2QMXA

The crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
278
structure length
278
Chain Sequence
NWLIAYQGEPGAYSEIAALRFGEPLPCESFDDVFSAVTEQKADYAVIPIENSLGGSIHQNYDLLLRRPVVILAETFVKVEHCLLGLPGASVETATKAMSHPQALVQCHNFFATHPQIRAEAAYDTAGSAKMVAESRDKSALAIASKRAGELYGLDILKENLADEEWNITRFFCIAHENNPDISHLKVRPDVARQKTSIVFALPNEQGSLFRALATFALRGIDLTKIESRPSRKKAFEYLFYADFIGHREDQNVHNALENLREFATMVKVLGSYGVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of open (R) and close (T) states of prephenate dehydratase (PDT) - implication of allosteric regulation by L-phenylalanine.
pubmed doi rcsb
source organism Chlorobium tepidum tls
molecule tags Ligase
molecule keywords Prephenate dehydratase
total genus 85
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qmxA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmxA02
1CB6A 3T66A 1S7YA 1SDXA 4FE8A 2JHEA 5DTBA 5M2VA 3UK4A 3W15C 3ZS6A 4EQ7A 3MZBA 2XHDA 2DOJA 1AMFA 1IIWA 4OTEA 3MAHA 4EQBA 1QKAA 1RKMA 1RYXA 2I9SA 3SEUA 1SI0A 4QSCA 3MAMA 3PMVA 5I2NA 3KEIA 2J0WA 3B6QA 1POY1 1LLSA 4XIGQ 2DE4A 1UTHB 1JW1A 2VHAA 3PPNA 3RY3A 3H4ZA 4FAJA 1YGYA 1LAGE 4NMLA 1I69A 1T0KA 4X48A 1S50A 3N26A 3C4MA 3QK6A 3MZ1A 4DIGA 3IO6A 3PGFA 4C0RA 1JW4A 3N6UA 2F1FA 1WVJA 4YU0A 3TAJA 4FECA 1LGBC 1M0SA 5HBCA 5IAIA 3EQ1A 3TEPA 1B46A 3E9XA 4RA1A 2DWIA 2RC7A 3O6IA 3KZGA 3EHTA 4GO7X 2AIXA 3K4UA 3IXQA 4G68C 2O7IA 3ZKKA 1AIVA 1KWHA 3O6GA 3Q29A 1JW5A 3G3GA 4GFRA 1QW0A 2E0SA 4F1YA 2XXPA 2ZNUA 3FJMA 4KPTA 5A5XA 3RN8A 2XXYA 3I3VA 5ICQA 3VFJA 4C1TA 2UVIA 1MH4A 3PD9A 2P0SA 5FHNA 4GWOA 4U1ZA 1MQHA 4F18A 3IK6B 2A5TA 2H5YA 5JTYA 5CMKA 1IXGA 5L9MA 2Y7PA 5HPQA 4JWYA 3CR9A 2F6PA 3OO6A 5TPAB 1OIBA 4KD5A 3PPPA 1O64A 1WODA 2NYIA 3F11A 1H44A 1B5HA 4UACA 2DVCA 4AB6A 4U2RA 4OQOA 4YKJA 3LBSA 3TCHA 4KYSA 1MQDA 2Q8JA 1USYH 4ZEIA 3V89B 1B1XA 1SBPA 2QS4A 4ZDMA 2F7CA 3IL1B 4F31B 4NF5A 2XXVA 3GLBA 3MP6A 2PVUA 2PMSA 1LAHE 2QL3A 5H8QA 3MTJA 3FXRA 5I59A 4NF6B 3TUIC 4F1UA 1N84A 3MVXA 1R1NA 3RUMA 4LUBA 4NWDA 4XTCQ 1P1NA 3HSTA 3OFHA 2DXRA 4OEUA 3MPKA 4H0WA 2OLBA 1AH5A 3DM0A 1MY3A 3RTWB 4BDMA 4NF4A 1TT1A 3PU5A 2I6EA 3O2AA 4OWDA 1OVBA 2I0BA 2F78A 4Q5TA 4P11A 3PPRA 4DLDA 2RCBA 4AQ4A 2V84A 1FTLA 3DP4A 3FJGA 3UP9A 1DMBA 2VOZA 3L6GA 4N13A 5I56B 1BKAA 4RXLA 2V3UA 1B7HA 3QAXA 1I6AA 1LAXA 2XXXA 2F7BA 4N6PA 1M5FA 1M5CA 3H03A 1TFAA 1WDNA 1TFDA 2Q89A 4E0WA 3PPOA 4GRKA 1HSLA 3RTFB 3VE1B 5FHMA 4ND9A 4KI0E 2DWAA 1URGA 4OHNA 3VV5A 1TWYA 3G3KA 3U7JA 3O66A 5I57B 3THIA 1ZBMA 1GTKA 1LK5A 4RPNA 1XOCA 4LQ5A 4ESXA 1PDAA 2FGCA 4U4SA 2H9ZA 2CZLA 1VFEA 2ALUA 4F3SA 3IB0A 1QUKA 4OFLA 4XXUA 4GL8A 2F8DA 3D4CA 3FJ7A 3PUZE 2XX9A 4EXLA 4KR5A 3MPLA 1B5IA 1GR2A 4JSOA 3A09A 5AA2A 5H8NB 4HCWA 1B05A 4KCDA 1FQAA 1ZKBA 1QKBA 1Y3QA 1N76A 4XKQA 1SW1A 3TPAA 5CMCA 1IEJA 1SW2A 4LVQA 2ABHA 2ONRA 4LZ8A 1B3FA 4NF6A 2XXQA 3CFLA 1DOTA 4RY1A 3TTRA 5L8DA 2B3BA 5AA2B 5H8NA 3N5LA 1FQBA 3FUZA 1UTBA 1ZTYA 1N7XA 1EU8A 1A8EA 1UIVA 1SQYA 3OMBA 2DSFA 3PUVE 5EHSA 1I6QA 2A5TB 2Q88A 4P0IA 4C1UA 1DTZA 4YAHX 2FYIA 1XVXA 1MXYA 1PB7A 4O3BA 3PV0E 4F19A 2QJEA 2PX1A 3EF7A 3CSBA 1FW0A 2XXRA 2PT1A 1B3HA 2H99A 4H6DA 3SDFA 3C33A 5BWJA 2O84X 4R2FA 3SEWA 4FJPA 3OOAA 2REGA 2O1MA 5CMMA 2DE3A 2F36A 2RC8A 3OEMA 4N07A 3QYTA 1XC1A 5DT6A 4RK9A 4HTGA 1AOVA 5AA3A 3KOSA 4X1DA 3W7BA 2GFEA 1MPBA 4IO5A 2I49A 4PFTA 1Z7ME 3OENA 3DHWC 4JBZA 4NF5B 2OBGA 4GD5A 3V5AA 1D4NA 1BP5A 1N3WA 5FTHA 1IITA 2NXOA 3G3JA 1ZPVA 3UGWA 3ZSFA 2UVHA 4NF8B 1A54A 3FD3A 3N94A 1EZOA 1US4A 3EHSA 3OBIA 1H76A 4MFIA 1YTVA 5F1QA 3LSLA 3FVOA 1B0HA 1JEUA 2I48A 3T9HB 4R6HA 1NMUA 1LK7A 1B3LA 4GVOA 3DELB 5FIIA 1Q1KA 1U8SA 3K0VA 1SD3A 4O3CA 3A3CA 3R7XA 2NVUB 3AB4B 4BDLA 5L9SA 2QSXA 1JQFA 2D21A 1EZ9A 4Z7EA 5ICTA 4DZ1A 5I58B 2Z8EA 1FQDA 4NMYA 5I59B 4P0GA 1MDP1 4F3BA 3PD8A 3HHFA 3T22A 2D5WA 4YB6A 2ANJA 2Y7WA 4FEBA 3IOUA 1PBPA 2W7YA 5KZTA 1MXVA 1XT8A 1MH3A 5L9OA 2V93A 1FQCA 3PUXE 2IA4A 3S9NC 2PBWA 3DP6A 3WAFA 2Z8FA 1LB8A 3FZVA 1URDA 4I8CA 1VSOA 2XX8A 1Y1MA 4F22A 1US5A 4FEDA 4GXSB 4LP2B 1MM7A 4ZEDA 4G8HA 5JTYB 1LBBA 3K1NA 5EYFA 1DPEA 4ZE8A 1GV8A 1II5A 3SETA 3IB2A 2HQ0A 3A3UA 3FVGA 4YKPA 3OO8A 5I2NB 4UA8A 3VVEA 1QUJA 2JOQA 1OLAA 4IO4A 1B4HA 3IOVA 1MQGA 3O9PA 3LOUA 3CI8A 1MQJA 4Q8RA 1H43A 4X84A 3IBWA 3USDA 3H6TA 3ILUB 3K6WA 4QRZA 4WKMA 5ISUA 2GHBA 1FQFA 3TMGA 2J0XA 4ECFA 3ECRA 3CIJA 3T93B 1J1NA 5DVJA 4DCXA 1B7ZA 3U94A 1B52A 5H8FA 2LVWA 4MF3A 5I2KA 2ZYKA 3K00A 3S4UA 4YMBA 4OZ9A 4KYEA 3CVGA 3BBRA 4Q30B 1NNKA 2Q2CA 4GMKA 1RYOA 1UTHA 2VGQA 3MP8A 1IQ7A 3MQ9A 4IGTA 2AYSA 1IZ1A 4H5FA 5LOMA 1BIYA 2GH9A 1MY0A 3MWBA 2NOOA 4OESA 5TPAA 3FV1A 5KDTA 4KFQA 3B6WA 3DLNA 5DVFA 1GVCA 5JJBA 2REJA 1UQWA 4KCCA 3G3IA 3H6WA 4F3GA 3RPWA 1A40A 4KHZE 1B1HA 3IB1A 3C9HA 3S9MC 3H6VA 3CG1A 4F39A 4EF2A 4LZ5A 1O7TA 3B6TA 3S2VA 5I84A 2I4BA 3G3HA 2UYFA 2XD2A 1USYE 2QRYA 1ZIUA 1B58A 4H1XA 2HXWA 5DEXB 4H65A 4U1OA 4PETA 1EH3A 3AXFA 1ZU0A 3C31A 4WXJA 3UN6A 1LAFE 2ONSA 3FVKA 3T96B 4U4XA 1FTMA 2ZYMA 2BJJX 5ITOA 3GXAA 3TTNA 4G4PA 3C36A 2ZHOA 1A99A 4ZEBA 4EF1A 1ZJLA 3RT6B 5CC2A 4JB7A 3UW1A 3TUJC 1JVYA 4QF9A 2VD2A 1IXIA 2QS3A 2G93A 4ZS9A 2PT2A 4LATA 2DWJA 4NTLA 5H8FB 5TU0A 4NF8A 2QRRA 5I2KB 1MY2A 1Y3NA 5ELVA 1P1UA 3L7OA 3MVZA 4PFYA 3R6UA 3Q26A 3SKPA 3HCQA 2QS1A 1A8FA 4IO2A 3K1MA 3LSXA 2OK2A 3FIRA 4MLQA 4YZZA 3FGSA 5AE4A 2F35A 4RK2A 4OFOA 2OCUA 3P7IA 5KDTB 1OMPA 3DC2A 3O97A 5FHOA 4I62A 1Z7NE 5A5XB 1MRPA 1R9LA 3K01A 3LUYA 1Y3PA 5FTIA 1R6ZA 2OZZA 3W9WA 4GOTA 4U23A 3LC8A 4Z0IA 3WAEA 3LSFB 4TLLB 2Z22A 4FATA 2X7QA 1QJMA 2XX7A 1LCTA 5DEXA 3TYHA 2VP1A 1PB9A 1NNFA 3E13X 1L5TA 2DVZA 2O7UA 4H67A 1IXHA 2OJTA 4DXBA 1B5JA 1MXUA 1MM6A 3OD7A 3OEKA 2P9GA 4ZEKA 1NNPA 3KJ7A 2AL4A 4K3FA 2F8MA 3O29A 1Y1ZA 5I56A 1M5BA 1Q35A 2Y7KA 2DE2A 2F5XA 1ANFA 1GGGA 2I4CA 3ENVA 2HCAA 3M3LA 2F6GA 1NH8A 3KSJA 4HS7A 1HSEA 3KFMA 3MP1A 3MC2A 3FV2A 3K5PA 4IGRA 4PQJA 1QULA 3KBRA 3ENQA 4X1BA 1NFTA 3D4GA 2PC6A 2UYEA 4R6KA 2DT9A 5TP9B 2ZYOA 3PPQA 1M5EA 3H6UA 3TELA 3S9LC 4KQPA 5CBRA 4R9GA 5J1DA 1MPCA 4EDPA 2PYYA 2LQJA 3M8UA 2P9CA 1MXXA 3KWMA 2H9BA 1PC3A 3OO9A 3RNNA 3VLUA 1QVSA 3MBPA 4JXIA 4LZ7A 5IS2A 1BTJA 1URSA 1JNFA 4U21A 4ELOA 4R73A 4POXA 4R6YA 3LSWA 3TTMA 3TKDA 3H7MA 3U1OA 2I3WA 3TQLA 3QUFA 4R74A 3PUYE 2Q9TA 3IAZA 3IO4A 1HSJA 2Y7IA 2ZNSA 3BKIB 3RT8A 3TTLA 4PFUA 2DXYA 4QSDA 2H98A 2WKYA 3KOTA 4IO7A 1Y20A 3S1TA 3QUJA 4XKPA 3MZ9A 2KO1A 1ATGA 3HHEA 2YLNA 1A7LA 2X26A 3QXMA 4JSDA 1IXCA 2PA3A 4YKIA 4G68B 4QHQA 2ESNA 1N0TA 1DSNA 3KN3A 1MG1A 3TODA 4ELPA 4THIA 1YPNA 3TQWA 1B3EA 3K6XA 1PEBA 1PSDA 1OQHA 3LR1A 4LONB 3VVFA 2R9JA 3U93A 3ENWA 1D9YA 1XS5A 4GL0A 2ZNTA 2QMWA 5CMBA 4OVJA 4KYDA 4POWA 1P99A 2UXAA 4IO3A 3VXBA 1PBQA 4F29A 1N7WA 1LBCA 4YKKA 1CE2A 5B70A 1SI1A 2NUVA 4IY5A 3H06B 1FQEA 2DTJA 3IOWA 1B40A 4F1VA 1KS2A 4GQOA 1VFDA 5KCJB 2I3VA 1O8BA 2Y84A 3GBAA 1OQGA 3H3GA 3KSXA 3EPEA 5IT0A 3OFGA 2D3IA 2HZKA 2XD3A 2ZMBA 5JEIA 2O69A 2XXWA 4G8NA 3MVWA 4ELQA 4F2OA 3VLWA 1SYHA 1MY4A 2NWJA 3KJTA 2RE1A 4DE8A 4EUOA 5K2XA 1P1WA 4RNSA 5H8QB 2XXHA 4QFPA 5CRYA 2QSWA 4WEDA 3U8QA 3ODBA 2I58A 4H5GA 2ZXTA 4MBPA 2OWSA 3U92A 2I0CA 5F7VA 3R26A 3UA8A 2P1SA 4E0XA 4M8LA 5JK4A 2E1SA 4M4GA 4OYVA 3L6HA 2O51A 2V3QA 3VDFA 2R6GE 4EXKA 1O63A 1B0LA 2V25A 3SERA 4QFLA 1IUDA 3E3KA 5AA2D 2H25A 3O1LA 4G68A 5CBSA 2RCAA 4X9TA 1UJ6A 4PFWA 1AL3A 5HM4B 1MDQA 3PMWA 1D9VA 3VLVA 2XXUA 1OLCA 1B7UA 4WEPA 4GO5X 2ZYNA 4OERA 4BLAA 3IJXB 1YCJA 1DPPA 3IORA 3I5OA 4IO6A 3HV1A 2G29A 1A55A 1R9QA 3TFLA 1H3DA 2RQMA 4OENA 3HN0A 4IB2A 5DVIA 1ZLQA 4QFKA 4NE4A 4ONYA 4H8JA 1B4ZA 3AB2B 3PUWE 3EHUA 3OELA 2IEEA 5AA4A 2O1LA 3T9UA 4FORA 1NL5A 1LCFA 4MH5A 4RYAA 1TXFA 3K2DA 4MLVA 3QIMA 4R72A 1FCKA 4RJZA 4XKRA 3M3FA 3FXQA 3TZAA 3OFEA 1UJ4A 3KN8A 3Q25A 2R71A 1BLFA 4BDOA 2HZLA 3KG2A 3IOTA 4FIMA 1XVYA 5AA4B 4L17A 3O6HA 3HO7A 2MDAA 4JWXA 3S9EA 1D3KA 1H45A 5TP9A 2QS2A 3G3FA 4H8IA 1Y4CA 3GZGA 2ONKE 2V3TA 4AB5A 3JV9A 3QSLA 2HEUA 3FASA 3K1PA 1B2HA 3CFXA 4YMAA 4GXAA 1SYIA 3TTKA 1B32A 4GIZA 1B51A 2XXTA 3K6VA 2UVGA 3C35A 5IKBA 2CDQA 5EHMA 3TCFA 3MUQA 1JEVA 2LAOA 1POTA 2DS9A 4ZZEA 2P9EA 3FATA 1LFHA 4R9FA 3OSQA 4BDNA 1M5DA 3U72A 2AL5A 3AAWB 2A5SA 4ISUA 2VD3A 1P1OA 3GBBA 3OFFA 4R2BA 2YPNA 2RC9A 3B7DA 4BDQA 3RQTA 4NF4B 3V83A 3TUZC 2XXIA 3TCGA 1OVTA 5KCJA 1UIUA 5CM6A 3CEDA 2RINA 1MXZA 3T9VA 2P2AA 2B3FA 4F2QA 1XTZA 1JETA 2FNCA 2CMOA 3G7WA 2THIA 2Z23A 3Q28A 1SW4A 2B65A 3DP8A 1B9JA 1PB8A 5CI5A 4O3AA 4I1DA 1F9BA 3JZJA 5DYHA 4HCYA 4RPOA 3HPIA 1I6BA 1MPDA 4GF8A 4TOZA 4IO1A 3P96A 2UVJA 1YAEA 1LSTA 1NKXA 3OXNA 4ZE9A 3K02A 3SESA 5B7DA 4OEVA 5AA1A 1MXWA 2KLFA 1FTJA 1LKZA 1S9TA 2RKMA 3CFZA 4U22A 3JYRA 1YBAA 2F97A 1NNTA 5K2YA 4G77A 5ITPA 3SEVA 3DHXA 4OMBA 3OSRA 4PE5B 1QUIA 4F3PA 3PMXA 4QFOA 4DDDA 1FTOA 1JVXA 1Y4TA 3E4RA 3RLFE 5I57A 1MQIA 3HHGA 3TDJA 3IX1A 1XHYA 1ELJA 4QFNA 4TLMB 4HW8A 2GHAA 1SC6A 3OO7A 4OFJA 2F34A 2O6AA 1MY1A 2HAUA 1VE4A 2M8CA 3VVDA 3EN3A 4ZECA 2HAVA 3IJOB 4YB7A 2GRVA 4GLIA 1Y9UA 2H4IA 4BDRA 3RGYA 3ONMA 1N3XA 3TUSA 4I9DA 4DXUA 1N04A 2DWHA 5BUUA 1LFIA 3UIFA 1EZPA 4DCYA 4NWCA 3BFTA 1NH7A 4G8MA 3MJNA 3ZKLA 4TQUQ 3UORA 1LFGA 2QPQA 1SVXB 4OXVA 4XKNA 1UTBB 3KN7A 4Q0CA 2Z8DA 3I6VA 3KGCA 4PWUA 1UJ5A 1ZMGA 5H8HA 1MS7A 3IR1A 4DXCA 2RF1A 3O28A 1SW5A 2X7PA 2O68A 4R75A 2HFBA 5H8SA 4G2ZA 3C32A 1LB9A 2Q2AA 4ZEFA 3Q27A 2OWTA 4ESWA 2Y7RA 4LQ2A 3SEXA 2YJPA 5IT4A 1FTKA 3VXCA 4M1VA 2DP8A 1DTGA 4ELRA 5H8HB 3CG3A 1Y7PA 5I58A 3BFUA 4ZZAA 5T41A 2QMXA 2RQKA 3MW0A 3N6TA 3T9XB 2F7AA 4LA9A 1P1QA 3CRBA 4EQ9A 1RWUA 3K6UA 3N0VA 4JDFA 2DQVA 3CSGA 2DYXA 3NRBA 4QSEA 3ILTB 4NEDA 3FXUA 3M3KA 1B3GA 3W9VA 3V8XB 4OETA 2FA7A 3SEYA 4IY6A 4JWOA 3MVYA 1VR5A 4YICA 3DDNA 4PP0A 1B6HA 4YB5A 3FVNA 3C34A
chains in the Genus database with same CATH superfamily
2WOMB 1RA6A 3DOMA 2JHEA 5DTBA 3UK4A 4NA1A 4Y0FA 5E3QA 3H8YA 3D0HE 5KOXA 4GX4A 2XHDA 3EJMA 4DV2J 1AMFA 5F9NA 3GZ7A 1IIWA 4U67Q 2IDLA 4O4GA 3UVJB 3OPKA 2YWEA 1RKMA 4KGVB 1HA1A 2PA8D 5K9FA 2XS7A 3FZBA 3EUNA 2HHUA 1N36F 2LECA 3CC4S 3MAMA 2HNZB 4ANDA 3KEIA 1SJ3P 2DIVA 4Z7YA 2VOPA 1CC8A 4C8ZA 1O0PA 2DE4A 4RW8B 1YBTA 1IM4A 4HKQA 4CM2A 4DI4B 2BBEA 2E5HA 3H4ZA 1LFWA 3BSCA 3GYXB 1T0KA 3T6JA 4X48A 1S50A 2DY9A 3N26A 4RNNA 3IO6A 3PGFA 4P2FA 2AP6A 3EZOA 4ILRA 3ZZPA 3N6UA 2F1FA 4NZ6A 4CLFA 3KLIA 5L39A 2J8AA 1GAOA 2E9ZA 3P5TL 1RTHA 1B46A 3Q23A 1PO6A 1IBKF 2HRUA 2JJ4D 2FGOA 1TVRB 2CXEA 4G68C 2ADCA 4W4MA 2R7WA 3IWXA 2XYHB 4GFRA 3HMJG 1BWVA 2RB7A 4YS2A 5CHCB 1KQGB 2HFNA 1DQ9A 1S1VB 4RUBA 4DR6J 2XXYA 4IG0A 1RCOB 4WFZA 3PD9A 1UA0A 3M6WA 3TYTA 2A5TA 3DLLQ 2HHSA 5CMKA 4Y65A 4QQBA 3MMAA 1NRKA 2V4JB 2DHGA 2Y7PA 2GAGC 4RJVA 1JK9B 4A8YA 1EQ0A 3OTBA 1S1VA 2B3TB 5A8KB 4KV8B 4O3SA 3KK3A 3Q2SC 1H44A 4MCOA 2Z2MA 1DTTA 4YKJA 1T0TV 3H4BA 2Q8JA 1JX4A 2Q8MA 2V8VA 1USYH 4BWMA 4DXLA 4JI6F 3N79A 2QS4A 4ZDMA 2ZH8A 3IL1B 4PR6A 4F31B 1SJ1A 4UY8T 5G0RB 4EBEA 2BE2A 2HW3A 5H8QA 1FDAA 3QRQA 3MTJA 1VJQA 4H4OB 3RW6A 4HHHA 5J2PB 4RW6A 3MVXA 3OVSA 3RUMA 3Q8YA 4NWDA 2C2NA 5A8RB 3HSTA 1RWOB 3RTWB 4DR4J 1C0UA 1NV7A 3PM9A 1TT1A 3PU5A 3EKIA 3OLAA 3O2AA 5ETKA 2I5JA 4F3QA 2I0BA 1V3RA 4Q5TA 2WONB 3UWTA 2MLYA 3VAMA 5D77A 2QN6B 3PPRA 4DLDA 1KA0A 2B4LA 4GVBB 3QJLA 2RCBA 1YVFA 4DX6A 5J2PA 4ZCIA 1IVZA 4AQ4A 4KTQA 2V84A 3DP4A 2OKQA 5FDLA 4ZPAA 4P3LA 1WC1A 4IKAA 1UPPA 2O5DA 3L6GA 2GS8A 3R97A 2CJXB 4DR6F 2R7TA 1MN7A 5A76A 4OVRA 3LP2A 2KTQA 1S76D 4TXSA 4PYAA 3ZZZA 2MKYA 2ZH4A 3FBEA 1N52B 2UVUA 3MM8B 1TFDA 2HQIA 2IVMA 4KXPA 1GQEA 3RTFB 2BJ9A 3RAXA 4TYAA 1RTZA 4HTIA 2WW4A 2QE5A 2FPHX 4MIAA 4NLWA 1SBRA 4ZVHA 3G3KA 4CCHA 3U7JA 2ILZA 4K50A 2V5HG 1ZBMA 1RB0A 2B4PA 4A8FA 4PG8A 4I3EA 2QA1A 1XOCA 4ED4A 3JSRA 4ESXA 1PDAA 4OL8A 1BQNB 1WORA 9ATCB 3F0NA 2CZLA 1VFEA 2ALUA 4LF4J 3HHLA 3VWSA 5CYQB 3HJFA 3B6BA 3IBFB 1S9EB 4ZCKA 2F8DA 3PUZE 3PRBA 4EXLA 3MPLA 3KK2A 2WYPA 2DGXA 1R8PA 3A09A 5H8NB 3R6GB 1YKWA 1B05A 5HVHA 3F73A 2DGSA 3MPVA 1FQAA 1QKBA 3QT8A 4LF7J 2W2PP 1Y3QA 1N76A 4ZCLA 1FPBA 2IA0A 4GRSA 5LXRA 3MECA 4LVQA 2J9CA 2ABHA 1HLWA 4LZ8A 1S57A 2IJRA 3BN4A 5SZTA 4I68A 3GR1A 4I2PB 2LKZA 4RY1A 5L8DA 3CJTA 2XBPA 2DD8S 4J9NA 2A3JA 1CQNA 1UEUA 5AA2B 1FQBA 2J9DE 2JJKA 2JVOA 1N7XA 4DZ6A 3CULA 1EU8A 2ALZA 1SQYA 2DSFA 5EHSA 1HHSA 3KDNA 7FD1A 1B0VA 1S9GB 1YLXA 4M5LA 3RPLB 1NO8A 3P4UB 3HSZA 4F4XA 3QQCD 4PWWA 3RU0A 1PB7A 2HVIA 4TYBA 1XEZA 3V81A 2EEYA 2PX1A 3G87A 3CSBA 1CJKB 2B43A 1CVJA 1IN0A 4ALZA 3SDFA 3CD6S 4X04A 2O84X 4R2FA 3MM6B 4X62J 4FJPA 3OOAA 4ICLB 2DE3A 4LF5F 2RC8A 4ES1A 4GX3A 4MIBA 4A46A 3EVOA 4N07A 2K3IA 3GYNA 2R2SA 3HM9A 5CD4H 1VYAA 5DT6A 3MM7B 1DTTB 5IM0B 2CNKB 3GIKA 5EDWA 5BXIA 3J7YI 4HTGA 1AOVA 3KOSA 2DPIA 5GADU 1B4SA 2AGPA 4DQQA 3OENA 3AA9A 1LW2A 1BWEA 4OHZA 2RHSB 5D3GA 3HHNB 1U1MA 2R4FA 3ET6A 2WVCA 3NNHA 1WACA 2OUGA 1FBDA 2RH3A 2G4BA 1IITA 2RRNA 4C97A 2NXOA 3G3JA 2UVHA 3DLEB 5H9EJ 1RAHB 4NF8B 3KJFB 2P2CB 1A54A 2JEIA 3QJJA 3N94A 3NCQA 2GMJA 3CDEA 2YKNA 5KFQA 1XMQF 3EHSA 2AZ1A 3RB6A 3FQKA 1H76A 3N01A 4Q2MA 3LSLA 4P72A 3PXGa 1PG5B 1B0HA 3OJSA 4CO3A 3L9ZA 3AXKA 4M5KA 4IFYA 3PKMA 4GVOA 1U8SA 4P7TA 1SD3A 4KHPJ 3A3CA 2JVRA 3R7XA 2NVUB 4L3NA 5GADI 2B4UA 4I67A 1JQFA 4HL9A 4J91A 2D21A 1EZ9A 3PFOA 1NKCA 1X0PA 5D8HB 5I58B 2Z8EA 3NOCA 3VZHA 5GAGI 1JLBA 3EZUA 4G1PA 4P0GA 4N8OA 2FJBB 3HHFA 3T22A 2QL7B 4FEBA 3BR8A 1XT8A 4OJHA 2CUYA 1K73T 2IA4A 3S9NC 1UWBB 4G1QB 4R5PA 2PBWA 3I56S 2CFXA 1LB8A 2Z0GA 3CD0A 5LMUF 1OWXA 1FNOA 3MM6A 2Z4PA 3IC1A 2UU9J 1URDA 1VSOA 2JFDA 2XX8A 4NF0A 1VQLS 4DUYF 4C0HA 1UEVA 2CZVC 4EU0A 1CLFA 4JOUA 5CQGA 1EYIA 4LP2B 3JAMU 3LGNA 2WBRA 2WBBA 4NEZA 5J1EB 3K1NA 5EYFA 4NXNJ 3V6HA 1LW2B 1GV8A 2VDHA 2BKOA 4C6AA 3MAAA 4C8MA 2UUTA 4CNYA 4DPXA 3BS9A 2MSTA 3MDFA 1VQ8S 2M88A 3T41A 3IRXA 4QWEA 3ZNUA 3CDWA 2JOQA 1AW0A 1OLAA 4B08A 2C3UA 1IR1A 1B4HA 4DR5F 4N41A 3O9PA 4ECQA 3WBZA 1ROFA 1KNZA 3BPDA 1EQMA 2VOOA 1RU1A 2XSJB 3W8GA 1SV5A 1P9YA 3ENAA 4M5JA 1NHVA 3ILUB 3W5ZA 1RDRA 3X3UA 3CPWR 4B3SJ 2XGQA 4QRZA 4ILLA 3KXDA 4XFEA 5HMYA 4OI1A 2GHBA 1RT5A 3TMGA 4ECFA 2XCAA 1Q8KA 5A8RA 4TVAB 4XK8C 3D1OA 3ECRA 4JI2F 2D3OR 3C15A 1RLCL 5KFXA 1J1NA 5DVJA 3VGTA 4XPEA 5BYRA 4UY85 5KFNA 2FJDB 2MKKA 2QFJA 2R2TA 4C98A 4G6VB 3K00A 1T94A 3S4UA 1NEEA 1B99A 4ZN1A 1NNKA 1KWMA 1KHWA 1RYOA 2QA4G 3VF0B 2KHCA 4NI2B 1UTHA 4TLRA 2D3O1 2M70A 1BIYA 2NOOA 3HO1A 1W26A 4OESA 2W7AA 3G96A 2CIMA 4DWIA 3BEGB 2UVVA 2VONA 2KQZA 4OVPA 2PFZA 2GVDB 4B3SF 1UQWA 2MQLA 4IO9Q 4RNFA 3G3IA 1WOSA 1BY9A 1A40A 4KHZE 1B1HA 4B17A 1HW9A 1YQHA 4PXEA 3H6VA 1TVRA 4F39A 3PW2A 2BEFA 5I84A 4ZP9A 1RU2A 4LSNB 5KFYA 3PRVA 3G3HA 4A8WA 1ZIUA 1CC7A 1B58A 4LF2A 1Y4ZB 2KZZA 2VICA 4DLEA 4PETA 3KC0A 4ZP6A 2K2PA 1EH3A 3AXFA 1JLFA 4KB7A 2N3OA 1IKXA 3UN6A 3FVKA 1TK0A 4KO0A 1DHMA 2G1HA 3K5OA 1LWEB 4PPDA 5B0GA 4WCEQ 4CRJA 2YKQA 3GXAA 3RRKA 4G4PA 2ZHOA 3ZTRA 3ZZYA 2VFVA 3PTWA 1ZJLA 2HWTA 4CNZA 4M5GA 3U02A 3CD5A 3HCXA 4AT1B 3TQ1A 2FJVA 2OGUA 4DFPA 2W01A 2CZ4A 4N8YA 4DUYJ 2ASJA 1AZSA 1IXIA 4OX6A 1GTEA 2W25A 2XLIA 4ZS9A 1WD6A 2PT2A 4LATA 3QGGA 4WXWA 2DJWA 2Z56B 2EK1A 3QSYB 3RYDA 5TU0A 3MOZA 4NF8A 4LF5J 1HQ2A 4GKKJ 2HVDA 4J90A 1Y3NA 1U4BA 2DRAA 5IZZA 1DFDA 1RT7B 5G0RA 1NPRA 4DBQA 2R8KA 4CLSA 1WELA 1A8FA 5F3TA 2EC2A 4MLQA 4NL5A 3FGSA 4YZZA 2HQCA 5AE4A 3MR5A 1RHUB 1Y9OA 4L74A 3SSRA 2OCUA 4XPCA 3M6VA 3KUGA 5F0UA 3TZWA 1S1UB 3DC2A 1CJKA 1N4LA 1TL3A 4DV1J 4G3IA 1Z7NE 4R0EA 5A5XB 3QWUA 1MRPA 2ZJRQ 3CJ8A 3L95X 2EG1A 2ZITA 1P27B 4ZVEA 5FTIA 2OZZA 3W9WA 1FJ9A 2UP1A 2RUSA 5CAAA 3N6LA 2ZHAA 1IR2A 2DITA 4TLLB 1RT4A 4K4XA 1S97A 3BO4A 2ZH9A 3G9CA 4ILMA 3L7UA 4RNOA 2GGPB 2QVVA 2B9EA 4L76A 2KYZA 1PB9A 1MW7A 4X8RA 2HURA 3CJQA 5D0RA 2CKWA 2DVZA 3FCVA 2XZTB 1IXHA 1YTYA 2LXIA 1KQSR 3MTKA 1MM6A 1N54B 5E3RA 2RF2A 2P9GA 1KEKA 4IRKA 2JEJA 3KJ7A 1TKXA 2AL4A 3RR8A 3VR1A 2ZH2A 1TR0A 3QAEA 1UCNA 2HQGA 4X4PA 3OR1A 3QT7A 3R7BB 2Y7KA 5M2PA 4GWYA 4F3OA 4CO1A 1GGGA 3T9ZA 2KR0A 2HCAA 1LFPA 3M3LA 4HS7A 1NH8A 1RBOB 5KT4A 2GVZA 3LANA 4LR9A 3KBRA 3ENQA 3R7NB 3D4GA 4R6KA 4PABA 1EIYB 4Z7CA 4K8RA 2M8HA 3BGUA 3TELA 1Q81T 3S9LC 1TKDA 2BM0A 3N4WA 2GJ2A 2K3KA 3CJ2A 5HK4A 4TQSA 5H1SV 5A5LA 3TW0A 3J7ZT 4U6PA 2RQ4A 3RUBL 2LQJA 4OZ2A 3A3OB 1MXXA 3IM9A 3E01B 1ZZFA 1X4BA 1F0XA 3RNNA 1TQLA 2QEXS 1QVSA 2DXEA 3DLKA 2PCRA 2ZOMA 2F40A 2EFPA 2K8GA 5IS2A 1IJEB 2LEAA 1BTJA 5IWAJ 4K4ZA 3NNCA 2QA2A 3Q8SB 4U21A 4R73A 2MQ8A 2Z30B 3J81Y 3TTMA 3H7MA 2HWIA 2I3WA 3QWPA 3LTOA 3CCZA 1S0MA 2RRAA 4CIOA 2Y7IA 3TTLA 2COLA 1JB0C 4PFUA 2DXYA 2WKYA 3KOTA 3FEYB 4NCBA 3D1RA 1VBZA 4HHJA 4XKPA 3KUEA 1SQFA 8RUCA 5DLGA 3I9V9 3BYPA 4JSDA 4AE5A 1RT4B 2QT7A 5EHHA 1N33J 5CXTA 3SV4A 5D4LA 3M8WA 4NLRA 2NXJA 3CJ3A 2KRRA 3V6KA 4ELPA 4THIA 2MZJA 1V5VA 5FLXY 4YY3J 2AJQA 5L8RC 2MKSA 1VC6A 1S7HA 1XNQJ 1XBWA 3LR1A 3MUMP 3OLBA 1ZYQA 4I4BA 1D9YA 1TV6B 1FRPA 4BWJA 2YQ1A 1S0OA 1X7VA 2UXCJ 2MSSA 3FEZA 2D69A 2Q1LA 4F25A 5T3JA 2ZNTA 1KTVA 4FXDA 1P1TA 3OHBA 4IO3A 4JV2A 2IMOA 2DNKA 3GP9A 1Q82T 1LBCA 4YKKA 1Y0HA 3M30A 1CJUA 1FQEA 2DTJA 3DYAB 4C9DA 2ZVSA 1LNQA 5KCJB 3HVAA 2Y84A 5I5PA 2BJ8A 3TAPA 3EPEA 3FVYA 2FDNA 5IT0A 4ITSA 2D3IA 2G0CA 2PT0A 1TP7A 2GC8A 1FPLA 2DNQA 1GMWD 1HMVB 1XQIA 1G1XA 2CQHA 1MMDA 1AYEA 1RTIB 2G9OA 4RX6A 1L3VA 4JYAJ 3IFCA 3NBPB 1IMFA 2CQDA 2YVSA 2WRMA 1FO1A 3DXSX 3SSSA 5BR8F 4TU9A 5K2XA 4IDKA 5H8QB 3HVWA 4AS5A 4QFPA 1PYOB 5CRYA 1YJWS 1D9AA 2RKIB 4MIWA 2X1AA 2I58A 4OYMA 3KTQA 1TFYA 1U6ZA 1QVFR 3FCHA 3MR7A 2ZXTA 3GONA 1QM9A 1WC4A 1VQMS 5F7VA 3R26A 2KVIA 2E1SA 3I0SA 3G8SA 2R6GE 3B4DA 1FBCA 4AS4A 4RW7B 4EXKA 5HROB 4LF7F 1MU2A 3ELHA 1B0LA 3SERA 4K5RA 2GHWA 1D8YA 4QFLA 4RU2A 1E6VB 4OX8A 4G68A 3MPDA 1SH3A 1RKJA 4X9TA 4PFWA 4FDFA 2ZC4A 3PMWA 2HS0A 2VHGA 2XXUA 3HHLB 1F5BA 4FVCA 1OLCA 3CDAA 4BLAA 4NAPA 3GSIA 5I42A 4YHHF 2OD4A 4QU6A 2GCFA 1PBAA 4WZQA 1YCJA 4ZMMA 1X5PA 3DLHA 3IORA 1RCXB 2EVZA 5IT9U 3GJQB 2G29A 1R9QA 4OZJA 3HN0A 4LRDA 2H4YB 1FPFA 5DVIA 2GQ1A 3ILLA 5ETPA 3M30B 1NHKL 4CZCA 4DV6F 3GSDA 1VDWA 3IG1B 3OELA 4J9UE 1FHTA 2AMCB 5AA4A 3KHLA 1VQNS 4JB8B 4JI0F 5F8HA 3KHRA 4OA4A 1NL5A 1Q79A 1KC8T 1FJ7A 4P47A 5KFZA 2XCPA 4RYAA 3K2DA 4MLVA 4DZDA 2Y5KA 3CHGA 4WE1B 1TKZB 2RS2A 4XKRA 3KNAA 1ZM4A 4ZVRB 1FKOA 3CJ0A 1UJ4A 2AEMA 2M0GB 3AD7C 3IOTA 3B8HA 5AA4B 4FXVA 4LF8J 4YFUA 4DSFA 4OLPA 7AT1B 1NB7A 4X4QA 2E1PA 4FF2A 3OT9A 1U09A 3NLCA 3GV8B 5TP9A 5K14A 5DRKA 4PWDA 3OJUA 1WI8A 4Q44A 4I6WA 4HTJA 4L75A 4Q2LA 3H5UA 5C7PA 4UABA 2HEUA 5C25B 2J0QD 4YOEA 8ATCB 3ZTSA 4E2FB 2YNGA 4FS2A 3HX9A 1JJ4A 4GXAA 4F4WA 2HLTA 4P73A 1B32A 2VC1A 5EQ8A 2PD1A 4JI3F 4EO6A 1E6VA 4DV7F 2FHJD 4CLPA 1A0OB 4J9LA 1NSQA 1JEVA 3MUQA 2DS9A 3TAQA 1IWGA 4OLOA 3UD3P 1LFHA 4J5OA 2XQCA 2O1PA 2XMJA 3P5BP 3BBFA 2KG1A 5HATA 2NLWA 3BQ1A 1JXEA 2VASA 4R2BA 3AQPA 3CIMA 2K06A 2NREA 4DLGA 5KG1A 3LH2S 5I3QA 1FPIA 2HBZB 4BDQA 3KLEA 5DGBA 5DQGA 2KDOA 2OSRA 3TCGA 5KCJA 3IRXB 1YXIA 3GFZA 3LP0A 2QTWA 1GX5A 1BUXA 2FNCA 2MKCA 3CW2C 2CZIA 3OR2A 4ELUA 1U1OA 2OHDA 1K1QA 1XJWB 2AV5A 2HQDA 4A8QA 2HHXA 1YI2S 3Q28A 1SW4A 3DP8A 5KT7A 2M4MA 1EX8A 4J37A 3JZJA 1RE1B 2PMZD 3ETMA 5HI7A 4OANA 1U45A 3EMTA 3RR7A 1I6BA 4TOZA 2E7WA 3PRDA 5DLFA 3A3NB 2GFFA 4B3RJ 3MF5A 1TU0B 4R5PB 1LSTA 3OXNA 3LPYA 3T19A 1CULB 3KK1B 4I56A 3K02A 5ETTA 2MZ1A 2UXCF 2RT3A 4PEOA 1D1UA 3H59A 3H5SA 1RAIB 3OD2A 1HWUA 1TK5A 1YBAA 1NNTA 4Y34A 4O4RA 4DV1F 2P6TA 1NV2A 1NV3A 5ITPA 4DL5A 1ZTWA 4OMBA 3OSRA 3CCQS 2Y0BB 5GVQA 4PE5B 3EGZA 2B9XA 4FBPA 3TA1A 4DDDA 3QSIA 3KLFB 2BDPA 2DRDA 3EVMA 3E4RA 3RLFE 4ZJQA 2HPUA 5CYMA 2J7UA 2HBRB 2XZDB 1ELJA 3BKTA 3NL0A 4LVOP 2QMUB 4LREA 1M1HA 3OO7A 3LF0A 3A29A 4M1KA 2JLGA 3CCMS 4QIVA 2BKPA 5KT6A 2IM0A 2MPUA 2M8CA 1Q8BA 4ZECA 2HAVA 4YB7A 5A0YA 3LA0A 3RGYA 2HMIA 3ONMA 4F4KA 3TUSA 2KYXA 1N04A 1RTDB 2DWHA 1UVIA 2C1EB 5DG7A 1LOUA 3KLGA 2ZHBA 5IM0A 2YKPA 2RVJA 4NWCA 3TZXA 4G8MA 2IC3B 3ZKLA 4DFJA 1K0TA 2U1AA 4TKTA 1LFGA 4HH1A 4G1IA 2BOAA 4OXVA 3J81U 3GIRA 5AXMA 1HR0J 2VH7A 2YKOA 2DCLA 2HIYA 4EFAC 2BJ1A 2JLFA 1BQXA 5HJXA 2RF1A 3B4MA 1KRPA 3GFYA 4X65F 1SXLA 1ZETA 2ZZTA 4OI0A 4WU2A 5H8SA 4Y2AA 1LB9A 3J80U 3MR3A 2HVEA 4K7QA 3PV8A 1VRTB 2Y5LA 2YX7A 5IC6B 3UFCX 5IT4A 3R8YA 4ELRA 5H8HB 1YG0A 4RU9A 4B3TJ 2ATLA 2AJ1A 5K20B 3CG3A 2XMMA 4NLDA 1NLKL 2QMXA 2QLXA 2RQKA 2ROEA 2E1MC 4I7FB 3V81B 1RZMA 4DR1F 2UXDJ 2DR5A 3UQSA 3AODA 1FVSA 3CRBA 4H46A 1X9MA 3FQLA 4EQ9A 2DNZA 1QLNA 3HF5A 3MEGB 2O3DA 4F4AA 4UT4A 4PAIA 1R8CA 4QJVA 1NMEB 3FXUA 2HVZA 5HVGA 2FC9A 3W9VA 2E7VA 5EWEA 4OI2A 3GFHA 3PX4A 4DFMA 4H45A 3KLVA 4JWOA 1U49A 2O66A 1SC4B 5FBPA 4O44B 1FRKA 1VR5A 4YICA 4YQWA 2CZ9A 3FVNA 3NCRA 4G61A 2HYIB 3W15C 1KHVA 1X4FA 1TELA 3PJWA 1YJTA 3UO0A 4AUKA 2O01C 5KFBA 1D0EA 4QW8A 2F7VA 2CVIA 3HKWA 2FVQA 3MAHA 1NK8A 1RWMB 2DNRA 1Q16B 1VRQC 2I9SA 3MMBA 1TMMA 1PCAA 4KO0B 4P2MA 3RBZA 1FKPA 3GYGA 5I2NA 5T7LB 5K8MA 2VJUA 1WG5A 3DOKA 2MQMA 1NUXA 3N6MA 3PW5A 4UOCA 3J81j 2MJUA 3FRYA 2GHPA 5I3PA 5JVGQ 3KDOA 2KXNB 5K5MA 1LAGE 1QVGR 3JXOA 3EX7B 1T8EA 1DTQB 2CJAA 2H65B 1R27B 4DR2F 3C4MA 3GJTB 2OELA 3AOCA 3AOAA 1KA1A 3IG1A 3I87A 4DIGA 2B0GA 1RT1B 1VQYA 1JW4A 4DHVA 5B0AA 1FBGA 1WUUA 1LBYA 5E7OB 5IAIA 3TEPA 4U7UK 1RUSA 4DU7A 4AL6A 2XGPA 2DWIA 2RC7A 2QZ8A 4LF4F 1IBLF 4B3MF 3IXQA 2O7IA 3PVXA 3O6GA 3Q29A 1JW5A 2ZJPQ 3G3GA 1KP6A 5ADZA 2FHKA 2ZE2A 2LA6A 4ZHRB 4A47A 3D0GE 4F1YA 1YIJS 2XXPA 2B8QA 4Y3CA 1I6JA 2ZNUA 4USHA 1REGX 5LSLA 3HHDA 4KPTA 1LW0A 5A8WA 3RN8A 3V6DB 3K8VA 3I3VA 2GV1A 2APOA 2HS4A 2VODA 5ICQA 2E44A 2ZZMA 4K5SA 2JRSA 1AB8A 3D5MA 5HROA 4XDCA 1QUVA 4F18A 2V4CA 2A2CA 4KJIA 3IK6B 5U47A 3RPLA 3GU0A 2YPZA 1IXGA 1WKKA 1RTIA 1L3TA 1LWCA 5HPQA 4X65J 2YNGB 3KG0A 2F6PA 3H5XA 3OO6A 3D7SB 4CM0A 4UOGA 5KFCA 3I31A 4IDKB 3F11A 4OI6A 4MNCA 4KFBA 3C14A 3W8PA 2VPZB 1KVKA 4ZVTB 1G0HA 4OQOA 2D9PA 2MEWA 2QLBB 3WHIA 4B3MJ 5DQIA 2R9LA 2WAQD 4ZEIA 5J2NB 2DKOB 1FKPB 4N56A 1IMEA 3MR2A 1B1XA 1SBPA 1FXDA 2F7CA 2EWHA 2QLJB 3N28A 3FRZA 3GLBA 3MMBB 4Q0BB 4ZN3A 2PMSA 3V4IA 3BM7A 4DCPB 2VPOA 2C2RA 3FXRA 1NJYA 4F50A 4MEVA 3TUIC 3UCZP 3OL6A 2ZOGA 4OMFG 4XTCQ 4FS1A 2C28A 2R7OA 3LALA 1TZ0A 1BQMB 2ZOFA 1XNRJ 4BDMA 4NF4A 4FVMA 2I6EA 4P74A 1I5OB 2PMWA 1W7WA 4ECYA 4DR7J 3EDRB 3R9LA 3T5LA 5LL6d 2J9DA 2WVFA 2IRXA 1RT1A 1FTLA 4HE1A 1NK7A 1I51B 1VC5A 4JI2J 3PO5A 4ES2A 2VOZA 1RAEB 4NZ7A 1CBKA 2QV6A 3NWGA 4TU8A 4PDHA 5I3UB 1V3SA 1ZS6A 3M2RB 4IH6A 2WB4A 4NGUA 3T1AA 3DRRB 1U0HB 2MHNA 1LAXA 2XXXA 4LIWA 2F7BA 3BR9A 1U48A 1JKHA 4RWWA 1M5FA 3US5A 1WHXA 3ADAC 2P8IA 3WDOA 4DMZA 4GRKA 1PC5A 1G6BA 1N48A 1VLYA 5KFIA 1RDZA 2CQPA 5AE3A 1FVQA 2X3DA 4P7VA 1BE4A 4EUVA 1R0CB 4NCAA 1URGA 1YBUA 3T5KA 2L5VA 4P71A 1OSCA 1TTHB 3QGHA 3MECB 3ICLA 3NOHA 1Q0NA 2V9WA 2KXFA 3IAS9 1CSJA 1GTKA 4P9KA 2Y1IA 4RPNA 1WDDA 4PDDA 2RILA 1PYTA 2AD9A 5KFGA 2BJDA 4KQZA 2FGCA 1FRXA 2QLWA 1QUKA 4OFLA 3QRRA 1TV6A 2EBEA 3BREA 3KUHA 3KNGA 1UVKA 2XX9A 2HPGA 4DN0A 5F8JA 4CLYA 2XLKA 2I6WA 3QNWB 4BLGA 2A18A 4HCWA 4W92B 1INPA 1UVNA 4YMEA 3AD8C 2YNHB 1BGXT 4WK1A 5AXNA 4X4NA 4DV4J 5CMCA 3E51A 1WEXA 4YR2A 2UUWA 1SW2A 4N5SA 4OYAA 1VHIA 1EAYC 4NF6A 4IUFA 2KT5A 3QGPA 2EFGA 1N0VC 5CA5A 3N5LA 1JXVA 3MCMA 1ZTYA 3EGWB 3MM5B 2HBYB 3HSJA 1KVJA 1A8EA 2XLJA 5ETRA 3OMBA 3HDSA 2NXUA 1C2PA 2Q88A 1JLGA 1FFGB 2FYIA 1RWVB 2WTFA 2VQEJ 2HZAA 3JS9A 1XVXA 4NXMF 5AXKA 5ET5A 3GWCA 4IR8A 4F19A 4FYDA 4I40A 1S59A 1FERA 4B3RF 1O5JA 3ET6B 2QJEA 2B8PA 1FK9A 3QRPA 2BA9A 1FDNA 1NK9A 2J76E 1YX2A 1XR6A 5BWJA 3GYYA 4KHRA 1FBPA 2KFYA 4JI8F 5B08A 2REGA 2WVBA 2O1MA 5CMMA 2LEPA 1N5QA 2F36A 2ZH5A 3OEMA 2DR6A 4C8OA 3EGVA 2JC1A 3QYTA 3MMJA 4H4OA 4KIAA 1V5IB 3C66A 4X1DA 3VAHA 5E5NA 5CYJA 2I49A 3DHWC 1GK8A 2OBGA 1CULA 2E1RA 1FNMA 2CQCA 4NX9A 4GD5A 2VDIA 1FF2A 1IQTA 5K8PA 3B78A 5IGAA 4F4ZA 2PGCA 1N3WA 2LDYA 2V34A 4NLPA 2KG0A 4NLTA 3KOAA 2ASLA 3ZSFA 2QVRA 4PBHA 4OYZA 1AUSL 3FD3A 4MK7A 2MZQA 1VIXA 2OD6A 4OZ1A 4LF6F 1US4A 3M7VA 4I2QA 1J5EF 4JI7F 2KM8C 2KT3A 1H7XA 3I9ZA 3V4MA 1NDCA 4C2MA 4MFIA 2IM1A 3BF4A 1EP4B 4DV7J 2AYGA 5DETA 3Q0AA 5HMWA 2HNYA 3FVOA 2I48A 3OL7A 3DRSA 2DH9A 1NMUA 4R6HA 2DXDA 2DDKA 2EK6A 4P10A 4OI4A 3DELB 3PNIA 1DBDA 3U1NA 4HACA 3FSXA 4EMDA 4PFIA 3AB4B 4BDLA 4KHMA 2I38A 3BN7A 2VG7B 1HNZJ 4B02A 5HQ8A 4DN9A 2E9TA 3GV5B 4NMYA 2Y0SD 1KBRA 4F3BA 2ERRA 2HHVA 2QFLA 1RADB 2ANJA 3IOUA 4C7QA 3PKYA 3M8RA 1PBPA 2Z57B 2CEXA 2W7YA 4OYXA 2V93A 1OJ4A 2DEJA 4X62F 3NS5A 3PUXE 1H6KX 4X4VA 3E79A 1TUVA 1V9OA 3DP6A 3WAFA 2KJVA 2Z8FA 1NCLA 4ZHRA 2VG7A 3MM9B 4LRBA 4F22A 2WHOA 4LBPA 1NAQA 4GXSB 1A7GE 1RGVA 2PFDA 3O6QA 3H42A 4RW9B 3D2WA 5GAEI 3V6DA 3HSGA 4UW2A 3KMSA 1MM7A 4URSA 1B7FA 5FD1A 3D1HA 4KV8A 4K2JA 4OYPA 2HGNA 2V8GA 1CJVA 4PUOB 1TK8A 2XWIA 3TWZA 4QOTA 1HL6A 2B5JA 3A3UA 2FJWA 3FVGA 3OO8A 2K1RA 5I2NB 4N8NA 1QUJA 4IO4A 1IQZA 3RZAA 2OPSB 4F26A 4CO4A 4DU8A 1FEEA 1JLAA 5KT2A 3P6YC 2BUNA 3EGNA 3NGKA 1RTJA 4Q8RA 4J9RA 2D9OA 4CTAB 3MCSA 3IBWA 3I4PA 3USDA 2X1GA 3H25A 3H98A 4MKYA 1ZAWA 3ISPA 3LGMA 2MXYA 5C2CA 3MFIA 1URRA 2V68A 5ISUA 4KHPF 1J5OB 4XO0A 3T1YJ 3PHTA 4HT5A 2GVDA 2ZBCA 4PQUB 1MMLA 1B52A 1MROB 4MF3A 4ED6A 2DGOA 4YMBA 4WK3A 4KYEA 3OTOF 3CVGA 3VCDA 3BBRA 2XTJP 4Q30B 1F9HA 2Q2CA 1F1BB 3VGVA 4GMKA 2VGQA 4ZLNA 3DOLA 1IQ7A 2NPIA 2XSJA 4WFBQ 2AYSA 1HBUA 2DO4A 2KM8B 1IZ1A 1JLQB 4PZVA 3CSKA 1NK5A 3CMAS 2EFNA 2D3UA 2R8GA 4KYZA 4GBWA 1HNVB 1RT5B 3HKZD 4X4UA 4U7CA 1LWFB 5DVFA 2VF3A 4B9UA 4EZ6A 2V4RA 2HEKA 2BACA 4ZLLA 5F8IA 1QJHA 3C9HA 5E33A 4DQIA 1EARA 2DGVA 3Q24A 3CG1A 1O7TA 5J2MB 1UTAA 2I4BA 3P8BB 2LYVA 4MYUA 4DSLA 1USYE 3HT3A 1QGXA 2A6MA 3I5AA 4LQ9A 4DG1A 3SCLE 5DEXB 4KH1B 2W9CB 3K58A 3DRPA 4TY9A 4JI5J 4IFYB 2POKA 2B5JB 2J0SD 3BB5A 4OHXA 1PGZA 1AUDA 1Y00A 1FTMA 3AJ1A 2UU9F 3HD2A 2NYHA 4WP3A 3TX8A 3CWJA 3H5YA 4ZEBA 4EF1A 2VPYB 2DGTA 3KLFA 4L73A 1RA7A 3DI6B 3CVKA 4ELVA 3R2CJ 1OSDA 3RT6B 3FBPA 5CC2A 5KFSA 3N5FA 3G82B 2QL9B 1UETA 2W9BA 3SCIE 2MY7A 1VQOS 1S12A 2XULA 3UN3A 2LQBA 3O5TB 5EQ7A 5I2KB 3VQTA 4ZVUB 2GQ2A 5B0DA 4DJBA 2YQ0A 3FUYA 5ELVA 5DG8A 2HMIB 1S6QB 1T9YA 3MVZA 3HPOA 4QIWD 2OP5A 2BABA 4DEZA 2DNOA 3JYTA 1REVA 2QS1A 3D54A 3LSXA 2IC3A 4NLXA 2F35A 3P7IA 5KDTB 1VDHA 1HFEL 3NY0A 1WKLA 1DRZA 1VMBA 6FDRA 3OVBA 1VCTA 5C24B 3DLJA 1QAIA 3EPGA 3W5YA 1RDXA 3K01A 2CQIA 2VKZG 3LUYA 2R7QA 4QWCA 1Y3PA 4O44A 1DLOA 3CCES 1CPZA 3CCUS 4MAGA 1Y5NB 1YJNS 1SVDA 2L41A 3AA8A 2C3OA 4JV5F 1L5UA 1JLCA 5DEXA 2VP1A 1NNFA 3M6XA 1L5TA 4H67A 3KMQA 1B5JA 4IG3A 3TZZA 4UZBA 1DQAA 2UV8G 1NNPA 2L9NA 3ZZTA 3TRGA 3P45B 1M5BA 1K9MT 1SPBP 1R0BG 1T9XA 1R8BA 2DE2A 2OPQA 2BX6A 2V0NA 1GXTA 2I4CA 1F2HA 2F6GA 2M8DB 2HNDA 1HSEA 3KFMA 3FV2A 2PEBA 3K5PA 2FIUA 4JV0A 3MOJB 4X2BA 4X1BA 1NFTA 1S6OA 3TA2A 4ZVQB 2PC6A 2DT9A 3BKUA 5HQMA 2KRBA 2H3EB 3K8WA 1SC1B 4KY3A 4NLVA 1QE1B 4HLBA 1RISA 4KQPA 1F6TA 2Q66A 1JJCB 3SBMA 1N88A 2W8LA 4OI3A 3R2DJ 4KPCA 3QJPA 3SQGA 2UUCJ 3HFVA 2PYYA 3M8UA 2P9CA 2C2DA 3QMQA 2WX9A 3WIUA 4ZPTR 3T1HF 2QFIA 2M9KA 1U0SA 4HHUA 2HXRA 4N6KA 4NYPA 4WKYA 5A8WB 2HAFA 4TU7A 2FB0A 3TO8A 1BMQB 2BQUA 4ELOA 4ZLPA 4R6YA 3HHLD 4A8KA 4WE1A 3LSWA 4NRTA 4DL6A 2MQOA 3TQLA 1KQFB 2RQCA 3QUFA 2KT2A 3S8SA 4KT0C 4DG1B 2VBYA 2NXCA 3MUTP 5C24A 1HNWF 3IR5B 3MPWA 3DMJA 2H98A 3VZIA 4FF1A 4IO7A 1Y20A 4M5NA 3S1TA 2E1AA 2HK3A 4N8GA 2ZJQQ 2OFGX 2F4VF 3QXMA 5KFVA 1IXCA 4DL7A 3EVWA 2XNRA 1TUGB 1SJQA 4PUOA 1VRUA 4PPZA 3GR0A 3THVA 3K5LA 4HI1A 1B3EA 1PEBA 4MHFA 2K1RB 4RKUC 4B9NA 4LONB 3U93A 1IKVA 5C5JA 1N5VA 4YR3A 3BDPA 2IMWP 2QMWA 5CMBA 5D15A 2VG6B 2XZWA 1P99A 3OL9A 4F29A 1FJ6A 1SQGA 3FMWA 1N7WA 2CJKA 1JLAB 2FQQB 1CE2A 2ZVIA 1BQMA 4IY5A 3OV7A 2DNLA 2CQ1A 2IDEA 2HZCA 2LQ5A 4Y2MA 4ETZA 3DM2A 2QG9B 2ZZVA 1B40A 3SQOP 3RB0A 1KS2A 2HFOA 3H40A 3TAMB 1R8AA 1X4DA 3H3GA 4KBIA 1PILA 4ZIWA 2XD3A 2ZMBA 1YRUA 3BH6B 2VPWB 1G2EA 3IAM9 5GMEA 3BDEA 4PAAA 1BK4A 2A0FB 1R8HA 5J2NA 3POTB 3H0PA 4JI5F 6FD1A 2XS2A 3VLWA 2NWJA 1ZM3A 5J2QA 4YY3F 1B7YB 2RE1A 3LP0B 1VFJA 3BGLA 2OO4A 4EUOA 1HNIA 3FZ2A 4OX9J 2HIQA 2ZZNA 2YH1A 2WSFC 2XYPB 1ACMB 5SUHA 2VPNA 4EO8A 1IXKA 3ODBA 1HPZA 3PJ9A 1GMWA 1VISA 2GIQA 3J7A1 2I0CA 4HACB 4NLSA 2IYGA 2P1SA 4E0XA 4M8LA 1NZAA 3PHEA 3BKFA 5JK4A 1T11A 4N7TA 4M4GA 3K17A 5HP1A 2V3QA 1WNEA 1NPKA 2CQ0A 1NM2A 2RU3A 5CABA 4GWSA 2V25A 1P1LA 1U26A 2DR9A 3FFIA 3O8WA 1IUDA 2H25A 3O1LA 3N6NA 3VGUA 1ZBTA 1NK4A 5DQHA 1WF1A 2F9JA 4LBHA 1MDQA 4RNHA 4PTKA 1TKZA 2ZWOA 4YB1P 1F3VA 2QIFA 2DNPA 1SKSA 1B7UA 4WEPA 3PY8A 2FD2A 2RDIA 2RKIA 2HNZA 2E5LJ 4K4UA 3H20A 4N15A 3CCLS 1OYEA 1A55A 4Z2XA 1HI8A 2HHQA 4F67A 3TFLA 3V5RA 2RQMA 3JSMA 4OENA 1YSJA 2IAJB 4FKYA 4R8UA 2FHYA 2CZKA 4NE4A 2IEEA 2O1LA 3T9UA 2BW2A 4GC7A 1LCFA 4MH5A 2HFUA 2GMLA 4R72A 2F9DA 3DI6A 1I94F 2W4CA 3HP6A 4FYXB 1HNZF 3TZAA 4M5MA 3KN8A 4ZDNA 2F3BA 2OPRA 2OPQB 3Q25A 2CPZA 1U47A 2Y1RI 1RYSA 5IOLA 3KG2A 5H9FJ 1U25A 2XI3A 1URNA 2XI2A 2OPPA 3O6HA 3HO7A 1NV1A 3SEOA 2QGFB 3DU6A 1KLNA 2VV5A 2B4OA 2CPYA 2QS2A 2IFXA 2NXNA 4IG0B 1PJ6A 3GZGA 2ONKE 4F2RA 1SC3B 3O2IA 3AXMA 4JI3J 3FASA 3M2UB 3GQCA 2MMYA 2R8HA 3HFKA 5KFAA 2WW8A 4K4VA 2AJFE 1WI6A 1U02A 2Y9HA 4LF6J 3LAKA 1FESA 1DLOB 2CJBA 1X5OA 1CQMA 1LXJA 5KFKA 2UVWA 2CDQA 2IHR1 5DDRC 1WHVA 4GKJF 2DGWA 2P9EA 1T9WA 3C8YA 3FATA 1OYDA 4R9FA 4J7CA 2GQQA 3M9NB 5E3CA 4YDXA 2A5SA 4TLQA 2VD3A 3OFFA 1IKWA 2HLUA 2V2ZA 1HYSB 2RMLA 4Q0BA 3RQTA 3PX6A 2XXIA 1UL3A 4BC7A 2RINA 3IM8A 3NS7B 1MXZA 1U2RA 3T9VA 5GAHI 4NLGA 1XTZA 2XG8A 2XY7A 1H38A 2JFKA 2V2KA 2YWWA 1HQUB 4OJGA 5DG9A 3G7WA 2ZH1A 3M8SA 2THIA 2XB2D 3OXGA 2B65A 1V3ZA 1PB8A 5CI5A 1X8DA 1S1UA 2XY6A 3HHLC 3JYTB 4HYKA 3RRHA 2VFRA 4HCYA 3TJ8A 3OTOJ 4RPOA 5HLFA 3KG1A 3UDVA 3MM7A 3P96A 4M5HA 1UW9A 2QC3A 4NEYA 3W60A 2FVSA 4LRCA 2AYBA 2FHMA 3T5JA 2VG5A 2XMUA 4IR1A 5AE1A 1ZM2A 1NKXA 1FI4A 3R5JB 2XWOA 4OEVA 4WFAQ 3ILJA 1M5HA 3CXCR 1LKZA 1UAWA 3CFZA 1ICEB 2B6AB 2R7VA 1RT6B 5KG5A 3DHXA 1M5OC 4ETXA 4UUXA 4F3PA 2EFOA 4ZITA 4QFOA 5ETQA 4HDHA 5B0EA 1JLCB 4Q8FA 5LT5A 1K1SA 4ICLA 2JX2A 4Y2KA 2B4VA 3TDJA 4QWDA 1XHYA 3C16B 3QFHA 3IX1A 4QFNA 4DR7F 3G71S 2EXUA 1H2UX 2HK2A 1LEOA 4O3OA 1UA1A 5IQ6A 1SC6A 1W2IA 2F34A 3G2XA 2O6AA 1N6QB 3CTRA 1BQNA 3NOGA 4EGLA 4PGNA 4EK2A 1MY1A 2HAUA 1VE4A 1NDLA 5E41A 3VAKA 4DV3F 3NMAA 4YEAA 4GLIA 4MJOA 4MNPA 4GKKF 2WK4A 5J2MA 4FN5A 4P2SA 5BUUA 3G8TA 4GVBA 3UIFA 1U1NA 4DCYA 2V50A 3BFTA 1OQ6A 1S6PA 1F3FA 5KFPA 5AJ3J 3GPAA 3MJNA 2BOPA 1SKUB 2F8EX 1IKWB 4NWBA 1N5SA 4RW9A 1UTBB 2HAIA 4Q0CA 2C2KB 3AFGA 2Z8DA 1WC5A 4ER8A 2A10A 2DGUA 3I6VA 1U1QA 3KGCA 4DPUA 4PWUA 3N9UC 1QAXA 1FRHA 3IR1A 4PQUA 4DXCA 1AA1B 1KR4A 3G6ES 5D4PA 3O28A 4ZJOA 3QIPB 4R75A 1SIZA 2HFBA 1DJ0A 5DW8A 3FEXB 5LM7E 2HBQB 3IP0A 1GT8A 1FD8A 4QBUA 1VJWA 2Y7RA 1C0UB 3NGDA 2YJPA 2IAJA 5KG3A 4R8UB 3FC9A 1DTGA 3POTA 1FSAA 7FDRA 1RTJB 1AROP 2CYYA 5I58A 3DRSB 4K4SA 2HRTA 1NU4A 1F60B 3T1HJ 1T03A 4JI4J 4LA9A 4X66J 4KR0B 2ZUAA 1WC3A 2B56A 1B0PA 1EKRA 4NEDA 2XWYA 5CYQA 3S01A 3A13A 4J9MA 3M3KA 4OYIA 3V8XB 4K0KJ 2EKYA 2FA7A 4AQYJ 5A8KA 1UZDA 3KK3B 1B6HA 1VLOA 1CB6A 1K8AT 1M1KT 1S7YA 3G6VA 4JV5J 1SDXA 4FE8A 5IZ1A 2WCXA 4EQ7A 5F41A 1S5ZA 2X1BA 1XNQF 4JVDA 4O94A 3C16A 2IBKA 4A48A 3T5HA 3UR3C 3GILA 3C15B 2DNGA 2XMAA 4IH7A 3LP1A 2VA2A 1EYJA 1EZZB 3SEUA 2V9KA 3AHPA 3PR5B 3U27A 2GO8A 4QSCA 1N5TA 4DPWA 4PF8A 4PG4A 2BANA 2AX0A 2J0WA 1POY1 1S6PB 2MZRA 4RW6B 1HQUA 1LLSA 4XIGQ 1FE4A 1UTHB 2ZZXA 1R6VA 4OVSA 2VHAA 5DM6Q 2HFSA 4ECVA 1QTNB 3NG8A 1U24A 1YGYA 3DGPB 4NMLA 3M9MB 2OI2A 2HFVA 5IZ3A 3I0RA 5IWAF 4MKVA 3ULHA 4A8SA 2AQ4A 1GMUA 3UCGA 3LAMA 3JAMY 4C0RA 1SH0A 4FECA 4B3TF 2VBZA 1M0SA 3EQ1A 1IKVB 1HNWJ 4IOCQ 5BR8J 3E9XA 4RA1A 5ESYA 3VAIA 3O6IA 1HBOA 1H7WA 2HSEB 4B9LA 4GO7X 5CCLA 3K4UA 4ZS6A 3CMES 3ZKKA 2B6AA 2H48B 3WIVA 3Q8RB 4DL4A 2FUG9 1IMDA 2N7CA 3FXBA 2BYCA 2YY3A 2WBMA 3MUVP 1QW0A 2VC0A 4O0NA 4ED1A 1RHKB 2KFNA 2NUUG 1S0NA 3M8PA 4RWXA 2EFQA 1IM6A 1RAJA 2X51A 1EETA 3C19A 5J1EA 5IXUA 2W9BB 4C1TA 1F9EB 4USIA 4U8VA 1FBFA 3TZYA 1WOPA 4KC5A 4GWOA 1SB6A 4U1ZA 2CG4A 2XMVA 4NHBA 4WBFA 5LMUJ 3M1VB 3W65A 5KFDA 3GIMA 2CJYB 1Q53A 5F9LA 1R43A 2YBVA 3MEEA 2W24A 4GC6A 3CR9A 3M8PB 2FZCB 5TPAB 2I1RA 4KD5A 2GHVC 3PPPA 1WODA 4OV1A 1FPJA 4UACA 4ZVFA 2VFUA 2AU0A 1MWZA 2DVCA 1A9NB 1QTMA 4AB6A 2I8EA 4U2RA 2EW9A 1I1GA 4IG3B 3ZO7A 3C3LA 4KYSA 4B9TA 2E29A 4OIXA 1NUYA 3V89B 2W1BA 1S9FA 3OVAA 3AJDA 3GJSB 2W2MP 1VGYA 5B0CA 3M8ZA 5ETMA 3MP6A 3F56A 4ZPWR 2PVUA 2KI2A 3R6LB 1LAHE 4DL3A 5B0BA 4LFCJ 1SKRA 4LUBA 5KFUA 1P1NA 4BS2A 4UF4A 4OEUA 4H0WA 4FP9A 1AH5A 3BV8A 1MY3A 3L4BC 5IC4B 3Q8QB 2VBXA 3MEDA 2B9YA 2CNOB 3EWGA 3NGRA 1IBLJ 4H4KC 2LXFA 4KPYA 1U2FA 3SXLA 1ZM9A 4F2SA 5KFWA 4F02A 3MAQA 2DHSA 2FZKB 4FBUA 4RBTA 4C4WA 1H0HB 2Q3PA 3UDCA 1NSAA 5DS7A 4HEA9 2YNIA 1Q7YT 3MEDB 2Y1JA 1BKAA 4RXLA 2V3UA 3T9NA 4OX9F 1B7HA 4FF3A 4QBAA 2A2DA 3V6JA 1PYSB 3RGIA 3D3CJ 3TJ9A 2ATCB 1M5CA 3H03A 4WTOB 2HNDB 2MB0B 4CWBA 2FY1A 1TFAA 1WDNA 1G7CB 3RRGA 1VC0A 1AFJA 1XR5A 1HSLA 3BZQA 2ZH6A 2L9DA 2OTLS 1YJ7A 3VE1B 1U1LA 4NMXA 3KJVA 4KI0E 4DF8A 2RD5C 1TL3B 3RJMB 4UOHA 4OHNA 2IRUA 4NZ0A 2HS3A 4WU3A 2CWKA 2C3PA 3I5CA 2IIHA 2DHXA 5I57B 4LSLA 3THIA 2QA4S 4C8NA 4K4YA 3ZZUA 3PFEA 3ZZ0A 5KAKA 3I82A 2A6OA 3SZPA 3TUPA 4H4MB 3MEEB 4KSEB 2DGQA 1E6YA 3AD9C 4MJKA 4LF9F 3MFHA 1S1XB 1NSPA 4U4SA 2RDJA 4N81A 2AYEA 3W2VB 3LWLA 4RW8A 2LA4A 3UE2A 3NEKA 4XXUA 4DV4F 3J7YU 4GL8A 2PSZA 2FYXA 3KLGB 3FJ7A 4CQ1A 4KR5A 4MT1A 1GR2A 1XI6A 1S48A 3CCTA 5AA2A 2W8KA 1QDUB 1ZKBA 4XKQA 1TL1A 1BC6A 1SW1A 3E01A 3FCWA 4ED2A 3TPAA 3BSNA 1A6LA 3R3TA 2DNMA 2VFSA 2L3MA 1B3FA 2I0XA 1SQEA 1FDDA 1DARA 1DOTA 4WP9A 3TTRA 1HWJA 1G3OA 3KK1A 2FC8A 1C1CB 5H8NA 1R6YA 3FUZA 1UTBA 4KKOB 4OV6A 3D6TB 4RUHA 1LXNA 1HWLA 1F2GA 4U95A 1FNXH 2MGZB 5J2QB 1NKBA 4C1UA 5J1PA 1DTZA 4YAHX 4KRWA 5DO2A 1MXYA 3DGPA 4O3BA 5LSRA 1F5CA 2VG6A 1Z2ZA 3D66A 4ECTA 3EF7A 3PW7A 5J16A 1FW0A 3QLHB 2H99A 4H6DA 1IKYA 1NB2A 2J7WA 5F3ZA 1HD1A 1IMAA 4PC9A 3O3LA 3R1LA 1PKUA 1RBLA 1TKTB 5IM2A 2XM3A 1RWPB 4ZOSA 2ADBA 1YZ7A 4OX7A 3GJRB 3R5GA 1XC1A 2IBOA 2VU5A 2P6SA 2CAJA 3W7BA 2LCWA 2IM2A 3IFAA 4IO5A 1YITS 1X4AA 2JC0A 4UOFA 2XWKA 4OHWA 5L1LA 1XMBA 5CZVA 2ZD1A 1W2BR 4E0DA 2F4FA 4QU7A 3V5AA 4ZJLA 1BP5A 1QY7A 4KGMA 4X64F 4BCAA 4F04B 1XERA 2AYMA 3L3CA 4P2XA 2ZM6F 4DL0C 3W62A 1ZPVA 3MD1A 3UGWA 3FK4A 3IWNC 4U96A 3Q86A 1EZOA 3JSMB 2DIUA 2BANB 4Q43A 2N3LA 3HXMA 2VKRA 4C8LA 4ELTA 1YTVA 3IGNA 2BM1A 5F1QA 4JI8J 1VRUB 4USMA 1DTQA 5KG0A 3SYZA 1R0AA 4ANEA 1AT1B 2OJ3A 2NSBA 3CGIA 3CJSA 5GMDA 1JEUA 3T9HB 1LK7A 3GE9A 4IOBA 2MZTA 1XMQJ 4MK9A 1FTRA 4EYHB 2LU1A 1CJUB 2ZEJA 2BR0A 1RHRB 4O3CA 2W2NP 5M2RA 4NXMJ 3LP2B 4FNIA 2QSXA 4C11A 4Z7EA 3CT9A 4DDFA 5ICTA 4DZ1A 1S7IA 3NP5A 4B3OB 3KFWX 4RW7A 4LSZB 1MDP1 1NUZA 3PD8A 3DRXA 2D5WA 4YB6A 3W3SA 1OY9A 1UEKA 2Y7WA 2V6AA 2V4QA 1X60A 5KZTA 1K9ZA 3OQ2A 1FQCA 1KOHA 4LF1A 4ED7A 1Y5IB 4ZVSB 4ZPBA 5H9FK 4NE9C 2RAQA 4H4KA 4DSEA 1N8RT 3FZVA 4I8CA 5I42B 3BSAA 5MLCV 4FEDA 3G86A 4CH0S 1Y11A 2AEJA 1DK4A 3U1MA 1S1TA 3OSPA 4GWWA 3R27A 2MLZA 4ZEDA 4G8HA 3VVTA 1WHYA 2W7OA 1JQGA 5B09A 4ZE8A 5LOQA 3QAUA 2ZM6J 4OVTA 4ECWA 1X5TA 3SETA 3IB2A 1OO0B 1S49A 2ZUGA 4CO5A 2HQ0A 2FJXA 3F41A 1SIWB 4O3NA 4YKPA 2VQFF 3K5MA 3A8JA 1KN6A 3C46A 4B9SA 1R31A 5A0YB 1UW4A 2D3ZA 3KJVB 1WSVA 2NPFA 3IOVA 3LOUA 4OZ0A 4JI1F 1APSA 2YNFB 5AJ3F 5L1IA 4X84A 1JMTA 3BGFA 2DXFA 2YWFA 1NBEB 4QPTA 3SFUA 3DLEA 4RUCA 3M8QB 2CPEA 1YRXA 4A8MP 2VB6A 3DDIA 2XA5A 3DOMB 1DZ5A 4USUA 1HMVA 3VHQA 1MMNA 1EYKA 5DM7Q 3UDEA 3CIJA 3T93B 4ED0A 4LBIA 3I5BA 4DCXA 2CJ9A 1RQ0A 1SV5B 1AFIA 4MTPA 5H8FA 2H5JB 1IBKJ 1RABB 2ZYKA 4CT9A 2M3DA 3K5NA 4NLQA 4RBVA 2HHPA 1VS3A 2GQCA 4XAKA 2NSCA 2DNNA 1S0VA 4A8OA 3MP8A 1XR7A 4FYWB 1JXLA 4YN3B 2GH9A 4I3YA 3DRRA 1MY0A 3MWBA 1P8GA 1RAAB 3TVYA 5DJBA 3SSQA 3FV1A 2DHAA 1I3OB 2FVCA 4DV3J 4KFQA 4P8BA 3DLNA 4M94A 1Q78A 2F63A 1GVCA 5JJBA 1O51A 5LMNJ 4KCCA 4WKRA 3VAGA 1L3UA 4DPOA 4C8YA 3S9MC 4IQXA 5ETLA 4ZVOB 1JNRB 3S2VA 3RB3A 3ILOA 2UYFA 1DBZA 4NA3A 1Q8LA 3M6UA 4H1XA 2WB1D 4DUTA 2HXWA 3ZXWA 5D78A 1J2VA 2QSFA 1HBMA 4U1OA 4NCGB 2IYIA 1JLQA 4P52A 4KAIA 2A1BA 5E3PA 1NPPA 3C31A 4WXJA 1GTHA 4QWBA 2ONSA 1X0FA 3T96B 3NAIA 4U4XA 1KFDA 4Q8EA 4MK8A 1RT6A 2FHJA 4RL1A 5ITOA 1XNRF 2V63A 4OZ3A 3C36A 4OJ1A 1RBAA 3M9OB 4YHHJ 3E8OA 2VPXB 1S4FA 1JLFB 4ID8A 2E9RX 5K8OA 4ED3A 1WOOA 3X1LB 2J8SA 4QF9A 5CZXA 2V2QA 2G93A 3NKYA 3SCJE 4I2PA 2WVEA 1IJFB 5H8FB 2BVZA 2O67A 3CCSS 4KGXB 4KGKA 1MY2A 1VQ9S 4WIQA 1P1UA 2RUGA 3UD5A 2DO0A 2QLFB 1Y3KA 2XYGB 3Q26A 4ECXA 2VQFJ 1AZSB 3FKBA 4IO2A 2GW8A 3OSNA 3CO0P 1H73A 3IGVA 1T03B 1FPKA 1RAOA 4PWDB 4OFOA 2EC0A 4CLTA 1S1TB 2YQ3A 1FPDA 1BD6A 2KB2A 4NLUA 3UNGC 3O97A 5FHOA 3I96A 3NGUA 5EGYA 3CC2S 1SL2A 4I62A 2WONA 2HQ3A 2OPSA 1GEHA 4WZMA 4M5DB 4W98A 4AXJA 2V94A 3Q8VA 2MQNA 4XIUA 1R6ZA 4GOTA 4U23A 2LQ8A 1H72C 2WZ1A 4FATA 2AEFA 2X7QA 1JWWA 2GO9A 1PJ5A 4MMPA 2Q43A 3SIPB 1LCTA 4L6V3 2KN4A 2W2QP 3BJYA 3ROJA 2JLEA 3TYHA 1W25A 1S79A 4K2XA 2YNFA 2YPYA 1N0UA 4Z37A 3OD7A 4Q7AA 3K0JA 3OEKA 4PG6A 2XHWA 4ZEKA 2AHOB 2AWZA 5L1JA 2F8MA 1TL1B 3O29A 1RP5A 5I56A 3VAJA 3H4DA 1FE0A 1UVLA 3UR0A 1Q35A 3OTDA 4JI7J 2F5XA 3DKDA 1WSRA 3RTVA 4FYYB 3H2VE 3WX8A 4QW9A 3NGTA 4PRFA 4K4TA 4J9PA 3RBXA 3MC2A 4IGRA 4PQJA 4WYWA 1QULA 4HI2A 2UYEA 5TP9B 3T6BA 4DV5J 1TAUA 3PPQA 3WC0A 4NI2A 2BE2B 1HKAA 1HNXF 2FLLA 2ZC3A 1M5EA 3H6UA 4K4WA 2BJIA 5KOWA 1YZ6A 5CBRA 3QATA 4R9GA 2G13A 3KK2B 3LV0A 1Q4RA 3ISNC 4GKJJ 2E1CA 4EDPA 1NZ8A 3KC1A 3KWMA 1ZTTA 5K8NA 5KFLA 2H9BA 2VUGA 1PC3A 1G4CA 3EPIA 4PXCA 2PI5A 3OO9A 3VLUA 4F0MA 2Q74A 3MBPA 4JXIA 2BMBA 3BYRA 3D28A 4LZ7A 4ZVGA 1LWCB 1FFSB 1URSA 1ZA1B 1JNFA 1PAUB 4POXA 2YWHA 3TKDA 3PYDA 3E3XA 4QIGA 3TVKA 3PUYE 4MMOA 2EKNA 3IO4A 1HSJA 5IFMA 4USVA 1LQ9A 2ZNSA 2UUBF 2V4JA 1X4GA 1RTHB 4WIIA 4MAKA 5C25A 2CQ3A 2AW0A 3MZ9A 2DVIA 3DLGB 1RAGB 3HHEA 1MN9A 1A7LA 2X26A 1EKSA 2G0JA 2LEBA 4YKIA 4G68B 3QIDA 4Y2CA 3FSIA 2ESNA 3HVRA 4D3GA 4LF9J 2XY5A 3TODA 1JNZB 1HI1A 2VA3A 5JVHQ 3TQWA 2IM3A 3K6XA 4WXOA 3OUYA 5KG2A 4MNIA 2R9JA 1Q5VA 3BBBA 3ENWA 2KVQE 1J5EJ 1BHNA 4CDIA 4NQ8A 1NJIT 2FTRA 3QMFA 1U1KA 1ZA2B 1VQKS 4OVJA 2UXAA 1D9FA 1PBQA 4I6YA 4P75A 4J9OA 3H06B 1KONA 1RKIA 3DRYA 2PO4A 4D3HA 1VFDA 3TR5A 3PYGA 2I3VA 1O8BA 5A6WA 3KSXA 4FNHA 3OFGA 1T3OA 3CF5Q 3GMGA 3CCRS 3MPUB 5JEIA 1X9SA 4IQMA 4P1EA 1LWEA 1Q7LB 2XMKA 4JI6J 1C1BA 3M2VA 3MVWA 3SMZA 4HH0A 4F2OA 1HHTP 5B0FA 5EYGA 1IBCB 1R7IA 4CLZA 1ULRA 3IN5A 3EICA 1SL0A 1P1WA 4RNSA 2JEGA 2XXHA 1GFWB 3E2EA 2MY8A 4URGA 4PKDB 4DOZA 3B8BA 3U8QA 3MCNA 4RBUA 5A2QY 4H5GA 2FLOA 4TN2A 5ET7A 1LV5A 4MBPA 4DPYA 2R7RA 3U92A 2DH8A 2D1CA 4MKAA 2X3GA 2ZBQA 3UA8A 3L7PA 5C42A 4L3KA 2BQ3A 3K59A 1VK3A 3L6HA 1KTQA 1YHQS 5GAGU 1OQ3A 3VDFA 2QL5B 1N32J 4U7UD 2R2RA 4KE5A 4P1LA 1NKEA 5I3SA 1M5KC 4JV1A 3JSBA 4NX1A 2WOMA 1FRJA 3D1QA 4H4MA 5AA2D 1XC9A 1UP1A 1TKXB 3TOQA 1WG1A 3CE8A 4JI4F 2VIHA 1D9VA 3VLVA 2HGMA 5RUBA 1HNXJ 1RSCA 5D0GA 2PI4A 3OUYB 1NK6A 4NCGA 2ZYNA 1RT3A 1YWXA 2AJ4A 3IJXB 3Q8PB 3PIOQ 2ZKTA 2UUAJ 5F8NA 1U1PA 4DSKA 4OVQA 3CJRA 1H3DA 1SUQA 3CJ5A 2C2ZB 4IB2A 2OEJA 4DX8H 4PBQA 1NI9A 2ILYA 4H8JA 2VBWA 3AB2B 3PUWE 2R8IA 3H7HB 2R8TA 4ZP7A 1Q8IA 1FWPA 5EN1A 4FORA 1TL7B 3GIJA 3KHGA 4LIRA 1RHQB 1IMBA 3QIMA 4RJZA 2R3VA 3SI8A 1NV6A 3OFEA 4JVIA 2R71A 1NSKL 1Y3JA 4FIMA 2MLXA 1FEHA 4Y2IA 4AL7A 3M8YA 4UQGA 3PR4A 4L17A 1VIOA 2PE8A 1T9TA 2BQRA 3CJKB 3S9EA 1D3KA 1YZ0A 1GH8A 4X4TA 1RT7A 4N91A 4R0JA 3G3FA 4H8IA 3KLHB 1HW8A 1CNQA 3EYZA 4AB5A 2OAUA 3JV9A 3QSLA 3G8QA 2AJ0A 3K1PA 5IV3A 2DRBA 1B2HA 4ZKAA 3CFXA 4U8YA 1UWAA 2IVFB 4JI1J 1C1CA 4YMAA 3IR6B 1X9WA 3SCKE 4EEYA 1SYIA 3TTKA 2CNNB 5M2UA 3PEHA 1UFKA 2YNHA 1H2TZ 3BBCA 3RBEA 2XXTA 1QSLA 2UVGA 1NXIA 3C35A 1FJEB 5IKBA 3A8KA 1RI7A 2GGPA 1TL4A 2LAOA 3UPFA 2RSQA 3W2WA 4XF5A 2Q79A 4ZP8A 4NPOA 2NZCA 3OSQA 3FBFA 4BDNA 3U72A 2DEIA 1H74A 2L08A 2AL5A 4XEQA 4PXDA 3AAWB 3VALA 1K0VA 1T3NA 1L3KA 3PYFA 1P1OA 3ZTPA 4OJ3A 2U2FA 4G65A 2RC9A 5F8LA 4NF4B 2N4CA 3TUZC 1VBKA 2VT5A 1N34F 3CB4A 1OVTA 3OW2R 3DNCA 3OR1B 4BHQA 3CEDA 2B3FA 1WKJA 1JETA 2FY8A 1H98A 1WF2A 5C2GA 3JTNA 1Z2LA 4DR4F 1HBMB 2BW7A 1U2CA 3JQMA 2Z23A 4NYOA 1G0IA 4N47A 1RDYA 1N32F 3HJVA 1B9JA 4M63A 4PQAA 2JZ5A 5D3GB 4O3AA 4I1DA 3CNQP 4V1Ak 5DYHA 1YRTA 1N36J 4TY8B 5LDZA 3HZEA 1QAYA 2UUBJ 4GF8A 2RDDA 2N82B 2GZOA 4C3KA 2Z2ZA 3UN5A 4X4OA 3M2RA 4PG5A 2MQQA 4IRDA 4AYBD 1XMOF 3K2YA 4KGZB 4CLUA 1YAEA 3FNNA 5HQLA 2Q6CA 3MGJA 1PAEX 4WFNQ 4HE2A 4FZVA 4ZE9A 4O3RA 1JKHB 4JP8A 1L3SA 3SESA 3IS9B 5AA1A 4WP8A 2KLFA 1FTJA 2V8PA 5AXLA 4CT8A 2RKMA 2OFHX 1Q5YA 2Z58B 3JYRA 4U22A 5KFRA 4G77A 3SEVA 1S77D 2OH2A 1F5AA 2UUAF 3MI7X 1Y10A 1FTOA 2LMIA 1S4EA 3M4XA 3HHGA 1WEYA 2LFVA 3HVTA 4PGPA 3MHYA 5ITHA 3IS9A 2NCKL 4XDDA 4MH8A 4HW8A 3TARA 3KG4A 5EQAA 2GHAA 3QLHA 4OFJA 2FHOB 3U1LA 3DLGA 3NS6A 1IKYB 1UZHA 2BE7D 3A4TA 3VVDA 3IJOB 4N17A 5DGAA 3D68A 4C3LA 4NA2A 4G1QA 5GAEU 1Y9UA 2H4IA 4DUZF 4BDRA 2BV3A 5KFFA 2CPJA 1N3XA 3I0SB 2NZ4A 4TNOA 1VQPS 2E5IA 1BLUA 4I69A 1EZPA 3MMCA 1NH7A 2F3DA 4TQUQ 3UORA 3TI0A 4PAFA 2CQ2A 1M5VC 2QPQA 1UKUA 1SVXB 5A6PA 2Y8WA 3OXFA 5F8GA 1D9DA 5FLXU 3CIZA 2YKAA 2AGQA 4URQU 1YDLA 1UVJA 5I7IA 5IV4A 1ZMGA 3AQOA 3J7AN 1RTDA 5H8HA 3EE3A 3LQVA 2KFZA 3TAMA 3KBZA 2X7PA 4IYQA 2O68A 2HNYB 2ABYA 2BXJA 2ZDPA 2KU7A 1KKHA 1U6FA 4G2ZA 3C32A 2Q2AA 4HT7A 3MEKA 4ZEFA 2OWTA 4QR2A 3SEXA 3TQEA 1HIYA 4M1VA 4TY8A 2HFZA 2DP8A 3PX0A 1Y7PA 3O44A 3DMJB 1S99A 2MTLA 4QR0A 5T41A 4PCQA 1FTCA 1OPZA 5LXYA 1S1WA 3MW0A 3N6TA 3T9XB 4ES3A 2F7AA 4P6QA 1P1QA 3S7RA 4AQYF 2WEFA 1VBXA 1FXRA 4ECUA 1RWUA 4LFCF 1AXQA 2CADA 2CPIA 5KG6A 3NRBA 3M05A 4OZNA 3HULA 3ILTB 2XWXA 1X4HA 2F4VJ 1B3GA 4A8XA 4DX7A 3L09A 3GV7B 3SEYA 2ZBRA 4IY6A 2KXHA 2B51A 1NV0A 3ITHA 3PJXA 3MVYA 2BZ2A 3DDNA 4GWUA 5E0OA 4YB5A 1VR6A 2HHWA 5E2QA 2WSCC 5D4OA 2W4PA 3MD3A 5CD4A 3T66A 1R89A 2H4WB