2QMXA

The crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
278
structure length
278
Chain Sequence
NWLIAYQGEPGAYSEIAALRFGEPLPCESFDDVFSAVTEQKADYAVIPIENSLGGSIHQNYDLLLRRPVVILAETFVKVEHCLLGLPGASVETATKAMSHPQALVQCHNFFATHPQIRAEAAYDTAGSAKMVAESRDKSALAIASKRAGELYGLDILKENLADEEWNITRFFCIAHENNPDISHLKVRPDVARQKTSIVFALPNEQGSLFRALATFALRGIDLTKIESRPSRKKAFEYLFYADFIGHREDQNVHNALENLREFATMVKVLGSYGVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of open (R) and close (T) states of prephenate dehydratase (PDT) - implication of allosteric regulation by L-phenylalanine.
pubmed doi rcsb
source organism Chlorobium tepidum tls
molecule tags Ligase
molecule keywords Prephenate dehydratase
total genus 85
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qmxA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmxA02
2P1SA 4YB5A 5CM6A 2GH9A 1NNPA 3JV9A 3HHGA 4G8MA 4U1ZA 3T96B 3VLWA 3N94A 5CMKA 1ELJA 4TLMB 1FQAA 3N6TA 2QSXA 4NWCA 1CB6A 4HCWA 3R7XA 1FQBA 2GFEA 2NXOA 2ABHA 3IL1B 4HS7A 5I58A 3ENWA 3K0VA 4H8IA 3KSJA 4NF6B 4Q5TA 1AOVA 1A7LA 1D4NA 3FIRA 1IUDA 1URGA 5AA1A 4NMYA 1IZ1A 4POXA 4YMBA 3CFLA 3IX1A 3Q29A 5DYHA 4EF2A 1M5FA 2F7BA 2LVWA 3L7OA 1SYHA 2HEUA 1QKAA 4KYSA 4F2OA 2V3QA 3C32A 5L8DA 1IXHA 4H8JA 5EHMA 3TCGA 3U93A 4R2FA 1JETA 1H43A 1MM6A 2O1LA 1Z7NE 2XXVA 2DXRA 3MJNA 1D9YA 3EPEA 3E4RA 3RUMA 3ONMA 2OLBA 4G68A 1UTHB 4ZEDA 1XVXA 3CVGA 4FAJA 2I48A 1BIYA 4ZE8A 1DPEA 2X26A 2DQVA 3C33A 4PFUA 3TTMA 3MC2A 1A8EA 5TP9A 4OEVA 1US4A 1LBBA 2OCUA 3VDFA 4QFPA 3CG3A 3TUIC 2F8DA 1VFDA 3GXAA 3V8XB 2PC6A 4AB6A 2X7PA 4NF8A 4OZ9A 3ENQA 3P7IA 4E0WA 4JB7A 4M4GA 3PUVE 1B7ZA 3E13X 4KR5A 4QFNA 2X7QA 1MXXA 5DEXA 2JOQA 2HAUA 1LKZA 4OERA 1FCKA 5I2NA 3MVYA 3TTKA 3OELA 3PUWE 1SDXA 4X48A 3RT8A 1URDA 4QSEA 2DP8A 4AQ4A 1B2HA 3ILUB 3EHTA 4R6HA 4JSOA 2Z22A 1OLCA 4M1VA 1YCJA 4F3GA 2Q8JA 3VE1B 3SKPA 3TELA 3QUFA 4PWUA 4NF6A 1B4ZA 2B3BA 4PFWA 4NF8B 2CDQA 5KZTA 2RINA 4XIGQ 5KCJB 4ZEIA 1B7UA 3KOSA 4OWDA 1QUIA 3S1TA 3B6WA 2UYEA 1MQJA 3KOTA 3LSXA 1LBCA 2RKMA 4DIGA 1QUJA 3S9MC 4N07A 3RLFE 5B7DA 1VE4A 4F1UA 1SBPA 1SW2A 3CG1A 1ANFA 2NVUB 2ALUA 5HM4B 2XXIA 4NWDA 3PD9A 2RC8A 2B65A 5I84A 3O1LA 4QHQA 1KS2A 4F3BA 4DZ1A 1LK5A 2I3VA 3C36A 1MPDA 3Q26A 3B6QA 1N04A 3EQ1A 3S9NC 2Y7IA 4GXSB 4G4PA 3BFUA 5H8FA 3LSWA 5H8FB 3GZGA 3PV0E 5CMBA 4FEDA 3RN8A 3Q25A 1MPCA 1N7XA 1MPBA 4EQBA 3PMVA 4NMLA 5TP9B 1S7YA 3LC8A 2V25A 3UGWA 3SESA 1Y4TA 3SDFA 1SI0A 1FTKA 2ZYMA 4GXAA 2XXXA 4MFIA 3U92A 3RPWA 3BFTA 4R2BA 5K2XA 2BJJX 3PGFA 4IO7A 5EHSA 4DXUA 2O7IA 3KBRA 2MDAA 3R26A 5H8HB 1P1UA 2DT9A 1ZPVA 1MXVA 1B46A 1F9BA 4GIZA 4U21A 4LZ7A 2V3UA 2CMOA 2DTJA 5IS2A 5H8HA 3VVFA 1PBPA 4ZZEA 3FGSA 2D21A 1OMPA 1JQFA 1SYIA 2WKYA 2XXWA 1MDQA 3EHSA 1IQ7A 4F2QA 2Y7RA 2H98A 3MPLA 4EQ7A 4GFRA 4GO5X 4F1YA 4ECFA 1B40A 4UA8A 2NOOA 1SW1A 1NMUA 3MWBA 1OLAA 2V93A 1LCTA 3TZAA 5CC2A 1UJ5A 3OO7A 1LCFA 3G7WA 3G3GA 4H0WA 1B0LA 3TAJA 2GRVA 1HSEA 5AA2B 4F3PA 2OWSA 4AB5A 4ZDMA 3MZ9A 3SEUA 3MUQA 3D4CA 4YICA 3O97A 4DLDA 4IO5A 3TUJC 1RWUA 3UIFA 4YKKA 1FTLA 2XXYA 3C4MA 1MS7A 3ILTB 3E3KA 1FQEA 1LFIA 5DVIA 3IO4A 3O28A 3FVKA 2PA3A 1WVJA 2PYYA 4GL8A 2I4CA 2Q88A 3B6TA 1EU8A 3DM0A 3FASA 2XD3A 3H6VA 1TT1A 4GQOA 4ZE9A 3TUZC 5KDTB 4GRKA 3FZVA 3K6WA 3PPOA 4IO2A 1HSLA 4R9FA 2RF1A 4OESA 4LQ2A 2QPQA 4UACA 1MXYA 3W7BA 1DMBA 3G3IA 3K02A 1S9TA 4P11A 4U2RA 3CR9A 3M3FA 2Z8FA 1M0SA 5H8NB 2F97A 1A40A 5K2YA 1RYXA 2ZNTA 2I3WA 3OOAA 1A54A 5HBCA 2GHBA 3RT6B 1B51A 3H7MA 1GR2A 2NUVA 1S50A 4GOTA 1B52A 3QAXA 3RNNA 3CSGA 3KWMA 4X1BA 4LATA 2W7YA 3MAHA 5ITOA 2ZNUA 5H8QB 3OMBA 4MLVA 4ONYA 1IEJA 1L5TA 4ELOA 4ESXA 1B7HA 5TPAA 4RY1A 2VHAA 5CBRA 1DPPA 1MY0A 2E0SA 1CE2A 3GBAA 3TCHA 2DYXA 1YGYA 1MRPA 3W9VA 3TDJA 4QFLA 1BTJA 3CIJA 1JNFA 1H45A 3A09A 3E9XA 4FIMA 4XKPA 2PMSA 4H6DA 2RQKA 1QJMA 1II5A 5B70A 1N76A 3SEYA 1BLFA 5I59B 1P1OA 3MP8A 3VXBA 3ODBA 3RTFB 4OFOA 4M8LA 3FVGA 2R6GE 2F5XA 4YB7A 3T9VA 3K1NA 2NYIA 3G3KA 4X1DA 3G3FA 1B3FA 1FTMA 3USDA 4NEDA 4OXVA 3OSQA 4BLAA 5FIIA 1ZMGA 5ISUA 5JTYA 1D9VA 4IGTA 4GLIA 1B3EA 2ZYNA 2Z8DA 2H4IA 3MP6A 4HTGA 1B3GA 5L9MA 2PT2A 5CMCA 2H9BA 3K01A 4G68B 5BWJA 1UTHA 3N5LA 4U23A 3RTWB 2D5WA 2DSFA 1US5A 1SD3A 3KJTA 1B3LA 1MQIA 4I8CA 4ZEKA 3CFZA 2F1FA 2DE3A 3MP1A 3R6UA 4YKJA 4MH5A 1QVSA 5ICTA 4Q0CA 4ELRA 2B3FA 1XTZA 2I9SA 1H44A 2GHAA 4POWA 1B1XA 1A8FA 2OBGA 3HO7A 1MXZA 3CRBA 4OMBA 5AA2D 3OEMA 4OYVA 5TPAB 4ISUA 1Y3QA 5IKBA 4MF3A 4O3AA 1SQYA 2XD2A 3PD8A 4KYDA 4TLLB 1R1NA 1LLSA 2Z23A 4LVQA 2LQJA 2Y7PA 3HV1A 3MPKA 1MQGA 4KCCA 3M3KA 3MVWA 4BDQA 5A5XA 1Y3PA 2VOZA 4G8NA 1B9JA 3O6IA 3CFXA 5FHNA 3VV5A 2OJTA 5I57A 1IXCA 4WEDA 2H25A 3MQ9A 2XXUA 2H9ZA 4LUBA 3TTLA 1Y3NA 1IXIA 1LGBC 3IOTA 3OFFA 3OXNA 1USYE 2HFBA 2OK2A 4XKRA 2IEEA 4KCDA 2I4BA 3N0VA 4YMAA 3TQLA 2O84X 5CRYA 1N3WA 1NFTA 2G93A 4RK9A 2NWJA 4YB6A 2QJEA 5AA2A 1MQDA 4LQ5A 1B05A 2XX7A 4WKMA 1Q35A 4H5FA 5CMMA 3H03A 1TWYA 2A5TA 2DE4A 4H67A 5JTYB 5F7VA 1B1HA 3M8UA 1SW5A 3EF7A 4OHNA 2QMWA 1A55A 1B0HA 4KQPA 2ONKE 4EF1A 4P0GA 5IT0A 1MY4A 2Y84A 2UVIA 5CBSA 1WODA 3THIA 3HCQA 4NTLA 3PMWA 5J1DA 5I2NB 1Y4CA 3IOUA 5HPQA 3TCFA 1M5DA 3MAMA 3ENVA 4G2ZA 1NH8A 1YBAA 4ZZAA 1R9LA 1O7TA 1MXWA 3N26A 2QMXA 3LR1A 3VLUA 1XVYA 3T9UA 4YKIA 4WEPA 2H99A 2M8CA 3S2VA 2F78A 4NF4B 4LZ5A 3TUSA 1DSNA 1QUKA 1PDAA 4R72A 1ZBMA 2D3IA 4HW8A 2Y7KA 4NE4A 1P1WA 2O51A 4E0XA 4MBPA 3HHFA 1FQCA 2AL4A 2HZKA 2RC7A 1H3DA 3DP8A 2QRYA 1OVBA 1OQHA 1MDP1 1R9QA 2F36A 5DEXB 1PB8A 1FW0A 2THIA 4C0RA 1AH5A 4DXCA 4F31B 1LAGE 1NNTA 4R6KA 4WXJA 1H76A 3TODA 3CSBA 2XXQA 3U1OA 1WDNA 2Z8EA 1GGGA 4P0IA 4OTEA 3IXQA 4EUOA 1M5CA 1ZTYA 1EZPA 4TOZA 1IITA 2QSWA 1UIVA 3UP9A 4XTCQ 3F11A 5ICQA 5AA3A 1LSTA 5F1QA 1PEBA 3KFMA 3PPNA 4O3BA 1LAHE 2KO1A 4G8HA 2QS1A 3JZJA 1VR5A 3K00A 1ZJLA 3FXQA 3RY3A 3V83A 3IBWA 5EYFA 3EN3A 2Q2CA 3T9XB 1JW4A 5AE4A 4G77A 2KLFA 1SVXB 4C1TA 1LAXA 1PB7A 1GVCA 3PU5A 2PT1A 3U94A 1TFDA 2DVZA 4X9TA 4JWOA 1LFGA 3H3GA 4H65A 3UA8A 3TFLA 1I6BA 4F19A 2AIXA 3ZKKA 4H5GA 1LK7A 1MY3A 1Y1ZA 1UTBB 3OBIA 1MH3A 4QFKA 2FA7A 4RNSA 1R6ZA 1ZKBA 1NNKA 5I2KA 4IO6A 4LONB 3HPIA 4GWOA 3I6VA 4PFTA 1VSOA 3IB1A 4ESWA 3OFGA 4BDLA 3S4UA 1HSJA 2XXTA 3FATA 2HQ0A 3FJGA 1MQHA 4OEUA 4GMKA 1QW0A 3IK6B 3I5OA 2F35A 1YAEA 1XS5A 1RYOA 1J1NA 3A3UA 4IO4A 2R71A 4K3FA 5DTBA 2DOJA 3DELB 3K2DA 1MH4A 1YTVA 4JDFA 4F1VA 5T41A 4O3CA 2J0WA 2VD2A 4RPOA 3OO8A 2XX8A 4ZEFA 3U7JA 5I2KB 5FHOA 3QSLA 1TXFA 3DLNA 3UORA 2CZLA 3MZBA 4NF5B 3H4ZA 2I0CA 2HAVA 3EHUA 3KN8A 2ZHOA 2AL5A 3K1MA 2I49A 3IR1A 4TQUQ 4LP2B 2V84A 3PUYE 4I62A 4QFOA 3O66A 1MY1A 1EZOA 2DS9A 3TKDA 1A99A 3LSLA 3NRBA 3H6UA 4I1DA 2XX9A 2HXWA 1OQGA 4Q30B 3UN6A 3KSXA 4EQ9A 1DOTA 4R74A 3H6WA 2VD3A 4JXIA 1O64A 4GL0A 3TEPA 2FGCA 3K6UA 4JSDA 1ZIUA 4JWXA 4EXLA 5DT6A 2A5SA 2Q9TA 3KN3A 2ZXTA 3ZKLA 3WAEA 4QF9A 3IO6A 4F22A 3B7DA 4EDPA 1UTBA 4QRZA 4DCXA 1M5BA 5DVFA 3HHEA 3W15C 3KZGA 1EH3A 2P2AA 2Q89A 4OVJA 4OENA 4THIA 3C31A 3OFEA 3ECRA 3AB2B 4YU0A 4KD5A 1JVXA 3SETA 3Q28A 3FUZA 1YPNA 1B6HA 2DWHA 4GF8A 1LAFE 2DXYA 5KDTA 3G3HA 2I6EA 1MXUA 1Y20A 3OD7A 5I56B 1NL5A 4NF5A 3T93B 1I6QA 4DDDA 2HZLA 5I56A 4ZS9A 1JW1A 4DE8A 3S9LC 4KFQA 1XOCA 4I9DA 2REJA 2Q2AA 3TTNA 3IAZA 4IO3A 5LOMA 3QXMA 2RQMA 1IIWA 4IY6A 2DWAA 3DP6A 2J0XA 4X84A 3H06B 1P99A 4R73A 3UW1A 3KN7A 4QSCA 3V89B 2ZNSA 1N7WA 1FQFA 3KEIA 1EZ9A 4EXKA 3PPPA 4G68C 1O8BA 3K5PA 2AYSA 3T9HB 4OFJA 5M2VA 5FHMA 2QL3A 2ZMBA 4IB2A 2I0BA 5BUUA 2QS2A 2IA4A 2F6PA 3FJMA 1NNFA 2ONRA 3QYTA 1USYH 4N13A 4FECA 1NH7A 3TYHA 2RE1A 2OZZA 3SEWA 3MVXA 4KPTA 1O63A 1B5HA 3U72A 3FV1A 3I3VA 4F18A 3LSFB 1URSA 4PP0A 1RKMA 3LUYA 3KGCA 2FYIA 1POY1 3PPQA 2ESNA 3OSRA 5DVJA 5JK4A 1T0KA 4BDNA 1MY2A 3V5AA 4RXLA 3IOVA 3QIMA 3VVEA 1FTJA 2UYFA 1JEUA 3A3CA 2DWJA 1UJ4A 1Z7ME 2Y7WA 3C9HA 3VXCA 2F7AA 4Z7EA 5H8QA 1B5IA 2QS4A 1PB9A 1P1QA 2RCAA 3U8QA 4JBZA 4U1OA 3GBBA 5I59A 3D4GA 1JW5A 5L9OA 4YZZA 4BDMA 3C35A 2H5YA 2V3TA 3HN0A 3DP4A 3TTRA 4R75A 2ANJA 3O6HA 2UVGA 1PC3A 1N84A 5ITPA 5FTIA 2UVJA 4FJPA 4F39A 4GD5A 4KHZE 4PE5B 1PSDA 2XXRA 4Z0IA 3LOUA 2O6AA 3MZ1A 3O9PA 2DWIA 3TPAA 3QUJA 3LBSA 4FEBA 4BDOA 2PX1A 5CI5A 3DDNA 3BKIB 4HCYA 1LFHA 1DTGA 1XC1A 3DC2A 3Q27A 2P9EA 1OIBA 2RCBA 3PMXA 4FORA 3PUZE 3K4UA 4RYAA 4R9GA 1QKBA 2I58A 1Y9UA 4GO7X 2PVUA 2O1MA 1N3XA 2YPNA 4C1UA 3JYRA 3IOWA 1M5EA 2P0SA 3DHWC 2XXPA 2DE2A 1LB9A 2O7UA 3P96A 3WAFA 5H8SA 3MTJA 3RQTA 4JWYA 1DTZA 3MBPA 2XXHA 3FD3A 5A5XB 3PUXE 1IXGA 3T66A 3VLVA 3CEDA 3TMGA 3O29A 1OVTA 1QULA 1P1NA 1TFAA 3M3LA 1ZLQA 3C34A 1N0TA 3K1PA 4RK2A 5IT4A 1B4HA 2R9JA 4Q8RA 1ATGA 3AB4B 1VFEA 3FXUA 4LA9A 4ELPA 2DVCA 5FTHA 4N6PA 3QK6A 3AAWB 1B5JA 4RA1A 2PBWA 4YAHX 2OWTA 1FQDA 2ONSA 4IY5A 1UIUA 2O69A 4BDRA 1POTA 2ZYKA 2QRRA 1Q1KA 3FVNA 1UJ6A 3BBRA 3PPRA 1Y1MA 2ZYOA 2YLNA 4OFLA 3SERA 1AL3A 5I58B 1GTKA 5H8NA 5I57B 1SI1A 4KI0E 4R6YA 2UXAA 4ELQA 1NKXA 2F6GA 4F3SA 3IB2A 1GV8A 1SW4A 4DCYA 3FVOA 5IAIA 1MM7A 4F29A 2REGA 5KCJA 3CI8A 2VGQA 2HCAA 1JVYA 1B58A 1XHYA 3OO9A 4ZEBA 5TU0A 3GLBA 2JHEA 2E1SA 5L9SA 3VVDA 1U8SA 3OENA 2F34A 3W9WA 4IGRA 2VP1A 5ELVA 2P9CA 4XXUA 5AA4B 1ZU0A 4RJZA 5AA4A 4U22A 2F8MA 3H6TA 3HSTA 3FJ7A 3VFJA 2G29A 3DHXA 2UVHA 4U4XA 3SEVA 4PETA 1B32A 3K6VA 3OFHA 4FATA 2P9GA 1PBQA 4OETA 1AIVA 4FE8A 4GVOA 1UQWA 3K6XA 4H1XA 4XKNA 1I69A 4MLQA 3O6GA 1LB8A 3OEKA 3MW0A 4IO1A 4OQOA 4DXBA 2O68A 3RGYA 3S9EA 3IJXB 1SC6A 3L6HA 2A5TB 3FV2A 3O2AA 3IB0A 2YJPA 3N6UA 3G3JA 1BP5A 4KYEA 4PQJA 4YKPA 3KJ7A 1MG1A 3ZSFA 5JJBA 1I6AA 5JEIA 1Y7PA 3TQWA 2LAOA 3L6GA 3OO6A 3AXFA 4QSDA 3UK4A 2FNCA 1B3HA 4U4SA 3FXRA 3IORA 1AMFA 1XT8A 2F7CA 4PFYA 3T22A 4ND9A 3MVZA 4LZ8A 3ZS6A 1JEVA 4NF4A 1BKAA 2QS3A 3SEXA 3KG2A 4ZECA 1D3KA 1KWHA 2XHDA 2RC9A 1FTOA 4L17A 4XKQA 4RPNA 3IJOB
chains in the Genus database with same CATH superfamily
4JP8A 2IAJA 4YB5A 4FZVA 4WU2A 3D28A 1NNPA 3VAGA 2QL7B 3VLWA 4LVOP 3JQJA 2C28A 3IMQJ 1FQAA 3DXSX 3HXMA 1N48A 2JWNA 2YX1A 3FUYA 2XGQA 4H8IA 3G82B 4N81A 4NF6B 1A7LA 2ZEJA 2CZVC 2RDIA 4NXMF 1O6XA 1YQHA 4MIAA 3QGHA 2XTJP 2MGZA 3I82A 2XO6A 4B3RF 5EQAA 1S0OA 3KJNB 2ASYA 5D3GA 1HWUA 2ZM6F 4NCGB 1SYHA 1HQEA 4KYSA 4F2OA 3C32A 3FMWA 1BQMA 1N8RT 2WRMA 3N4WA 3KMSA 5K5MA 2DGTA 4H8JA 5EHMA 3TCGA 3U93A 2JDJA 5H1SV 2F9JA 2IVYA 2O1LA 1Z7NE 2CJXB 1RAOA 3M2UB 1D9YA 4C11A 1PGZA 2W9BA 1NUEA 2CADA 1J5EF 2OLBA 2BR0A 5HVGA 1UTHB 4ZPBA 1HQ2A 4YDDB 1FNMA 4NLTA 4HE2A 4FAJA 2I48A 4F3QA 4KT0C 5KFPA 1RTIB 3DN9A 1I6JA 2DQVA 4Y65A 4TYAA 2XWKA 4PFUA 2FJAB 1F2GA 1VBZA 4TN2A 1KA1A 3E51A 1EQ0A 3AQOA 3TNVA 5DLGA 3VDFA 4QFPA 3CG3A 2F8DA 3JYTA 2X7PA 1CJUB 1GMWD 3NBPA 4O4GA 4ID5B 4KY3A 4JB7A 3W5ZA 2RUGA 3MEEB 1U2FA 4A47A 3GYNA 3E13X 4EO8A 4F4YA 4R25A 3KK1A 2HQCA 2C22A 3CCZA 2E44A 5KG2A 3KHGA 1NJYA 3KHLA 5DEXA 2JOQA 2HKEA 1LFPA 3IG1B 2D9PA 5I2NA 3MVYA 4EBDA 2VOOA 3KLVA 2DGXA 2VG7A 3CCLS 1B99A 1SDXA 4X48A 3RT8A 1T05B 1URDA 1J5OA 2DP8A 4AQ4A 1B2HA 3EHTA 4KGXB 2AJ0A 3D9BA 4R6HA 2XHCA 1YCJA 2Q8JA 2B9YA 3VE1B 2GQ1A 3QUFA 4NF6A 3W66A 2F63A 2CDQA 1HW9A 5KZTA 4I6AA 4EWTA 4OWDA 1YX2A 5JVGQ 4LF4J 3B6WA 3KOTA 2RKMA 2ZZTA 4DIGA 1QUJA 4QXDA 4N07A 1S6UA 4ZPWR 1SBPA 3G87A 4NI2B 2UUWA 3CG1A 2AHOB 1ANFA 2APOA 2V50A 2U1AA 2OGUA 4NWDA 4NLUA 4AL5A 2B65A 4DN9A 2YQ1A 2QFJA 3O1LA 4ZKAA 1I51B 5CXTA 3C6TB 4OVSA 2QA4S 1IMBA 5BYQA 1LK5A 3ZTPA 1YZ6A 4ZOSA 2CQDA 2I3VA 1MN7A 4CM0A 2MQQA 4O0NA 3Q26A 3B6QA 3CE8A 1NUYA 1PBUA 3HD2A 2Y7IA 4KPYA 3KLGB 4G4PA 1YHQS 1LBWA 4PDHA 1U6ZA 2DGVA 1TKTA 2FTRA 5HMZA 5KFCA 1JLQA 4XPEA 3OLBA 1MPCA 4JI2J 2ILYA 1SIWB 3CWJA 3PEHA 3UGWA 3PACA 2EFVA 3SCKE 1LQ9A 2DIUA 3GFYA 2JRSA 3LW5C 1Y4TA 4J7CA 4MTPA 1HHQA 5HI7A 4DXLA 1FTKA 2ZYMA 4GXAA 4NCGA 2DKOB 4LR7A 3T1YJ 3GONA 2JC0A 2Q43A 3G8TA 3B54A 2OD4A 4KH0B 1J5OB 5IZ3A 2O7IA 2H3EB 3KBRA 2MDAA 3A29A 4G1QA 3U02A 1T0TV 3BYRA 1VHIA 1B46A 1FBEA 1S9GA 4GIZA 1YITS 4FYYB 4LZ7A 1B7FA 2V3UA 2H51B 3KLFB 2COLA 3MZIA 4N41A 2CMOA 5ESYA 2LQ8A 4IG3B 5H8HA 3FXBA 4M63A 5E3CA 4UY85 2OTJS 3ZTSA 1SC4B 2V4JA 3EHSA 1RA7A 3A8IA 4F2QA 2P5VA 1U09A 3RB3A 4UOCA 4EBCA 3FBFA 1HLWA 5KG0A 2CQHA 3T3FA 1GMUA 3TAMA 2V93A 4IOAQ 1OLAA 1TVRA 5FLXU 1LCTA 2UVRA 3AD9C 5I5PA 2AEJA 3VVUA 3SDEA 3DGPB 2YKNB 3KUEA 4Q43A 3MCOA 1Y11A 3R3TA 5AA2B 2G1DA 4CLYA 4QPXA 3U65A 4NF0A 3EWGA 1KBRA 2OWSA 1Y3KA 2P2CB 3LPEA 1JLBA 2HIQA 4D3HA 1NPPA 2PEHA 3F41A 2VG5B 3TUJC 4UABA 3M4XA 4DSEA 1FTLA 3CVKA 1UVKA 4KIAA 2JX2A 2A2DA 5I4MA 1RT4A 2AJFE 1WUUA 1UW4A 2R8IA 1TKTB 3HSZA 2V2KA 1WC1A 3KJFB 4B3OA 2V5HG 3B6TA 3T19A 3RB0A 1QSLA 3FASA 2YXLA 2A2CA 4ZE9A 2YKMA 4IRKA 2F65A 2QIFA 4GRKA 3FZVA 4IO2A 2QPQA 3W7BA 3E79A 4RW6A 3OPKA 1UMJA 3WZ0A 2VQFJ 1A9NB 4OX6A 2D69A 3TOQA 3RBEA 5C25B 1A40A 5E33A 2VU5A 1RYXA 1IR0A 3BPDA 2I3WA 4WE1B 1A54A 1EHWA 5HBCA 2Y1JA 3W9HA 1C0TA 4O3OA 4QWDA 2V94A 1FK9B 5B08A 2HHUA 1KLMB 2NUVA 4AQYJ 1RI7A 3TA2A 3KWMA 1IQTA 3MM8B 2HMIA 2ILZA 1E6YA 4A48A 2KTQA 2MZTA 2KJWA 3JSMA 1C1BA 3TEHB 3GTYX 1U25A 3PCOB 3NS6A 4V1Ak 4DX7A 2HHVA 1IEJA 2FGOA 2V63A 1U2CA 2DXFA 4Q44A 2EFQA 4P2SA 1DY3A 5CBRA 1MY0A 4ECQA 2M7SA 1CE2A 5BR8J 3TCHA 2VJVA 3W9VA 1ELOA 1CBKA 4DV7F 4PUOA 2X51A 1F9FA 2GMJA 1N5TA 5AE3A 4DR6F 3MUMP 2BJDA 4XKPA 5EQ7A 2YKAA 2BX6A 1S72S 3AH6A 5I59B 1TV6A 3MSTA 3DOMA 3RRHA 3VXBA 2VPWB 5HAOA 1JJCB 4YUDA 1VK8A 4QU6A 1EP4A 3EJMA 4M95A 2R6GE 3IWLA 3UVJA 2HFZA 2B4VA 5D8HB 4D3GA 1WDDA 1SH0A 3POTA 2UUBJ 2HRUA 4NX1A 2VC1A 1KDNA 1EP4B 3GIJA 3BGFA 4JI3F 4URGA 2GV1A 4NEDA 1IKVA 5JTYA 4RW9B 4Y28C 2RJZA 3SZ2A 1D0EA 3MP6A 1YK9A 4IO9Q 5CMCA 4M5KA 2H9BA 1PC4A 3K5NA 3IFCA 5J2MA 3MD3A 4NCBA 1FBCA 3QPIA 3KJTA 5EGYA 4ZDNA 1HPZA 4DR3F 2CPEA 4I8CA 4ZEKA 2F1FA 2NZ4A 1N6QA 2C2ZB 4OX7A 3D3CJ 4PPDA 2MHEA 4JUZA 1B1XA 3W64A 4DV7J 4DBQA 3ZNUA 4XTTA 3M2RA 5SUHA 4DG1B 1FTRA 1FJ9A 2OIHA 2YQ0A 3QAEA 1N5YA 4QBAA 4TLLB 4KE5A 1LBYA 2VOPA 5CYMB 3E3XA 1JNRB 4DR2J 1XJWB 2Y7PA 3HV1A 4N5SA 2B43A 1VR6A 4WE1A 3DLEB 1OO0B 1LNQA 4KCCA 3KLEA 3MVWA 4BDQA 5A5XA 4G8NA 2VL1A 1N32J 4EU0A 1HD0A 2WBRA 1M5KC 2H25A 3UFCX 2R7XA 3MQ9A 1AW0A 2H9ZA 6FD1A 2O01C 4P72A 5DETA 4F04B 4CYUA 4Q7AA 2HFBA 1JWWA 2D7SA 3CT9A 4A8QA 3NGUA 2HMIB 3TQLA 2O84X 2VFVA 4USVA 3F0NA 5CRYA 2HLUA 3B4MA 4OX8A 2HYIB 1U1PA 1RAEB 3JS9A 2G4BA 1X4HA 3SMZA 4WYLA 4ED7A 3UDCA 2DHHA 5ET6A 2XX7A 4KKOA 1Q35A 3H03A 2A5TA 1R7IA 4C8OA 2HXRA 5JTYB 4CNZA 3OW2R 5F7VA 2BJ3A 1FPBA 1NI9A 3Q8SB 4ECTA 2GO8A 4KH1B 4OHNA 3RAMA 4HEA9 4CZCA 1I3OB 1NSKL 4G3IA 1B0HA 4KKOB 4KQPA 4A8OA 1RWPB 3ADAC 1NSAA 2V8VA 5DZ7A 1IKYB 1HNVA 1JLEB 5D0GA 2JLGA 1WODA 3THIA 2WK4A 1B7YB 4PAIA 4NTLA 3PMWA 5J1DA 1FFWB 3PKMA 1LW0B 3IOUA 4AXIA 1M5DA 4MH8A 3ENVA 1CQNA 3LP2B 3R5BA 3CCUS 1HR0J 4LFBF 1FBDA 4PXDA 5KTQA 3QYYA 2AJQA 3N26A 2QMXA 4HT5A 5HVFA 3SIPB 1EARA 1RHUB 5LSRA 2H99A 4NL5A 4MJOA 1CQMA 1MMDA 5ET8A 2ZFHA 3M32A 2Y5KA 3V4IA 1WF2A 2OFGX 2D3IA 2VF3A 3B4DA 1IUJA 4K0KF 2XYHB 4NEYA 1MMLA 3R8YA 4MBPA 4E0XA 4F36A 3HHFA 1FQCA 1H3DA 3ILLA 3CJQA 1R0AA 2HAIA 3OL9A 4HDHA 1OVBA 2DRBA 1MDP1 3PY8A 3AD7C 2ZH9A 3H5XA 4DHVA 5DEXB 2XWIA 4DV2J 1JXVA 5BXIA 1JKHB 3TZZA 4DXCA 2Y0BB 2R2UA 3H0PA 3VAKA 1GAOA 5I3PA 1WEXA 4WXJA 2FIUA 1LWCB 2DCUB 3TODA 2HNZA 1NK4A 2XXQA 2BMBA 2DHXA 5DDOC 5DJBA 1N0VC 3UR0A 3ZO7A 1X4AA 3EXYA 2W7OA 2XMMA 2H54B 3Q22A 2GS8A 4H45A 4TOZA 1WTBA 2QSWA 1TUVA 2DRAA 3F11A 3JSYA 2A3JA 3JSRA 1KR4A 1CEZA 2IY5B 4FKXA 3PPNA 1LAHE 2KO1A 2EI5A 1DURA 1HWJA 4CYUB 2EWHA 4G8HA 4G65A 1VR5A 2CQ2A 1CJTA 4K4VA 3VHQA 2AGQA 1F9HA 5CYJA 3RY3A 3V83A 3FZ2A 2WBMA 1DFDA 1Y5LB 3NP5A 5DS7A 3Q8QB 3OL6A 5F8LA 2L3MA 3C16B 2KLFA 4DR5F 3AA8A 1LAXA 2MZ1A 1GVCA 3I5BA 3PU5A 1VQ4S 3RBXA 1NV3A 3W61A 2R8KA 4A8MP 4C9DA 4X9TA 4EZ9A 4OYZA 1S6PB 2X1AA 3JTOA 4H65A 3R7BB 4NG7A 2O3DA 4X4QA 3ZKKA 1LK7A 1NUWA 1MY3A 2RU3A 2HFOA 3AODA 5EWGA 1MH3A 4XO0A 2F4VF 2V2VA 3QO9B 2DNGA 4QFKA 3TA1A 5ETRA 3KK1B 1BWEA 2R8HA 1GTHA 4LF6J 3LGHA 1CPZA 4IKAA 1XNQJ 4ZLJA 4DV5J 3OTEA 5E0OA 1L3VA 5GAGI 3GIMA 2MKIA 4L76A 3IB1A 4ESWA 4ETXA 2RKIB 3OFGA 5SZTA 2HS3A 1HSJA 2FVZA 4QIEA 2KDOA 2KM8C 4J9QA 3FJGA 5I3SA 2UVWA 3D7SB 5LSLA 1JB0C 1XS5A 4R5PB 3BR9A 4USHA 2OMOA 1WSVA 1RADB 3M6VA 3VAHA 2XHWA 3RYDA 2DOJA 1RT5A 1YG0A 2JFKA 4FNIA 1VQYA 3F44A 1MH4A 4ZVOB 4B3MJ 1OSCA 4F1VA 2O66A 1FXDA 1NV7A 2MKKA 5KFRA 2XX8A 1RJJA 2LXIA 1FFSB 2MKZA 1JKHA 3EGWB 1S57A 3DRYA 5CYQB 4QYZK 1QAXA 4NF5B 2WW8A 3J7YI 1IBCB 4IRDA 4JVIA 2Q3PA 4IG0A 1NV2A 4OVRA 5A8KA 4P7VA 1JLBB 3KN8A 3CCJS 1EQMA 4F4AA 4WFNQ 2VIHA 1NUZA 1G2EA 3IR1A 1BD6A 3GE9A 2AWZA 1VQ7S 1AYEA 3DMJB 3DOKB 3D0HE 2KHCA 3MM5A 3K5OA 5KFBA 3LH2S 4I62A 2KL8A 4K4TA 3UR3C 2CKWA 4YP3A 3O66A 4IQMA 4IDKB 1N54B 3MM8A 5I7IA 1BQNB 3KLHA 3UNYA 2Q6BA 2GFFA 1S9EB 2R9LA 1OQGA 3DLJA 4Q30B 3IM8A 3FSXA 4EQ9A 4R74A 1RBOB 2IHR1 4B3RJ 2OAUA 1HNWJ 3DRRB 3HF5A 4ED3A 4ED5A 3MPVA 3K6UA 4C3MA 1PC5A 5A8KB 3DLEA 2Q9TA 2ZXTA 1WHWA 3PR5B 3ZKLA 3CJ0A 4LQ3A 3WAEA 3ZZOA 1WC0A 4F22A 2XLJA 4FYVB 1Y5IB 2PCRA 2MQPA 1YJTA 4KC5A 4DCXA 3HHEA 3HFUA 3T1HJ 3OR1B 3KZGA 3R5JB 2P2AA 4DV1J 2C3PA 4OHWA 1H38A 2DCLA 3SCJE 5GAHU 2IBKA 1V6HA 1KQKA 4KGVB 3AB2B 3BGRA 3CNQP 2V9WA 3AXKA 2AJ4A 3DI6A 3GFXA 4DR4F 4NLRA 1JVXA 4O7IA 3OL8A 2ADBA 3Q28A 3FUZA 4O0IA 5IFMA 1LAFE 4XIUA 3VCDA 3KOAA 1IR2A 3DDKA 1JP4A 5J1EA 4OA4A 1NU4A 2UUCF 4DL5A 1X9SA 1RUSA 3PV8A 4DPXA 2W2MP 1N5VA 1RWVB 5J1NA 3MM7A 3IAZA 4IO3A 2MXYA 5LOMA 1HL6A 2LQ5A 2MPUA 2UV8A 2DWAA 1HIYA 5H9FK 3MAQA 5AT1B 4QWEA 4LSZB 1P99A 3UW1A 4QSCA 3KEIA 4EXKA 2V67A 3W60A 2ZZVA 1T03B 1O8BA 1WOSA 3QFHA 3K5PA 2CRLA 4JOUA 1KVJA 2AYSA 1GX6A 1FXLA 3T9HB 3RRGA 2C2RA 1FDDA 5M2VA 2ZC4A 2GVDB 1BY9A 1R89A 1CJKB 2YWWA 4IB2A 1GXLA 4CLPA 2F6PA 3MDFA 2ONRA 2J5AA 3T1HF 1WACA 4N13A 3TYHA 2E9ZA 1YBUA 2RE1A 2OZZA 2EFNA 3VZIA 4X65J 1HI1A 1VRTA 1O63A 3HMJG 2N82B 4F0MA 4ES2A 1GT8A 1HNXJ 2XULA 1Q0NA 3OTDA 3KGCA 3JB9k 1HPZB 5KFMA 1NM2A 1SJ1A 1T0KA 3MPWA 5IZ3B 4YS2A 3V5AA 5HBMA 1FNXH 3IOVA 4RW4B 4EBEA 1SB6A 2UYFA 1NV5A 1S6OA 2MLXA 5DQIA 1SH3A 3E78A 1UA1A 1FRIA 3EICA 1YJWS 3CDWA 1B5IA 4CH0S 2QS4A 1NMEB 3U8QA 4M5JA 1UW9A 4ZVFA 4ZCKA 2HGLA 3W2VA 1FNOA 4EFAC 5M2PA 1JW5A 1S1VA 3C35A 2H5YA 1TKXB 1P27B 2DY9A 1ZM3A 5C42A 3HN0A 1G0IA 1LWEA 5ETSA 2DISA 3HX9A 4A8XA 1RE1B 4NE9C 2ANJA 2MKJA 1PYSB 2RAQA 4AFFA 3G8SA 2ZWOA 4FBUA 4EI2A 2V8HA 4CCHA 4DS4A 5MLCV 5FTIA 2OEKA 1FBFA 4WYWA 4RU9A 3O9PA 3TPAA 3OXGA 4FEBA 3DYAB 1PJ7A 2DXEA 4HCYA 1LFHA 2BJ7A 2GQQA 4X65F 4UY8T 3SQGB 3X1LB 2HGNA 2P9EA 2J0QD 2RCBA 1DLOA 2MY8A 1AT1B 3K4UA 2HBRB 4NLPA 1QKBA 2I58A 4OZNA 1N3XA 1V3RA 2VH7A 4C1UA 4NAPA 3IOWA 2F40A 3I55S 4Z7YA 1M5EA 2D41A 2XXPA 1LB9A 1SV5B 3MTJA 5GMKa 1DTZA 1XR6A 1YYZA 5L38A 3MBPA 1T9XA 3FD3A 5A5XB 5KFXA 1XMQF 2JEIA 4GKKJ 4JV5F 1OVTA 1QULA 4W4MA 3OR2A 3M3LA 3C34A 3D0GE 3K1PA 5IT4A 1B4HA 2R9JA 1SUQB 1FDNA 2XLKA 1ZAVA 5KFVA 1R43A 1C0UA 4KGZB 3EM1A 4YAHX 1FHTA 4NLVA 2CIMA 1FQDA 4IY5A 1HA1A 2BRKA 2DBBA 2Y9HA 1Q1KA 3FVNA 3N6MA 2OO4A 4J9LA 3A3OB 2DNPA 2KVQE 5DQGA 3KLEB 1VQ9S 1U4BA 1GTKA 1NLKL 1SI1A 4Y2IA 2QT7A 4KI0E 2QL9B 1KRPA 4F02A 3JSBA 4M5HA 1MM7A 4EYIB 2WTFA 2REGA 4YHHJ 5KCJA 4HKQA 2HNZB 1C0TB 3M8QA 1VQPS 4C0OC 2CQ4A 4X4SA 1JVYA 1S1TB 2ZH5A 1B58A 3R1HA 1YTYA 1XHYA 4OYMA 2IYIA 2MKSA 3HHNB 2F3JA 3OO9A 3ITHA 4PTKA 3GLBA 2JHEA 2FPHX 3PRBA 1VC6A 2MEWA 3R6LB 1FRJA 2ZJPQ 2V8DA 1Y3JA 2ZNYA 4GVBB 1IN0A 4M5DB 2V34A 3HSTA 3DHXA 4RW7A 2XSFA 3HVTA 3OVBA 1IXKA 1B32A 4WFAQ 4L73A 1HFEL 2ATCB 4FATA 2P9GA 2B9EA 2PFZA 4FE8A 3ZNJ1 1FKPA 3G96A 3IGNA 2QZ8A 2C3MA 3O6GA 1LWFB 3MFIA 2E5HA 4OV1A 4OMFG 5FD1A 2G13A 2HS0A 3FKBA 2AF6A 2M52A 2QLJB 1S6QA 2GGPA 1EZZB 3OT9A 3NNHA 2BQRA 2W01A 4CTAB 4PYDA 3W2WA 5ETMA 4Z37A 4WXOA 1ZTTA 3L6HA 3D6MB 4LIWA 5JVHQ 1FCAA 2W7PA 2OELA 3ULHA 1EYKA 4PQJA 2CPIA 1VK3A 4B3TJ 3KJ7A 5JJBA 5JEIA 2RF2A 3MECA 2VASA 2HPUA 4MKYA 1ZM9A 2HNYB 2ERRA 3UCUP 2FHKA 5EUHA 2FNCA 4U4SA 2M9KA 3B8HA 2F7CA 1NHKL 2AJ2A 1TR0A 1KLNA 1N6QB 2ZC3A 2XC9A 3CDUA 4QJVA 1JEVA 1ZBTA 5IQ6A 2JVRA 3S8SA 3KG2A 5I3UB 2ZOGA 4ZPDA 1D3KA 2GVZA 2EEYA 4P10A 1FTOA 3RG6A 4R5PA 2DNHA 2YH1A 1NPKA 1TL7B 3IJOB 2P1SA 5CM6A 3JV9A 1NZAA 4Y00A 3HHGA 1S1VB 3N94A 5CMKA 4ZPCA 6FDRA 3G71S 4K4WA 1F5AA 3R5AA 4HCWA 1FQBA 2GFEA 3IL1B 1JLAB 2G2ZA 5I58A 1TAQA 3K0VA 4FBPA 4USWA 2FHYA 3KSJA 4Q5TA 4I2QB 1CULA 2VG5A 2F4VJ 1IUDA 1URGA 5AA1A 4POXA 4X4UA 4DI6A 1FJ7A 3G6YA 5DO2A 2R7WA 3HHLA 3CFLA 1Z2LA 4ANEA 3IX1A 4EF2A 4P2MA 4IR8A 2LVWA 2HEUA 5HLFA 2V3QA 2UUTA 3NWGA 1H73A 1H7XA 2UV8G 1SPIA 3VALA 1QUVA 1JETA 3RW7A 3CD6S 1MM6A 4N17A 4K4XA 1FO1A 2EG2A 3ONMA 4Y6IA 1REVB 1VDWA 1EYJA 4ZEDA 1EJ7L 1REVA 5HK4A 4ENOA 5HMWA 3MC2A 3UNGC 1US4A 2OCUA 5HN0A 3DM2B 3OXLA 3TUIC 3GXAA 4J5OA 4K59A 1CC8A 3P4UB 4E0WA 1MU2A 4NLDA 2AT1B 1U0SA 3G86A 3PRVA 4RUAA 4CT9A 4DSFA 3UN5A 4P74A 4FF1A 1FPEA 2ZH8A 1HBUB 2CPXA 3QIDA 3MEGA 1T05A 2ALZA 3M8PB 1JJ4A 3JQKA 3N01A 3DU6A 4ZLNA 2J9DA 1VQLS 2XWVA 1TL7A 5BYRA 1M1KT 2Z22A 4O7MA 4M1VA 2RRNA 3ZZUA 4K7QA 3SKPA 2XCPA 3TELA 4PWUA 1B4ZA 2V4RA 3AJDA 5LJ3Y 5M2RA 5KCJB 4ZEIA 1B7UA 2L08A 2JC1A 1LEOA 1UFWA 2UYEA 1MQJA 1VBXA 1LBCA 4DMZA 5J2PB 1NDKA 4ZVSB 5B7DA 4F1UA 3Q8RB 3TAMB 1ZM2A 2VDIA 4A4JA 5HM4B 2JVOA 2XXIA 3DOLA 4O44A 1R0CB 3QIPA 2ZH2A 3TZXA 4F3BA 4DZ1A 1TKZA 4DUYF 1IBLF 3RPLB 3LO3A 1MPDA 1Q8LA 2LKZA 1NJXA 4DWIA 5H8FA 1Y4ZB 1UWBA 2E5JA 4LT6A 3LSWA 4Q0BA 2BM1A 2HFVA 5H8FB 2M5YA 4U96A 1P9YA 3GIRA 3BR8A 1VIXA 2YNHB 3CJ4A 1XNRJ 4I2QA 1U1OA 1VISA 1N7XA 1MPBA 1FDAA 3PMVA 5U47A 4NMLA 5C7PA 4ALZA 5HJYA 2JFDA 3GV8B 1MG7A 1K9ZA 4YN3B 3SDFA 1U1RA 1SI0A 1RTJB 4X4NA 4JVDA 2RH3A 5DG9A 4MFIA 1DTTA 1OQ6A 4LF7J 3IS9B 3U92A 1OWXA 1U48A 3M05A 1S5ZA 4R2BA 2UXCF 1WHVA 2BJJX 1SL1A 5F8IA 2GCFA 4BHQA 5EHSA 3H98A 2KG0A 2ACYA 1P1UA 1FESA 4IUFA 2F4FA 1MXVA 1VBKA 2AJ1A 1F9BA 5DG8A 4HXVA 4PCDA 4C3KA 1RWNB 2HQ3A 3G6VA 4U21A 4ID5A 5BJRA 3I6PA 4FNHA 2ZVSA 2HHSA 1EIYB 1NEEA 2DTJA 5IS2A 1S4EA 2B4OA 3C6UB 1PBPA 3FGSA 3D4JA 4HYKA 4LVNP 3DRPB 4WTOB 1JQFA 1HHSA 2MKCA 4MIJA 1U7LA 3L7UA 2H98A 1N33F 3MPLA 4EQ7A 3H59A 3ROJA 3BDEA 4LR9A 3KKFA 4ECFA 2VONA 2HEKA 5KFZA 1SW1A 1VQ6S 3MWBA 5CC2A 3KLIA 1LCFA 3G7WA 5KFDA 4H0WA 4NXNF 2VPOA 1B0LA 2QMUB 2HQFA 4DJBA 4CLUA 2GRVA 4CP5A 4AS4A 4GC7A 3AD8C 3KHRA 3RU0A 1D1UA 4F3PA 3NS7B 1UEVA 1TTHB 4KTQA 3IAM9 2XMUA 4ZDMA 3SEUA 1RAJA 3D4CA 4YICA 3JTNA 3O97A 4DLDA 1U0HB 4B9LA 4Y3CA 2RD5C 1X5TA 1RWUA 2ADCA 4OYIA 1AA1B 4ZJLA 2XXYA 3JTPA 4OHVA 2UXCJ 4QZVB 3C4MA 2QLWA 3KJVB 4DQQA 3R7SB 1SC1B 2QL5B 4ID8A 2V2ZA 2QC3A 4ZK7M 3IO4A 3O28A 2A6OA 2IC3A 4OJ1A 3OTOJ 2I4CA 2Q88A 1RHQB 4QU7A 3THPA 1EU8A 4IR1A 3MM9A 3DM0A 2XD3A 3HLUA 2JLEA 1JJHA 3H6VA 4GQOA 3E01A 3PPOA 2RF1A 3GWCA 4UTGA 4LQ2A 1MXYA 4UACA 1U02A 3C14B 3K02A 5KOXA 4MYTA 1S9TA 1U2RA 2G2OA 4P11A 4ILRA 4DOZA 3M3FA 4JV2A 2Z8FA 4PWDB 4RO0A 3OSPA 5DDPC 5L9NA 2ZOMA 4F67A 1FWLA 4LRCA 2F97A 2OPSB 2GVDA 1SKUB 1C4CA 4O3PA 1KEKA 1ZZNA 3FBEA 1BQNA 3OOAA 1QAYA 2B3TB 3EX7B 5GAEU 4PPZA 1N88A 2V4QA 2KKHA 5AXLA 5IOLA 2FJXA 4WKRA 1GR2A 2ABYA 2WONA 4WK3A 3QLHB 4JI8J 4PAKA 4GBWA 1TMMA 3VR1A 4CO3A 1BMQB 1LWXA 2JJ4D 2W7YA 3MAHA 5ITOA 2ZNUA 2FY1A 2UVVA 4DZ6A 2E7VA 5G0RB 3THTA 1HWLA 4RY1A 3G9CA 3ZTQA 3R1LA 2CJAA 3CD5A 4OVQA 1B70B 1DPPA 4N76A 3ELHA 4NA2A 5FDLB 4WU3A 2DYXA 1BXNA 3CDEA 1RAFB 5IV3A 1RT1B 3PYEA 1BTJA 4X8RA 2PMSA 4PAAA 4B9TA 4WZQA 4X4RA 3TW0A 2Z2ZA 1U1MA 3G2XA 3C15A 5J2QA 2DVIA 5B70A 1N76A 3SEYA 1UCNA 1BLFA 4C8ZA 3ODBA 3HCXA 2V9KA 4YQWA 2OJ3A 1F6TA 2LEPA 1Y9OA 1F3VA 4USUA 3TZYA 4WFXA 3NMAA 3NKYA 3D54A 1JLGB 1TV6B 3PRDA 2DGOA 4Q8EA 4WBFA 3MURP 2VJUA 3G3FA 4EMDA 5ETLA 1OPIA 5LSOA 1W25A 2B5JA 2AQ4A 1YXIA 1NDLA 4U8VA 4R8UB 5FIIA 1ZMGA 5ISUA 1J5EJ 3CJ5A 3HULA 1IKWB 2B8QA 5HROA 3BIHA 2HZVA 5A6PA 3BH6B 3EGNA 1SUQA 2EW9A 2BUNA 2WYPA 1W26A 4GX6A 2EG1A 2L41A 2UZAA 4ECZA 1REGX 1MQIA 5D4LA 2YWGA 2DE3A 4YKJA 2E5LF 1JLGA 3VF0B 3PW0A 5C2GA 4Q8FA 3ZTRA 4ZVPB 4POWA 1KTQA 3PJ9A 3RB6A 2IDEA 2J9CA 4Z7CA 3VWSA 4OMBA 3L3CA 5AA2D 3OEMA 4ISUA 1S77D 5IKBA 4MF3A 4RBTA 2X1BA 4ANDA 2DGSA 3PD8A 4IOBA 5FDLA 1X4GA 1R1NA 5B0BA 1NKEA 2LQJA 3F73A 3JXOA 1CJKA 3UI3A 2RF2B 2XI3A 4AL7A 3DDIA 2XWOA 5KG3A 3M3KA 4MMOA 5KFWA 5KFOA 2LDIA 3JQMA 4TYBA 4PWWA 4ECSA 2RS8A 2QLXA 2Z58B 3IWXA 2G2YA 3CO9A 4RNOA 1KWMA 3MM6A 3PYGA 4ZVGA 3RR7A 1IMCA 4RU2A 1FPLA 4KJIA 1K1QA 3QNWB 4N7TA 2OD6A 5GAGU 2XXUA 2J9EA 3TTLA 1Y3NA 4C8YA 2WBBA 2QG9B 1LGBC 5IZ1A 5HQMA 3K57A 2XGPA 3Q8YA 3O8WA 5K9FA 2OK2A 2WSEC 2IEEA 4QWBA 2NXJA 4NI2A 3J81j 4H4KC 2KFYA 3ZZ0A 3GPAA 3GYGA 3DRSB 1N3WA 1N36J 2HHWA 4LSLB 1NFTA 2NWJA 1WG5A 3AT1B 2EFPA 1WC3A 5AA2A 2NXUA 1ZS6A 2BJ8A 2E5LJ 1MQDA 4WKMA 4X4OA 5CMMA 2G0CA 2DE4A 1TKDA 4ZLPA 4HE1A 5CA5A 4NMXA 4DF4A 3T0JA 4GVBA 1L3KA 2QMWA 4TKTA 4F3OA 1A55A 2JSXA 4N8OA 1BHNA 5C5JA 5IT0A 2GZOA 1TL1B 2R7UA 3CJ3A 2CZ4A 1WG4A 2BANA 5AE1A 2HFSA 1NO8A 3HCQA 4Q2MA 1IKWA 3ILIA 2FHMA 2X3DA 3T6JA 1FPGA 5I2NB 2F5GA 1QDUB 1RTHB 4K2JA 3L95X 5I3QA 4G2ZA 3MOJB 1IWGA 1JX4A 1YBAA 2DITA 2MJNA 4ZZAA 2AX0A 1R9LA 2C2DA 3NMRA 1D8YA 3OXFA 1MXWA 3W3SA 4OYWA 1DBZA 2R7QA 3LR1A 3N6NA 2KZMA 5KFQA 3TQEA 1FE4A 3T9UA 2M8CA 2F78A 1VRQC 1QVGR 3GYYA 5E3AA 4PXCA 1DSNA 5T7LA 1RYRA 2R8GA 1ZBMA 4LFBJ 5EQ8A 5E3QA 1SCJB 3BSCA 2Y7KA 1P1WA 3D66A 1LXJA 1RDRA 5F9NA 5IT9U 2AL4A 3H2UB 2HZKA 2R7SA 2RC7A 3HVAA 1O5JA 2YWEA 3DP8A 1U49A 1N34F 3UO0A 2HHPA 4NYZA 1QJHA 1R9QA 4A8WA 2WSFC 3Q8UA 4MKAA 4WP8A 2CEXA 1KHVA 2KH9A 3SEOA 1DHMA 1S4FA 1PB8A 2I5JB 2WOMA 4H4MA 1FW0A 1K0VA 1AH5A 1RB0A 2QFLA 1LAGE 4ZP8A 1QSSA 4QOTA 1F2HA 3MR6A 4F2RA 1HMVB 1R8CA 3UWTA 3W5XA 2ZZXA 1H76A 3BEGB 3K17A 1Q7YT 4DUZJ 4YY3J 2QLBB 1RT7B 2C3YA 5LMNF 3AJ2A 3IXQA 4EUOA 5K14B 1M5CA 1FKPB 3LTOA 1IITA 2HRYA 4XTCQ 3SYZA 5ICQA 1M5SA 3W9IA 2LFVA 2Z2MA 4KSEB 2VBXA 3DYAA 1PEBA 1U1LA 1B3TA 4O3BA 4ER8A 3RAXA 5GMEA 3ET6A 4H4KA 4U9RA 2QS1A 1K0TA 3GFHA 2OMLA 1ZJLA 4HE0A 4XDDA 4WP9A 1X8DA 4YHHF 1WI8A 4HL9A 3ETOA 3LP2A 3PHEA 3PG9A 4P2XA 1U45A 2VHGA 4PBQA 5EYFA 3MCSA 2EPIA 1T11A 2Q2CA 2VQFF 3I96A 1JW4A 5AE4A 1UWBB 2P6TA 4GKJJ 5F3ZA 1U6BA 4DCJB 4JI1F 2ZKTA 4BWMA 2DXDA 3NEKA 1MROA 4KHMA 2BRLA 3QGIA 1FJCA 1U8WA 1IJEB 2E9TA 3H4DA 1PB7A 2W8KA 1H72C 4ITSA 4DL0C 3U94A 2DVZA 2R7TA 1DQAA 3M1VB 1NHUA 2HBZB 1Y00A 3M7VA 3PJWA 3UA8A 1J2VA 5FBPA 4F19A 2C2NA 3VVTA 1OIAA 5HBMB 3EVWA 1IR1A 4KO0A 2VDHA 3I0SA 3LAKA 3PDNA 1UTBB 3OBIA 3A8KA 2NSBA 2RIJA 2YNGB 4K4YA 4NLXA 5EWFA 2A10A 4X04A 1MLAA 4C8LA 2WVBA 1XNRF 2XWYA 2B51A 4J9UE 1SIZA 3QATA 2FIXA 5C24B 5F8MA 2H4WB 3W2VB 4KO0B 1NNKA 5I2KA 1T94A 4GWOA 4K5SA 4PZVA 1SBRA 2YKOA 1RLCL 1LW2A 3BN4A 4F4ZA 3AHPA 4KV8A 2HQ0A 1QW0A 3IK6B 4RL1A 2F35A 3ILJA 1RYOA 4O3SA 1DQ8A 2Q1LA 1NJIT 2RT3A 5HVHA 2MZQA 1WOOA 4OQJA 3M8RA 4JI6J 2WAQD 2IFXA 3H5SA 5E41A 4P1EA 5H9FJ 3FVYA 2IBOA 4KYZA 4ZLLA 2F3DA 5T41A 4O3CA 2VD2A 4RPOA 3I87A 3IRWP 3DLLQ 1FF2A 4FPIA 5LXYA 1S12A 5I2KB 4X66F 4I67A 4V19J 1X60A 5FHOA 1X5OA 3R2CJ 4I7FB 3HVWA 3DOKA 2OTLS 2KR0A 1Q8IA 3SQOP 2C42A 3H4ZA 3CMAS 1TUGB 2EC2A 4X62J 2KRRA 3A3PB 2AL5A 2MB0B 2RRBA 5J2MB 2HURA 2V84A 1APSA 4NHBA 3PUYE 3DNCA 3L9ZA 3R27A 5F0UA 1NHVA 1EZOA 3I32A 2KI2A 2DS9A 1HI0P 1WD6A 1X4EA 4WP3A 1N4LA 3NRBA 2HHHJ 2ACMA 2BE7D 2MSSA 2YKPA 4QW8A 2HXWA 3MOZA 2B7CB 3QT8A 4UF4A 1TK5A 3B8BA 1DOTA 2XS2A 1IBMF 1T95A 5GVQA 4DR2F 3AJ1A 2HNDA 3L4BC 1O64A 4A46A 2A18A 4Y2AA 3TEPA 2H4YB 2M0GB 4DV6J 1ZIUA 1SJ3P 4B02A 4FYDA 4JI6F 4PWDA 2ATLA 4M5MA 4P3LA 2KFNA 3ISZA 2VPNA 2XSJA 4LFAF 4EDPA 4PG5A 4ZCMA 2BKNA 4QRZA 3HFZB 4OI1A 1AB8A 3W15C 3QO9A 2Q89A 3OR1A 4WXWA 4OENA 3SV3A 1XBWA 3QBCA 4RNNA 2JEFA 3M8SA 2XZTB 3QSIA 4KD5A 5L39A 1OYEA 3FBPA 2ZUGA 4DFMA 2CWXA 4GWSA 2DWHA 3VAJA 4GF8A 2MLZA 5L1KA 2UXDF 2OEMA 1MXUA 1DZ5A 1Y20A 4KHRA 1RT2B 4NF5A 1I6QA 3IRXB 1SV5A 2HZLA 4DE8A 2J8SA 3S9LC 1TMJA 2Z57B 1HNZF 2Q2AA 1WEZA 3HHKA 3DU5A 3O3LA 4TY8B 1ZA2B 5DM6Q 1MWZA 2EVZA 3V2UC 3KJVA 2RQMA 1S0VA 1RHMB 5C25A 1FJEB 2XY5A 1DARA 2EKYA 2DR7A 1SXLA 3CD7A 3VAMA 1VRUB 2IA0A 1FKAF 1SJQA 1TKZB 3PO4A 3V89B 2KT5A 1YRUA 2LEBA 3WC2A 1FQFA 1FK9A 1RT5B 1EZ9A 3PPPA 2CJ9A 3JAMU 2HVHA 4G68C 4LBPA 2QE5A 1ZAXA 3TWZA 4OFJA 3QGPA 3QSYB 1NV1A 2ZMBA 3HM9A 2OUGA 3AOBA 2NXNA 9RUBA 4DL2A 5BUUA 3BGLA 2QS2A 4GWUA 2FZGB 3FJMA 1NNFA 5K8OA 1Q79A 1RTIA 3KXDA 1USYH 5AJ3F 1WTFA 2OPSA 3NWRA 2CJQA 3SEWA 3R97A 3CSKA 2AV5A 4DUYJ 1IBLJ 4HTJA 2ZZMA 2QX0A 3I3VA 4F18A 2HVDA 1N5SA 1VIOA 4I4BA 1RKMA 3LUYA 2FYIA 1POY1 1FRXA 4ZHRA 2R2RA 4WF9Q 2UXDJ 4NCAA 4PQUA 4RXLA 4B9UA 1QLNA 2DWJA 4PE3A 1VOMA 1Z7ME 2PDAA 2LLZA 2J6SA 3DGPA 1YBTA 4ZVEA 3IR7B 2K2PA 4TLRA 1PB9A 1OY9A 2RCAA 2Y3YA 4JBZA 1R8BA 5LTCA 4U1OA 3UDVA 5D15A 1W7WA 3FCHA 4ZP7A 4YZZA 4B08A 5DM7Q 4BDMA 5L9OA 2QYGA 4UZBA 4LF7F 4ELTA 3TTRA 1X4FA 2VKRA 3O6HA 4PABA 2KFZA 1N84A 4KHPJ 2UVUA 3ZC4A 4NN3A 4WFBQ 4ZJOA 2Q74A 3TVKA 2QJ3A 3FNNA 4FJPA 2R4FA 1AZSB 4F39A 4PE5B 4RW7B 1DQ9A 3LOUA 4JI5F 4GWWA 2O6AA 2QO3A 3QUJA 4RW9A 1D3WA 3CMQA 1G3OA 3Q0AA 1IWAA 1RT2A 2FLNA 4DPOA 4ECWA 2AGOA 4HH0A 1PIEA 4X4VA 2AGPA 5A8WA 1V3SA 3Q27A 3RPLA 1OIBA 4P9KA 3W65A 5ETVA 1KD1T 4RYAA 1Q16B 4R9GA 1TK8A 2CFXA 4DPYA 3D68A 1RWWB 5CYQA 1N5YB 2LU2A 2R7RA 4RPFA 1TL4A 2ZD1A 3QJPA 2DE2A 3QMFA 1RSCA 1FRLA 5H8SA 4FF3A 3PZPA 2GQ2A 3JAMY 1R0BG 1NJWA 2XXHA 1LXNA 3T66A 3PIOQ 3HP6A 2AEMA 5DQHA 3H7HB 1EKRA 3GR0A 1P1NA 1TFAA 1ZLQA 2HW3A 1N0TA 5KFNA 3M6XA 2J76E 1S7IA 4Q8RA 4MFBA 2CQIA 2VFTA 3WBZA 3AB4B 1VFEA 3FXUA 2E9RX 1QY7A 3BSNA 2DVCA 2NPIA 2B4MA 1B5JA 1UKUA 4RA1A 2PBWA 4F8RA 4W98A 3C3LA 3Q23A 2BOAA 4O94A 2O69A 2ZYKA 2QRRA 2MQNA 3PFOA 3OJSA 1UJ6A 3BBRA 1Y1MA 5AXMA 3T1AA 2MZRA 3SERA 3EGVA 5ADZA 2W8LA 1GFWB 3UN2A 5E5NA 2CQ1A 3DFEA 4A8SA 2CUYA 4N6DA 4J90A 2DH8A 4ZP9A 1RWXB 4CRJA 5K8PA 2MKHA 3U1MA 3IB2A 7FDRA 4GC6A 4DCYA 2M8HA 5IAIA 3B78A 3OHBA 2ZBQA 3VZHA 1ICEB 3QRPA 1W2BR 3G82A 3UN3A 4Y2KA 1FKOA 2CJYB 3K58A 3ICLA 2F34A 3HHLB 5IT9Y 3U1LA 4IGRA 2GC8A 3M9MB 2P9CA 5AA4B 2VBYA 1F1BB 1ZU0A 4RJZA 2IAJB 3T5LA 1FKOB 3CD0A 3CDBA 2BYCA 4M5GA 4CLKA 5D4PA 3LF0A 4WKYA 2F8MA 2FLLA 1RT1A 4UOFA 3HK2A 1HBMB 3FJ7A 4JYAF 1DJ0A 2G29A 1SC3B 3SEVA 1HYSA 3CCQS 4MYUA 1WC5A 1VLYA 4DQPA 3KYLA 3K6VA 4TXSA 4TU7A 4QBUA 2PMHA 4OETA 1A7GE 1XQIA 1TL5A 2H1YA 1CULB 2BE9B 3KK3A 1UQWA 1AXQA 3WX4A 1A6LA 2PE8A 4H1XA 3Q86A 1LB8A 4RWXA 1YKWA 3UD5A 4OQOA 4QPTA 3BGOP 2O68A 3RGYA 4LREA 4IH5A 4YMEA 5IZZA 3M2UA 4DV0J 3HZEA 3TEGA 2VODA 5F8JA 3TX0A 4UT4A 1JNZB 4LF9F 2A5TB 1X7VA 1AUSL 1ZPWX 3CJSA 3BQ1A 1NK6A 3G3JA 2NR0A 1BP5A 4I6YA 4YKPA 2BW7A 3PVXA 2RU9A 4LMZA 4N4UA 3HHDA 5A5LA 1MG1A 1YI2S 2H5IB 2K7JA 1I6AA 1FPJA 3OO6A 3MUTP 1S99A 2RMLA 3RB4A 1KOOA 4FS2A 3UK4A 4ED2A 4WFYA 1TL1A 3SV4A 1B3HA 3FXRA 1W2IA 3CXCR 2W2NP 1WJ9A 3TYTA 3EMTA 1XT8A 4ZS6A 2YY3A 4MAKA 4MIBA 4ND9A 3ZS6A 4L75A 1Q9DA 4I69A 5I42B 2GJFA 3LWLA 2FHJA 4JYAJ 2XHDA 1BWVA 1ZYQA 2E7WA 1C0UB 4DLGA 1Y10A 4L17A 2ZOFA 4XKQA 3BBCA 2Y0SD 3H5YA 2WZ1A 1TELA 4LBIA 4G8MA 4ECRA 3T96B 2HWIA 2VG7B 1TQLA 2M4MA 3KNGA 1FRPA 3TAQA 2QSXA 4NWCA 5G4DA 2PEBA 3Q2TC 4JI4J 3R7NB 3PW7A 4KV8B 1HYSB 1PJ5A 2ABHA 1FWPA 1N56A 1AOVA 3FIRA 2CPDA 3Q8VA 1V3ZA 2ZBCA 3P5BP 4YMBA 2XXKA 1P8GA 9ATCB 2OX3A 3VAFA 3FDSA 2ZUAA 2YVSA 1UPPA 2GIFA 1S59A 3L7OA 5J2NA 2IJRA 4Y34A 2WSCC 2ZKUA 3H42A 4I0WA 3M2VB 5L8DA 3C6TA 3BKUA 4F2SA 2D3O1 4R2FA 2X3GA 4NGUA 4F4WA 2HNDB 2VFUA 2E5IA 2CNKB 4DPUA 1FPDA 1SPBP 2XXVA 1F60B 3Q8PB 2G0JA 3KG0A 1MWYA 3E4RA 2Y8YA 3RUMA 1PO6A 4RR5A 3V81A 2DPJA 4G68A 1XVXA 2CEYA 4ZE8A 1DPEA 4GWZA 3C33A 1A8EA 1ZAWA 1KKHA 4OEVA 5ITHA 3QJJA 2L9DA 3B50A 3V8XB 5D3GB 1S1WB 2OSRA 1VFDA 2PC6A 4AB6A 4OZ0A 3SBMA 2NYHA 3K7RA 1H7WA 2DNYA 4OZ9A 1S7HA 3ENQA 3P7IA 4ES1A 2HVEA 3PUVE 4J9SA 3T5JA 4KR5A 3EZOA 4X64J 1R6VA 3HSDA 3J81Y 1MXXA 1S1UB 2Y1RI 1QE1A 1QD1A 2HAUA 1NZ8A 4OERA 3MD1A 1PILA 3TTKA 2KG1A 2BW2A 1B0TA 3PUWE 2RRAA 3GU0A 4NLSA 2CQCA 2PI5A 2DO4A 2MY7A 5A8RA 4QSEA 2YPYA 3OQ2A 3ILUB 2FZKB 4JSOA 4MJKA 4AS5A 1P9QC 1Z2ZA 5A2QU 1NUXA 1TAUA 2B3BA 5E3PA 4N8YA 2RINA 2GA7A 4XIGQ 1IJFB 1QUIA 2AKWB 4F0KA 2OKQA 3S1TA 1UZDA 1XR5A 3P45B 1KQGB 2CNNB 2CA9A 1UP1A 3CIMA 2MZSA 4H46A 3D67A 2NXEA 2M2BA 5KFTA 1HMVA 3RJMB 3PD9A 2PD1A 2RC8A 5I84A 5HLFB 5KAKA 3QIPB 2CZHA 4J9OA 1D9AA 4J91A 1KS2A 2EBEA 2GO9A 5L8RC 2A0FB 4U6PA 1M90T 3EZUA 4C8MA 2AX1A 3TJ8A 2IM3A 2DGQA 1U0HA 3FQLA 4DCOB 2M88A 3HDSA 2CVEA 3S9NC 4GXSB 4ZP6A 2HFUA 1JLAA 3GCXP 3HHLC 2DNKA 3GZGA 1NB7A 1YIJS 1XMQJ 4FEDA 1N32F 4B17A 3BQ0A 3D1QA 4OJ3A 3ZZPA 1KSPA 5LM7E 3PNIA 2V25A 2P3NA 4LF5F 4NXMJ 1FBPA 2FB0A 2Z30B 2G9OA 2GAHC 3OHAA 1HBOB 1UTAA 5ETOA 3GYXB 2LA4A 4N6KA 1KQSR 4RUCA 1SJRA 2XWXA 1MN9A 2IVFB 4PXEA 1LOUA 2P6SA 4C8NA 5K8MA 5A8RB 4IO7A 1VQMS 4DXUA 3K5MA 5H8HB 2QN6B 2L48A 3TQ1A 4DF8A 1JMTA 1ZPVA 1X0FA 5CABA 3MECB 4URQU 2FHOB 4F26A 3V6HA 1ROFA 1VC5A 2D74B 1XERA 1KA0A 1XEZA 3IRXA 1H74A 2GW8A 3NGSA 3PTWA 1IKXA 4ZITA 4XEQA 2WKYA 2XXWA 1JIHA 2BABA 3KLHB 2VPZB 2Y7RA 3OVSA 5AE2A 2VQEJ 1WF1A 2V8GA 1UA0A 3KUHA 4F1YA 4JI3J 4UA8A 1TK0A 3FGVA 1NMUA 5LT5A 1WKJA 1UJ5A 3UD3P 5HSPA 3OO7A 4HDGA 3G3GA 1GMVA 2JZ5A 3GG1A 4I6WA 1RKJA 5IQQA 2JNJA 3M8YA 1HSEA 3PX4A 3GJSB 2YKQA 4Q0BB 2GHPA 4AB5A 3TAPA 4DR3J 4I64A 1M5VC 1AUDA 1LEVA 1I1GA 3I31A 4IO5A 1Y5NB 2VG6A 2VC0A 4F4XA 3CHGA 3PEJA 3E3KA 4L3NA 4PRFA 1NK0A 5DVIA 2IIHA 1UL3A 2PA3A 1WVJA 2HG4A 1VFJA 3FSIA 3IC1A 1YJUA 4GL8A 2DHSA 1M5OC 1ITPA 2LQ9A 4TLQA 2K3KA 3PHTA 3T5HA 2MLYA 2ZH1A 1HBOA 2XNRA 5A2QY 1XC9A 4NA1A 3D5MA 3PKYA 5LMUJ 5F8NA 3IN5A 2W9CB 4ZA1A 4DU8A 4R0EA 2HWHA 5IM0A 3BZQA 4MFBB 1S76D 3HVRA 2VICA 3C14A 3CB4A 4Q2LA 4ZN3A 2OPQA 4NZ6A 1M0SA 4IR9A 4W92B 1PKUA 4QQBA 2IJNA 3J80U 3NS5A 2VQEF 5LJ5Y 3RR8A 3QLHA 4N8GA 3RBZA 4N15A 2HHQA 4PG8A 5K2YA 3BH7B 2ZNTA 2WEFA 3SSRA 3CCVS 3FEYB 4USMA 2V4JB 4NRUA 1QSYA 3NCPA 2GHBA 2PFFB 1G4CA 1FX4A 3RT6B 4B9MA 1B51A 2P3VA 3A8EA 2HZCA 5K20B 4GOTA 1B52A 1NXIA 2W1BA 3SCLE 3QAXA 3CSGA 4X1BA 4JI0F 3IGVA 2J0SD 2GJ2A 4XAKA 4ONYA 3HJFA 1L5TA 3IO1A 2IM0A 2Q79A 2N4DA 3U27A 3NGTA 1B7HA 1FTCA 5TPAA 4ESXA 2W4DA 2UUAF 1EX8A 1FRHA 2E0SA 4B9NA 4G1PA 1XMBA 2CPFA 1YGYA 3W63A 4G1QB 4FIMA 4RX6A 4U95A 4H6DA 3FEZA 2RQKA 4U8YA 2HHXA 3TO8A 1QJMA 1II5A 2GHWA 3NG8A 2AEFA 3BO2A 1P1OA 5J2PA 2XQCA 1YJVA 3RTFB 3ITHB 4M8LA 2N7CA 4NLQA 4JV0A 1NPRA 2FJWA 3CJ2A 1NK5A 4GX3A 1UVNA 3GB0A 2FJBB 4DN0A 3M8QB 2Q66A 3VAIA 3EUNA 1KONA 2VV5A 3T9VA 3K1NA 2YKMB 4LSNB 4QYZJ 2ZE2A 4YFUA 1T7PA 2NYIA 3G3KA 1GMWA 4X1DA 3EKIA 3SSSA 2ZHAA 1B3FA 4RNMA 1HNWF 2R3VA 2X1FA 1GTEA 4HI1A 1FBHA 1D9VA 2BA9A 2GJIA 2CZ9A 4GLIA 4IGTA 4ATNA 1B3EA 4O8MA 2ZYNA 2Z8DA 1NK8A 2H4IA 4HTGA 1YJNS 1B3GA 2AD9A 2NXCA 2PT2A 4DX8H 3K01A 2HIYA 4G68B 1UTHA 3N5LA 1MROB 3OL7A 4LF4F 4U23A 4LF6F 4K0KJ 4DV5F 1US5A 1AWBA 1ZTWA 1Z4UA 1FVSA 1UPMB 2GHVC 4RKUC 4TVAB 2GX8A 3PX0A 3CFZA 3LP1B 5JXSA 4DI3D 1QVSA 4FKYA 1H44A 2GHAA 2OI2A 2HS4A 2ZM6J 1LV5A 2AYMA 4FS1A 5F8GA 4ZCIA 1A8FA 4MNIA 3HO7A 4DV2F 3UDLA 4YDXA 3CRBA 4OYVA 3FFIA 3H25A 1L3UA 5TPAB 4O3RA 1PBAA 1Y3QA 1Q81T 1GEHA 2WBDA 2IJFA 3CCMS 1OMSA 3J7ZT 4ZVQB 2XZWA 2Z23A 4LVQA 3IWNC 4NASA 2I38A 2RVJA 4NLGA 5KT7A 3MPKA 1URRA 4ZPAA 4UOGA 3Q24A 1FPFA 2AZ3A 4OI3A 1Y3PA 4USJC 3KLFA 1M1GA 5KG6A 3VV5A 2OJTA 5MAOA 4JI2F 3PW2A 1ZOTA 1IXCA 3QAUA 4WEDA 2HBYB 1UZHA 2E1CA 4QIGA 5DDQC 1RWMB 4LUBA 2BE2B 1IXIA 5I3UA 1Q5YA 3OFFA 5J2QB 3OXNA 4HTIA 4JI7J 1USYE 2R2SA 5F3TA 4AT1B 4ERDA 3E2EA 5DW8A 1GXUA 5C2CA 4MK9A 2B4UA 3G8QA 3ISND 3ZTOA 4XKRA 3N0VA 3FZBA 2IRUA 1L5UA 3QZ8A 2V68A 4DSJA 2BBEA 4YB6A 2QJEA 2LDYA 3PXGa 4OI2A 4L3KA 4H5FA 4X2BA 1TWYA 3M8ZA 2KYXA 3NL0A 2VPXB 3MM7B 2UXBJ 4CO2A 2A1BA 4TY9A 3M8UA 4NZ7A 4C2MA 3TVYA 4ED8A 2RUSA 3MCMA 3N9UC 4OIXA 1K9YA 2LYVA 3T1BA 1S6QB 4HHUA 4ECUA 1HQEB 3Q83A 4C48A 4J9VA 5FLXY 2Z2LA 2WVCA 1MY4A 4RUBA 2Y84A 2YBVA 2M8DB 3QJLA 3DM2A 5CBSA 2OPPB 2G1HA 2FC8A 2LA6A 3DLHA 3K8WA 5HPQA 3TCFA 4EO6A 4MAGA 3MAMA 3D2WA 1LFWA 1RDZA 5CCLA 4DCPB 4OANA 1KVKA 1LBZA 3MPUB 5DRKA 2E1AA 1QVFR 3D6HB 1YWXA 5ETKA 3N6LA 3CCSS 5CCMA 1S1UA 2UU9F 3VLUA 1XVYA 4YKIA 4LF2A 3D0IE 4NF4B 4RUHA 4P75A 3TUSA 1QUKA 2BJIA 2Q8MA 1T9VA 3C46A 4LRAA 4PFRA 1VBYA 3K5LA 2UP1A 4XPCA 3KUGA 4B3MF 5CYMA 1ACMB 4XDCA 2QEXS 2NSCA 2QRYA 2XMKA 5T14A 4K4SA 5DLFA 1NKBA 4O23A 2BQ3A 1KVIA 4AYBD 1FJGJ 5C24A 4P73A 4NXNJ 4F31B 3HFKA 1RQ0A 3LGMA 1NNTA 4R6KA 2V6AA 3OSNA 4CLFA 1FFGB 1F5CA 4I3EA 1UEUA 8ATCB 1WDNA 2Z8EA 4L72B 4I1TA 3SXLA 1EKSA 4QYRA 1H2VZ 4U7UK 1JLCA 4ES3A 2K06A 2FVRA 3HT0A 4NOHA 1UIVA 4CIOA 5D0EA 3ZFVA 5CQGA 3UP9A 1VQ5S 2C2EA 1PCAA 1T8EA 4LSLA 5F1QA 1HNXF 2OPPA 3KFMA 1S1TA 3P3DA 4IG0B 4ZPVR 2W25A 3DKDA 1FA0A 2V8PA 1VQKS 2ALYB 1DTQA 2GMLA 1K9MT 4OLPA 3FXQA 2JJKA 3RGIA 4ECXA 3IBWA 1AFIA 4DPTA 3GSDA 5J2NB 3EN3A 4MHFA 4DX6A 5HJXA 1H0HB 2XMJA 3OLAA 1SKRA 4BBYA 1VQNS 3M32B 2FD2A 1TL3B 1X5SA 3P5TL 2GNKA 2BKPA 2PT1A 2OFHX 2J9DE 4WCEQ 1TFDA 5B7WA 2B4PA 2EKNA 2QFIA 4FBTA 2M3DA 2C1EB 2FY8A 4PAFA 4X4TA 3VGTA 3IR6B 2LXUA 1Q5VA 1I6BA 7FD1A 3MM5B 3M2RB 4EK2A 4H5GA 4OZJA 2ZZNA 1Y1ZA 3IBCB 3PM9A 2KJVA 3OJUA 4GWXA 3PFEA 1BUXA 3BV8A 4ED0A 1S10A 4DSIA 4EYHB 2B56A 2UUCJ 3NOGA 4FDFA 1WKKA 1AROP 3RUBL 1QGXA 1LW2B 2LXFA 3AOCA 3BBFA 3MCNA 3NOCA 4RNSA 1ZKBA 3HZGA 4IQXA 2C2MB 1KTVA 1XK8A 3UDEA 3MI7X 3NGRA 4IO6A 1RT7A 1HR0F 1S1WA 4P8BA 1F9EB 4MEVA 1VSOA 1OS5A 1PAEX 2YNFB 4I7FA 4BDLA 3NAHA 2KHDA 2XXTA 3ONQA 5IC4B 2C2KB 3UPFA 3CC7S 5JUMA 1MQHA 2WCXA 1TUWA 4GMKA 3MEDA 3AA9A 1YAEA 2YX7A 2JH3A 2FJVA 3KG4A 4YR0A 3CMES 2R71A 3TI0A 4B3OB 3AXMA 5DTBA 4ZIVA 2WB1D 3DELB 4FXVA 2BACA 1RTZA 1YTVA 3PX6A 1SQGA 3H2LA 4K2XA 4GVLA 3LPYA 2J6TA 3TP2A 1E6VB 2E66A 2J0WA 3KLGA 1S1XB 1NRKA 4DFJA 3N28A 4ZEFA 3GZ7A 3U7JA 1DAXA 2KN4A 4FP9A 4FVCA 3QSLA 3M6WA 1P1LA 1UFKA 3MZBA 4DR6J 4FXDA 2I0CA 2CNOB 2MTLA 3OD2A 2HAVA 3EHUA 2VA2A 1ZM4A 3KC1A 3BKTA 1VDHA 2ZH6A 3UE2A 3D1RA 1OSDA 3K1MA 1QTNB 2EK1A 3BYPA 5GAEI 4LP2B 3GLJA 1RT3A 2XI2A 2B4LA 3MR7A 4PFBA 3E01B 4X62F 4RW4A 4IFYB 3RAQA 2ASJA 1YRXA 3LSLA 3H6UA 2XX9A 2I6WA 3UN6A 4M5IA 2ZH3A 2CPZA 3H6WA 5CD4A 1FWKA 1FTAA 3DLBA 2B8PA 5F0WA 3TUPA 4KGMA 2KRBA 4GWYA 4S0MA 3A1YG 1CJVA 4I2PB 1FRMA 2NQPA 4WIIA 3HHLD 2FGCA 4JSDA 4OL8A 4EXLA 2AU0A 5DT6A 1B0PA 1I5OB 4DL3A 3KN3A 2XMWA 4FXWA 3NCRA 1K1SA 1C2PA 1HBNB 2B9WA 1IBMJ 3CJ8A 3H2VE 1IMEA 5LMUF 4K4UA 3LALA 2K7KA 1M5BA 5DVFA 2XS5A 2KXNB 2FDNA 1K47A 2CJBA 2DR9A 1KP6A 4BWJA 4THIA 1HW8A 5A76A 3LAMA 1Q4RA 1RT6B 4LR8A 3OFEA 3ECRA 2J8AA 4YU0A 4PEOA 1V5IB 3PW4A 3SETA 3J7AN 1S48A 3QRRA 2ROEA 4CM2A 3QWPA 3P6YC 3MEGB 3I56S 2DXYA 2N3OA 4NZ0A 4NX9A 3M6UA 3OD7A 1R8AA 3LP0A 1S1XA 1NL5A 3T93B 4DDDA 1WNEA 5J1EB 2DD8S 4ZS9A 2DH9A 5E2QA 3EVMA 4KFQA 1XOCA 4GKKF 1U26A 2REJA 2KU7A 1IM4A 3KDOA 2HBQB 1WI6A 1URNA 3QXMA 2QVVA 1KNZA 2YNIB 1HHTP 4MKBA 1JQGA 5KG1A 4IY6A 2ZD1B 3EDRB 4LSNA 2J0XA 5HO4A 4X84A 2OSQA 5F8HA 3H06B 1YJ7A 2R2TA 1MNEA 1EETA 3BM7A 2RHSB 4NEZA 2K8GA 4RZRA 4LF1A 1RTJA 5H9EK 4QR0A 6AT1B 4FF2A 4Y2MA 3LWMA 1X5PA 3KK2A 3W2WB 1HNIB 2I0BA 2QA2A 5HATA 3QYTA 4DL6A 1X4CA 3ZZTA 3I0RA 5KFKA 2XM3A 4E0DA 1NH7A 3EYZA 3MVXA 4G61A 3EPIA 1HD1A 3LSFB 1URSA 3LV0A 4PP0A 5DG7A 4PG6A 4IG3A 3OSRA 3M30B 5DVJA 2XYGB 5JK4A 1MY2A 1K44A 2AIRB 3QIMA 1NDPA 1UVMA 4IDKA 1KQFB 3TJ9A 5IV4A 2CPYA 2JEGA 5B09A 3N5BA 4XK8C 2Y7WA 4A8YA 3C9HA 3VXCA 2BVZA 4Q45A 4P56A 2F7AA 4Z7EA 1P6TA 1X9MA 3HPOA 4U7CA 4I40A 1ZH5A 5E7OB 4DR5J 3GBBA 1WF0A 3D4GA 1X4BA 4ZJQA 1S0MA 3O2IA 2VKZG 1RAIB 2YX4A 3QMQA 2M70A 5EQ9A 3DP4A 1CG2A 3D6FB 4ZHRB 1PC3A 2FC9A 5AXNA 5ITPA 5ET7A 1F0XA 2J7WA 4CLSA 1E6YB 4GD5A 4Z0IA 3POTB 1CLFA 3WDOA 5CI5A 3DDNA 1FVQA 4JV1A 3MMBA 5A8WB 4KHPF 4FPRA 4UUXA 2WHOA 1XC1A 2FBPA 1BQMB 4ED4A 1RTDA 1FDBA 3J80Y 3DC2A 2QVRA 3KK3B 4C97A 5KG5A 2WVDA 4EGLA 2I2YA 4ZVHA 5HP1B 3PUZE 2R7VA 4DV3F 1Y9UA 3CC2S 1YZ7A 2YPNA 3PIPQ 3SSQA 1U1KA 1U47A 5HROB 4KB7A 1U1QA 4I68A 5HMYA 2O7UA 5B0EA 3LP1A 4XFEA 3OV7A 3WAFA 3QT7A 3BSAA 5L1JA 3RQTA 4JWYA 3C66A 3KFWX 1HQUB 2PMZD 1T02A 3PUXE 1RP5A 1IXGA 3UVJB 4OHXA 3MMCB 3CEDA 5KFLA 3TMGA 1VJQA 1T3OA 2B6AA 4OVPA 4U67Q 2PMWA 1A0OB 2O5DA 3I4PA 2L5VA 5CAAA 4BC9A 4NYPA 4CNYA 4N6PA 3QK6A 2BQUA 2DRDA 3CCES 2OWTA 2ONSA 3FFIB 4TU9A 3NGKA 3KBZA 2HQGA 4BDRA 1NDCA 1POTA 2N7YA 4V19X 2QA4G 1IBKF 1QAJA 3HFVA 2ZYOA 3GILA 2YLNA 2OLWA 1KC8T 5I58B 4HVZA 3THVA 5I57B 4PXBA 3OUYB 3AQPA 3W5YA 4P71A 2UXAA 4ELQA 2FVCA 2HQDA 2RQ4A 1SW4A 2YWHA 4FYWB 5CHCB 3FVOA 4F29A 2P8IA 5EN1A 3CI8A 5KFYA 2D1CA 3K59A 2HHMA 2VGQA 1IVZA 4FVMA 5KFFA 2I0XA 3OTOF 2WONB 3CO0P 2E1SA 3EXCX 2E1PA 3ENAA 4PGNA 3DI6B 4LJMA 1FX2A 1U8SA 1G6BA 3OTBA 5B0GA 2DNMA 1XWLA 4CLZA 4XXUA 3SFGA 1IQZA 5AA4A 3GJRB 4U22A 2W2PP 3G6ES 1SH2A 4ECYA 5F24A 3H6TA 4WZMA 3W1YC 3VGVA 1U6FA 4U4XA 2ROGA 2RB7A 4C7QA 3QZ7A 1U24A 4PFIA 1RISA 4HI2A 2XNQA 4QR2A 1RT4B 3WHIA 4J9NA 1PBQA 1AIVA 5D4NA 4GVOA 3A13A 1N52B 1OJ4A 3K6XA 3M2VA 1IBKJ 1I69A 4MLQA 4PBHA 3MW0A 2XMVA 4O3QA 1WELA 1RLDA 2HK2A 3BIGA 2MKYA 1OYDA 3J7A1 1OY6A 2IYGA 1DTTB 2DK2A 2DR6A 5LL6d 2XY7A 4NA3A 3LA0A 3O2AA 3IB0A 2ZJRQ 2OPRB 1OY8A 1WDTA 4AD6A 4KYEA 1R6YA 3PYDA 2HK3A 1NK7A 4USIA 2HAFA 2KM8B 1Y7PA 2LAOA 1Q7LB 1GXTA 4ZCLA 3VQTA 3FRZA 3KMQA 2VUGA 3AXFA 3SFUA 2MQMA 4LF9J 1TL3A 1FD8A 3G6XA 1HWKA 2XZDB 3PTYA 3H90A 1KZ8A 4MNCA 4H4OA 2LP4A 3HO1A 2POKA 3UCZP 4PFYA 3BQ2A 2JLFA 1JLEA 1D09B 5ET5A 1YLXA 2KZZA 4CI0B 3MVZA 4WK1A 4OJGA 1WG1A 4TNOA 4WWSA 4B9SA 1BKAA 2QS3A 1IM6A 3SEXA 2KB2A 5DGBA 1R31A 1KWHA 2PSZA 1PAUB 2LEAA 1CS4B 3GR1A 3FC9A 1RWOB 2FLPA 4B9VA 4RPNA 3MAAB 4CT8A 3IG1A 2PFDA 2IMWP 3H4BA 2GH9A 3FRYA 1QAIA 1Q82T 4LRBA 4U1ZA 1D8ZA 1WC6A 4KQZA 1DK4A 2IPOB 1ELJA 1MW7A 3MR5A 4LF8F 4TLMB 3R5CA 3N6TA 5D0HA 2KYZA 1CB6A 1UWAA 1YVFA 5ETQA 1EYIA 3R7XA 1X9WA 2NXOA 1C4AA 1HNZJ 4HS7A 3TARA 3ENWA 3MEDB 1QM9A 2FHJD 4QIWD 1D4NA 2AYBA 1RK8A 4NMYA 1IZ1A 4GX4A 1AZSA 1S79A 3DGVA 3DRXA 3OVAA 3Q29A 4E8UA 5DYHA 1M5FA 2F7BA 3BS9A 2CQGA 2PO4A 3DCAA 1QKAA 2ZZWA 2ZH7A 2DPIA 3HSJA 3WC0A 2D9OA