA 2ZU6A 4U5XA 2X19A 4OQLA 2V6JA 4TLBA 1IJEA 1D2MA 1KYIA 2P6UA 3O8RA 1XF9A 4DXAA 1R0WA 1SKQA 1T8UA 2DYKA 2GA8A 3B8HA 4FMCB 3EIQA 5GV8A 3WRYC 4HYYA 4RZ3A 1DVRA 3THOA 3P4XA 1NF3A 1G8HA 1QG4A 4O2LA 5J4YA 5JJIA 1TAGA 1EX7A 5JFGA 5FUYA 1IN5A 2OLJA 4Q4JB 5C4GB 3OJXA 4BASA 1P5ZB 1T9HA 3QE0A 4X8MA 5G40A 3PUXA 1IQPA 4G1BA 3I55B 3QF4A 1E2MA 3Q3JB 3MSXA 3I5XA 2LWIA 4PSAA 5J4LA 4O2RA 3SJAA 3D7MA 3KJEA 3OEHD 4TMXA 1LV7A 2KB0A 4C0AC 1GKIA 1OFTA 1W2BB 4V02A 1KDTA 5IF9A 4UXHA 1E64A 4R7ZA 2REBA 2FF7A 3KXIA 1ZUIA 4LHZA 2WWWA 3A1VA 4KFTA 4CZ2A 3AP1A 1AZSC 3D3QA 1DBSA 3DOEA 4GOJA 4HUTA 2ZREA 2QBYA 2VNKA 1GITA 1D1NA 1G8FA 1BOFA 2CLCX 5A5GA 1G16A 5HKKD 4UNNA 3A4NA 5KNDA 2MSCB 1ZNYA 4DDUA 2XAUA 4IDNA 4A92A 3EXAA 1QUEA 3WBJA 2BBTA 4X8LA 4DDVA 5SZJA 5HE9A 2D2EA 1RZ3A 3B2EA 1OKKD 1W4AA 2IL1A 4Q21A 4CIDA 3B9QA 3CCRB 2D7CA 4LY6A 4UQOA 4M9SA 4M4SA 1VQLB 3SS8A 2QU8A 2QPAA 2F55A 3A58B 1ZM4A 1W0KA 5TDHA 2ZSAA 4DIEA 1N6IA 2H92A 1SXJA 1PVOA 3A37A 1UKEA 2L0XA 1N5JA 4XWKA 1DAKA 2NO0A 3LBIA 3CRMA 3NC0C 3CMAB 1E1RA 3OIUA 2VIIA 4JVNA 4HLUA 1GRRA 4TLEA 4C0HA 2ANBA 5B30A 5FOSA 1TQ2A 3BD9A 4B2LA 3RS3A 5FOUA 2QRZA 4MRSA 3ZQJA 5J40A 5J47A 1QFYA 4JYCA 4L9SA 1X8JA 4PQFA 2F1JA 4CF7A 2IK8A 2VF7A 8OHMA 1YZUA 3VTKA 821PA 5KPDA 1MABA 5AWFC 2VHJA 3A4MA 1SKYB 1T3SA 1H85A 4GOKA 5ANRB 4CEHB 1DOAA 3AUYA 5JEDA 3UWOA 1BYUA 4M22A 1N0VC 2QE7A 5BN3A 3V9PA 5KOYA 2VHUA 2FE4A 3VMFA 3TBKA 5GV7A 4D80A 5BYKA 1CF4A 2AHOA 2ZAOA 3IO5A 4POAA 2P65A 4QFMA 4IDQA 1KO1A 4HLQB 1KZGB 4LRWA 4Q7JB 1U94A 1XTJA 2FMXA 1I4TD 2IWHA 1F2TB 2JA1A 1W36B 2OTJB 3CD6B 1FUUA 4AK9A 4AG5A 1D6JA 3B1ZA 1S72B 5DHAA 4XSGA 3LV8A 3TE6A 3H1TA 3CC2B 4TLAA 1E4YA 5J4VA 1KRHA 2OFWA 1UBEA 2YWFA 2W0MA 2PIAA 1E79A 1QGYA 2HUPA 2JJ8A 4PC1A 3DZ8A 1S3SA 2C5LA 4A0GA 1OFIA 3CNNA 4C3ZA 1XFAA 5AR1A 5CLQA 2QSYA 1KO7A 3Q7PA 2VQSA 2IX3A 1HTWA 2V8OA 3HDTA 1YQTA 4D82A 1KO4A 3QNUA 2DWQA 3U3OA 5LD2C 3L2OB 3WP1B 1EFUA 1N6OA 1YR7A 2VEDA 2JLXA 1IN7A 2G6BA 3CWZA 4NZYA 2NPIA 3U7FB 2V7QA 4QM6A 1QG0A 3FMOB 1FL9A 1N5LA 1W2HA 1WBDA 1DAEA 3I73A 3TGPA 4RZUA 4HAUA 2VNHA 3EPHA 1JNYA 3PG5A 1TQDA 2BMDA 3CH5A 1EP1B 4CDGA 4JLOA 1TUEA 1IONA 4YXWD 1J7KA 2IYYA 3D6TB 4IJMA 2ZE6A 3EZ9A 1QHHB 1XBTA 4Q9HA 4F92B 3CRQA 4P32A 5LD2B 4AKGA 1Z22A 2ZAMA 4B3GA 1W4RA 1VQ7B 3W2IA 4GZLA 2BMFA 2FSGA 5EE0A 3SJCA 2VP2A 1P3JA 2CHVA 2DERA 4TWZA 3HU2A 2A5DA 3WMFA 1YE8A 3GJ6A 1B2RA 2ZRGA 4FMCF 3AEZA 3OAAA 2O52A 5AUOB 1VQ6B 3QKSA 4B3XA 3HPRA 4PANA 1B0UA 4DC9A 5DI3A 1FX0A 3FPKA 1O3YA 4JLPA 4HZUA 4JYBA 3O8DA 5CM8B 2W6IA 4RD2A 2O0HA 4IXNA 5JWOA 3ES9A 4ARZB 1G4AE 1KO8A 3AKCA 4XIGS 4QJ3A 2DFLA 1GRNA 3JQQA 1I4DD 2QMOA 1ZM9A 4P0TA 1RIFA 4TYQA 1ZIOA 5IHPA 1VQNB 1ZUNB 1QGZA 4Y7CA 4KFRA 3R9XA 1U9IC 1XMIA 4JLDA 4JJKA 2B5OA 4OK3A 4TT3D 1DARA 4O0MA 5FPKA 4P3YA 3GJ0A 1YZTA 3HJNA 4NYJQ 1D8TA 5H59A 4S2EA 4JL5A 3WMEA 3EPJA 3GJ3A 3OIVA 5AJWA 2WOJA 2QDXA 4G5QA 5K8IA 1VG1A 3GLGB 2PEYA 1E2NA 3LLMA 2FJUA 1JQJC 2DFTA 4U02A 5B58C 3L0OA 2R62A 4Q4AB 1N2CE 3U3KA 3T35A 3GLFA 3QFTA 4MYTA 4NDZA 3THWA 1E9CA 3W90A 4N0EA 3Q9LA 4US1R 4TMKA 3CZPA 2CL7X 2HXSA 2BVNA 4BWYA 2VH5R 3F5FA 3LBNA 4D4LA 1M7HA 1N5IA 4A2QA 5H8WA 3UPUA 3LY5A 1FPMA 4C7OB 3K0FA 1M1KD 4P4UA 3NHBA 5FH9A 1SKYE 3BE4A 4D0NA 4BRUA 1RRCA 2ZUBA 1Z07A 1EFCA 4FMDB 5JEEA 2J3EA 2R65A 4QBIA 1RYFA 1W2GA 4MRVA 1WXQA 2P2LA 5BN4A 2XNSA 4EQ6A 2QI9C 2IXFA 3IEUA 3QKSB 3ZBTA 4JLKA 3R7WA 3ZVRA 4C0SA 3I72A 1R2QA 2VBCA 4YLGA 3K9GA 1VQOB 2J87A 3N2EA 3R8FA 1I2MA 3KKQA 2J0UB 2AFHE 1ZYUA 1ZINA 3LA6A 1RJ9B 2PBRA 1N8RD 1P73A 3VNUA 2CE7A 3AVWA 1VQ4B 1JR3A 1W47A 2CLSA 3LQQA 2GCOB 4L5BA 3IQWA 1E2QA 4U00A 1A2KC 1S8FA 4BFVA 1QVFB 4PAOA 4HATA 3SZRA 4YHBA 5FI1B 1FMJA 4J0QA 3A6PC 1SVIA 4Q1EA 1T0JB 1BMFD 1F6BA 2QY9A 1E9RA 1GAJA 2GVDC 4XVRA 2JDIA 4RFSB 2R6HA 5E4FA 2CK3A 1CRQA 2A78A 2FSHA 2P5TB 4NMMA 3RS4A 1RRGA 4R71A 2N42A 2ZRMA 5KTYA 2J1LA 2YVUA 5GJWC 4N1AA 4B6FA 3U6BA 4P4SA 5P21A 2XZOA 2IT1A 2XOKD 4NE2A 1TQ6A 3AF3A 3GLHE 4YDSA 1KI7A 4V0KA 4TYYA 5FBLB 2F3TA 3EWAA 2ZEJA 5CDFE 4NCNA 1NLZA 4LBWA 2GHIA 1JXOA 3AF1A 4EIWA 1YJNB 5DYGA 1AQYA 3T1VA 1E0SA 5L3VA 1BX1A 3RABA 2UKDA 2H8KA 3QENA 3RS0A 1NMZA 3CPWB 5KSYA 3B60A 4DEXA 1R0ZA 1Z2AA 2FGKA 4DUGA 1BKDR 1NN1A 4F7DA 1JJ2B 1Z0IA 1R7RA 1XPRA 2ZUCA 1DAFA 4IVPA 2O8DA 3I92A 3CPHA 1E9AA 3FB4A 2EWWA 3NXSA 2ZJAA 4XH9B 1GSIA 3U44B 1IY1A 1K8AD 4DRZA 1OXUA 1AS0A 2PEZA 3K0SA 1Q1EA 4OQFA 2J0QA 2OFXA 4KCGA 1YZLA 2QT1A 2ZJ5A 2PT7A 5FTJA 2WWFA 4UXIA 1UAAA 2AXNA 2O8BA 2NO1A 1JQLB 3CCEB 2QA4B 2H18A 2BEJA 2JLQA 2KSQA 3LXRA 5FTLA 3EARA 3GLHA 3HYRA 4EFNA 3VNVA 1JB1A 2FA9A 2OTLB 1NRJB 2YNMA 4BRWA 3P32A 2RGCA 4UJ3A 1LS1A 4M9QA 2C04A 4OL0A 4I1SA 4ZGNB 4HSEA 4I1UA 5C4MA 3BFXA 1N6LA 1NKSA 4V03A 1E2GA 3SFVA 1FOEB 4C9BA 3R7WB 3C16C 4PQRA 1IY2A 1ONBA 2O0JA 1N25A 4LOAA 3GJ4A 1NNEA 1OH5A 4TZ6A 2ZRKA 2QAGA 4MUAA 4D6PA 3LXXA 3QQ5A 2G88A 5FL7D 3M4YA 4A4DA 1GJRA 2YV5A 1VCNA 4BEJA 3DZDA 1G19A 4IOKA 3FKSA 4BZXA 1EWQA 3MLEA 3SN6A 5FFMA 4LYAA 1XXHE 5JWRA 1QHGA 1OXVA 4IHQA 4M8NE 1KJZA 2J0SA 2AWNA 2ASEA 1FZQA 3VR5A 1SXJC 4ZV4A 2YC2C 3MD0A 4Q02A 1W7AA 2A30A 1AS3A 4PHTA 3VHLB 4TYWA 1QHNA 3CM0A 1II8A 1AS2A 2CCJA 3K0AB 1N0UA 4WAUA 4Q18A 1OH8A 1N6RA 3BGWA 1EG7A 3T06B 1GM5A 3H4MA 3VFDA 4XJXA 3CNLA 4DBLC 1VHTA 2HJGA 3CWQA 3Q5EA 4QGGA 2WMNB 1GL9B 1S3GA 1JALA 1JB9A 4M1OA 2RC6A 3FOZA 4TMWA 2H57A 3AF2A 3DDCA 1L4YA 5LBIA 3PQCA 2XNDD 4M9XA 4QL3A 2HXYA 4G5SA 1UADA 3QFRA 3B78A 1GG2A 4NKRA 2QUZA 4CEIA 4TQ9A 3AVYA 3H0KA 4DKXA 1ZNWA 3MRSA 4D26A 3K8YA 2OBNA 1I4LD 1WQ1R 2YJTD 4D4MA 2IHBA 5HR5A 3EA5A 1G6OA 1IBRA 4DDWA 3A36A 3REGA 1A8PA 1D9ZA 3CCUB 1SVMA 2RB4A 2ZRBA 3LAWA 4WXPA 1VCIA 1J70A 2QQEA 3KL4A 1OFHA 3AVQA 1TMKA 4C4PA 5BXQC 3QKRA 2IHYA 1Z6TA 1HH4A 4RZ2A 3RYTC 1SVSA 3IPYA 1FFHA 4CVNA 2ZIAA 1AM4D 3C7KA 2ZRJA 1UDXA 3U7EB 4AYTA 3QPVA 1H8EA 1RVDA 3EPLA 2WV9A 2XX3A 3SJZA 3W5UA 2GAAA 2J46A 4LCBA 5EE1A 2O8BB 2G0TA 3W5IA 2WTUA 3B82A 2DCUA 1E4VA 3KB1A 3GQBA 5J5CA 4B35A 3V4RA 2IXEA 2FDCA 2JLWA 3GJ7A 4Q01A 3HR8A 1XX6A 2ZUDA 2O8FB 3ZZ0A 5DYIA 3G4SB 1XPUA 1X8KA 2WHXA 3AUXA 3WHLA 121PA 3PCRB 2AXPA 2ZRAA 2FV8A 5L3QA 3TIFA 2BBOA 4MDFA 1W35A 5CB6A 4EFLA 1F2TA 4JMPA 1AKYA 3CLVA 2FPLA 3FVQA 4PR0A 4Q4LA 1GNRA 3U60B 1DTSA 1Z28A 1W48A 1DDGA 1CXZA 1OB2A 3OFND 4V0MA 4Z51A 4I4LA 1KNXA 3LQRA 2BMWA 3U2QA 1W5TA 1YR6A 2WSMA 2GKSA 4GBMA 1ETUA 2QTFA 2GTPA 3RSOA 4DLYA 1HUQA 3CBQA 3E5HA 2FG5A 4HB4A 5JSZA 2QN6A 2RGNA 3TUZC 3U61B 2QM8A 1FDRA 1NG1A 1NJGA 4URYR 1VQMB 2ZE7A 2ZU0C 3ETLA 3U3RA 3UK6A 4AKIA 5AK0A 4TMZA 2PCJA 1CR2A 4LK2A 3ZIAD 1BIFA 1IXZA 3NBZC 3KUCA 1NDHA 3VO1A 1G3MA 4BZPA 3BFVA 3PUYA 2QE7D 3W8RA 1M7BA 4O3MA 1OSNA 2C9CA 1XD2A 2O8DB 3Q85A 3THXB 3SQXA 3CUEF 3AF0A 4Q4JA 4EJSC 3R20A 3TH5A 4Q4HA 3SYNA 2ERYA 2R44A 2Z4RA 4LHVA 3ADKA 3SBEA 5DI9A 2OFOA 3RWOA 1G4UR 4LC1A 2ZM5A 2IYLD 1KK2A 1Q86D 1W0JD 1XEXA 3KKOA 5HPYB 1D2EA 4LPKA 1U8AA 3I5YA 4NHOA 4Q9IA 1NVUQ 3X1ZA 1EFRD 2D4HA 3QI2A 1TU4A 2VSOA 2ZYWX 3ZZTA 3WYFA 1KI6A 4RD0A 3CW2A 4DQLA 2OK8A 3FYHA 3AVXA 3E70C 3CRW1 4PX9A 5KHOC 3KJIA 3IUYA 1LS6A 1NVVR 1X1RA 3QKRB 4MRNA 1FQJA 2ZJ2A 4DSTA 5DISB 4X8OA 1RRFA 4KSBA 1PUIA 1CJKC 4A15A 1CNEA 3OEHA 3E1SA 4B34A 1E62A 5L3SB 2EFEB 2IYWA 1I7PA 1HQCA 1ZW6A 3OHMA 1UMKA 1GWNA 1MOZA 2CHGA 5HZKA 3JQPA 1E2HA 4QJ5A 4RFVA 2OT3B 2WM9B 4KXFB 2QP4A 3NTUA 4DLTA 4TL6A 4MYUA 1J8YF 1K6MA 4LBYA 1YRAA 3HWSA 1FNBA 1QHSA 3FMPB 4DB4A 2WPDD 2E87A 2F43B 2ODNA 3BH7A 3K0FB 5TB5A 1ODFA 2ZRNA 4B44A 3ZS8A 2VSFA 4QBGB 1AN0A 2Q21A 2BBSA 3IKJA 4QM7A 4MGIR 1U81A 2WWGA 4ZCMA 3CCLB 3KJHA 4A6PA 4YONB 2MSDB 3UWKA 2Z6VA 1K9MD 1ELOA 2BC9A 5CJPA 3RLFA 1IXSB 3O8CA 2W00A 3MJHA 1F2UA 1XMSA 3QG5A 1IJFA 1XMJA 5HXBA 1ZJ6A 1G8YA 3GEHA 4MGYR 4LDJA 2VSXA 3LFUA 4PPNA 2BN4A 4Z8XA 4B76A 3K70D 1UBCA 3DMDA 2PH1A 2ZXUA 3U7GA 1UBFA 2ZRPA 5JJLA 1TTTA 5IRCD 1F20A 4FINA 3BRWD 2PT5A 4URWR 3GJXC 3K53A 4MGZR 2P0EA 2PJZA 2ZJBA 3U5ZB 1Q3HA 2Q9AA 3BFKA 1BO6A 1BYIA 2IYXA 2H5EA 4GMDA 3HPQA 3W5JA 4NYMR 3GLIB 1P2TA 5AJYA 4P4TA 1YJ5A 3ADDA 3T1TA 1JR3E 2KBEA 3ASZA 3TSOA 2V1UA 2PLFA 5EP4A 1A7JA 1IN4A 3QFCA 1Q7YD 4JLBA 3LW7A 4WBSA 4HAYA 4V0ME 1L4UA 1V5WA 1E2KA 1ZIPA 3M0EA 5JS8A 1P7CA 4GP6A 3RAPR 2HLDD 5KSZA 2BGJA 4M21A 1KSGA 3KJGA 4G01B 4S35A 3QUSA 1T4GA 4OJQA 3PUWA 4R98A 5CYOA 2R6GA 3T1OA 1AZTA 1W1WA 1X1SA 4UNRA 3Q8XB 1AIPA 1KQSB 3EPKA 3W34A 3GLIE 1A5TA 4L16A 1G3QA 1FNCA 4II7A 1OW3B 4Q7KA 2AK2A 3AGPA 2WWXA 2EYQA 1S2MA 5DSZA 4AD8A 3OEEA 1NJFA 1OYYA 2VLIA 4RFSA 5EP2A 2UVQA 2GEVA 2IYSA 4GFDA 3W5VA 1E0JA 3MJRA 5JS7A 4HZIA 2DWOA 2IC5A 1CEEA 4DJTA 2AKAB 2IBMA 4EPVA 1IM2A 3OZVA 1H42A 3H84A 1KI2A 1ZD8A 5FR1A 4TT3A 3ND8A 4OBEA 1RE0A 4HUQB 3X1XA 3CRVA 3PUZA 5FBRB 3VR4A 2FNAA 4EDHA 5M04A 1DAHA 2WMOB 4URVR 4GZMA 3CCMB 2R2AA 4I1VA 2ZI4A 4B3FX 4AI6A 4GDFA 1ZC3A 3MGCA 4KYIB 3AGQA 2TMKA 4OHZA 4TYNA 3NEYA 4IKEA 2BF4A 4JS0A 2CE2X 3QKTA 4A0RA 2GXSA 4D4JA 5F9HA 2RMKA 5KDDA 4G5OA 4CT5A 3ICEA 4JT4A 1P2UA 1FQKA 4G1UC 1E69A 4N3NA 1M8PA 1XEWX 2IYTA 3LRPA 3NBFA 3DPUA 4NP6A 5A0FA 3BXZA 3IBGA 3PFIA 1CULC 4FCTA 4RD4A 3WHKA 2GDJA 2ZS8A 3CCSB 4ZKDA 4ARZA 4EKDA 4DSNA 1XTKA 1FP6A 3OIWA 4LJYA 2B92A 1LW7A 1R8QA 3QFSA 3LO8A 1ZU5A 2JDID 1V43A 2GXUA 4IOJA 5HCIA 2HDNB 2CVFA 3OF5A 3QOFA 4Q4HB 2G0NA 4XTRA 4M1TA 3GLFE 4CEJA 2IEYA 5FBWB 3EC1A 1VG8A 1KI9A 4QXAA 5FBQB 2XZLA 1GAWA 1EFHA 5CM9C 2CCGA 1P9RA 2WKPA 1AA9A 2O8CA 3DHWC 4A36A 4OI2A 2V1XA 1T91A 2ZI5A 3K0AA 3WNCA 4FCVA 5GJBA 1AGPA 1MABB 4QC2A 3PITA 5KDOA 2XJ4A 2GZHA 2F3RA 4HDOB 3W2FA 3VKWA 1LB1B 2YKGA 4FWTA 1JEEA 1Q21A 1G18A 2HCBA 4TTRA 2GCPA 1P9NA 1SXJB 3ASYA 4WIAA 1YHNA 4NCHA 4BLOA 2JLRA 1KKLA 2XTZA 1R0YA 1KY3A 3NIBA 3K70C 2WKQA 2XB2A 1CJMA 4ILEA 2X2EA 5DIFA 2QT0A 4XVUA 1G291 2GZAA 2IUUA 2C96A 1HV8A 1ZP6A 2IYRA 3CIOA 1GNQA 2R8RA 4HAXA 4HAWA 2V4ZA 3K9NA 1OXXK 4KV9A 5FOXA 5KU1A 3ZLJA 1U99A 4Q1CA 4Q7MB 2REXB 2XSZA 1IHUA 4LBVA 4LX0A 3B85A 2IS4A 1NI3A 2W83A 4JLVA 4PSKA 3GMTA 4URZR 5AN9A 3EZ7A 4DCVA 3THYB 4MKIA 1GIAA 3GJ8A 4RD6A 3BWDD 4NCIA 3L0SA 1CS4C 3CX6A 1HA3A 2G77B 3QEOA 4B75A 3TJZA 5AJZA 4PZYA 1SGWA 4IDOA 1C1YA 3ADBA 3RC8A 1XJ0A 2RGBA 4KAXA 3ZBUA 1VTKA 4D81A 2XTMA 3CC4B 1US8B 3P20A 4JSYA 4RCYA 2B21A 1G8GA 1LF0A 1YU9A 3PEVA 1PLLA 2PL3A 3CO5A 4IOLA 3ZZUA 2IF2A 3A8TA 4NBSA 4YAOA 1VQ8B 1MRSA 1ZMXA 3PEYA 1N3BA 2Q3FA 2WVJA 2C9YA 3M6AA 4DT1A 2RGXA 2WWHA 5G3YA 1PUJA 2A5GA 2Y8EA 1TF7A 1I2DA 1Z6GA 1LY1A 3D31A 3PIRA 1KMHA 4W7SA 4B33A 4DSOA 2GQFA 1RRPA 1U98A 3C41J 4JLNA 1YRBA 3REFA 4EPYA 4DDTA 4C2UA 2AD1A 1ZU4A 4UJ5A 1XU4A 3IIJA 2LKDA 1ANKA 1M7GA 1VG9B 1XTIA 3BS4A 2X1VA 3VX3A 3GLGE 3IQXA 1Q3TA 1FX0B 2BOVA 3O47A 4L15A 4WZAE 4XVQA 2IYZA 3FHCB 2YYZA 1SM4A 3DKPA 3O8BA 3RS2A 3MHPA 1QGAA 1W4CA 3SOPA 1EFTA 5G3ZA 3CF6R 4KFSA 4LJ5A 4EPWA 5TV2A 4Q9KA 4AWXA 5F9FA 3AV0B 1TU3A 3GFPA 4QHTA 2OILA 2ZROA 3OIYA 1QHHA 2VP9A 4FW9A 4Z54A 1KY2A 3AM1A 4F4CA 2HF9A 1Z83A 4QRHA 5AJVB 2CNDA 3FWYA 5L8VA 3KKPA 3QBVA 5FTNA 2XNDA 3K9LA 2OCPA 3CH4B 2XXAB 1MH1A 2VTKA 2F1RA 4Z1MA 3QSYA 5B64A 2WOOA 4C0BA 1G5PA 4JSTA 1QZXA 1NBMA 4DLSA 2YC4C 2ORVA 3HP1A 5ELXA 1G5RA 4PAMA 3ZD6A 1GR1A 2IS2A 2RCNA 2GCNA 3GPLA 3CR7A 3VU9A 1W5SA 1CJTC 1E98A 3QJYA 5D3MB 4FCWA 1XEXB 2VP6A 1R8SA 3C5HA 3RS7A 2WZQA 4KLNA 2E9SA 1M34E 2IUSA 1KKMA 3KTAB 2QP9X 1W36C 1A2BA 2GJ8A 1PV4A 1L8QA 1YVDA 1NSTA 2IUTA 4TMTA 5SZKB 1OH7A 4PHGA 4PFSA 3TVTA 1FRNA 2RGGA 1E9FA 4LPSA 4HLCA 4TL8A 3TAHA 5HTKA 4TSFD 4V0OA 3IO3A 3NG1A 4NONA 1G20E 3MWYW 1SQ5A 2FU5C 4LJ9A 2OAP1 1L7VC 1Z0JA 5TY0A 3GFOA 5C2JB 2VP0A 1WB9A 1J90A 2NOAA 5K8UA 3K1JA 1XP8A 5EXTA 4M2LA 1FUKA 1S1CA 2OV2A 4MQBA 5DN6A 2ORIA 1UJ2A 4D0LB 5KUTA 4MGKR 4RVCA 4XD7D 3U44A 4W5JA 3MUFA 1L2TA 3TQFA 3LW8A 5LB2A 4BGDA 4Q00A 1Q0UA 4ZI2A 1H65A 3BB1A 2QM7A 3FMFA 4BFTA 1HQYE 2PZFA 3WNBA 4PZLA 2CJWA 1G7SA 3KQKA 1QUFA 3ZD7A 2V54A 1GKUB 2X2FA 3JZAA 2C99A 3CR8A 5KSPA 3BORA 4OI1A 1ZNXA 2NIPA 2O8EB 1JBKA 1GL7A 3NEJA 5CYPA 1HEIA 4QHYA 2O8CB 5JBQA 2DPXA 3C4JA 2NG1A 2ZSBA 3TNFA 4BFYA 4TMVA 1COWD 4R2IA 2ZITA 4PC3A 2CXXA 4PO8A 1OGJA 5EP1A 5GADl 5BW8A 4MKGA 3L0PA 4GI7A 2ZTSA 4EFMA 3OE7D 2GEUA 1BX0A 4C0JA 1MR3F 3RANA 5SZIA 4BUJA 2GJSA 4GNKA 3IEVA 3KX2A 4OK6A 1NVVQ 4DLZA 3EZ2A 2QA5A 3BB3A 5C1BA 2GNOA 4K46A 4GRAA 2GAOA 2WJIA 3B5JA 4OI0A 2EQBA 1XZPA 1PLJA 2CNWD 3ZVNA 3QVVA 1Q1QA 2ZE8A 3QXJA 4XTCS 3C14C 1G6HA 4V0NA 2C9OA 3ND9A 4PAQA 5FUVA 1P2SA 4XD7A 1UKZA 2P6NA 2CBZA 1CNFA 1ZVQA 3AVTA 3FFAA 4AF6A 2EVWX 1GTVA 1OPXA 2ZSFA 1MV5A 2EFGA 1NLYA 1OIVA 2G83A 3KKMA 4Q1BA 4CW7A 2AD5A 3KQHA 5FBVB 2OE2A 3IDQA 2LKCA 4DLXA 3KQLA 2ZI7A 2NO9A 4QBFA 3RWMB 4A8JB 4F4JA 3NC1C 4FMDF 2PX3A 3VU9B 1SXJE 4I99A 3WRXC 4XWAA 3W2GA 5D3MA 2HYDA 2XJ9A 1YIJB 3R9WA 4C0QC 1E0KA 2F1HA 2XITA 2D74A 3QXHA 4KI0A 1E1RD 2DWPA 2E1RA 4WZBE 4LSGA 3UXMA 3SE0A 1C9KA 2DEUA 1VHLA 1KK1A 2B8TA 1YKSA 2JLYA 1EESA 3W5HA 2FEOA 1E9DA 3ZYCA 3WP0A 4NYIR 2CL6X 2QSZA 4JIMA 4LHXA 1NL3A 1UBGA 1JPNA 1SHZA 1P60A 1H8ED 4B2PA 4KFUA 3N70A 4E09A 3B1XA 2VA8A 2VPPA 4YMVA 1FTSA 4C0KA 2YWHA 1S0UA 4QNRA 1P4SA 2FGJA 3ZS9A 4RD1A 4CGZA 4RCZA 1Z47A 2OBLA 1G5TA 4Q7LA 5DI3B 1FRQA 2ODEA 2EFCB 3NWJA 4IDHA 2PZEA 1VIYA 1R5NA 4L9WA 2IA5A 2JASA 1AGRA 5FPHA 1P2VA 1Z0AA 2IYVA 2OCBA 1KDPA 4OI4A 5E95A 4X8HA 5FPSA 1YZQA 4KYUA 5THXA 4JVSB 2XNCA 2JLSA 1JAIA 3K09C 4IEEA 3AP2A 4M53A 4QG7A 5J4HA 1CRPA 2D62A 3IBYA 1KI1A 5KSWB 3L8ZA 2WWIA 3OFNA 2J41A 3FGNA 2A9KA 2A5YB 2QGZA 1U9IA 2XOKA 3EWSA 3QBTA 4ZO4A 1JR6A 2FPMA 3L0IB 3NH9A 3RRMA 3B1WA 5KDLA 3VAAA 3CC7B 3F8TA 3KQNA 2JATA 1AK2A 3I56B 3BOSA 3KKNA 2GESA 4YMSA 1U0HC 3GLFB 4TTPA 3NH6A 3THWB 5JHHB 1NSFA 4RD3A 1E2DA 1OLOA 3NHAA 2RGNC 4DQKA 1MO5A 4Q66C 4TQUS 4LUCA 2AL7A 1T8TA 4MKFA 1G41A 1KI6B 3MG9A 2ZRHA 3TW4A 1P6XA 1QVRA 1DE0A 4NL4H 2IWRA 4EPRA 3TK1A 2QTLA 2W0SA 3SFZA 1E94E 2JEOA 1O87A 2RHDA 3ECCA 5G53C 2BIFA 2QGNA 1G7CA 2AX4A 3P27A 1GRQA 2D3WA 1M6NA 4B48A 2ATXA 4BFUA 1FNNA 2ZRIA 1OXTA 1PLKA 4A9AA 4Y9RA 3CRRA 3NDPA 4OQXA 2J9RA 2QPTA 2CCKA 5D3QA 3RNLA 4G5RA 4GL2A 2WJYA 2P6RA 2XB4A 5CB8A 1W0JA 1N6KA 1OIWA 1S96A 5E7JA 3CCQB 4FD2A 4BPBA 1DPFA 1EGAA 4YC7A 2ZS7A 3RRYA 1SHKA 1WF3A 2OZEA 3RDPA 3FDIA 2PCLA 3SHFA 4ON9A 4LZZA 1WRBA 4F7WA 1RJ9A 3OAAD 4KSCA 1HURA 4KBGA 3TW8B 3E1YE 3SHWA 5B57C 1F3OA 3B13B 3L43A 1MKYA 1YZGA 1LFDB 1PZNA 2R6CA 3P4YA 2X77A 3PV0A 3G0HA 1G21E 1CR1A 3LLUA 1YHQB 3DKVA 2WICA 1R0XA 1GP2A 2B7CA 1QFZA 4O25A 2B6HA 5L3RA 2HLDA 5LDDC 4QBHA 2RGEA 2ZRFA 3BB4A 1RKBA 1NMYA 2QTVB 1ZM7A 3AVPA 4MITA 3MAAC 2C78A 1VYVA 1RC8A 1UF9A 4EQ6B 4KU4A 1XZQA 3L82B 5H1YA 4QGAA 1TVCA 1IB0A 5CK4A 5JJKA 3TSWA 1CR0A 1IAQA 4M1YA 4MYHA 3PJRA 2CNWA 2GILA 4XWOA 1WE2A 3KUDA 4DSUA 1CQXA 2QQ0A 1OGIA 3FHOA 3OESA 4Q48A 3SNHA 1QF9A 1NY6A 5EZ6B 1W49A 5DH9A 2FOLA 2ZETA 3UMFA 1OYWA 2BV3A 4US2R 2IF0A 4L8GA 2EFHB 5JRZA 4YAFA 1GL6A 3SBDA 4WVFA 1Q12A 2HMAA 5CIQA 1JA1A 2FX3A 1NKTA 2CK3D 3MWLA 2VP4A 4BQSA 1TUIA 2ZI9A 2ZSEA 4U9UA 4JL6A 1JA0A 5FL3A 1XNJA 4G0NA 1Z5ZA 4OHVA 2ZS9A 5DHFA 2Q3HA 2IYUA 3B1VA 2IYQA 1UDWA 4M1MA 2I1VB 3BERA 3EW9A 2NQ2C 4LHWA 3UMRA 3V00A 3THYA 1RYHA 4DLUA 4B3DA 3QXCA 4DLWA 4UNSA 1ZC4A 4TLCA 2GVZC 3TR0A 4M0LA 3K0CC 1XDBA 2B8WA 4GT1A 3C15C 3OEED 5F98A 2HJVA 4ZKEA 4HDCA 1N5KA 2BCGY 1VYTA 4LC0A 1JJ7A 5FTMA 1AQUA 1M1YE 4U7DA 1W36D 4D0GA 1RW4A 2VYQA 4Q9LA 1II9A 3U4QA 1KJWA 2HEIA 2WIAA 4IW3B 1W87A 4ACAA 3KDSE 4PC7A 4DT1B 1KI4A 1N6HA 2O5VA 4AY2A 3G6EB 2A3RA 3W6NA 2W6JD 3DVLA 3AH8A 2X3UA 3ZGXA 4TLDA 4TQAA 4E22A 3CRZA 1G64A 3UANA 4L4UA 1KGDA 5EMNA 3I8SA 2GJKA 3W3AA 3E20A 4NH0A 4M9ZA 4E07A 2Q6TA 4AF7A 3CX8A 1DO2A 2FFAA 5C18A 3PXGA 2PLRA 1DG1G 5EUMA 2GETA 1UPTA 3THXA 5BQ5A 3X1DA 1BMFA 1X8LA 1SZPA 2GRJA 4ZCIA 2GBLA 2KBFA 1J99A 4N3GA 1IXRC 3BAFA 2FSIA 2A7QA 4JLAA 4GPTA 3ZVMA 1DAGA 1QBKC 4BE7B 4I1OA 4DLRA 2ZYTX 2NO6A 2EIXA 3B9PA 3VHXA 4JBXA 4PSVA 4HAZA 1G17A 1UEIA 1VECA 1ESMA 1U0JA 2YZ2A 3TVDA 4RZXA 2A5FA 4ASUD 3UATA 2BHRA 3T12A 1Z8FA 2FZLA 4A6XA 2CRVA 4DZZA 1FP7A 1KIMA 3EASA 5FA6A 1XEFA 1F5NA 4NCJA 2GBLC 4DCSA 3G71B 4YAWA 2N1BA 2VHCA 2ZANA 3F3YA 2MMCA 1CU1A 3K0EA 2F1IA 4YALA 2WBLC 4LWZA 3AVOA 3EC2A 3V4FA 2OBMA 4DUGD 4AYXA 2D7DA 1M74A 1Y3AA 4IDPA 3WYAA 4P6VF 1CBUA 1SVOA 2Q9CA 3AKDA 4PXAA 5BWMA 2OLKA 1CTQA 1XEWY 2CL0X 2PX0A 2R6DA 3TKLA 3FMIA 5GVSA 3W2HA 2ZR7A 1HT2E 4UNQA 4OHYA 3OZUA 4Q5IA 2UZ3A 4Z8YA 4QJ4A 2P3SA 1VQ5B 4XSHA 1UKVY 1Z08A 3AP3A 2N46A 4YMTA 4KHZA 4UAJA 1ESNA 1EP3B 3KFXA 5JECA 1HE8B 1P9WA 1VYUA 2ZE5A 3SR0A 2QNRA 3GLIA 1Q1ZA 1XJQA 1GVHA 1E2IA 4NYJR 4BLSA 3W3ZB 1TEVA 4GOXA 521PA 3QY0A 1Z63A 4FIDA 2HCJB 2H7VA 4PPQA 1DEKA 1P62B 2IW3A 2GJAA 2ZPTX 1VDZA 3A1UA 2VL7A 3U3JA 2ZVQX 2J7PA 4A0HA 5HZHA 4MRRA 2YWEA 3GFTA 1T0HB 2NO7A 2QRNA 2Q3MA 4AIIA 1C4OA 2AKYA 1LF5A 3CPJB 1HY3A 4H1UA 4NPHA 3WYGA 4RKEA 4B3CA 2KWIA 3N2IA 4KBFA 4DLVA 1Q82D 2QTHA 1NJID 1KSFX 2FH5B 1GDDA 2HT6A 3SQWA 4EH1A 3N5CA 5BN5A 2AFIE 4JVMA 1QHYA 1E3MA 3OJWA 3EZ6A 1RFLA 4Q19A 3T5GA 4QHSA 1XTRA 1R5BA 2A5JA 5JSZB 2JLZA 1D9XA 4QOSA 1FW6A 1TF5A 5E7MA 1KJYA 2JIZD 4HZUB 3UG6A 5FTKA 4EPTA 1QFJA 4M1KA 4WW0A 1P61B 1VCOA 2OO7A 3Q72A 2ODWA 1XD9A 3I32A 3ZJYA 2MMGA 5EQTA 2WAYA 5DN6D 1XCPA 2JJ1D 2BSAA 3BH6A 2QBYB 3Q5DA 3QIAA 4IOMA 4HE5A 2JJ2D 1T6NA 4ZDKA 4I81A 1ZCBA 3ZDQA 1TNDA 1ZD1A 2VHQA 5JCPA 1XD8A 2ONJA 2WJHA 3L8YA 4Q47A 3LDAA 1U0LA 2JCSA 3MWJA 3UMSA 1E0AA 3GLGA 4TL7A 1KSHA 3T15A 4A2PA 5EP3A 4LYJA 2WAXA 5J4KA 2OEPA 2REOA 2I1QA 2DR3A 3RSLA 4LJ6A 1E9EA 1HE1C 5CIWA 5H70A 4B71A 4EJSA 1Y63A 4D25A 3LWNA 3ZC3A 4WOPA 4BFWA 2PMKA 3A1WA 1OHHD 3G5UA 2DFNA 4GP7A 1S4QA 4D4KA 4HEJA 721PA 1KDRA 4AYWA 5KNBA 3RRNA 3LVQE 1HT1E 2G1JA 4MUBA 1J9ZA 2FZ4A 4FN5A 4D2IA 3AVVA 3I62A 1E2LA 5K8LA 1TL7C 5L3SA 2B7BA 4B3BA 2BEKA 2VNIA 2C8VA 4P33A 4ZIRA 3P1JA 1EWRA 4LJ8A 2OK7A 4V0LA 4LJAA 1QHXA 1Z0FA 3DOFA 3FFBA 5TR9A 3EIHA 1Q81D 3TUJC 3SI7A 4TSFA 1D2NA 2ZSDA 4HE6A 1OXSC 1XWIA 5CLLA 3ADCA 3LO5A 1G9XA 3ONWA 4FWIB 1SVKA 4GMXA 3QXSA 4CEJB 2F43A 4HLDA 3F0TA 1II8B 3I3SR 2VNJA 4F38A 4M1WA 5IK2D 4AKHA 2J59A 4QNMA 3EA0A 2WIBA 4PQYA 2J7PD 3K70B 1KK3A 2D2FA 5DGXA 1T3LA 4WXRA 2BKUA 1KSJA 2NPFA 3EG5A 4HI0E 2ZYUX 4FXPA 5FOVA 2BGIA 3QPUA 3CKLA 1E32A 1M90D 1ZBDA 1XTSA 3GCGA 1KD1D 2I3BA 1ZD9A 1US8A 4GSYA 3SYLA 3HU1A 1E63A 3JQRA 4ZDWA 1KC8D 2CJWB 5JRJA 3TMKA 1XPOA 3WNDA 1K73D 1EWYA 2W2TA 4EPXA 3AVUA 4OHXA 2BJVA 4RY2A 5EUQB 3SYKA 2NZJA 3JVVA 2NZ8A 2GXQA 4HB3A 3ZQ6A 1XCMA 3NVAA 1LNZA 4PTLA 2QP3A 2PJRA 3V76A 5EXSA 5AJXA 4ERNA 5DO9A 4HDQB 2WWYA 4R9UC 4M1SA 4A0FA 1K8RA 1KMHB 3SJBA 2ANCA 3OZWA 5BYJA 4NCKA 1JJVA 3FJOA 2DBYA 4OQMA 4B43A 1W34A 3LH5A 5AUQA 1VQ9B 1SULA 3U7HB 4Y0AA 4TTQA 3QKUA 3W8NA 2EWVA 1TQ4A 5FOTA 4K1XA 1MO3A 2O8FA 3KFVA 3VKHA 4LJ7A 1NN5A 3JZMA 4Q1DA 1Z2CA 3OE7A 2Q0HA 1SVLA 4RJLA 1G3IA 3KB2A 3IHWA 1Q57A 4DVGA 2OESA 2O0KA 2R9VA 3X2SA 3LX8A 5JI3E 2GK6A 2VO1A 2P67A 1J8MF 1SVWA 3TSZA 2Q9BA 3CCJB 2QAGC 2ZJOA 4MRPA 1CLUA 3R8CA 1U8ZA 1CP2A 5KO2A 1HYQA 1OV4A 2JIZA 1OKKA 1U2RA 4BZQA 4BECA 4BFZA 1GNPA 1G8PA 221PA 5C46F 4ESVA 3SDZA 2QAGB 3RHFA 5EXXA 2HT1A 4ACBA 2FEMA 2JJ1A 2GK7A 1W0KD 3FPAA 1DADA 3IHLA 4LV6A 5EXPA 3BBPA 2MSEB 3E2IA 1SXJD 2V55B 3M1IA 5FPYA 4HUQA 4NTZA 2G9NA 4BFXA 4UXJA 2XNJA 4IEIA 4WA7A 1R5OA 3AKEA 5DNYB 3DL0A 1JECA 3LBHA 1MO4A 2X8AA 3ZH9B 1DAMA 1M2OB 1ZM2A 2ZRCA 2FSFA 1PJRA 2AN9A 4ZCLA 3K0CA 5FR2A 3S1AA 1NN3A 2QEQA 621PA 2Z5FA 3U3MA 5FL7A 2OAQ1 4LV8B 3K9HA 1G3RA 2F9MA 1QDEA 4JZKA 2FFQA 3FKSD 1KI8A 3TUIC 3CZQA 4H1VA 5FPTA 1DS6A 1EK0A 1ZM3A 3T34A 4ESHA 2XGJA 3AKYA 3CF2A 4MH0R 4TN1A 1RPZA 1QRAA 1FMLA 1IN6A 2JAQA 3NBXX 2K5UA 4QGFA 4PC2A 1OF1A 2J0UA 1N0WA 1NVXQ 3KXKA 3ZIAA 1VMAA 4JL8A 1N6PA 3I61A 2BWJA 5KSOA 1ZRHA 1YR9A 1MRNA 1N6NA 3IPXA 3UIEA 4AG6A 1OJLA 1S9HA 1YI2B 4C0LA 2NMVA 4CEIB 3QF7A 4KO8A 3LNCA 5TVKA 2DY1A 1XRJA 4MA4A 2ZRDA 4BEBA 4ZI3A 3IILA 2YOGA 2ZYVX 1Z3IX 2OUKA 4ZDJA 2ZQ5A 2G3YA 4NU0A 2DHRA 1UEJA 2WJJA 4BLTA 1XTQA 1AKEA 3FHTA 1QVGB 1E9SA 4W5HA 4PHFA 4KVAA 3DEFA 2CHQA 4XOIA 5IK2A 2ECKA 2QTZA 3NDBB 2C95A 4LJ4A 1X86B 3K09A 1A4RA 4W9MC 2W2XA 5CDFA 3VR3A 1Q20A 3QF4B 2CDNA 1R10A 5GVRA 1BQEA 4ZPXA 5AUNB 1KHTA 1E2EA 1NP6A 3QPWA 5L3QB 3MWKA 5JCZA 1OE0A 4PC6A 3CB4A 3A1SA 1G7RA 1Z6AA 2ZJYA 1GUAA 1TPZA 4TL9A 5SZHB 1CJUC 4Q03A 2W6JA 2Z43A 3OW2B 3JVUA 4E03A 1OB5A 2RGDA 3DM9B 5F2EA 1T5LA 2BM1A 4A8JA 2OM2A 4E5UA 4FI3C 4JLJA 1NN0A 4UKDA 1T3HA 4PPFA 2ODBA 1Z6XA 4UNPA 2Z83A 1YITB 1WCV1 2QL6A 3S1AB 2HYIC 1QVAA 4OQNA 3RRZA 1H8HA 3HU3A 2Z4SA 2G1KA 4LI0A 5KPJA 1E6CA 1JAHA 1KK0A 2R6AA 3D8BA 4MYCA 4YDHB 5E3HA 2QMHA 5KNCA 3BC1A 1GFIA 2Z0MA 4C30A 3VX4A 2QMEA 2FN4A 3LVRE 3RS5A 4EUNA 3G82C 5CK5A 1D5CA 1T5IA 1GO2A 2W58A 1WMSA 2C2HA 1G7TA 1NBME 4HB0A 1FTNA 3T5DA 2V9PA 2C77A 2CLDX 3B7GA 3LX5A 1TF2A 1P72A 3H86A 2EFDB 3PEUA 3VR6A 1Q1BA 1CJVC 1W46A 4LGMA 1U8YA 3KXLA 4C2TA 5JLJA 3GLHB 2ZI3A 2F9LA 3QG1A 4Q4AA 4ZGQB 2GEDA 3IGFA 4PO1A 4URUR 5DE3A 3VO2A 1W4BA 2RH5A 4OK5A 2BMJA 4KODA 3X1YA 3BK7A 1NVWQ 3ZVLA 2V7QD 2W6ID 1GILA 4A2WA 5H5JA 2PZGA 1NG9A 3TAUA 1A1VA 1X6VA 2P5SA 2FPKA 5FOWA 4CRWB 2QEXB 3QE2A 4PPGA 4PGOA 4Q9JA 3GP8A 1QG2A 4IVQA 2VZLA 1KOFA 3C8UA 5H68A 4ZDIA 3EX7C 2GXAA 1NIPA 2XXAA 1IN8A 2OCAA 1VG0B 4IXMA 3Q7QA 2C03A 4TYPA 3GD7A 5B2ZA 2AR7A 4KITB 2BJWA 1K5DA 1EFRA 1JI0A 4NYMQ 4Z1MD 1G3UA 1JR3D 3KZ1E 1MT0A 1OT3A 3DM5A 2QG6A 2ONKA 1XMVA 2GF9A 4Q1AA
chains in the Genus database with same CATH superfamily
3MNFA 4ENPA 3H2YA 1I4OA 3EIEA 3GJQA 3Q8WA 4ASUA 3JQFA 4IFEA 1GOTA 2C94A 1ADJA 1F48A 1G1MA 1LSUA 2COEA 3GMSA 3MMZA 4JKIA 3A1DA 4B2YA 4DIDA 3QI7A 1Q0TA 3L0CA 2DPMA 1JXMA 3HKDB 1L7XA 3DMTA 4CEHA 2AS0A 2I4IA 4DW8A 4DR6B 4BLQA 1RZVA 4OMFG 1XZAA 4U39A 2YOHA 5SV2A 4Y18A 2J5KA 1MC5A 4CKCA 2IY7A 3F6YA 5A9RA 4KJZA 3TQOA 4EKYA 1O2DA 1L5LA 2ZZFA 4KLAA 5K8TA 1FDSA 1YOVA 4HJRA 2H17A 3IVGA 4XEUA 3VR1A 5L51A 4TS1A 1RYZA 3OQNA 1W93A 1J2JA 1Y8QA 1J25A 1F2UB 3GEIA 3GGSA 3PXAA 2WPDA 2GWHA 1TIPA 4OP1A 4R1PA 1HNWB 2ORWA 2R1VB 3Q10A 3AEKA 3AILA 4MS4A 4Y1FA 4BLUA 1B6SA 1SC6A 1SQ0A 1Z34A 2VZEA 3PA1A 2UVPB 3HR7A 2GD6A 4B3RB 2GBCA 3H4VA 1G6Q1 1NBEA 1U90A 2FFHA 3L0BA 3M2PA 4W7IA 4ZODA 2BGUA 5AXCA 3D3KA 3ITNA 1Q0ZA 5GM2A 1L4EA 1DAIA 4MR8B 3VQTA 4QWWA 3ELYA 1SK8A 3VSBA 4UEWA 2YINC 3OQPA 4QO7A 5CLGA 5DBFA 4AJJA 4F4IA 5IBRA 4YP6A 1KZ7B 2KI5A 3DJYA 3MHTA 2H29A 1XA4A 5A88A 3WY9A 5HKKA 1KDYA 4ATNA 3WA7A 2LCFA 4WNIA 5UKDA 1KAMA 3F7NA 1TUBA 1P7ZA 1KAGA 1UKYA 2PWPA 4EHIA 4RKRA 4HNTA 9LDTA 3P9IA 1LBQA 2J0VA 4GYWA 2PKRA 4L3WA 1CZNA 3CCVB 1VB5A 5A03A 3CGGA 4ZCSA 1HM5A 1CDZA 3MC1A 5GMOA 3ENZA 4BPRA 1U3FA 3X1WA 2YVKA 3U49A 2VHYA 1QV9A 3U39A 3AQ4A 2Q27A 4QWMA 5IT5A 3NKVA 1CQZA 5EE9A 1C1DB 4REOA 5KOJB 2NTYC 2J48A 3EXHA 1M6WA 1JWLA 1DZ3A 1VE9A 3KAJA 1M75A 2OZKA 5CNKA 2PMDA 4KLZA 3L4KA 1DUSA 3EH2A 4C7JA 1X1BA 4FOPA 2IEZA 4L0CA 4BLRA 4BNGA 1DEXA 2C8KA 2CVHA 1UFQA 3D6AA 4CZ2A 2P30A 2VYNA 2G40A 3FZGA 4MI3A 1UP4A 1MA0A 2EL9A 4GLFA 3ZW8A 5DM70 4WLEA 2DETA 4DRXB 2H8GA 3HYTA 4ABYA 4HB2A 3DH0A 4OU4A 3EGVA 4QYMA 4URHA 5ADUS 3AERB 1FC0A 1DTWB 2FWRA 1E2JA 2WILA 2W71A 4LG1A 1WUHS 1DXHA 4A0SA 1RMQA 1YZNA 2Z4TA 3ANTA 3KBOA 4J90A 5ALIA 3RVKA 3V2IA 5CNMA 1GTJ1 2OZPA 3TTWA 1R6DA 13PKA 2XVXA 3FN4A 3I6BA 3P0JA 4WXMA 4WZ6A 4NQZA 3UHOA 4BX3A 1UD6A 4KIUA 1VLLA 1U02A 2YMMA 2XIJA 2X2PA 1EWVA 2HQBA 2DMRA 4TVSA 3IQGX 1A77A 4PYNA 3RFTA 3RM3A 5E0KB 3DG9A 1U3TA 2RHHA 3S1LA 1E6MA 2PU5A 3ESQA 3OZXA 4A8JC 4EBBA 1Q2UA 5JTTA 5TRDA 5FUBA 1VL5A 3FJYA 4PHCA 3G2NA 5JY6A 3H9UA 4IJUA 1Y8QB 3D6VA 1CIPA 1VHQA 3C98A 4PVDA 4KKSA 2BFOA 1GYPA 1YR8A 1LXCA 3LSYA 4YH1A 3AJAA 2FEKA 2VWGA 4IJ5A 3D3WA 4OHWA 4R1LA 3UBMA 2GVNA 4AO8A 2H4YA 2HV8A 5C8YA 4DV7B 1COWA 1PEYA 2BZGA 2Y1GA 3UT6A 1YJ9B 2ZR0A 2VF8A 1JDTA 4ZN6A 4NY1A 5CBPB 1SCDA 2H1SA 3ANLA 1WP9A 4MV7A 3VMMA 3V1UA 1HNNA 3NS7A 3F3SA 3GJYA 5LJIA 3PLAE 3GOHA 4QTYA 4RF2A 2IS1A 2NU6A 5AUPB 4R5MA 3ZXYA 3TJMA 2CFTA 3WGIA 1MEJA 2D3NA 2FMUA 2W2KA 3CZRA 1UFVA 1E2PA 4Q4DA 2OSBA 2RSLA 3WISA 4Y7DA 3FYUB 1ZCAA 3O8NA 3RFUA 3ZGNA 4G5GA 2C2WA 1E7SA 3S81A 5CITA 1AY0A 4EY6A 1U4SA 1W5AA 1QGOA 3OTGA 4LV5B 5TMEA 3WBKA 3RFVA 1DQSA 3WB1A 3WNVA 1LZKA 2BHLA 2J5XA 2WRZA 4XGKA 1K7YA 2YNMD 4ENTA 2KLBA 2HA2A 5K3SA 4B9AA 3O2SB 3GCZA 1UBRS 2GZDA 2X3YA 3RVBA 3SU8A 3SZOA 3X0DA 2C20A 4BDTA 1O6FA 1J2RA 1Y6JA 5BQFA 3ZY5A 1DUIA 1E99A 2CMKA 2QQGA 2GPBA 1CF9A 5F2OA 2CXOA 2NXNA 3RASA 5DLQC 3S2ZA 3A4VA 2VP5A 3VPSA 2PT9A 1MO2A 1R9JA 3D4BA 5JC1A 2JGNA 1I3MA 3KUXA 3UG7A 3IUEA 4HL6A 1Z0KA 3DUFB 3JZIA 2QRJA 2FY8A 2B4AA 3QTLA 1TPYA 3GVKA 4TXHA 1KY4A 3ROZA 1U80A 3UY4A 2JJ2A 2J9FA 3AFHA 5LPNA 2IQIA 2WU4A 4JBWA 1T0PA 3H75A 1ORTA 1OR8A 4O0LA 4HCJA 1TU0A 4AJEA 3CUUA 1Y3BE 1S1MA 4ZIRB 1E79D 2H9AA 3N28A 4ZU3A 2IP1A 3SEAA 4CG1A 4DRXA 5C81A 3I9OA 4PO9A 3TX6A 1KEKA 4KZPA 1ONSA 3UMJA 3P26A 4AC9A 3LWDA 3KS9A 1Z29A 3TOXA 5JHGB 3DTNA 4M9CA 4KXXA 4ZAXA 3ZCPA 3IT0A 1PQWA 3HXMA 2Q0XA 2ZJ6A 1V4BA 3CMEB 2BSQA 1DT3A 3BIFA 1E7MA 3VBEA 1EB9A 1DX6A 2HWXA 4IFBA 4QPJC 1T4BA 2NT4A 1ZN9A 1II0A 3K9WA 1QHIA 4W9NC 4IVNA 1FNMA 2MINB 2R1TB 3G1WA 3AXTA 3L7DA 4G8JA 1BTOA 5CB0A 3W6ZA 4D4IA 1KE1A 4ITRC 2DHQA 3AF4A 1BFDA 1ZA2A 2HF8A 5FBKA 2OXIA 4QUZA 4B7XA 1QH0A 5EUBA 1SHLA 1ZAKA 2H1WA 4ZC1A 4AAYA 4ZGWA 1N3LA 4QLOA 1S2OA 4Q1FA 1JKJA 4ZAZA 4M87A 2GF0A 4NECA 4YXWA 1BS1A 3LYAA 4IXWA 4Q16A 1HTTA 2H2DA 4EG7A 2VRWA 3WIDA 5JASA 1JIUA 5BSRA 3FF1A 1JSCA 3MJDA 3X2EA 4CT4B 3GRCA 5IJ0B 4P25A 1QMPA 4BLPA 1IUNA 2PA3A 1Q44A 4IP0A 2BY4A 1DKLA 4OO3A 5FV7A 1BJKA 4DZTA 1HDOA 2BGGA 2FQYA 1PP4A 2XUFA 4PZ0A 2E89A 4Y2VA 5AHRA 2P6UA 4OV6B 4P5PA 3VNRA 4HTAA 4DXAA 4E5DA 2GA8A 2HL6A 1ZXLA 1SNYA 4P5EA 4R2LA 1F14A 1XAHA 2OBYA 1JFVA 4FMCB 2QGFA 3EIQA 1VJCA 4HC4A 3RE1A 4UTPA 5JC8A 2HMVA 1XL1A 5KHAA 1Y33E 4L72A 3THOA 3GN2A 2JJYA 1Z7BA 4CM8A 1QG4A 2XLCA 3QPDA 1VIDA 2JG3A 1YDWA 5AM5A 4YV1A 1SUBA 1TAGA 2FZGA 5FUYA 2OLJA 2WHYA 4EAAA 5JJIA 3OJXA 2YR0A 5G40A 4OFWA 4X8MA 3L8GA 2GZRA 3QOWA 3PUXA 5JDCC 4D8XA 4CLRB 2FOIA 2PUJA 2GZMA 3I55B 1C2TA 2Y76A 1VE5A 3IV9A 3QF4A 1XELA 4DA9A 2LWIA 2FMTA 4UUNA 3SJAA 3OEHD 1Y37A 1DRWA 2Q5JA 1JFRA 3ANXA 4MRMA 3W7BA 1JBQA 2FF7A 3KXIA 2DXIA 1EFPA 4LHZA 3A1VA 4Y3UA 2PH7A 4YP7A 3M6UA 4H3VA 5GONB 3ROTA 2JVJA 1GITA 3SEJA 4Z4SA 1YHZA 3G8DA 5GZ6A 5LOVB 4LF5B 1G8FA 1BOFA 4HGRA 4N7JA 1VA5A 1ZN2A 4UNNA 3DMRA 4AICA 1EFVB 5DBIA 3DVAB 4WOJA 4IDNA 5K6AC 3DC2A 4A92A 1WM1A 3ZYZA 3KIPA 1MG0A 1PBTA 3U17A 3KWMA 2POCA 2Y93A 1RZ3A 3B2EA 4W8HA 3U7QA 3F78A 5IYNA 3U4MA 2HRBA 1DU4A 3HE3A 1V39A 4LY0A 2IY9A 2J9XB 4UQOA 3WDSA 3PCXA 4WI1A 4CWAA 1I18A 4JP8A 3SS8A 4I1IA 5K8JB 1KBZA 2ZUWA 2I7CA 3CLKA 5LA6A 1V7ZA 4IGKA 2JBWA 3GSIA 4XQFA 4R9NA 1TMOA 1E9VA 1YB1A 4DIEA 1PVOA 6AT1A 4GI3A 1FA9A 1GT6A 1IEVA 3A37A 4PBTA 1FFXA 2NO0A 1THTA 1NW4A 3ZWAA 4UZFA 4DPKA 1K9SA 3OIUA 2VIIA 4ZA2A 4Q9AA 1H1LA 3D4IA 1EVIA 5B30A 2ANBA 5JCOC 1QIGA 1WAMA 3BGDA 3BD9A 3TCNA 5IVPA 1GPH1 4L8LA 5ABPA 5J47A 1W29A 5J40A 3T3OA 2Y1DA 3FUWA 4EGSA 1Y89A 2AG0A 5AOBA 3K6SA 4CF7A 1G63A 4RBNA 821PA 5ANRB 3VR6H 1T3SA 1ICIA 1DOAA 5B2EA 3NLLA 3KUKA 3UWOA 4CIXA 1M1ZA 3GJZA 1KEZA 2RARA 4G4SO 4QXQA 4ZK2A 5HP4A 2FOXA 4DJEC 2P9JA 2FE4A 1A9SA 3A4YA 4GH5A 4O5AA 1RHKA 1YZYA 3IBSA 3JSAA 1L8LA 4FNAA 4D80A 5BYKA 3JQDA 1GRCA 5EWJB 1SFRA 2EZ9A 4JOQA 3R7BA 4POAA 1WW8A 1C3VA 1KVRA 1LPPA 1KO1A 2YS6A 1KZGB 4ECAA 1U94A 2I6FA 4R1UA 2CNOA 4M86A 1NVAA 3H94A 1F2TB 3KSDO 3ZNOA 2OTJB 5K51A 1W36B 4N6GA 1NTOA 1D6JA 2DQYA 1M2NA 5DHAA 2HA4A 3CC2B 1PZMA 1QX3A 4AS3A 3N05A 5KYGA 2VSNA 1XXLA 2AOXA 2JAOA 4LKOA 4AJPA 4CLRA 1QGYA 2HUPA 4PAWA 5JAIA 3SWWA 3IEPA 5JXHA 4R9SA 4CBVA 3CNNA 3OUUA 1XFAA 5CLQA 1BW9A 3K1YA 1KQ3A 5EA2A 4F2HA 1I0LA 2Q4TA 3Q7PA 2CGEA 2KQUA 1OA1A 4P58A 5CCEA 5T64A 3I6QA 1HTWA 1M1XB 3HWWA 5HHTA 3HDTA 4PYIA 2HMUA 2H1IA 1KO4A 4RABA 4MI1A 5LKAA 2VEDA 1JDPA 7MHTA 1IN7A 1RJFA 1QM5A 3EHDA 3U7FB 2VTVA 3PGKA 3KLPX 4WX2B 4R2KA 3UAOA 3DLPX 1FL9A 1U3UA 3LL7A 5JCJA 3UM9A 1XRQA 4ZVUA 1Q1AA 4QRIA 4RZUA 4HAUA 2AUMA 1DJMA 2BMDA 2WV7A 1EP1B 1R4NB 3I64A 2EATA 3L92A 2IYYA 2UVPA 3AOEC 3R09A 1USGA 5FWAA 1HYEA 3QMVA 2MSWA 4GKBA 4Q9HA 3ZWOA 2PUCA 1ULHA 3EG9B 1KEUA 3CCCA 3CRQA 4P32A 4K5QA 5LD2B 4AKGA 3KYIB 2HHJA 2ZAMA 4B3GA 5T6MA 3NTLA 1W4RA 5BSKA 2I6QA 3W2IA 3ESYA 4P3OA 2BMFA 2Q6LA 2OFPA 2EQAA 3M3PA 4C22A 2D0DA 1P3JA 2CHVA 4ZT4A 2WHQA 2J3IA 2ZIXB 1GQOA 2A5DA 3AI3A 3E53A 3FWPA 3D1LA 3QQPA 1V9SA 2HDHA 4Y2JA 3AFOA 2ZT7A 1TUBB 2ZRGA 1MFZA 3SSAA 4GOMD 5HZGA 3QFHA 3OAAA 2O52A 1NNI1 4OB8A 5FT9A 3KE8A 3B7WA 1XMPA 5A7HA 3RIXA 3VR4D 1JQKA 4EK9A 4NE9A 1MAUA 2WT4A 3HPRA 4BFLA 3BMCA 3U16A 5IDWA 2BFPA 2DTDA 4JLPA 4KO2S 4E1AA 1YRQA 2PR2A 1XRNA 4BKMA 5G4KA 1G42A 2JB9A 3CIFA 5T57A 2GK4A 4ENUA 1H4TA 2XGMA 3RC2A 2QMOA 4V0QA 1E4OA 4CMHA 2E4ZA 3P19A 1C0KA 4TM7A 4XR6A 5IHPA 1ZIOA 1AQNA 1VQNB 4WWHA 3O8QB 4G5HA 4WLVA 1PU2A 4N7BA 2IZOA 4Y7CA 1NDQA 1ULAA 2HO5A 4QPPA 4KFRA 5TC4A 1U9IC 2PK3A 2VDWA 5EWJA 4BZZA 5LQUA 4TT3D 3KC2A 1Z2NX 4F1WA 1NVFA 4ZAWA 3P9NA 3QVOA 3WWCA 3JVIA 5IZCA 1XCLA 1D8TA 1SBCA 3I9V6 5LDHA 4DKJA 2EZ4A 3AQIA 3WMEA 3UT0A 2IRWA 1QO7A 5AJWA 5K8IA 4G5QA 5KVAA 4R3NA 3NM6B 5FLYA 1E2NA 1ECJA 3L6BA 4K26A 1JT9A 1PKXA 1ONPA 1P39A 1IZ8A 2HA0A 2OBXA 1HI9A 3K8OE 5I3CA 3U3KA 3T35A 4QOFA 4L6AA 2YIVX 4LVUA 3HA2A 2IGBA 1X0VA 2QTMA 1E9CA 3MSCA 4FZ5A 5TJHA 3W90A 3WIEA 1QIJA 4US1R 5FEUA 1TZCA 4RTOA 4TMKA 3IKTA 2ZP1A 3OSUA 5AI9A 4XM3A 1BW9B 5IH3A 4D4LA 2XCIA 1N5IA 3DOUA 1H3FA 3NCHA 1ZQ9A 3UPUA 2GLTA 3JALB 4AP9A 2AEFA 2IDJA 2LP4Y 1M1KD 1T2NA 3HWX1 4RMHA 5FH9A 1C14A 1RMTA 1E2BA 3CV3A 4BMCA 1EFCA 2AMVA 4FMDB 5LKRA 1RYFA 1SUEA 4MRVA 3ZDAA 2VJMA 5F4ZA 3F5QA 4EQ6A 5DXFA 3ZE8A 4WKBA 3WDLA 2QUHA 3IEUA 1P2BA 2YY6A 3N3AC 3R24A 3DULA 4EA7A 2Y27A 3R7WA 1UD3A 2DTXA 1KFJB 5T3UA 1O6BA 3QOXA 4QVKA 5JDIA 2GBPA 1CRZA 1VE6A 5F33A 2VBCA 3OBBA 1QPBA 3R7NA 3NUZA 1EZZA 4E5VA 3L7YA 2J87A 3WK9A 1BWSA 2E4UA 4O2BF 1VKHA 2PQ6A 4I8IA 5T67A 3KKQA 3IAXA 3SSOA 4JI2B 3HKDA 3IXQA 3KOYA 4J2OA 4O1IA 3LA6A 2FPPB 1ESEA 4N49A 2ISSD 1DZIA 3DFKA 1C3LA 3KYDB 3NJ4A 5CYFA 5K0NA 3GRZA 2BKLA 3IQWA 3A6LA 4HATA 4BV3A 4M36A 2OXFA 5AKHA 5A62A 1H05A 2OHXA 3Q8LA 5DOVA 3UCFA 4Q1EA 4NCBA 2H9IA 1F6BA 3IA7A 1E9RA 3WB2A 1PYOA 2GVDC 2P79A 4OA5A 5KINB 4RFSB 2VJQA 5L53A 5E4FA 2YQ5A 1WOMA 1CRQA 4ONEA 1M2JA 2P5TB 3F5DA 3HADA 3PRYA 4CRWB 4L02A 4NMMA 3TFOA 5TS2A 2XHZA 1YT5A 2N42A 2AW5A 4P3IA 1PK8A 1SY7A 3D6NB 2YVUA 3JTMA 3MINA 2XZOA 3U6BA 3WL6A 1NVBA 1QH1B 2W8BA 1BVYF 2AZDA 4BMZA 3UW1A 4D96A 3B53X 3UWSA 4O4IA 1KI7A 3N2GA 5CX4A 4J0DA 2GCIA 5HQ3A 2H0RA 1PI3A 5CDFE 4GQNA 1KOLA 4COKA 4NCNA 2COUA 2WK1A 3HWRA 2PUHA 3L1JA 2VDJA 3LYLA 1LPOA 2CL5A 4RDHA 3NNDA 1TJ5A 3TDKA 1AQYA 2J9ZB 3RKRA 1IDOA 2JZNA 3OPYB 2H8KA 4KKTA 3RS0A 1NMZA 3R77A 3FNGA 3H0EA 3OA0A 1BKSB 1R7RA 1RI4A 1CJSA 4YAKA 4FP9A 2JJQA 2RHJA 3CPHA 4KIWA 4S1PA 3WLHA 4OH1A 3FB4A 5DNCA 2ZTMA 2FN9A 1DAOA 2ZIWB 2QTCA 1KDVA 2HF2A 1K7CA 4XH9B 3U44B 2C2OA 1SXGA 4P3XA 3R0QA 4UU7A 3IAS1 3TIXB 4EI8A 5HRAA 2QJTA 4MLCA 4DM3A 1XLVA 4Z4GA 1CF2O 1TKRA 1CRWG 3CJTA 2C0QA 1WF6A 2WIJA 3H7IA 2W37A 4BE4A 2VP3A 3M4ZA 1UAAA 1EWTA 5ICCA 2O8BA 2Z5LA 3JALA 1JQLB 1PR9A 4K9OA 4N3AA 4PGAA 3OCUA 2BEJA 4QOGA 4BYGA 4XNFA 4ENWA 1QP4A 2JFUA 3FNIA 2FA9A 2OTLB 1MRZA 1LS1A 4M9QA 1AB5A 2QG4A 2F3SA 4ZGNB 1VE3A 3Q1KA 1P0IA 4FW8A 4I1SA 3HJHA 4FWBA 1N6LA 4DDKA 5KWSA 3LKVA 3R7WB 2O14A 1IY2A 1ILWA 1RLMA 3ANMA 1NRKA 4Y9DA 2QAGA 2D1QA 1RWXA 5HM8A 2YY5A 4KYVA 2L19A 4CU5A 5A6VA 4U7HA 2BTOA 1U6IA 2Y67A 1GJRA 3CTMA 1NDUA 2NO5A 1VCNA 4UBKA 1ZOOA 3E3OA 3FKSA 4Z1OA 1QRUA 1F51E 3MLEA 4QU8A 4M7PA 4LYAA 4RHTA 3V1TC 4I46A 2W5UA 1SU6A 3TD9A 1KJZA 2AWNA 1WXFA 1FZQA 3VR5A 4F3NA 1VMDA 3MD0A 2YJ5A 1W7AA 5K1ZA 2A30A 4C0XA 5IX8A 4WOCA 3IRUA 5EPEA 1EJBA 4LFAB 3CM0A 3B20A 2LZJA 3K0AB 4W4TA 1XEAA 3JD0A 2H5LA 4LF8B 5I4CA 3RUEA 4Z49A 2NAPA 1J0AA 3M9WA 4G09A 1I80A 3VFDA 1TQ8A 1E66A 1EUDB 1GNVA 3RUCA 3ST7A 3ZY4A 3Q5EA 1WUKS 4UM7A 5ALSA 4BVGA 4DBLC 5E4YA 1SBHA 1V16A 4DY4A 2X6XA 4EJFA 1JALA 1XZIA 1KEVA 3E2MA 3GVHA 2AMFA 5J2UF 3WIUA 3GZ4A 3PRHA 3DFMA 2VAWA 1XZLA 3KQMA 4IIHA 4MKZA 1L4YA 2FWNA 3V34A 2IYFA 4QL3A 1QU2A 3GAAA 5BY2A 4JY7A 3T5CA 5CDHA 4IV0A 2AT1A 1NBIA 4OAPA 1ZXBA 4TQ9A 3RB8A 4DKXA 2B6NA 2ZSKA 4WCDA 5EKSA 3K8YA 4LZWA 2Y71A 1P1BA 4ZI7B 4GYYA 4UZSA 3D6FA 1V0JA 4XPIB 2Z6QA 4D4MA 3CXRA 3DQZA 4C78A 4IUBS 1W9XA 4V1CI 3JZAA 4HAOA 4I3GA 1XT6A 2V0GA 1NMQA 3DCNA 4Z7OB 2RB4A 3LAWA 3PB3A 2O2SA 2OGUA 5KWJA 2X0DA 3KL4A 1MIOB 3COYA 4QFCA 1TMKA 3AUUA 3DJFA 3ON5A 3BBLA 1PEAA 3SLKA 5A0VA 2I4NA 3H19A 1Z6TA 3D0OA 3DOJA 3FH0A 3PDHA 4RTJA 1SVSA 4RADA 1FFHA 3ZDXB 3JW8A 1AHIA 4N12A 1AM4D 2ZRJA 2ETVA 3GWGA 5E3JA 3U7EB 1H8EA 4TKZA 2FR8A 2GD0A 3EEBA 5EJMA 2NVWA 4Z4WA 1T9AA 3W5UA 3P0IA 3PSAA 3GLQA 4ND8B 3ZCVA 2O8BB 2G0TA 3K1AA 3PS9A 1M54A 1N2CB 2GLXA 3K8ZA 1NBAA 3KB1A 7REQB 5GZ3A 4FFSA 4DLAA 3Q0IA 1XX6A 1T5HX 2ZUDA 3O9VA 2O8FB 3ZZ0A 5DYIA 5BQXA 5TMDA 3D7KA 2CB0A 3GJRA 3FCCA 2IPXA 1QK5A 4BNUA 3WHLA 121PA 1HF3A 1M8JA 2AXPA 1Y9JA 1IDN1 2FV8A 2CD7A 4I4CA 5E2IA 5CVVA 2JNWA 4MQMA 1GPJA 1BG6A 3EVAA 3GO4A 4KG7A 4L5CA 1X9GA 2VAPA 1G98A 1CG6A 3GMDA 3BGVA 3HACA 1F2TA 2XE4A 4PX2A 3IR7A 4GXRA 1AKYA 1ID1A 2FPLA 2J4FA 3CLVA 3DNMA 1YGPA 3QVSA 4Q4LA 5LQNA 1DTSA 2C54A 4Z4IA 1MQSA 1DDGA 1OILA 1NP7A 5J2TB 1ISFA 2DHEA 1SRQA 2RI6A 2V65A 1RHJA 3T5TA 1W5TA 1YR6A 2WSMA 4PTZA 2R5WA 5AW1A 2QTFA 2VQ6A 3BRSA 5H1YA 1O97D 1YQDA 4CM6A 2I03A 1IG0A 3GJSA 4DLYA 2M6KA 3I28A 3UOAB 1QQBA 4DDHA 2G25A 1HUQA 1X19A 1KH3A 3IUBA 3BL8A 2FUEA 4BN0A 5EWLA 3FXAA 3ISVA 2RGNA 3I34X 4NH4A 4EF5A 2VTBA 3MQ4A 4OATA 3U81A 4TKOB 2C2MA 1AN9A 2CLFB 4RGQA 2CHEA 2FMKA 3D6UA 5A9SA 5IABA 4LJRA 1AGYA 2IPLA 3INTA 4AKIA 4OFXA 3LWBA 2PCJA 3PICA 5C5EA 3ZE7A 1SXPA 5JZBA 2NSLA 3JQ6A 1IXZA 3DKKA 3TFQA 1FJ2A 3KUCA 3EVBA 4BZPA 2E1PA 2G71A 1Q0RA 2H3HA 3ANSA 3BFVA 3ORFA 3C8HA 4EHBA 2ZPAA 1SU4A 3OPVA 3ETCA 2C9CA 1YXMA 4HXEB 4BVLA 4ED9A 5FXMA 2V7UA 3MA0A 2M6SA 1TYDE 3AF0A 2I99A 3WL8A 2HAEA 2BI8A 3FFXA 3R20A 3TH5A 4HSGA 4Q4HA 1HMYA 2R44A 1PJTA 1T5TA 3ADKA 1YS7A 3JV7A 2IYLD 4DV3B 5I9BA 3C85A 2FYTA 1JV2B 1YL5A 5HPYB 1D2EA 1C3XA 2WLTA 1NPYA 1U8AA 4Q9IA 2QTNA 1NVUQ 3I5YA 1KVTA 1TRKA 4F3KA 3MTQA 2VSOA 3ZZTA 1KI6A 3E4CA 4M83A 1XTVA 4PX9A 3PU6A 1OWOA 1QK4A 2DT5A 1XKQA 1LS6A 1NVVR 3GELA 4BNMA 4XW2A 5JZ9A 2O54A 2IIQA 4MRNA 4QDJA 4JI4B 1PNOA 1TKCA 1CZOA 4M6WB 1TMYA 5DLPA 4CIAA 5KTKA 4KLCA 4X8OA 3M7IA 4KQXA 4KSBA 1PUIA 4AZWA 1UK6A 1CNEA 3ZHOA 4WNYA 3C3XA 4QU5A 1J0EA 2HM7A 2UYQA 1HLFA 1I7PA 3H2KA 2DECA 2O20A 3EQ6A 1MJGA 1UMKA 2XKJE 3IRVA 1GWNA 4HPXB 4AUEA 1R50A 4RDCA 1CEQA 2VJAA 3KUUA 4NEGA 1ZRMA 4QJ5A 5GGYA 4CFYA 2W48A 2GYWA 4KXFB 2PAFA 3PWSA 4CLOA 4JJ4A 3VYRB 4MYUA 1J8YF 1B1CA 2QN7A 4LBYA 1I6LA 1Z6PA 3HWSA 4XJTA 2CVQA 2ENUA 1UK7A 1WUJS 1M66A 1NTRA 2E48A 1MCZA 3NASA 5TB5A 4JLSA 2WA1A 4WUTA 3GFRA 4YAEA 1AN0A 3ND6A 1QFSA 4MGIR 1U81A 3C70A 4MEBA 4CKCB 3CCLB 2A92A 3KJHA 5BPHA 4YJFA 3NE5B 5ALQA 4A6PA 1G6KA 2C4TA 1K9MD 1AXGA 1E1NA 2BC9A 4OB6A 3RH0A 3RLFA 4ZZ0A 3DDNA 3EZGA 4QUHA 1IWPB 1F2UA 3N75A 4XIJA 2ZBEA 3PL1A 4MJ7A 1OYVA 4LDJA 2VSXA 4PLFA 1BU5A 4KN8A 4L85A 4EGQA 2FZCA 1RCUA 2GM5A 1UBCA 5I7EA 2EOAA 1TGVA 2PGDA 4MWCA 3U7GA 4OX9Y 1G5HA 4FHEA 2GHQA 1U3WA 1Y5IA 2PO5A 1T13A 3BRWD 2TSYB 3GJXC 3MRVA 4J7AA 5C35A 4OMUA 4CLHA 1FIUA 2XRYA 1KPIA 3TEMA 2H1OA 2AC2A 3H9CA 1Q3HA 3U5ZB 1IBMB 1EUCB 1EG2A 4JBNA 4B4UA 2H5EA 3L8HA 4NYMR 2FR8C 3M9XA 2X22A 1RRMA 4BIMA 4XKWA 2IY8A 3HYNA 3NEAA 3LT2A 3QKWA 2RDMA 1UT5A 4N48A 1E60A 1QQ5A 3TSOA 3KLOA 2ZWOA 2V1UA 1WP4A 4WNAB 4YO8A 1NMSA 1U7DA 5EP4A 1EFLA 2WUWE 3IP1A 5G1PA 3PHIA 4ZMRA 3H1AA 3HXLA 4WBSA 1JFFB 2OKCA 1ZIPA 4YQYA 4ZRDA 1P7CA 4GP6A 1NM5C 3D7RA 5JRDS 2PGLA 2XY4A 2YMPA 3LKBA 4LGVA 1KSGA 5GONF 4G01B 4OMCA 3OLYA 3E9NA 2FPIA 4S35A 3DYIA 3WTCA 4FM9A 3FOFC 3W5BA 1QKIA 2BFFA 1DMRA 1UPXA 4ND3A 3ZWXA 4MWBA 5CYOA 7YASA 1T1IA 1AZTA 4RM0A 4XQ0A 2BSXA 2YASA 4UNRA 1X1SA 1JU3A 3FYSA 4M98A 5M3BA 1U9JA 1U8CB 2VJCA 3Q8XB 1O08A 5EJFA 4MTLA 1U3DA 3A27A 5HDBB 2XT9A 3GLIE 2I2XB 4BBJA 5FFNA 4L16A 1KRWA 2DSNA 1UDAA 5H3HA 1NR1A 2P3MA 2GN6A 3KOWA 3SF8A 3GU3A 1S2MA 1NA5A 2ECQA 1CB7A 3HB7A 1E1LA 1PNQA 1QYDA 4YRMA 1E6WA 1OTYA 2VLIA 4RFSA 4G65A 4IF6A 5LZ4A 2I55A 5EHZA 1U4OA 4LW8A 1R4NA 2GEVA 2IYSA 3RCBA 1VL1A 1XCJA 3AIMA 3MJRA 3KOXA 4QOIA 4N8SA 5JS7A 2AEMA 4Y30A 4YCDA 4EPVA 2X40A 1J2TA 4AJOA 1TOAA 1KI2A 2WYHA 1O94C 4AUNA 3QJGA 1CR6A 4OBEA 4HUQB 3PX2A 1HZZA 2FNAA 2O7RA 1LA2A 1K75A 4IMPA 3OX4A 4K28A 5DRYA 4BC1A 2WP8J 1WDKA 4BWGA 5JXJA 1GY8A 3LGAA 3P97A 2L2QA 1KVSA 3AGQA 2HADA 3G5AA 4JS0A 4X3OA 3QKTA 4H77A 3HCOA 4NJMB 5JW6A 2OR3A 4G5OA 2C3MA 3H2ZA 3I83A 3LCMA 4XUCA 1P2UA 3KQQA 3DEZA 3ZWYA 1XEWX 3JXEA 3HBFA 2KM1A 3PF9A 2V7EA 3IBGA 3OWHA 1GUFA 1V4NA 1VJRA 4ZKDA 2CMHA 1NXVA 4FX5A 2GDJA 3HABA 3KB8A 4DSNA 4EKDA 3O38A 4KUHA 2PQ0A 3FOWA 4L27A 4YRJA 3IODA 4Q15A 1Y6QA 2B92A 1F38A 1ZU5A 2JDID 4Z7JA 4IOJA 4QVAA 4LOKA 4X1KA 3IURA 4XTRA 5C32A 1FTQA 2WTEA 3EMBA 1AU9A 1V6SA 2IEYA 1XZNA 5FBWB 1VG8A 2CNBA 3MLAA 4JR0A 5EJ7A 3LCVB 2XZLA 2HGZA 2BHNA 2CCGA 4ISCA 3B48A 1AG9A 1EIWA 4M1QA 1THMA 5KU7A 3BWYA 5JROA 1QMGA 2V1XA 2XODA 4ZT7A 3WNCA 4FCVA 4CHTA 3AHEA 2ZW9A 3DOIA 2CXNA 4KX3A 2HJRA 5GJBA 4NSNA 3WG9A 1MABB 5IZ4A 3PITA 3FTPA 4MWTA 2XJ4A 2F3RA 2HHAA 4WNAA 1LSSA 4TQUS 1LB1B 4TTRA 1K98A 1NUPA 2GCPA 3S99A 1P9NA 4LRSB 4OPMA 4DA6A 4YEDA 4HT3B 4XL9A 1PAUA 4NCHA 4ARVA 2BFDA 3O4HA 1NQWA 1U7PA 2JH9A 3ML1A 4FKBA 5EIFA 1P29A 4LZAA 2A0YA 5KCZA 3QLUA 1LLQA 4ILEA 1NBWB 5E6TA 16PKA 2D5IA 5BSYA 2V3VA 1XQWA 3DXZA 2AZ4A 3GUVA 3OFKA 4YMHA 2IUUA 3HKEB 1UZUA 1E89A 1HV8A 3NYWA 3NANA 2J3HA 4DILA 3MN1A 4J0KA 1XAJA 2R3SA 1GNQA 4CFZA 4HAXA 2V4ZA 3GARA 4JX9A 1FYDA 1Z3CA 3FYCA 2P77A 1GZDA 1OXXK 1QH8B 1ESDA 2C5SA 3P5BA 4F6RA 4LQLA 2AG6A 4R7TA 2Z57A 3EXHB 5FOXA 2VJJA 3UJPA 4Q1CA 1YI1A 3FCYA 3JYNA 2REXB 1J09A 4LBVA 2P6OA 5BWOA 2ZZNA 4X7MA 3GMTA 4MWGA<