2QMXA

The crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
278
structure length
278
Chain Sequence
NWLIAYQGEPGAYSEIAALRFGEPLPCESFDDVFSAVTEQKADYAVIPIENSLGGSIHQNYDLLLRRPVVILAETFVKVEHCLLGLPGASVETATKAMSHPQALVQCHNFFATHPQIRAEAAYDTAGSAKMVAESRDKSALAIASKRAGELYGLDILKENLADEEWNITRFFCIAHENNPDISHLKVRPDVARQKTSIVFALPNEQGSLFRALATFALRGIDLTKIESRPSRKKAFEYLFYADFIGHREDQNVHNALENLREFATMVKVLGSYGVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of open (R) and close (T) states of prephenate dehydratase (PDT) - implication of allosteric regulation by L-phenylalanine.
pubmed doi rcsb
molecule keywords Prephenate dehydratase
source organism Chlorobium tepidum tls
molecule tags Ligase
total genus 85
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qmxA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmxA02
1QJMA 4PFTA 3FXUA 1LGBC 2NWJA 2D3IA 3VV5A 1XC1A 4POWA 1IQ7A 2I4BA 1LBCA 4PFYA 5TPAA 2Y7IA 1IEJA 4PFWA 3U7JA 1FCKA 3MQ9A 4ESXA 4NEDA 3TMGA 4EXLA 2ZYNA 2P1SA 2HXWA 4PFUA 2Z22A 1B1HA 3CIJA 2UYEA 1IZ1A 1MM7A 2Q2AA 5DEXA 1FQBA 1NL5A 3AB2B 4HCYA 4LQ5A 4RPOA 1P99A 3FJ7A 4OWDA 2DXRA 2NOOA 1LFGA 2E0SA 4MFIA 4X48A 4RY1A 1MH3A 2VGQA 2QS1A 4IO6A 2I9SA 4EDPA 2A5TA 3IB2A 3PPPA 3P7IA 4EF2A 3OSRA 4HS7A 4M4GA 3HPIA 3N5LA 4YKJA 1Y7PA 2ONKE 2ANJA 4DLDA 1FTKA 3AB4B 2X7PA 3OO9A 3TELA 3C9HA 3OENA 2XXIA 4LZ5A 5I2NA 3TPAA 4HTGA 4KCDA 1ZBMA 5EYFA 1QVSA 3IO6A 1YGYA 1B3HA 3G3IA 4Q30B 1D9VA 1OIBA 1DTGA 1B51A 4IY6A 3TKDA 4U1OA 4FORA 2OWTA 3IX1A 1I69A 5F1QA 3EQ1A 4JWOA 1Q35A 1HSJA 4YB6A 2I3VA 1WODA 4R9FA 1MDQA 2PVUA 2VP1A 3VVFA 3L6GA 1FQCA 1Y1MA 3DELB 4GIZA 3PUVE 4G68C 2RC9A 3H6VA 3UGWA 4NWDA 3HHGA 1WVJA 5KDTB 5BUUA 2RF1A 4F3PA 3V89B 3FATA 2H9ZA 2QS4A 4JWYA 1YBAA 2GHAA 3IL1B 3MVXA 4XKNA 4YKIA 2UVJA 4N6PA 2Y7RA 3NRBA 1OVBA 4U2RA 1S7YA 2PMSA 2GRVA 4OHNA 1MY1A 2E1SA 4Z7EA 3SEWA 1DSNA 4OETA 4GO5X 4JB7A 2Q8JA 2GFEA 3UIFA 2OLBA 3GBBA 1JW5A 3H4ZA 2XD3A 3K00A 2XXTA 1MXXA 3TYHA 3EHUA 1NKXA 5ITOA 3K2DA 4YICA 3OD7A 1LKZA 2O69A 4NF5B 1JW4A 3CG3A 1SI0A 1II5A 3U8QA 2QSXA 3E13X 3P96A 4GMKA 4LVQA 4R74A 2HCAA 1AMFA 3HHFA 3PD8A 2THIA 2GH9A 4KPTA 3TUSA 2D21A 4IO7A 1LSTA 1YCJA 2Z8DA 1QUIA 4FAJA 2H99A 3T9HB 3O28A 4GQOA 1Y3QA 5L8DA 1QUJA 1ZTYA 3TAJA 4EF1A 1OMPA 1H43A 3IOVA 1XTZA 4JSOA 2O1LA 1JVYA 3QXMA 4O3AA 4EQBA 3FVOA 3GLBA 3MPLA 4YMBA 2I49A 1NMUA 3T93B 5EHSA 3MVWA 3PUWE 3C36A 3TEPA 3SKPA 3K6VA 2O1MA 4F18A 2ZNTA 1CE2A 1P1OA 4NF6B 3S9EA 4TOZA 3WAFA 1SDXA 1MY0A 2JOQA 1SVXB 1DOTA 3VLUA 4BDLA 5TPAB 3TQWA 4KFQA 3HHEA 2CDQA 1IXIA 4R6KA 4LP2B 2ZNSA 3OFGA 4OENA 1N3XA 3S9NC 5H8HA 3B6TA 3FVGA 4GWOA 4QFOA 4NF8B 3ZKKA 5A5XB 3U1OA 4G2ZA 4PWUA 2F7CA 4BLAA 3UN6A 4H6DA 4C1TA 4GL0A 3LSLA 4F3GA 1US4A 1Q1KA 3CFXA 5JTYA 3MZBA 2YJPA 4ND9A 1Z7NE 5CBSA 2REGA 2X7QA 4P0GA 4GXSB 4GO7X 3PPNA 1EU8A 4ZEFA 1NNFA 2DXYA 5CC2A 1OLCA 4QFKA 4OQOA 2FA7A 4NMYA 3V5AA 1LFIA 3N0VA 3OSQA 1US5A 3ZSFA 3DP4A 4RNSA 3RT6B 3KZGA 2F1FA 1NH7A 3IO4A 1YTVA 5DT6A 4HCWA 3SESA 5I2NB 1FTJA 3TFLA 1VE4A 1EZPA 3MUQA 3PUZE 1USYE 3A09A 3W9VA 3H6TA 1B7UA 5AA1A 1POTA 3L7OA 2AIXA 1M5CA 2OBGA 4Q5TA 4P11A 2DSFA 2F97A 5JEIA 2ALUA 3O6HA 2V84A 4AB6A 4IO3A 3BKIB 2XXHA 4U4XA 5ELVA 4ZDMA 3KBRA 2DWAA 4ZECA 4BDQA 1ZIUA 2UYFA 2HEUA 2Q89A 2ESNA 1SW5A 1TFDA 1H3DA 2J0WA 4C0RA 3IOWA 2Q88A 2O68A 3K0VA 2DP8A 2VD3A 1MQDA 1D3KA 4G68A 4H5GA 3PMVA 1A54A 1XS5A 1URGA 2H25A 3MW0A 1ANFA 3N6TA 4YMAA 3ILTB 3IOUA 3IB0A 4ZS9A 2QRRA 1SW4A 2V3QA 4LQ2A 3VFJA 5IT4A 1S9TA 2BJJX 5CMKA 3O1LA 5H8SA 2PA3A 1UIUA 4F19A 3FZVA 4POXA 3UW1A 4BDOA 4R9GA 1LBBA 4Z0IA 5I2KB 4NF4A 1PSDA 3O97A 1N04A 2J0XA 3UA8A 3QAXA 2I0CA 3JZJA 1FTMA 3G3GA 3OXNA 4O3CA 2OZZA 4AQ4A 1SYIA 5L9OA 4QSCA 1PBPA 2CMOA 2NYIA 3K02A 4OEUA 3OFFA 4ZZEA 5KZTA 5CMBA 1LK7A 1I6AA 2XXXA 3TTLA 2JHEA 1PB9A 2QSWA 3RUMA 4F29A 1B32A 1MPCA 4QHQA 5CMCA 5H8NB 2V3TA 5AE4A 4BDNA 3KSJA 4I9DA 3ECRA 1MQGA 5TU0A 4G8HA 3R7XA 1DPPA 2VD2A 4Q0CA 1MPBA 1J1NA 1LLSA 1Z7ME 4IO4A 3OO7A 1UIVA 2OCUA 5AA4B 4NTLA 1JVXA 1MS7A 3LSWA 3K4UA 2ZYKA 2OK2A 5DYHA 1S50A 4KD5A 2KO1A 4F3BA 1IITA 2HZLA 4OESA 1TFAA 4WEPA 5TP9A 3C32A 1N3WA 2O51A 4P0IA 1B3GA 3RY3A 4KI0E 1MH4A 3HV1A 3E4RA 4M8LA 4X1BA 3KOSA 3UP9A 2Q2CA 2V93A 3K5PA 3FXQA 4TQUQ 4FEDA 3VDFA 2QMWA 2PBWA 2P9GA 3IORA 1DTZA 3BFTA 5H8HB 5AA2A 4ZE8A 1OVTA 1B3FA 1SW2A 1UTBA 2D5WA 4H1XA 2RE1A 1PC3A 1SYHA 5AA3A 3PMXA 4OTEA 1JETA 1VFDA 4F3SA 1ATGA 4IGTA 2KLFA 3O6IA 3FV1A 1MM6A 3N6UA 1GV8A 2DWIA 1MPDA 2DTJA 1RKMA 1M5BA 1M5EA 3R26A 4LZ8A 3RLFE 2I6EA 3RTWB 3CEDA 2XXRA 2V25A 4ZZAA 1URSA 3FJMA 3MBPA 5CM6A 1ZU0A 4KR5A 1B46A 3MJNA 3RGYA 3E3KA 3SEYA 3U92A 3LSFB 1Y4TA 3PMWA 1PB7A 1EZOA 5KCJA 4PETA 5JK4A 2XXVA 3LBSA 4JDFA 4YAHX 4GLIA 1YPNA 3PPOA 4F39A 4WXJA 1B5IA 4FECA 3DHWC 5BWJA 4EXKA 1MQJA 3V83A 4U1ZA 3Q27A 3PGFA 3DC2A 4DCXA 3RPWA 2LQJA 3LC8A 1AH5A 5H8QA 1M0SA 2F5XA 3MAMA 5DVIA 3AAWB 5L9MA 4G77A 3O2AA 4EQ9A 3CVGA 5H8FB 1D9YA 2PYYA 4E0WA 3GXAA 4DZ1A 5I57B 3N94A 3GBAA 4JXIA 4OZ9A 4F2OA 2NUVA 5DVFA 3OO6A 2O6AA 1LFHA 1N84A 4KYEA 1GR2A 1SI1A 3OO8A 1F9BA 1B7ZA 1P1WA 3IOTA 4N13A 1B5JA 1IXCA 1JEVA 1DMBA 1VR5A 1USYH 4ZEDA 1MY4A 4G68B 4IO5A 4IO1A 4H65A 3HN0A 5ITPA 4TLLB 1DPEA 2XXUA 4C1UA 4IGRA 1GVCA 3K1NA 2DT9A 2DWJA 3FIRA 4U23A 3UK4A 3I3VA 5ICTA 2O84X 1POY1 4F1VA 3KJTA 2Y7PA 4QRZA 1NH8A 3B6WA 3TCGA 5FHMA 4LA9A 3SEXA 3DHXA 2I58A 2HAUA 4DDDA 1MG1A 4NF4B 2HZKA 4UACA 2P0SA 3OOAA 2G93A 2DWHA 3VVDA 1B2HA 3KOTA 1MXUA 3R6UA 3FGSA 3EHTA 3MWBA 4PP0A 1N7XA 4GL8A 4MBPA 2IEEA 3SEUA 2DVZA 4ELOA 1Y3PA 4YZZA 1RYOA 3VLVA 1MQHA 3MC2A 4GD5A 3KGCA 3TUIC 3O66A 3F11A 3OELA 1TXFA 4RJZA 3ZKLA 2VHAA 2CZLA 3K1MA 1NNKA 5DEXB 3JV9A 4KCCA 4MLQA 4LATA 1MY2A 3FJGA 4QSEA 3I5OA 3QSLA 4OXVA 1B3LA 3GZGA 3C31A 3Q25A 1XVYA 1FW0A 2DVCA 5I58A 2XX9A 3TZAA 2A5TB 2VOZA 5TP9B 5DTBA 3K01A 1R6ZA 5DVJA 3PPRA 1RYXA 2P2AA 3KWMA 2YPNA 2DE3A 4X1DA 4U22A 3E9XA 3QIMA 3SETA 1ELJA 3WAEA 5I56A 3U72A 3TTRA 3B7DA 2RQKA 2ZNUA 4KYSA 3U94A 5M2VA 5KDTA 3S1TA 3ODBA 1RWUA 1B4HA 3IK6B 3DP8A 3K6UA 2PT1A 1UTBB 3OMBA 4RA1A 4GFRA 2MDAA 1M5FA 2FGCA 4RK9A 3KFMA 3DM0A 2B65A 3M3KA 4U21A 1B3EA 2XX7A 2P9EA 1VFEA 1IUDA 3BFUA 1IXGA 4PE5B 3C4MA 3SEVA 4OYVA 1A40A 3HO7A 2QMXA 3TODA 3Q29A 1PBQA 3D4CA 2XXWA 3FVKA 2O7UA 3OFHA 5FTIA 3HSTA 3FD3A 4R72A 3VXCA 2AL4A 3ONMA 3IJXB 4NF5A 4DXBA 1N0TA 2FYIA 4G4PA 1O8BA 1O64A 3LOUA 3RQTA 1T0KA 4R75A 3FUZA 3QK6A 1GGGA 1HSLA 4EUOA 1B40A 2I3WA 4GF8A 1NFTA 1BKAA 4RK2A 1N76A 3C34A 2RC8A 3H6UA 4RXLA 1MRPA 1H45A 5H8QB 2F78A 1FQEA 3JYRA 2DOJA 3MP1A 1ZMGA 4XKRA 5HM4B 3PUYE 2I4CA 4F22A 1O7TA 1N7WA 3PV0E 4IO2A 4MH5A 4KHZE 2B3FA 2F35A 4R2BA 3W9WA 3UORA 3T9XB 4XIGQ 3TDJA 2NVUB 4F31B 4OFJA 4Q8RA 3EN3A 4LZ7A 2QPQA 1UJ4A 1B05A 4F1UA 2LVWA 2ZYMA 2AYSA 2RKMA 1ZJLA 4ZEBA 4OERA 5B7DA 3MP8A 4NF6A 1JEUA 1GTKA 1MXYA 4ELQA 4H67A 4ZE9A 4YB5A 2G29A 2F7AA 1VSOA 2H4IA 4ISUA 1OQGA 3I6VA 1H76A 1LAGE 5B70A 3A3UA 1R1NA 1QULA 3CSBA 4KQPA 2XX8A 1B1XA 4THIA 2F36A 2H5YA 1A8EA 4RPNA 2UXAA 5CMMA 1Y1ZA 2RCBA 3TQLA 4AB5A 3B6QA 1B58A 4NF8A 3A3CA 5A5XA 5EHMA 1P1QA 3MPKA 3U93A 2H98A 4WKMA 4X84A 3LR1A 2XXPA 5ISUA 4XXUA 3CFZA 1QKBA 3MVYA 5IS2A 3Q26A 4FE8A 3OEMA 4I62A 4QSDA 4XKPA 1Y4CA 1O63A 1QW0A 3KN3A 3IXQA 1BLFA 2ABHA 3QUFA 3K6WA 4JSDA 3TUJC 3CSGA 4QFLA 4TLMB 2R6GE 3PUXE 4F2QA 2PT2A 3RTFB 3KSXA 1FQFA 2FNCA 4NWCA 1LK5A 5FIIA 2QL3A 1B52A 2PC6A 2O7IA 2ZHOA 4LUBA 5T41A 1LB8A 4ZEKA 4NE4A 5J1DA 4YKPA 1PDAA 5CRYA 1B5HA 2F6GA 5ICQA 1NNPA 3T9UA 1UQWA 5F7VA 5JTYB 4GRKA 3SDFA 3ILUB 1FQDA 4OFLA 4IB2A 3EPEA 1LAXA 5I58B 5AA2D 4GVOA 2RINA 3K6XA 3THIA 1MDP1 4MF3A 5I59A 3V8XB 3BBRA 3ZS6A 1A55A 3LUYA 3HCQA 5FTHA 3TTMA 1OLAA 4DCYA 3M8UA 1I6BA 5IKBA 4R6HA 3RT8A 3H7MA 1JQFA 3TUZC 5I56B 3CG1A 1URDA 4DE8A 3CR9A 3USDA 4XKQA 1UTHA 4BDMA 4L17A 2ZXTA 3CFLA 1LB9A 3S9MC 1FTLA 4N07A 4R73A 3MVZA 2NXOA 3T96B 1MXWA 3G3JA 3G7WA 1AL3A 4LONB 4FATA 2QS2A 3G3FA 3C35A 3RN8A 2Y84A 1MXZA 5K2XA 2QJEA 4I1DA 1CB6A 3G3KA 1SD3A 1WDNA 4QF9A 4HW8A 2F8DA 3MP6A 3PU5A 4NMLA 4UA8A 1LCTA 3TTKA 4ELRA 5LOMA 2Y7KA 1U8SA 1A8FA 4I8CA 3O9PA 5I2KA 2IA4A 4X9TA 2UVIA 3T22A 1ZPVA 2XXYA 3IJOB 3QYTA 1AOVA 2M8CA 3D4GA 1XVXA 4YKKA 1ZLQA 3CRBA 1P1NA 4GOTA 3EF7A 4F1YA 4FIMA 3IB1A 1TT1A 5HBCA 2QS3A 5CI5A 4XTCQ 5I84A 1JW1A 4OEVA 2R71A 4G8MA 3OFEA 3MTJA 4H8IA 5H8NA 2RCAA 3MAHA 1SW1A 1FQAA 2DS9A 2I0BA 1LAFE 1B0LA 1Y3NA 4ONYA 1XHYA 2B3BA 3ENQA 3C33A 3IBWA 1A7LA 4E0XA 3L6HA 2RC7A 4RYAA 3W15C 1SQYA 5AA4A 1D4NA 2AL5A 5IT0A 1R9LA 2PX1A 4KYDA 1BTJA 1XOCA 1MY3A 3O29A 1Y20A 3DDNA 2P9CA 3ENWA 2W7YA 3QUJA 2UVGA 4K3FA 3FVNA 3TCHA 1B0HA 1EZ9A 1SBPA 5HPQA 2Z8FA 3VXBA 3Q28A 1M5DA 3K1PA 3KEIA 3T66A 3EHSA 4ZEIA 3G3HA 1H44A 2XXQA 5FHOA 3N26A 2I48A 2ZMBA 3H03A 3S4UA 5CBRA 2LAOA 4ESWA 1A99A 4G8NA 3KG2A 2V3UA 4M1VA 5JJBA 2OJTA 2R9JA 1MXVA 4DXUA 1NNTA 1TWYA 2OWSA 3MZ1A 2F34A 3KN8A 1IIWA 1PB8A 2A5SA 2DE2A 3TCFA 3DP6A 4O3BA 2HQ0A 1MQIA 4H0WA 3OBIA 1LCFA 1R9QA 2Y7WA 3SERA 1BIYA 1L5TA 1ZKBA 4H5FA 3VLWA 5AA2B 3T9VA 3DLNA 1QKAA 3IAZA 4IY5A 2XHDA 4EQ7A 4ELPA 2XD2A 4U4SA 4OMBA 4BDRA 2HFBA 2RQMA 3TTNA 1QUKA 2DE4A 4OFOA 3H3GA 1XT8A 2YLNA 3PD9A 1KWHA 3VVEA 4QFNA 4FJPA 3FV2A 5K2YA 4DXCA 1EH3A 4YB7A 3ENVA 3W7BA 3M3FA 5I59B 3FASA 5H8FA 4R2FA 3M3LA 3KN7A 4WEDA 2F7BA 3PPQA 4JWXA 2UVHA 1B4ZA 3AXFA 2HAVA 4OVJA 5I57A 4MLVA 2ZYOA 2QRYA 2Q9TA 3MZ9A 5IAIA 1KS2A 3LSXA 1B6HA 1UTHB 5KCJB 3O6GA 3FXRA 3H06B 3RNNA 4R6YA 4QFPA 2Z23A 1OQHA 5L9SA 1B9JA 1BP5A 1AIVA 3S9LC 2DQVA 3KJ7A 5FHNA 1SC6A 2ONRA 3H6WA 4H8JA 2REJA 2ONSA 1P1UA 2Z8EA 4PQJA 2X26A 1IXHA 1HSEA 3S2VA 4JBZA 1UJ6A 1PEBA 4YU0A 1LAHE 3VE1B 4ECFA 1I6QA 3IR1A 1JNFA 2DYXA 2F8MA 3OEKA 2H9BA 1YAEA 1B7HA 2GHBA 4GXAA 4FEBA 3CI8A 2F6PA 2WKYA 1FTOA 4DIGA 1Y9UA 1UJ5A
chains in the Genus database with same CATH superfamily
2MHEA 1SQEA 1D9QA 4QWCA 5KT6A 3K58A 4RU9A 3T5JA 2D69A 2HHSA 4W98A 4O8MA 4WFAQ 4POWA 5B0EA 9ATCB 4DL0C 1N48A 1JLGA 1PCAA 2J9EA 3VAMA 4PKDB 2O3DA 5GMEA 3I0RA 4PFYA 3N79A 1FCKA 4I3EA 2XY7A 3VAJA 3M8WA 3J7ZT 4DZ6A 3TMGA 1FJ6A 2EG2A 4CLPA 2ZYNA 2VFTA 4M5HA 4PFUA 2ZITA 3RW6A 1DTQA 1R31A 4CT8A 3M8QB 4KPCA 5T7LB 2YKOA 2F9DA 3CIJA 4NA3A 1PYSB 1EAYC 3MR2A 5GAEI 1OJ4A 3HSDA 2WSCC 4U95A 3GZ7A 3HZEA 3CD0A 3DLKA 2DCLA 2DXRA 1JJCB 2NOOA 1LFGA 2HRTA 1U1QA 4OV1A 2MZ1A 2HHVA 4KR0B 3LPEA 1NSAA 3VAFA 5J1PA 5HBMB 2HBQB 3AOBA 3KLHA 2DISA 2Y1LB 1K9MT 4AD6A 4X64F 1NKCA 1WHWA 1INPA 1F60B 4DUZF 3OSRA 1VDHA 2FJWA 1RWPB 4RZRA 1UPPA 1FRKA 3V4IA 4IH6A 2P6SA 4B3OA 1AW0A 2ASLA 5DLGA 1NUZA 1UEUA 3EYZA 2LXUA 5KFIA 5J2NA 2CUYA 5EYHA 5I2NA 1UFLA 2FZGB 4OL8A 2CVIA 1B3HA 3J7A1 4LQ3A 3G3IA 3D7SB 1OIBA 4QZVB 2OEMA 1ZM3A 3R5CA 2MQOA 1T03B 1T9WA 4KTQA 5K8PA 2OWTA 5A76A 3M8YA 4OYOA 1Z2LA 4ZCKA 3EQ1A 4JWOA 1HSJA 7AT1B 5HATA 4R0EA 1WODA 2CPEA 5KFTA 2PVUA 5E3PA 3IO1A 1M5SA 4Q44A 1FQCA 2W2MP 3H40A 3DELB 1RT4B 2CG4A 3N6NA 4OZJA 5KDTB 1LBZA 4QBUA 5EN1A 1WF2A 4XDCA 4F3PA 5KFSA 2EFVA 2W9AA 3LGNA 3MVXA 4XKNA 5DM6Q 1RT2A 4CLFA 1K8AT 3HD2A 1YX2A 1VQKS 4N6PA 1F5BA 4L72B 5KT2A 4EMDA 1X5PA 3KHLA 4IQMA 5KG1A 3DRRB 3HVRA 2C28A 4W4MA 2ASJA 4U2RA 4LFCJ 2UUTA 4QPXA 1E6VB 2CEXA 3RG6A 1RWNB 3H90A 1C4CA 3SEWA 4OV6A 1HYSB 1FD8A 2Q8JA 3M2RA 2ZD1A 4CH1A 1TTHB 2H51B 1JW5A 3BQ1A 3N6LA 4P2MA 2BV3A 1SH3A 2MMYA 4GX4A 1V5VA 2XXTA 1MXXA 1UKUA 4OX8A 3EHUA 1NKXA 4CLZA 4NF5B 3CG3A 1SI0A 1TQLA 4LF7J 4OI0A 3U8QA 3E13X 1J5EF 4ZVQB 2EKYA 4C8OA 1X5SA 4R8UB 2CZ4A 2PIIA 2Q6BA 4WYWA 4IRDA 2VQFJ 2HQDA 3EZ5A 3QO9A 4FNHA 2I5JA 2GJ2A 3DOLA 2H99A 3T9HB 1FPJA 2ALYB 3EDQB 4DJBA 4FF2A 2EK6A 1QVFR 2KI2A 4H4KA 1QUJA 1ZTYA 3TAJA 1WWHA 4IR1A 2E1RA 2CNKB 1XBWA 3MPLA 3MHYA 5B08A 5HO4A 1O5JA 4KGMA 1KOOA 5A6PA 1FDNA 1M90T 4N7TA 1NV5A 2J6TA 2O1MA 3JAMU 1GT8A 3NY0A 1RCOB 4P3LA 5K8NA 1NV2A 1TR0A 3TYTA 4HT5A 3PFEA 1RAHB 4NF6B 3NGUA 4TOZA 1HWJA 3OXLA 1M1HA 2OSQA 1IVZA 4HI2A 3TQWA 1U0HB 4KFQA 1H2UX 2UXCF 3HHEA 5DJBA 1S0NA 1P8GA 2CNLB 3W60A 4R6KA 5CZXA 1C4AA 3KK1A 4OJ3A 5E2QA 1TELA 2XQCA 2FZCB 2ZNSA 3OFGA 3QZ7A 4YS2A 1N3XA 3CHGA 3S9NC 3ZKKA 1UZDA 2F5GA 2YKNA 3M2VA 2GQCA 3U1OA 1PGZA 4AQYJ 4DLEA 4X4RA 3NOCA 5HMYA 2BRKA 3LSLA 4HLBA 2AX0A 2ZC4A 2XMAA 3MR5A 2NQPA 2EFNA 1L3UA 2CPXA 2IDEA 5CBSA 2X7QA 1S4FA 1HBOA 1I94J 3BPDA 3MPVA 4ZEFA 3I55S 1LBXA 1AA1B 5CC2A 1OLCA 4FYXB 4OQOA 2JWNA 3TAPA 1LFIA 5I3SA 5CXTA 5AXLA 3OSQA 1IKVA 1GX5A 2MY7A 3NCQA 1EZPA 3MUQA 1NKBA 1USYE 1FXLA 2A1BA 2P8IA 1N36F 4ZVEA 3H6TA 3ZZYA 3MPYA 2OTLS 1B7UA 5AA1A 3T0JA 2DBBA 4Q5TA 1K44A 3H2VE 2RU3A 2DSFA 4DFPA 2B8QA 3PR4A 5KFHA 1RT3A 3O6HA 2C3PA 3ITHB 1V6HA 1JIHA 4W90B 2V94A 4ZDMA 1BQMA 4ZCIA 2MKKA 4AS4A 3U1MA 3T1YJ 4OYBA 1S4EA 2ZH4A 2OWZA 3HHLD 3KHHA 4YOEA 2VPZB 4ZMMA 1ZIUA 2GGPA 2I38A 1RU2A 2ESNA 3T41A 2XO7A 1SW5A 1H2TZ 1TFDA 2Y5LA 1CQMA 1WOOA 1RLCL 3ZNJ1 3CIZA 3CC7S 4C0RA 3IWLA 4LF5F 2KQZA 2V9WA 3RTVA 1BWVA 2X1GA 3A12A 2MGZA 3PMVA 3RU0A 3QMQA 2IA0A 1A54A 2N3OA 1JB0C 4QJVA 5T14A 5A2QU 4K4ZA 1XK8A 4F4ZA 3N6TA 4ENOA 2B5JB 2HFVA 3OXGA 1UEKA 3CTRA 3P5TL 1WI8A 1TK8A 5IT4A 1HHQA 1Y5LB 3D6MB 4X62J 2E29A 3CMQA 4DV4F 3M7VA 4ZCMA 1KHVA 4F19A 2HNZB 1RKIA 2MJUA 2VFUA 4ZVUB 4POXA 1HNXJ 1YKWA 5I2KB 4PUOA 4O3NA 4HTJA 2IJNA 2DGSA 4I69A 1FTMA 5EQAA 4TU8A 4TQRA 5D0RA 1S1WB 3KLGB 3OXNA 1WKLA 1VQ7S 2ZOGA 4AQ4A 2Q66A 3CSKA 5AJ3F 1FE0A 1CC7A 3VAIA 2CMOA 3TX0A 1H6KX 5KZTA 1SC1B 1KVKA 1C1CA 2QSWA 1MPCA 2H1YA 4QHQA 5CMCA 4GX3A 2R7OA 5AE4A 3H0PA 4BDNA 3BYRA 1MQGA 1QVGR 1OY8A 4TYAA 3TWZA 3NEKA 2XI2A 2VDIA 1L3VA 4I7FA 5ETTA 3RB6A 2LQBA 3E01B 1MPBA 2DNHA 3PRVA 3RJMB 1TUGB 2WVBA 1FJGJ 2VFVA 1GAOA 4OLPA 1FBCA 3A3NB 4H46A 5K20B 1JVXA 4FKYA 1MS7A 3VZIA 2OTJS 4NOHA 3K4UA 1S99A 2ZYKA 3DRPA 3W8PA 2CADA 2BJDA 1OSCA 3NNAA 1SPIA 5DZ7A 2HZLA 4PCDA 4D3GA 4GBVA 5TP9A 1RBOB 4C3KA 1WC1A 2K1RB 2O51A 3W9HA 2WSFC 3U1LA 5IT9Y 4I0WA 1V9OA 2X7IA 1KEKA 4A8WA 3D3BJ 2QC3A 2Q2CA 3NGDA 2K06A 2V93A 2GHWA 2KVQE 2QMWA 2LCWA 3NAHA 1DTZA 1NO8A 2MB0B 2APOA 2BM1A 5H8HB 5AA2A 1B3FA 1SW2A 1IBKF 2H54B 4C7QA 2LU1A 2MPUA 4LR9A 1PC3A 2ILYA 1LNQA 2ZDOA 1FRIA 4TY9A 3N4WA 1RWOB 4A8FA 5LTCA 3O6IA 4U9RA 3IRWP 4ELVA 3FV1A 4AYBD 1U26A 2M70A 5HLFA 2PA8D 1MPDA 4C48A 1K0VA 1V3RA 2LXFA 4LZ8A 1KLMB 3CEDA 1NM2A 1X7VA 3FJMA 3NWRA 1ZU0A 3PTYA 3DKDA 4OX9J 3MJNA 2YWEA 5L38A 4CNYA 3LP0B 3HPOA 1NUWA 3M8ZA 1U45A 3BS9A 4CO2A 5HMWA 5KFOA 1DZ5A 2BBEA 1JX4A 1EZOA 4PETA 4JDFA 1RJJA 2Z56B 4YAHX 4N47A 2HFSA 4DQSA 5IGAA 3PPOA 3HHLB 4CP5A 4WXJA 3FMBA 3DHWC 4L74A 4XPEA 3GR0A 4NCBA 5B0DA 1CJTB 3DC2A 4XAKA 2WOMA 3BO2A 4DCXA 4TU9A 3UQSA 3LC8A 3T3FA 3VAHA 2R2UA 2EPIA 3CJ8A 2ZUGA 1SL2A 3AAWB 1XN9A 2H48B 4M5IA 4EQ9A 4WIQA 5J1NA 1M1GA 2PYYA 1JLFB 1SJ3P 3MCSA 5E3RA 3GXAA 3N94A 3GBAA 4JXIA 4ZOSA 4OZ9A 2Q1LA 4F2OA 4M5LA 4DR5J 5DVFA 3V81B 4JBCA 3OR2A 3BGRA 3UCZP 3RRKA 2PGCA 1P1WA 3IOTA 1XERA 4N13A 1IXCA 2RILA 4B3RJ 1DMBA 4LSLB 1USYH 1SL1A 4WYLA 1MY4A 1JLAA 3KG1A 4G68B 1T9TA 2HBZB 4IO1A 4KH0B 4CO5A 4KYZA 2LP4A 4TLLB 1DPEA 5DM7Q 2PT0A 3S01A 4NXMJ 3FJ2A 4DFMA 3THTA 1QDUB 4JI3J 4WFBQ 1EARA 2VOOA 3J80U 2VA2A 3GYNA 1Q8LA 1AFJA 3UK4A 4H4MB 2BR0A 3GG0A 2BDPA 2IC3A 3DHXA 4K4UA 3GCXP 2HZKA 2GC8A 1VQ4S 5AE1A 3OOAA 3GPAA 2BA9A 2NXUA 3VVDA 1B2HA 3KOTA 2GO9A 1JLGB 3FGSA 3EHTA 4EYHB 3MWBA 3Q8UA 1JLCA 1N7XA 4GL8A 4MBPA 3DNCA 2N7YA 4L6V3 4I4BA 2IEEA 5IXUA 1JP4A 1QSSA 1S76D 3A8EA 2CJAA 4YZZA 1RYOA 1MQHA 1VLOA 4DPTA 3IS9A 4GC6A 2EEYA 1DTQB 2KZZA 4RW4B 2I6WA 2DY9A 1ICEB 4RJZA 3UDEA 1Q86T 2NXJA 3ZKLA 4LSNB 2EFGA 3G9CA 2IJFA 2IAJA 5M2RA 3PV8A 2J8SA 4LF1A 3K1MA 5KFEA 4PEOA 3MCMA 1SJFA 1NNKA 4JOUA 1NKEA 1Y9OA 5KG4A 3MR7A 3JV9A 4LATA 3QJPA 1T95A 3FJGA 3HFKA 5L1LA 4EBEA 2HKEA 3QSLA 4JI5J 4OXVA 3SFGA 1RB0A 1U49A 3GIIA 1B3LA 1RAAB 4G1IA 3D67A 3DXSX 4C4WA 1RHQB 1VLYA 2L9WA 3TZAA 3GJSB 2VOZA 3KLHB 1SJQA 3P4UB 2JZ5A 2BYCA 2UXBJ 3NL0A 1NDLA 2P2AA 2QVRA 2YPNA 2X1FA 1VBXA 4O4GB 4UTGA 3N5FA 4GWUA 5I5PA 4K2XA 3V4IB 3QIMA 3MM9A 4B3OB 3SETA 1N32J 4DG1A 5EUHA 4ZHRA 5AE2A 4F4KA 4UY85 3WAEA 2FBPA 3GONA 4PQAA 1NJYA 2ZNUA 4KYSA 2BJ1A 1FX2A 2FZKB 4KGZB 4F3OA 1MU2B 2RVJA 4I1TA 4F3MA 1NXIA 2LEAA 3SCKE 2ZE2A 1RK8A 1X4HA 3BKFA 3TZYA 2B9YA 1UETA 2AYEA 3OVAA 1ZTWA 2M88A 2BEFA 2FGCA 3DXBA 1CLFA 1S9GA 1FNOA 3KFWX 5F9NA 3DM0A 1ZAWA 2E5JA 3M3KA 1PBUA 1B3EA 2VBWA 3C4MA 2CNNB 1JJ2R 4NPOA 1HKAA 3HO7A 3PYGA 1FJ9A 4MKBA 3Q29A 2YPZA 1T3NA 1F3FA 1IMCA 3HSTA 3JTNA 2GS8A 3HCXA 3VXCA 2MKJA 3HM9A 2R42A 1N0TA 2SXLA 5KFKA 2MKIA 1WC6A 5D15A 3DRYA 5KT7A 3MEGA 3JSRA 5E3QA 2ZM6J 3WHIA 1A0OB 2KM8B 1XC9A 1HSLA 1B40A 3IMQJ 2P2CB 1NFTA 1N76A 3C34A 3H6UA 1MRPA 5H8QB 1DARA 4O0NA 1FQEA 2QX0A 2XLJA 1YJNS 4B9MA 1O7TA 1RYSA 1HWUA 4QYZK 1N7WA 1YZ0A 2LDIA 2ZNYA 2B3FA 3C14B 2Z30B 3IR6B 3T9XB 5LT5A 2KT3A 4ERDA 2RU9A 2NVUB 4IRCA 1TL1B 2WCXA 1R6VA 4DV7J 2W24A 4R25A 4F1UA 2AJ4A 1FDBA 2AYSA 4C3LA 4ZEBA 1R0CB 1RAEB 5HVHA 3O2IA 1GTKA 1MXYA 4ZE9A 4YB5A 2I5JB 3J7Z5 4RR5A 2F7AA 3HFZB 2BQRA 2H4IA 1OQGA 3CJ0A 2ZH3A 4N77A 1YDLA 4I6WA 2VUGA 4L3KA 5HROA 2XB2D 1LAGE 4LF4J 4J9VA 4F04B 1N8RT 1IR1A 1R1NA 4KE5A 1QULA 4LJMA 2KG1A 1IKWB 2F36A 1FRXA 5BXIA 2L9DA 2V0NA 2D7SA 1S1TA 2ZDPA 1YYZA 4RPNA 3BB5A 2UXAA 1V3SA 2ACMA 5CMMA 2RCBA 1RTJB 4QU7A 5DRKA 4NF8A 1R6YA 4Y34A 2R7WA 4OJGA 3NWGA 4PXBA 3MPKA 5CH7B 4QYZJ 2RF2B 2M4MA 3Q8VA 3HSGA 3MVYA 2L48A 2FIUA 4DCPB 4OHXA 1M1KT 2CQ3A 2MLXA 1C0TA 5E3CA 4QSDA 2BQ3A 4MFBA 4L76A 2R8GA 2VG5B 4UQGA 3KK1B 2R6GE 4F2QA 2J7WA 2W7AA 2G1HA 3RTFB 1HW8A 1WTFA 3HHLC 2NSCA 3E3XA 5FIIA 2QL3A 3EZUA 1C2PA 1SVDA 2PC6A 2YKNB 4LUBA 1WEZA 3M2VB 4DV1F 1LB8A 1HI1A 3W9IA 3BIHA 1KTVA 4KQZA 2HWIA 5CRYA 1VJQA 4OYWA 5KOWA 1NSKL 1FBDA 1S5ZA 1NNPA 1AXQA 4IYQA 2LEBA 3IG1B 3RW7A 5F7VA 1RQ0A 2AU0A 4GRKA 4C11A 5AA2D 1PAEX 3THIA 2MQLA 4NN3A 4USMA 1VOMA 4RNHA 2IYGA 4B9SA 4A8YA 3NGKA 3HCQA 2DGTA 2OEKA 5FTHA 5ETNA 3ROJA 4DCYA 3M8UA 5IKBA 1U2RA 4R6HA 2LLZA 1IKVB 3CR9A 3USDA 1VQLS 3MM8A 4C2MA 1UTHA 4BDMA 4L17A 2C2RA 2ZXTA 1NZAA 1NDPA 4H45A 4X62F 3S9MC 3GP9A 3HI9A 2VPNA 3CCQS 4FXWA 1FTLA 4N07A 5F8NA 2P6TA 3MVZA 1YJUA 2ZH1A 1MXWA 4KFBA 1HNXF 2WVDA 1TL3B 3K5NA 4LONB 3RN8A 3TJ8A 3BPSP 5ADZA 1RT3B 4DL2A 4X4UA 1WDNA 1VC6A 4HW8A 2R7SA 5L8RC 4PR6A 4NMLA 5C25B 1LCTA 1U02A 2GGPB 1FD2A 3TTKA 1FPIA 3OSNA 2DNPA 5LOMA 1U8SA 5F9LA 1FO1A 1NRKA 3R7NB 4DEZA 3AOAA 4KGXB 2I8EA 6FD1A 1S48A 3IGVA 2IFXA 1ZPVA 1B7FA 1ULRA 3TJAA 2MGZB 2XYHB 1AOVA 5LOQA 1RU1A 1FBEA 2YWWA 4YKKA 4OZNA 1FE4A 4LT6A 4GOTA 2AGQA 4ZVTB 4FIMA 3IB1A 1WHXA 2I0XA 4LFBJ 4OEVA 2UU9J 4H8IA 3MTJA 2RCAA 1BLUA 1M5KC 5IV3A 1SW1A 2RAQA 2YX1A 3G96A 1XHYA 4DR2F 3IBWA 4ECVA 2XULA 1GXLA 4PUOB 3EVWA 3OXFA 3TA1A 1D4NA 2AL5A 2PEBA 1CEZA 2RUSA 3PKMA 2PX1A 2AQ4A 2A3JA 2NUUG 1BTJA 4DQPA 2BE2A 4FYYB 1JNRB 1YRTA 2B9WA 1QAXA 4KKOA 5ET8A 2CKWA 1MW7A 1FX4A 3DDNA 1RAIB 3MAAB 1QY7A 3NMRA 4K3FA 3K2YA 1PIEA 2YQ1A 2QFJA 4MJOA 3O8WA 2QG9B 3ETMA 3K1PA 2E5LF 3MR6A 2LU2A 3LAMA 1O51A 3T66A 5D0EA 4ZEIA 2AHOB 4PGNA 1EKSA 3C15A 3G3HA 3RAXA 2XWOA 2GMLA 5FHOA 4I7FB 3N26A 2DYAA 3NCRA 5CBRA 2CJQA 1VDWA 4KRWA 5HVFA 2LAOA 5F24A 1S9EA 4OJ1A 1A99A 1RZMA 3PW4A 5CA5A 1W2IA 4OX9F 4DQRA 3R1LA 3ISND 2AT1B 2FVPA 4M1VA 5JJBA 1HD1A 3N9UC 4HYKA 2M52A 2LMIA 4QYRA 4OYAA 1WACA 1UW9A 1QAJA 3MZ1A 2F34A 2ZH9A 1ZZNA 3R6LB 1PJ5A 4ETZA 1F5AA 3LA0A 1HWLA 3OUYA 1BHNA 2OMOA 1NZ8A 3HX9A 1NK6A 2RIJA 2JNJA 1AUDA 1B64A 3V4MA 3TCFA 2CXEA 2WYPA 3GIJA 3H42A 4RNMA 3TANA 2HQ0A 1OYEA 3OBIA 1BIYA 4PFRA 3VLWA 3R1HA 5AA2B 2XMTA 2KM8C 2VL1A 2CQ2A 2XD2A 4WP3A 5DO2A 2CQIA 4IRKA 4BDRA 4G6VB 4AL7A 4CYUA 1SC4B 4DR5F 4OFOA 2W1BA 4GBWA 4V19X 4B3MJ 2Z2LA 3J81j 2CPYA 4FJPA 4DXCA 2FVCA 1EH3A 3GSDA 5HLFB 3ENVA 2B4LA 3M3FA 3BSOA 4RWWA 5A0YA 4R2FA 3M3LA 3KN7A 4WEDA 3JSYA 2F7BA 4NI2B 2VG7B 4WBFA 4DUYF 2UVHA 3I0SB 4NXMF 2DDKA 4BC9A 2HS3A 4RNOA 2EVZA 2RSQA 5IAIA 1S0OA 5KFJA 4IFYA 3LSXA 1B6HA 1IMEA 4UZCA 3H06B 2MSTA 3QYYA 3CJ3A 1X0PA 3ENAA 3FBBA 3S9LC 4H4KC 4ZP6A 3L9ZA 1U4BA 3KJ7A 4H8JA 2WOMB 5ETPA 2REJA 2RB7A 2BJIA 3S2VA 1PEBA 4YU0A 3VE1B 1J5OA 3K8VA 1VQ5S 3CC2S 4QU6A 1OIAA 1DURA 4K59A 2F8MA 3OEKA 3TI0A 4TVAB 1G0HA 3BSCA 4XTTA 1UFWA 1WF0A 3FRYA 2F65A 2F6PA 3NOHA 1UMJA 1URRA 1FTOA 1NJZA 1ZYQA 4HH1A 4JP8A 5AXMA 3EUNA 4DCJB 2MLYA 2V34A 4N8OA 2W9CA 3W2VA 2MXYA 1QJMA 3VALA 4PFTA 3FXUA 4MYUA 1JLAB 3LP2A 3ZTSA 3EXCX 2D3IA 2DNKA 3VV5A 4NEZA 1XC1A 1L3KA 2ZZVA 2ZH5A 4O94A 1J27A 3U02A 1S6PA 2P5VA 3HP6A 4OZ5A 3PHTA 4X04A 1R8PA 2Y7IA 5EWGA 1QJHA 3U7JA 4IUFA 4JI5F 2UXDJ 3CCES 4Z37A 2NXCA 4M5DB 3KTQA 1QSYA 2R7XA 2P1SA 2ZZWA 4DV0J 4DV6J 3PO4A 2AZ1A 1VIXA 1VFJA 2UXBF 2UYEA 4U8VA 3R8YA 1J2VA 4USWA 1CULA 3FSYA 1MM7A 5DEXA 3O5TB 3C6TA 3KJVB 3AB2B 3SI8A 2OSRA 4HCYA 1SI9A 3FJ7A 4OWDA 3A13A 2JL9A 1Y0HA 1NDKA 5GAGU 7FDRA 4J9LA 3HHNB 4RY1A 1MH3A 5SZTA 3BKTA 5CCLA 4JI8J 1JLCB 1RCXB 5CHCB 4QCLA 4AUKA 1NB2A 2KFNA 4EDPA 4CM2A 4KV8A 2A5TA 3IB2A 5HAOA 3P7IA 2MQMA 2PEHA 2KL8A 5KFDA 2R2TA 4M4GA 1EETA 3HPIA 3IAS9 3N5LA 3IS9B 4YKJA 4JVIA 3QGIA 1TKTA 2IAJB 2HQ3A 1U24A 3MMAA 4MNPA 3I5AA 3M8RA 4BWJA 2XXIA 1NJIT 1FBGA 2V9KA 2AJQA 4KCDA 2YPYA 4JVDA 3IO6A 1RBAA 4RJVA 4MTPA 1D9VA 1DTGA 2XI3A 2EW9A 1HI0P 2GX8A 4OZ0A 5CYQA 5ET6A 4U1OA 1SKUB 4DV5J 3TQEA 4DFKA 3IX1A 1I69A 5F1QA 4OZ2A 2GJIA 2BOAA 4YB6A 3H5XA 2RH3A 4P1LA 5CD4A 4TU7A 4YQWA 1C1BA 1VHFA 1ZM2A 4R9FA 1G0IA 3MM9B 4DG1B 4ZHRB 3VVFA 3G2XA 1HNVA 1Y1MA 4ECXA 2JLEA 3H5SA 1TL4A 1RI7A 2A2DA 2HAIA 2RF1A 2YBVA 3FATA 2HXRA 4IKAA 4QWAA 3GV7B 2B43A 3UDLA 2MQ8A 1FBHA 2XZWA 2J6UA 1YBAA 4Q8EA 3IL1B 2ZE2B 4YKIA 4EI2A 3ZZUA 2Y7RA 1S9GB 3NRBA 5F8GA 1CJUA 1KTQA 3EPIA 4OHNA 2H5EA 3V6DB 3SIPB 4DV7F 1MY1A 2E1SA 4Z7EA 2BUNA 2XMWA 3QIDA 4OETA 4E0DA 4FF4A 2L3MA 1HHTP 4JB7A 2HHPA 4DPWA 1G7CB 4IOCQ 4MKAA 2IVFB 4IOAQ 2XD3A 2DIUA 3H4ZA 1N56A 2VHGA 2R8JA 2GNKA 2WTFA 2HHXA 2FTRA 5ITOA 4RUAA 4YR3A 4PQUA 1RDXA 1Q8BA 3ETOA 3OD7A 3B54A 3RB0A 3UNYA 4LF4F 5B0FA 3Q2TC 2QSXA 2QL7B 1FDDA 2HCAA 3PD8A 4C97A 1GFWB 4LBIA 3TUSA 3DGPA 2GCFA 3EKIA 1YCJA 3FMWA 2Z8DA 1RTHA 3JAMY 1QUIA 4FAJA 3D1QA 4F25A 1WKJA 2OELA 4GQOA 1Y3QA 1TK5A 5HN0A 1OMPA 1XTZA 2OI2A 1H2VZ 4XIUA 2O1LA 5JVHQ 5IZHA 3QT8A 1UWBA 3GLBA 4YMBA 4AL6A 1NMUA 4P2XA 3IWXA 3MVWA 2X3GA 3C36A 4DV3F 2DO0A 3CD7A 3B8BA 3OTOJ 2BE9B 1U1NA 2ZNTA 2ZFHA 1YJVA 5HI7A 1HA1A 4EZ9A 3MMJA 4V1Ak 4XK8C 4Q2MA 4PAKA 1MY0A 3WQPA 2H5JB 1DOTA 5TPAB 4G1QA 3PJWA 3DRXA 3L7UA 5HROB 2XCPA 3B6BA 2GA7A 2W2PP 4JI6F 2HGNA 2HVZA 4DL3A 1IXIA 4DN0A 2P3VA 1VQ9S 3UR0A 1TKXA 1FVQA 2Y8WA 4LP2B 1NUYA 2D1CA 5KTQA 3M9MB 3FEYB 1BMQB 2ZEJA 3CJSA 2OX3A 4NF8B 5E5NA 3BH6B 1TUWA 4IO9Q 1NK5A 2YX4A 3TA0A 1F0XA 5H9FK 3SBMA 3Q0AA 4ER8A 4C1TA 4IR8A 4UOFA 3WC0A 2ZKTA 4DU8A 1Q1KA 4OZ1A 1RUSA 3MZBA 4N4UA 4KJIA 5T3JA 5K8MA 8RUCA 3MCNA 3W64A 1Z7NE 3MD3A 3CF5Q 2REGA 2Z0GA 1DBDA 4I6YA 3PPNA 1EU8A 4WK3A 1SJRA 4ES1A 4FBPA 2F3DA 3HVWA 1IKXA 4MCOA 3T9ZA 4UZBA 1NPPA 4NMYA 1UFKA 4DPYA 3KNAA 4RW9A 1RHKB 4Y2IA 2YY3A 3DU6A 3KK3A 4RNSA 2HQCA 3KZGA 2F1FA 3K17A 4B9UA 4A8QA 5CZVA 1HNZJ 3TFLA 1F5CA 1Z2ZA 1X4CA 3PUZE 3U65A 2Y0BB 1N0UA 4K0KF 2HLTA 3MECA 1EYIA 3L7OA 2RT3A 4ZP9A 4P11A 3HKZD 5DZ6A 5JEIA 2ALUA 4KO0A 2GJFA 2HVDA 4U4XA 2R7UA 5ELVA 1RXOB 1X4EA 1TMJA 4X2BA 2YNIA 5A2QY 2KJVA 3EGVA 2CIMA 4AXIA 2UYFA 2NSBA 2RS2A 4ECSA 1H3DA 3MMBA 1L3TA 3LWLA 2KU7A 3KLFA 3FKBA 2J0WA 2W2QP 3T1HJ 2UUCJ 2DCUB 1N5VA 3IOWA 2O68A 4AL5A 3G4SS 2DP8A 2B51A 3B78A 5H1SV 3NKYA 1D3KA 3PX4A 4KFBB 4MIWA 3CCJS 4WCEQ 1GQEA 2XBPA 4MT1A 8ATCB 1HIYA 3AY0A 1U6BA 1URGA 4ZS6A 2H25A 2PFFB 3RRGA 4RNNA 4B08A 2BJ3A 2GQQA 4N81A 2QRRA 1NV4A 5IZ3B 3O1LA 5H8SA 2PA3A 4OI3A 3MEEA 5D4LA 3FNNA 5B09A 2E5HA 5AE3A 2DRDA 5F8MA 2BE7D 3UW1A 1NJWA 2XWKA 4DV2J 1E6YA 4BDOA 3CJRA 2J0SD 4Z0IA 3M32A 2Q8MA 3CJ5A 4NF4A 2VOPA 2ROEA 3O97A 4LF2A 2QFIA 3UA8A 4U8YA 3DDKA 4CLTA 4DPUA 2KR0A 3J7YU 3G3GA 2DEIA 4A46A 4O3CA 1FF2A 2RRAA 3A3OB 2JEGA 1T9XA 3SQGA 3OJSA 1VMBA 2CQHA 2VICA 3ISNC 5L9OA 1Y5IB 4CI0B 4ZPVR 3K02A 4TLQA 4ZIWA 1LK7A 2XTJP 3ZZ0A 2M9KA 2FY8A 2JHEA 2KZMA 4FNIA 2MJNA 2UVRA 4WFYA 4RO0A 1VQ8S 3C6UA 1HBNA 3DOKB 1XNQJ 4F2RA 2CQCA 2AX1A 4X4PA 2E1CA 4I9DA 3QMFA 1H73A 1S0VA 3T6JA 3FK4A 1DPPA 2VD2A 1J1NA 1LLSA 1I3OB 4RWXA 3EMTA 2G13A 3OO7A 2OCUA 5EDWA 4NTLA 4X8RA 2FHJA 2V69A 1KVIA 2BE2B 2ZBQA 5IFMA 4KKOB 5ETKA 1BXNA 5J2MA 4KD5A 4F3BA 5C24B 1IITA 4OYIA 2AYMA 3C32A 1N3WA 5C2GA 2MZTA 3RY3A 4KI0E 1GEHA 1DRZA 2HZAA 3F0NA 4M8LA 4NLOA 4QIGA 3FFIB 4MAGA 4X1BA 4JV5F 3ZZPA 3C15B 3HVTA 4B3SF 3UP9A 2BXJA 2ZVIA 3OTCA 3K5PA 4TQUQ 4ED2A 3MURP 1IMDA 2PBWA 4NMXA 2GV1A 3KNGA 2OJ3A 1HR0J 3GQCA 3JTOA 2KHDA 2HHWA 1UTBA 4PWDA 4H1XA 5DQIA 2RE1A 4NRUA 2MZQA 3KJNB 3SSRA 4OTEA 1SH0A 5A6WA 4LIWA 4F3SA 2IM3A 1ATGA 2Z2ZA 2CJ9A 1Q8KA 2KLFA 5IM0A 1IMAA 2PO4A 2AWZA 3N6UA 1GV8A 3IC1A 4IQXA 3MDFA 2WBMA 3PRBA 1RKMA 4G3IA 1M5BA 1FBPA 3NS5A 4X4QA 3NCPA 3RTWB 2V25A 4F0KA 2E1MC 5CM6A 4MIJA 4KR5A 3DLGB 4LRBA 3E3KA 3U92A 1RT1B 1YZ7A 4N76A 4PZVA 5K14A 4PDDA 5KCJA 5JK4A 3TEGA 4K5SA 1YPNA 5J16A 1LFWA 3MM7A 3PCOB 1MMDA 3C16B 1MQJA 4NZ7A 1QD1A 4HH0A 2LQ5A 4CO4A 2HQIA 4J9PA 1YZ6A 4HHJA 1AH5A 1M0SA 3MAMA 1TFWA 1MWZA 4MIBA 5L1KA 1DJ0A 3RBEA 1CS4B 1DQ9A 2K3KA 3CVGA 1D9YA 2ZWPA 4NASA 3R3TA 4CNZA 1U1OA 2NUVA 2RDJA 2H5IB 3SZ2A 3E79A 4KYEA 2UXDF 2ZH6A 4IFYB 4MMOA 3DCAA 3OO8A 3J80Y 4HR2A 1CJKB 4ECRA 1MN9A 4GC7A 2UVWA 2CZIA 1VRTA 4DV6F 2HK3A 1B5JA 1D0EA 1VR5A 1YHQS 3WIVA 2BJ8A 1BC6A 3TQ1A 1UAWA 3HN0A 5ITPA 2FC8A 2A6OA 1DCUA 2XXUA 4K4WA 4Q7AA 4HE0A 1J5OB 3JSMA 4IGRA 5HSPA 3M6UA 4U7CA 2F8EX 2L5VA 2WONA 4P9KA 4U23A 4D3HA 1WUUA 4GWSA 5ICTA 2G0IA 1LW0A 4QRZA 1ZPWX 1NH8A 3IN5A 3JXOA 2CJXB 3PIPQ 4NLTA 3SEXA 2QA1A 3TVYA 2HHHJ 4DDDA 3W2VB 1MG1A 3AODA 4XF5A 3FBCA 4ZN1A 4DL7A 1HARA 5L9NA 2DWHA 3LP2B 4IG3A 4NLSA 3VAKA 2N3LA 2HBRB 4NHBA 2BZ2A 1Q9DA 2CQ1A 2KXNB 1S6PB 5MLCV 2WYKA 2V2KA 3KKFA 4IR9A 2DGWA 4LBHA 2W9BA 4ELOA 2Y9HA 2J9CA 3NAIA 1PYTA 2B0GA 5L39A 2Z8QA 3TUIC 3F11A 3OELA 1B4SA 1TXFA 2G9OA 5D6GA 5CYJA 2DR5A 4FBUA 1HQUA 3CDWA 5A8RB 2F7VA 1CULB 5DEXB 3C6TB 4KCCA 4LFAJ 4MLQA 1MY2A 3CMAS 4QSEA 4FYWB 2PFYA 1HQ2A 2N4CA 2VG6A 3VCDA 2CZHA 1IWAA 4NXNJ 4K4VA 3L7PA 3C31A 2C2OB 1N33F 3Q25A 2WVCA 1FW0A 2GVDA 2B9EA 2ROGA 4LRCA 4U67Q 2XX9A 5I58A 2A5TB 4MJKA 1Q7LB 2QVUA 5DTBA 3K01A 1R6ZA 3KJQB 4TXSA 4F50A 4A48A 1EETB 2FB0A 4ZPTR 3KWMA 1TAUA 4BLGA 4ED4A 1S6OA 1Y11A 3MOJB 2C2MB 3KLEA 1JLEA 4X1DA 4CQ1A 4U22A 1SJ1A 4G61A 3UD4P 3U72A 2YNHB 3GFXA 3MMAB 4Q43A 2BW2A 3I56S 3GE9A 3BKUA 1AT1B 4JI2J 5GAEU 3S1TA 5EQ9A 3GIRA 1RWUA 1B4HA 2G4BA 3KC1A 4LF8F 3K6UA 2PT1A 4LSZB 3FEZA 4I3YA 1NV1A 2MDAA 1R8AA 4RW7A 5CYQB 1RDZA 5EWEA 4ZJOA 1QAYA 3PRDA 3BFUA 4NZ6A 2YKAA 4PE5B 2FJBB 3E8OA 4YDDB 1C1BB 2VQEJ 3DLHA 1N54B 1A7GE 3IR5B 1RLDA 2FD2A 1RDRA 2D41A 1HNVB 2YWGA 3R6GB 3PZPA 5A8KB 2XXWA 2GHVC 1RDYA 2O7UA 3CCLS 3OFHA 4PC9A 5FTIA 4WFNQ 3FD3A 2P3NA 1VISA 1HW9A 4WZQA 3IJXB 2YWFA 3MR3A 1Y4ZB 1YJTA 2XWYA 4DX8H 3S8SA 3BN4A 4ZVRB 4G4PA 3CNQP 5GADI 2H4WB 1TK0A 4IOBA 3BO3A 1T0KA 1CJUB 4GWYA 3QK6A 5ESYA 2E5IA 1GH8A 2AYGA 4GF8A 4RK2A 1Q81T 1H45A 3SXLA 2CNOB 3O6QA 2XLIA 1DQ8A 2HHQA 4P72A 3J81U 3IM8A 3QT7A 4OHYA 4XKRA 3B4DA 4F22A 2X1AA 5J1EB 4IO2A 1H38A 2CJKA 4PQUB 2F35A 3UORA 2VPWB 2XC9A 4XIGQ 1HWKA 3GTYX 3FZ2A 1XMOJ 2Q74A 2ADBA 4FP9A 1MWYA 1UVNA 2YQ3A 2HURA 1HQEA 1KSPA 3JYTA 2DNNA 1B05A 3HJVA 3K5OA 2ZYMA 4I2PA 1X9SA 3E2EA 3R2DJ 2CPIA 3DGPB 1WF1A 5KT5A 1CPZA 4OERA 5K8OA 3OQ2A 1FT8A 5B7DA 3MP8A 4C8MA 4ELQA 2BJEA 4ITSA 4M95A 1S7IA 5FBPA 4JYAJ 3M1VA 1VSOA 1X4DA 3NNHA 4ISUA 3I6VA 4IG0B 1IKYA 3ET6A 1DHMA 1NUXA 5B70A 2LFVA 3VHQA 1LW2B 3D2WA 4KQPA 2ALZA 1LBYA 1B1XA 4THIA 4Z7CA 4WE1B 2VFSA 1HBMB 1N88A 1A8EA 4ED0A 2RKIB 3M30B 5E7OB 1Y1ZA 2FJDB 1OS5A 2JSXA 3A3CA 2FUG9 1XWLA 1P1QA 4TLRA 3U93A 3AT1B 1CC8A 2JFDA 5F8HA 4CLYA 3GV5B 2OPSB 1Z1ZA 5F8LA 5ISUA 4WWSA 4WKRA 3PIOQ 3VV2B 2DNRA 3FXBA 1BE4A 1HNZF 1CJVB 4G1QB 3GYYA 4XKPA 1O63A 2QL9B 1WNEA 4O23A 4L3NA 4JI1F 3WX4A 1K1SA 3IXQA 1BLFA 2ABHA 4CLSA 4CH7A 1TL7B 4JSDA 4WIIA 1N5SA 4NWCA 2GO8A 1JXVA 1LK5A 4PG8A 1W7WA 2CQDA 2CPHA 1UVJA 2ZZMA 2V4QA 2ZHOA 5H9EK 2HZVA 2C2KB 3GIKA 1EP4A 1WDDA 2F6GA 1N5YA 4KXPA 5ICQA 5C2CA 3OVBA 2GMJA 5C42A 2HVEA 3I31A 5ETVA 3T1HF 4RW8B 4EGLA 4B02A 3ILUB 4F4XA 5F3ZA 2RINA 4GVOA 2BANA 1S77D 4MF3A 1H72C 2RHQB 1G6BA 5FD1A 3BBRA 3ZS6A 1A55A 1UP1A 1WELA 4DF4A 3UD5A 1IKXB 1HBUA 3G8QA 1CSJA 3M8PA 3EZOA 1SQGA 3FCVA 4RW9B 1JQFA 3TUZC 5I56B 5GAHI 1URDA 4QOTA 1K9ZA 4R5PA 1S1UA 4YP3A 2DR7A 2NXOA 3G3JA 3G7WA 3MECB 4DV2F 1REVA 3OL7A 2VPOA 1Q79A 3M2UA 1FWPA 2R8TA 5IC4B 2W7PA 1YK9A 3C35A 1SH2A 3BQ2A 3N01A 5HQLA 1VQPS 2ZNZA 4ZK7M 5K2XA 3UN3A 3T6BA 5KG0A 4LF6F 1RTZA 5H9EJ 2RRBA 1O0PA 1VQMS 1SD3A 5LDZA 1S6UA 2GAGC 5I42A 1BQNB 2YNIB 2VKRA 1VK3A 1LBVA 1GMWD 1FWLA 5DDRC 3LGMA 4WP9A 1N6QA 2YNFA 2BKNA 3CJQA 2BOPA 2Y7KA 3MMBB 4PG6A 2C42A 3O9PA 1XNQF 1XNRJ 3TVZA 4X9TA 2UVIA 1P9QC 5FLXU 2H4YB 2BQUA 3MM5A 5F3TA 2JEFA 2XXYA 4Q2LA 2ZZTA 2M8CA 3D4GA 2KDOA 1RA6A 1N5QA 2AKWB 2QVVA 4W92B 1SUQA 4WTYA 1P1NA 4F1YA 1FPDA 5HBCA 1NHUA 3FDSA 4DBQA 4PABA 3VVUA 5CI5A 3GYGA 2IM1A 2DJWA 5I84A 2XGPA 4QWBA 2R71A 4G8MA 5H8NA 2HFNA 3MEEB 1LAFE 5BR8J 3M8QA 4ONYA 2B4PA 3C33A 2DITA 4ZPDA 3KXDA 1A7LA 3W8GA 4DSLA 5CYMB 2CRLA 3RBDA 5LMNF 3L6HA 5LSOA 3W15C 4OHWA 5KG2A 1R9LA 3LP1A 4KYDA 5LMUJ 3HULA 1QE1B 2XNQA 4C98A 2QA2A 1YI2S 1MY3A 1HL6A 2OPPB 3ENWA 1LV5A 2AIRB 5HBMA 3RYDA 2MQNA 3WC2A 3FVNA 3PFOA 2GAHC 4Z2XA 5HPQA 1HBNB 3T9NA 1YJ7A 1KA0A 4C8YA 4UOGA 3CCSS 2K7JA 4QQBA 4KGKA 4DS4A 1U1MA 2AZ3A 3DU5A 1FK9B 5DQHA 2W7OA 3QRPA 1NBEB 5I3UA 4ESWA 5CQGA 3UWTA 3KG2A 4P2SA 2V3UA 5KFGA 5J2MB 4K8RA 3BDPA 2FGOA 2M3DA 2R9JA 1MXVA 4DXUA 2N4DA 4LR8A 2VPYB 2ZHAA 4M5JA 4ZJQA 1TWYA 3D5MA 3RBXA 3W63A 4B9TA 3RRHA 2CFXA 3TEHB 3HVTB 4CT9A 4USUA 4P71A 4O3BA 3LALA 4H0WA 1LEVA 1PJ6A 3G6ES 2DNQA 4CLKA 2JEJA 4LVNP 2HPGA 5EX0A 3NOGA 4WFZA 3DLNA 1QKAA 3TVKA 1HNIB 4N8GA 4X64J 4PF8A 4U4SA 4DUZJ 1Y00A 2HFBA 4I2QB 2MZRA 5KFBA 4JI7F 1QUKA 3FSXA 1XT8A 3AQOA 2YLNA 1KWHA 3VVEA 2DNMA 3OHBA 1K0TA 3IBCB 3I6PA 4ILRA 1T9VA 1HYSA 5IM0B 3OL9A 2XSJA 3FV2A 3QBCA 4DMZA 3KYLA 4OVRA 3OTEA 3PO5A 4C8KA 1OO0B 5I59B 4NE9C 5CD4H 4ECQA 4JWXA 1S1VB 2AD9A 1B4ZA 5I57A 1KN6A 2X1BA 3AH6A 2Q9TA 1KS2A 3BSNA 5K14B 4CO0A 2CQ4A 4BCAA 4PAIA 5KCJB 3O6GA 4R8UA 3RNNA 1MNEA 2Z23A 1OQHA 4TY8B 1NV0A 1JWWA 3R7SB 1NK7A 1BP5A 1RA7A 3MM7B 2DQVA 3TA2A 3TOQA 1CNQA 3H6WA 1XI6A 1B7YB 3MMCA 4DSFA 2HHHF 2Z8EA 3OR1B 3BJYA 1HSEA 4JBZA 3BN7A 4USVA 3VGVA 1LAHE 4JI4F 5LL6d 2FHOB 4FPRA 3W2WA 2DNZA 2AEMA 3AA9A 3QJJA 1B7HA 1TVRA 2GHBA 3NBPA 4YB1P 1SC3B 2PDAA 5HP1B 4GXAA 4LQ9A 3KLIA 4UF4A 4CH0S 2WKYA 3RGIA 2B7BB 1UJ5A 3SDEB 2XSFA 3DM2B 3QAEA 3D0IE 4V19J 2VBYA 4DHVA 1VRTB 1Q7YT 4PXCA 2JJ4D 4HT7A 1VQNS 2R8HA 1KRPA 5B0CA 4DR6F 1LFPA 4O3QA 2V2QA 3KBZA 3KDNA 4DR4F 1S97A 2QSFA 3W1YC 4LFAF 1EB0A 1LBCA 2VKZG 4L73A 1U0HA 3CW2C 3JSMB 1OWXA 4ZVFA 3PNIA 4Y0FA 4NXNF 4NEDA 4ESXA 1T9YA 2C3OA 1RT7B 1HI8A 3OHAA 2COLA 4EXLA 2MQPA 3EWGA 3EGZA 2HXWA 4K2JA 2KXHA 2PMZD 1LW0B 4DPXA 4NCAA 3KDOA 2B6AA 4ED7A 3DFEA 1IZ1A 2Q2AA 3A29A 4FS1A 2E44A 4LQ5A 2BABA 4RPOA 1P99A 3HJFA 4JI0F 4IG3B 4KT0C 2VGQA 4HE2A 2QS1A 4C8LA 4IO6A 2DR6A 1DQAA 2FY1A 1SIZA 1IJFB 2OPQA 4HDGA 1UA1A 4CLUA 3C8YA 4J91A 1LWEA 4EF2A 4HS7A 1KDNA 2CJYB 2XMVA 5KG6A 1Y7PA 2FIEA 2ONKE 1ZA2B 2ANJA 2V4JB 2IJRA 1XQIA 5DS7A 2K7KA 2X7PA 4BDPA 3SMZA 2YNGB 1U2CA 2E9ZA 3OO9A 3TELA 4PYDA 3C9HA 3OENA 5EQ8A 1JJHA 4ANDA 5KFPA 4LZ5A 1RKJA 5DDPC 4URGA 3TPAA 4HTGA 2Z2YB 1YJWS 1QVSA 2UXCJ 1VRQC 1YGYA 4B3TF 2NZ4A 2O67A 2XCAA 2DKOB 4YHHJ 2C22A 1RHRB 1PBAA 3GR1A 4EEYA 1RHJB 5U47A 3VZHA 4NLQA 1B51A 3JS9A 1YBTA 3HSZA 4MK7A 1K9YA 3TKDA 3VTIA 1SQFA 1LQ9A 1NK0A 3PR5B 3ZTQA 1EKRA 4TN2A 3EICA 2XZTB 1OQ6A 2YKMB 4EO6A 1JLEB 4ELTA 2B9XA 3UI3A 1NMEB 1KBRA 3L6GA 2QIFA 5ETOA 3PUVE 3QT6A 3H6VA 2LA6A 2KH9A 3SEOA 2CPDA 3HT0A 4HI1A 2KRRA 2X51A 4F0MA 3V89B 3DI6B 4MH8A 2ATCB 2QS4A 2BM0A 1JNZB 2E9RX 1XIQA 2FYXA 4HTIA 2Y0SD 2HNYA 1S79A 1ZOTA 1PO6A 3V2UC 4L75A 5IOLA 2PCRA 4ILLA 1S0MA 3TRGA 1SV5A 4ECWA 3GMGA 2CEYA 2GRVA 2B5JA 4KIAA 1DSNA 1RAOA 3BH7B 4GO5X 2GFEA 2OLBA 3GBBA 2HNZA 3K00A 5KFMA 1N36J 4F4YA 2QL5B 4OVQA 3JTPA 4M5GA 1DLOB 4I64A 1EQMA 1YWXA 2KT2A 1U1RA 1FEHA 2DXDA 1II5A 2NS1B 3F73A 1S6QB 1FKAF 1KA1A 3Q22A 3TAMA 3PG9A 1AMFA 2GH9A 4DSKA 2A2CA 2W8KA 1X4GA 3GCWP 1CQNA 4IO7A 1FXDA 4P74A 3PM9A 2QLFB 1TV6A 2DD8S 2RJZA 3DLEB 1LWXA 3O28A 2ADCA 1D9DA 1WC4A 2CDRB 1RISA 2MKYA 3H5YA 4EF1A 1F9FA 1ZH5A 3CUNA 4PXEA 3IOVA 5E0OA 1JVYA 4O3AA 1VI7A 4EQBA 3E01A 2FLLA 3T93B 5KFRA 3MUTP 4OJHA 1XR6A 3T1BA 3FBPA 1YSJA 3PUWE 1HQEB 4OIXA 3JYTB 3TEPA 3SKPA 3K6VA 1HD0A 2W25A 4F18A 5FDLB 4I2PB 4DV4J 1AB8A 2JLGA 2EK1A 3VQTA 1CE2A 1P1OA 3BGLA 3DYAA 3KUEA 3S9EA 5KG7A 2FLPA 3WAFA 4WU2A 4B9LA 2CA9A 1ZBTA 1PG5B 3I0RB 1FPBA 3PY8A 3ZTOA 2IRXA 3G8SA 3ET6B 1MWQA 3VVTA 2HWHA 2ZBIA 3MAQA 1IMBA 2WBRA 1R0AA 4QBAA 5AJ3J 5H8HA 2KB2A 3B6TA 3GFYA 1OYDA 3LGHA 4DWIA 3R5BA 3FVGA 4GWOA 1RHMB 5CCMA 4QFOA 4E98A 4PWUA 5LM7E 3MEDA 3CCUS 2WK4A 3FQLA 4N8NA 3ZO7A 4E8UA 2AMCB 3DLKB 2FJVA 3AJDA 3NGRA 9RUBA 4H6DA 3QIPA 2VA3A 4NLUA 3KUGA 4WXOA 1HNWJ 1US4A 3CFXA 4P7VA 4ND9A 4CZCA 4P0GA 2FHMA 3IFAA 3CT9A 4GO7X 4GXSB 1OSDA 1NNFA 4U6PA 2DXYA 2Y8YA 4QFKA 2FA7A 2QJ3A 4LBPA 4DX5A 1US5A 4UY8T 2XY5A 4LFCF 2HFUA 4HE1A 3DP4A 3RT6B 5J2NB 1NH7A 3IO4A 4HHHA 4WU3A 1IWGA 5DT6A 2DXEA 4HCWA 4DR3J 2YH1A 3SESA 5I2NB 3HDSA 3S6EA 1FTJA 2F40A 2OH2A 1EP4B 3A09A 2VPXB 2C3MA 4ETXA 4ZN3A 5I3PA 2BANB 2M2BA 4NG7A 3MFIA 2YWKA 1VC0A 4AB6A 1U0SA 3ULHA 1FA0A 4LF7F 1IBKJ 2DRAA 3BKIB 2XXHA 1VS3A 1M5VC 1HBUB 2VASA 3KBRA 3WX8A 1UW4A 4ZECA 3W5XA 2VQFF 5HJXA 3MYUA 4C0BA 2DNGA 2HEUA 2PI4A 3D68A 1OY6A 1IJEB 3SZPA 4YDXA 4R5PB 1S1UB 2CAJA 5IC6B 4DU7A 2Q88A 4LSLA 2VD3A 4TQSA 4G68A 1KFDA 1RT2B 1B0TA 2K8GA 3M2UB 2B56A 2Y3YA 2DY1A 4DQIA 2DGUA 2FVSA 5KT4A 3MW0A 4J37A 1S12A 3D4JA 5KFZA 4G1PA 5LMUF 5KFUA 4YR0A 2NYHA 3IB0A 2ZZNA 1ACMB 4LQ2A 3A8KA 3VFJA 4H4MA 1S9TA 3M2RB 2ZD1B 2O01C 5D0HA 2Q3PA 1Y3JA 4NLWA 4NLPA 1NPRA 1Y10A 4J9NA 1FJEB 4R9GA 4DDFA 1LBBA 2IVMA 2J0XA 3QAXA 2X3DA 4MKYA 2UUAJ 2I0CA 3QPIA 3MM5B 1N5TA 5HANA 3C66A 2HLUA 4M1KA 1H7XA 1HWIA 5BYSA 2IIHA 1Y5NB 3NGTA 1SUQB 4QSCA 2BX6A 2NYIA 1YLXA 3EGWB 1NNDA 3OFFA 3QO9B 4ZZEA 5CMBA 2XXXA 1PB9A 2WW8A 3DOLB 5H8NB 4ZITA 4LR7A 4AQYF 4RW4A 3GSIA 3HXMA 4XPCA 3ECRA 4LSNA 3W62A 3PACA 3QT5A 2ROPA 1RYRA 4G8HA 2N7CA 2VODA 3R7XA 1RTDA 4Q0CA 1SB6A 1MMLA 1Z7ME 3FBEA 4IO4A 2XMUA 4USIA 1UIVA 2WHOA 4ZP7A 3LP1B 1X8DA 4ZCLA 3CCZA 3THPA 3RUBL 3AD7C 1I94F 1UVLA 3LSWA 1X5OA 3I82A 2R2RA 2OK2A 2KO1A 5LSRA 1T05A 4ID5A 4WEPA 1VK8A 3ICLA 2W4CA 3AXKA 2GIRA 2QLXA 2VU5A 4ZLJA 5JXSA 2NR0A 4O4GA 3HV1A 3LF0A 2HMIA 2M7SA 4PAFA 3KOSA 1YIJS 1CVJA 1NHVA 3FXQA 5JVGQ 4MHFA 1NI9A 2AW0A 3JQKA 3VDFA 4TKTA 4FVMA 2EWHA 3R97A 5GMKa 4A8KA 2HBYB 4ZVHA 3BFTA 1MU2A 3UO0A 1QSLA 3RZAA 4ZE8A 2XA5A 2KKHA 1KD1T 4J9RA 5I3UB 4MK9A 3FUYA 2ZBRA 2IPOB 4OHZA 2IMOA 4NYPA 1SYHA 3H4BA 1ZM4A 2DNOA 4CM0A 3T1YF 4MIAA 3D28A 2MEWA 4RBUA 3BSAA 1U6ZA 1FNMA 4PAAA 4YN3B 4IGTA 2M5YA 1AZSA 1BUXA 1REGX 1MM6A 2DWIA 4UW2A 2QFLA 3OTDA 4GX6A 2MKHA 1M5EA 3R26A 3RLFE 4ECUA 4IDKA 1HBOB 3PJ9A 2GQ2A 4QW9A 3UDVA 1URSA 3MBPA 1NPKA 2KT5A 3MTKA 1B46A 3RGYA 3SEYA 1VJWA 2E9TA 1Y4TA 2HK2A 3PMWA 2HVHA 3W3SA 1PB7A 1YITS 2KYXA 4H4OA 1R8CA 5IWAJ 1VR6A 3KG4A 2QT7A 2XXVA 3LBSA 4OI6A 4WFXA 3CJTA 1B5IA 5AXKA 5ET7A 2CJBA 4EXKA 3PGFA 1H7WA 3ZXWA 2ILZA 2XSJB 2O5DA 5H8QA 3FEXB 4OVTA 1RP5A 3A3PB 5DVIA 2WEFA 3DLLQ 5GVQA 3QWPA 4ECTA 3LQVA 4UUWA 4E0WA 3BQ0A 2VT5A 3PX6A 1BQMB 3BBCA 3C14A 2W01A 4DZ1A 2JVOA 1D3WA 4N17A 4O7IA 5I57B 2PSZA 3OO6A 4DLGA 1LFHA 1TL1A 4NWBA 1SI1A 3IRXA 1QLNA 2E7WA 1B7ZA 3QFHA 4URSA 3CCTA 5B0GA 2A6MA 1JEVA 4ZPBA 4JB8B 2F63A 4I56A 3LO3A 5EX3A 1S9FA 1KOHA 5L46A 5THWA 4USTA 3MMCB 5IQQA 2XMJA 3ILLA 4CO3A 2Z58B 1FJGF 3IWNC 2ASDA 4DSJA 4C1UA 3W2WB 2HFOA 1DY3A 4WTOB 2XG8A 1GVCA 2HEKA 3Q8SB 2DGVA 4OYZA 2DWJA 4QR0A 3FIRA 3EGNA 1IKWA 1VBYA 1TVRB 3GJRB 3NBPB 4I67A 2WB1D 3KLIB 2O84X 3MUVP 2JVRA 2D3O1 1EIYB 2Y7PA 3KJTA 5KG5A 1F6TA 1NAQA 5ITHA 4LF9J 3OVSA 1RTJA 2JDJA 2RMLA 3TCGA 3S7RA 5KFVA 1KQFB 5FHMA 4CDIA 2HAUA 3ZZRA 4OYPA 4KHPJ 4B9VA 4UACA 2P0SA 4YY3J 3RAQA 2G93A 5IM2A 3H25A 2GIFA 2RF2A 1WHYA 1P9YA 2IY5B 1MXUA 3R6UA 3Q23A 4F7VA 4KB7A 2VFRA 4J9OA 1V3ZA 3NMAA 4CO1A 3OL8A 2OLWA 2DVZA 4YHHF 2VG5A 2HGMA 3VLVA 1C1CB 3MC2A 3QFWA 3K59A 3KGCA 1X60A 1D09B 1U7LA 3SCIE 3HHDA 4DFJA 1TU0B 3US5A 5DETA 2B6AB 2VHAA 2CZLA 2IRYA 1RT5A 1GXTA 4PDHA 2R7RA 4KC5A 3MXHP 3CULA 2JFKA 4WPAA 2HZCA 3CO0P 1MSWD 3CCWA 3I9ZA 3M4XA 3MF5A 1VBZA 1XVYA 3IG1A 2V8PA 2K2PA 2Q6CA 3DRPB 2EKNA 3DGVA 5KFFA 2L9NA 2OPQB 3V6HA 2JC0A 5TP9B 1LWEB 5DVJA 1ZS6A 1LBWA 2XGQA 1SKWA 2R8KA 2DE3A 4HEA9 3PJXA 3SSQA 3E9XA 1R7IA 2R3VA 1F9HA 2RQKA 4Y6IA 4AFFA 4PBQA 2ZHBA 2EC2A 1IR2A 1SBRA 4OQJA 3U94A 2FLOA 3ODBA 5A5LA 1PJ7A 1FPFA 4UT4A 3TZZA 4PG4A 1R89A 4O7MA 4ID8A 4RA1A 4GFRA 1TL3A 2YH0A 3FCHA 4RK9A 7FD1A 2B65A 2B4MA 1GMUA 3HZGA 2HGLA 3K7RA 4J9MA 4U21A 3QATA 1TMMA 2C3UA 2E1AA 2EI5A 3R5JB 3B8HA 1VFEA 3OV7A 1IXGA 1RBLA 4DV1J 4F4AA 4OYVA 1A40A 5C25A 4B3RF 2QMXA 1IQTA 1B0VA 2Y5KA 4WKYA 4NX9A 3TODA 5LSLA 3D4CA 4MNIA 3OSPA 1VC5A 3FC9A 3I9V9 4CTAA 2RQCA 1U1KA 3F41A 3BBFA 3ONMA 3J81Y 3D66A 3RPLA 4DXBA 1K47A 2F9JA 4JI3F 2FYIA 4DN9A 4FXVA 2HNYB 3RYLA 3I4PA 2RHSB 3FCWA 4C8NA 3LOUA 3DN9A 4J9SA 3RQTA 1SV5B 1QUPA 4R75A 5L9XA 2M8HA 3FUZA 2D9PA 1EQ0A 1GGGA 4EUOA 1ZM9A 2W2OP 2I3WA 3BGFA 1FPKA 4ZPAA 3W5YA 1FTRA 2F78A 3QLHA 3CVKA 1R0BG 3JYRA 2DOJA 2QZ8A 3MP1A 2CYYA 2RDIA 3GFHA 2WB4A 2I4CA 3PUYE 4ED8A 3EVMA 4KHZE 2G2YA 4R2BA 2C2DA 2CZ9A 1DAXA 3KJFB 4BS2A 4O3PA 4Q8RA 4X4VA 3OR2B 3BGRB 3TAMB 3EN3A 4LZ7A 2QPQA 1UJ4A 4OYMA 3ZZOA 2LVWA 4ZPWR 4CWBA 1C0UA 1ELOA 1HMVA 1V5IB 2RKMA 2FVZA 4NX1A 3MAAA 3A1YG 5IZ1A 4RKUC 1TV6B 3IR7B 5IV4A 2IM0A 1VQYA 3TUPA 5LXRA 1Y3KA 1FPLA 3CJ2A 1H76A 3FQKA 4P75A 3H98A 2VBXA 2CQBA 2UV8G 2NREA 6AT1B 3CSBA 3F56A 4M63A 5J2QA 4C0HA 1HNWF 2H5YA 3PHEA 1X31C 1VBKA 1VRUA 3MPDA 2QE5A 1ZTTA 1T7PA 2U2FA 2IC3B 1NU4A 5A5XA 1NSQA 3P8BB 5EHMA 1RWVB 4NYOA 1FRMA 2H98A 4K4SA 3GV8B 2F3JA 3DYAB 1N32F 4DR2J 4WKMA 1FRHA 4OVPA 3LR1A 1KZ8A 4MEVA 3CFZA 2EC0A 5IS2A 4DR3F 3Q26A 4FE8A 3OEMA 5F0WA 1EZZB 1Y4CA 3BR8A 1QW0A 3KN3A 1A9NB 4U7UD 3K6WA 3TJ9A 2BW7A 4QFLA 1FRLA 4TLMB 1R0AB 1U47A 3PUXE 3H20A 1SL0A 3KSXA 1FQFA 2FNCA 2JEIA 3ZC4A 2IHR1 4USKA 2ZC3A 4FVCA 3W9JA 4ED6A 3OLBA 2F4VJ 1YTYA 4N6DA 2DK2A 3UN2A 3N6MA 4NE4A 3MEDB 1NLKL 2E5LJ 5J1DA 4P10A 4YKPA 1PDAA 1ZZFA 4N8YA 1WSRA 5GMDA 4USHA 5D0GA 3QIPB 3Q2SC 3I4HX 3GILA 1UQWA 2OGUA 4DX6A 4OFLA 4Y00A 4IB2A 4OI4A 3PEJA 1M5PC 3NGSA 4DS5A 2PN6A 3V8XB 2L41A 4NI2A 2VG7A 2H65B 1ZA1B 3Q8QB 3D54A 3I0SA 1WC5A 4KHMA 1MMNA 1OLAA 2ZM6F 1I6BA 3Q86A 2CQPA 1MLAA 3RT8A 1G4CA 4IH5A 4ICLA 3JB9k 4JVCA 4XKQA 3G6YA 2BVZA 1TAQA 3G86A 4KBIA 3CFLA 2DHGA 4NLXA 1KR4A 2NCKL 2QLBB 3SCJE 3M6WA 4EWTA 4ELUA 2V6AA 2XLKA 4WXWA 3T5LA 1KNZA 3ELHA 3G3FA 3KMQA 1N34J 2NPFA 5LJ3Y 2Y84A 2YQ0A 5FLXY 4O0IA 2E5GA 3RBZA 1MXZA 5EHHA 2UUAF 1X5TA 4C0OC 2RD5C 4N15A 1NUEA 2BMBA 1BWEA 1CB6A 5HQ8A 3MP6A 4Y2MA 1PAUB 3EDRB 3K5MA 2HWTA 1WORA 4EYIB 1H98A 3H5UA 1A8FA 4Y2KA 3H2UB 2IA4A 3B4MA 4WJBA 2HHUA 2KVIA 4GRSA 4N56A 3CXCR 5D4PA 4DR7J 1XVXA 2J9DE 2IYIA 4DUYJ 3MEGB 1ZLQA 4OMFG 1XMQJ 3TW0A 3CRBA 3EF7A 1UA0A 2R7VA 2JJKA 1TT1A 1Z4UA 4QR2A 1OPZA 4M5DA 4RW6A 3UVJA 5I4MA 1EJ7L 3EVOA 2DH8A 4XTCQ 2VC1A 1JW1A 3ZTRA 2HFZA 3ILJA 3OFEA 5DG9A 1FQAA 2DS9A 2OIHA 1GK8A 1Y3NA 5IQ6A 2B3BA 3ENQA 4I6AA 4X65J 2K3IA 3LWMA 1RADB 1SIWB 2JRSA 2MKZA 3KJVA 2OFHX 4OX7A 1APSA 4E0XA 3K5LA 3BV8A 3FGVA 2RC7A 1SQYA 5AA4A 1FKPA 1KONA 5IT0A 3NG8A 2BACA 3WBZA 4NQ8A 1RAFB 3HLUA 3QNWB 1GMVA 1RWMB 1KLNA 4LRAA 1Y20A 3PW7A 3GU0A 1JKHA 3UR3C 4DI3D 2HAFA 3IA0A 3L4BC 3WIUA 4QXDA 4FN5A 3TCHA 1B0HA 2FC9A 4FYVB 1SBPA 2XEXA 3MUMP 3GFZA 2UP1A 3KK2A 2HPUA 2OMLA 5G0RA 1M5DA 2DH7A 2GHPA 1H44A 1IXKA 3TO8A 2XXQA 2KXFA 1RTDB 2MY8A 2I48A 2ZMBA 3H03A 2MQQA 4F02A 1S1TB 4HHUA 4LIRA 2IA6A 1KC8T 1XMBA 1VCTA 1U8WA 2IBKA 2M8DB 1YVFA 2AEJA 4IH7A 5EWFA 4F3QA 1T05B 4ID5B 2IRUA 2RRNA 2DNYA 2QN6B 2OWSA 4FDFA 4WP8A 5B0AA 5IWAF 2HHTA 1WTBA 3FRZA 3KN8A 4NF0A 1C0TB 1IIWA 2HMIB 4X4SA 4MFBB 1D1UA 4NA2A 3L95X 2DE2A 1GNKA 4DSIA 3RR7A 1MQIA 1RSCA 2HS0A 1R9QA 4NAPA 1L5TA 2D9OA 1ZKBA 4H5FA 3JQMA 1YQHA 3WDOA 1FESA 3T9VA 4GWZA 4IY5A 3AD9C 3FVYA 1XR7A 3PYEA 2ZH7A 4RU2A 4ELPA 4J9UE 4FBTA 1R43A 3MPWA 2H3EB 2VJVA 4PGPA 3QAUA 2HNDA 1OPIA 2KHCA 2QLJB 4BC7A 2DR8A 3PD9A 3V6DA 3DRSA 4QFNA 2BKPA 1AZSB 1PC4A 4NLRA 4C11B 3MM6A 1TKZA 4YB7A 4ZLPA 5JUMA 2DHXA 5FJ4A 3TZWA 1BK4A 4IDKB 5H8FA 3UD3P 3MFHA 3U1NA 5I7IA 4P73A 1TFYA 3AXFA 1ZETA 2E7VA 3AFGA 4HL9A 3CJKA 4MLVA 5KG3A 2XMKA 2QRYA 2B4VA 2OHDA 5ETMA 3MZ9A 3MM8B 4H4OB 1UTHB 1NSPA 2WAQD 4LFBF 4ZVPB 1FVSA 1A6LA 2OP5A 2HQGA 2UU9F 4R6YA 1FPEA 5L9SA 4PG5A 4FKXA 1QTMA 2OEJA 2UVUA 1X9MA 1AIVA 1NB7A 2GFFA 4LF9F 5FHNA 1SC6A 1MROA 2CZKA 1P1UA 4KHPF 4JV2A 4PQJA 2X26A 1N4LA 4YY3F 1UJ6A 1R27B 2ZJQQ 4ECFA 1I6QA 1JLQA 1ZAVA 8AT1B 3IR1A 4AE5A 4U96A 1JXEA 2WX9A 4CCHA 3HVAA 4MYTA 3TARA 3K8WA 3LTOA 1HHSA 4C9DA 2V2VA 3CI8A 3P5BP 2ACYA 3QRQA 3KUHA 4DXLA 2FJEB 3IRXB 5D4NA 4GKKJ 1Y9UA 2PMWA 2A10A 4ZPCA 1LGBC 2NWJA 3GWCA 4DSEA 2A0FB 3AHPA 1WOSA 3BZQA 3M6XA 1U09A 1X0FA 1IQ7A 4GWWA 2I4BA 2DGOA 3EXYA 1N0VC 4HXVA 5TPAA 3NXZA 4PFWA 1IEJA 1Q78A 3MQ9A 4ED3A 1IN0A 4M5KA 3R5DA 4PCQA 3HK2A 3H8YA 5DQGA 4K4XA 1R8BA 1SCJB 3KMSA 1VHIA 2Z22A 3DLJA 1WEYA 2MZJA 1B1HA 2QO3A 2JC1A 2OUGA 1XJWB 1FQBA 1NL5A 2DH9A 1KHWA 2YTCA 4P7TA 3QGPA 2DPJA 2XS2A 3MGJA 1VQ6S 1BQXA 2E0SA 4MFIA 4X48A 2XS5A 2ABYA 2FVQA 4KGVB 2V8GA 4EUVA 3R5AA 5DLFA 3MI7X 1RGVA 3AA8A 2I9SA 2VIHA 2QTWA 3PPPA 2OO4A 2YX7A 3CDUA 4DV3J