2QMXA

The crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
278
structure length
278
Chain Sequence
NWLIAYQGEPGAYSEIAALRFGEPLPCESFDDVFSAVTEQKADYAVIPIENSLGGSIHQNYDLLLRRPVVILAETFVKVEHCLLGLPGASVETATKAMSHPQALVQCHNFFATHPQIRAEAAYDTAGSAKMVAESRDKSALAIASKRAGELYGLDILKENLADEEWNITRFFCIAHENNPDISHLKVRPDVARQKTSIVFALPNEQGSLFRALATFALRGIDLTKIESRPSRKKAFEYLFYADFIGHREDQNVHNALENLREFATMVKVLGSYGVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prephenate dehydratase
publication title Structures of open (R) and close (T) states of prephenate dehydratase (PDT) - implication of allosteric regulation by L-phenylalanine.
pubmed doi rcsb
source organism Chlorobium tepidum tls
molecule tags Ligase
total genus 85
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qmxA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmxA02
1QUJA 4LZ8A 3O97A 1FQDA 1I69A 3MPLA 3RY3A 1A99A 3O66A 2Q89A 3FASA 4OESA 3ENVA 2LVWA 4C1UA 1LFGA 4BDNA 4ZZAA 3F11A 3A09A 5AA2B 2NOOA 3EN3A 3FUZA 3NRBA 3FVOA 4Q5TA 2V93A 3CIJA 2O1MA 3E3KA 4LZ7A 1P1NA 3PUVE 4PWUA 1Y4CA 1H44A 2QJEA 3IORA 3OFEA 1NL5A 2ZMBA 2V3TA 4POWA 1LB8A 5KDTB 3PPOA 5I59B 2RCAA 4F1UA 3USDA 1IXCA 1JW1A 5T41A 1NH7A 4K3FA 1SI0A 2UVHA 2V25A 1FW0A 2J0WA 4IGRA 1BP5A 3O28A 3Q26A 4PE5B 1OIBA 3U93A 2VD2A 3TUZC 2RF1A 5CBSA 1ZKBA 2UVIA 4AQ4A 1QVSA 4PQJA 2NXOA 2ZNSA 5AA1A 4XKNA 3FGSA 4I62A 2B3FA 4GD5A 4ZEKA 1NKXA 4XKQA 1B3FA 1MQGA 2F7CA 3S4UA 4O3CA 5KDTA 1P1UA 1UIUA 1B5JA 3T9HB 2RE1A 3S9MC 2Z23A 1D3KA 1S9TA 1VE4A 2KO1A 3CRBA 1N76A 3B6TA 3IJOB 4NF6A 4GRKA 4RYAA 2F34A 3RT6B 4BDRA 3C4MA 1LK7A 3N6UA 1EZ9A 2MDAA 3CR9A 3P96A 1FQBA 4MLQA 3PD9A 4NF4A 4IO5A 4ELRA 2F6GA 1DOTA 1SW4A 4ESXA 2P1SA 3SEYA 4LP2B 4TOZA 1LAFE 1ZBMA 1ZIUA 4XTCQ 3KN3A 2DWIA 4ZEIA 4NMLA 5K2XA 1EU8A 1SW1A 4RPOA 3LSLA 2THIA 1P1WA 4XKRA 4PFWA 3UIFA 1SI1A 2QS1A 3CEDA 1JVYA 4KHZE 3D4GA 3MBPA 1II5A 3PMVA 4JSOA 1ELJA 2DP8A 4MBPA 4IY6A 1FQFA 3VFJA 2B3BA 1UJ4A 4G68A 4IO6A 1Q1KA 1A40A 5H8NB 5IT4A 1MXVA 4F39A 3CFLA 1B0HA 2DWHA 4X1DA 3DLNA 3I5OA 4G8HA 3OXNA 1N3WA 1B4ZA 4ZECA 3IOTA 3OEMA 1B9JA 3EQ1A 4OERA 3M8UA 3T96B 3TFLA 3I6VA 4GQOA 1A55A 4YMBA 2UVJA 4IO3A 1B7ZA 3M3KA 3AB4B 2D3IA 5ISUA 5L9MA 5H8FA 2O7UA 1GGGA 4U22A 2P2AA 3SESA 3EHUA 2NVUB 3OFHA 3K2DA 5EHMA 2XXVA 1TFAA 4G8NA 5AA4A 2RKMA 5FHMA 5FIIA 4OYVA 3GBBA 2E1SA 3QUJA 4XXUA 5A5XA 3U7JA 3C33A 2NWJA 2WKYA 4N13A 5ICTA 3H6UA 4C1TA 5L8DA 4GXAA 3S9LC 1B40A 1JVXA 4X9TA 3ILTB 4BDOA 1B46A 1IXIA 3HSTA 2IEEA 4RK2A 2OCUA 4ECFA 2Y7WA 1TFDA 3AAWB 2AYSA 3N26A 1POTA 2FGCA 2B65A 1FTOA 3LSFB 3TUSA 3G3IA 1D9YA 1HSJA 3O6IA 4O3AA 4ZEDA 4YKIA 2GRVA 5I56B 3ECRA 3FV2A 4KPTA 1N04A 2A5SA 3KJ7A 3RT8A 4U2RA 2O51A 2HQ0A 3HV1A 2JOQA 3LUYA 5I84A 1R1NA 1ZTYA 4DLDA 3BKIB 4YZZA 1USYH 3TCFA 2DQVA 1LK5A 1QULA 4H0WA 3E4RA 3K6UA 4ESWA 4R75A 4OFOA 1AL3A 3KOTA 1B51A 2REGA 2DS9A 5IS2A 2BJJX 3C35A 3B7DA 3TMGA 3ONMA 1BLFA 2QS2A 4F22A 5CMBA 2CZLA 5JK4A 3U92A 4H5GA 3MWBA 2Y7KA 2Z8FA 4PFUA 3EHSA 3OSQA 3FATA 1ANFA 3MJNA 4GLIA 4N6PA 5H8QB 2I6EA 3OFGA 1MQJA 3KGCA 4LZ5A 2FNCA 2OBGA 3ENWA 4NWDA 5TPAA 4BDQA 4QRZA 4G68C 5IAIA 2UYEA 4YB6A 3OSRA 2H5YA 3AB2B 4U1OA 1PB8A 1MXXA 2VHAA 3C34A 1Z7ME 2HXWA 3CSGA 3JYRA 3MQ9A 5IKBA 3PU5A 4YKPA 3H6WA 2DWJA 1JNFA 1I6QA 2ZYNA 1NNTA 1BTJA 1JETA 2HCAA 2V84A 2RQMA 4P0GA 2YJPA 4F2OA 4GO5X 4JWYA 2I9SA 4R2BA 5KCJA 2Z8EA 3PMXA 5HM4B 4I1DA 4E0XA 5H8QA 4IGTA 5H8HA 4R6YA 1IXGA 2DE2A 4F3GA 3TYHA 2UYFA 4F31B 4PP0A 1SW5A 2I58A 4POXA 3LC8A 4GIZA 4EF1A 2DWAA 1LFHA 3P7IA 3DHXA 4H5FA 4OZ9A 2PT2A 4ONYA 2ZHOA 2PVUA 3N6TA 2Y7IA 1YTVA 1EZOA 2H25A 1FTJA 1OVBA 3WAFA 3TQWA 3PD8A 2UVGA 1MY4A 2R6GE 4IY5A 4OFLA 2ABHA 4WEDA 1B3LA 1IUDA 4FATA 4DZ1A 4MLVA 1M5CA 1R9LA 3IR1A 4U21A 4GL0A 1S50A 4X84A 2ZNTA 3A3CA 1LKZA 3V89B 1B7HA 3DHWC 1LAXA 3TUJC 1Y3QA 3UN6A 2VGQA 4OMBA 4G77A 4I8CA 3BFTA 3RUMA 2PYYA 3FJGA 3L7OA 5AA3A 4JDFA 2F8DA 3D4CA 3DP4A 5JEIA 1JEVA 3DP8A 4QFKA 3FJ7A 3FV1A 3IOUA 1JW5A 2XXPA 2Y7PA 2V3UA 1QUIA 3O9PA 1MH3A 1LAHE 2I0BA 1GTKA 3VLUA 5DVFA 3V8XB 2F7AA 4WXJA 2H9BA 4JWOA 1NFTA 2REJA 1H43A 2RQKA 2XXQA 1F9BA 3S9EA 4R2FA 1MQDA 1CE2A 4OTEA 1JW4A 2ZYMA 2DVZA 1U8SA 2XXTA 4KCDA 4ZZEA 2XXIA 5CMMA 1ZMGA 4NF6B 2XXHA 2Q88A 4ZS9A 5AE4A 1LBBA 3MAHA 4LQ2A 4EUOA 2DE3A 2G93A 4QFLA 3K0VA 2LQJA 2O68A 3TQLA 1IITA 3RN8A 2O69A 1IIWA 4FIMA 4NF4B 3TTRA 5J1DA 4R6KA 4GFRA 2XXUA 3TAJA 3H06B 3CI8A 2X7PA 3V83A 4HCWA 1QKAA 5B70A 4OEVA 4DIGA 1MM6A 1I6BA 3RNNA 3HPIA 3DDNA 1FQEA 2HZKA 2OK2A 4QFPA 1UTHB 3QSLA 3TPAA 4LQ5A 1PEBA 1MH4A 4G68B 4FEDA 3TKDA 2QRRA 1QUKA 4I9DA 1MY0A 1USYE 3HHEA 1SDXA 3O29A 4U1ZA 1DSNA 3SEUA 3FXQA 1B1XA 2I4BA 3I3VA 2Q9TA 1ZJLA 3RPWA 2DXYA 3S9NC 2H4IA 2OWTA 3M3LA 2Z22A 3K1PA 1N7XA 1WDNA 4DXUA 3UK4A 1MPBA 5H8FB 3RTWB 2RINA 1UTHA 3LSWA 4F18A 4Q8RA 3L6GA 5AA4B 4KI0E 4FEBA 5ICQA 1TWYA 3B6QA 2QL3A 3RGYA 1T0KA 4H8JA 5CRYA 1B3HA 4JBZA 3VV5A 5IT0A 1SYHA 5A5XB 3W7BA 4F3PA 2QS3A 3CVGA 5HBCA 3OEKA 4P0IA 1YPNA 3G3KA 2H9ZA 5K2YA 3QXMA 4NWCA 3W9WA 3N5LA 3QAXA 1XC1A 4F3BA 3OELA 1I6AA 3MAMA 3H03A 4QFNA 4XIGQ 1QKBA 1LAGE 3U8QA 5JTYA 1N7WA 2XXYA 3E9XA 4TLLB 4EXKA 2AL5A 1NMUA 3GZGA 4EDPA 2F5XA 4ISUA 4RXLA 3ZKLA 4KR5A 4DE8A 4HTGA 1XTZA 2OWSA 2YPNA 4AB6A 2D5WA 4NF8B 1B05A 4WEPA 3IO4A 5CC2A 1B52A 3FVGA 1B1HA 4C0RA 2UXAA 2IA4A 2FA7A 2HFBA 3R7XA 1N84A 3VVEA 1PB7A 2XX9A 5EYFA 2HAVA 3UORA 4IO2A 3TDJA 4KFQA 3L6HA 1SQYA 4F2QA 3IB2A 5I2NA 1B32A 4ZEFA 2O7IA 3TELA 5AA2D 3UGWA 2CDQA 3VLVA 5CI5A 3TCHA 3IL1B 4OHNA 5F1QA 5BWJA 4G4PA 3HN0A 3S2VA 2P0SA 1LB9A 1HSEA 3BFUA 4R72A 3LOUA 4R73A 4HS7A 3OO8A 3K02A 4ZEBA 4PFYA 5LOMA 3ODBA 1UJ5A 3TTLA 4NF8A 4IO1A 2Y84A 1EZPA 5B7DA 1B5HA 2H98A 4YB5A 2M8CA 2Q2CA 2PC6A 1S7YA 1SD3A 2NUVA 4PETA 5L9OA 1EH3A 3PPQA 1IXHA 2A5TB 3K00A 2F36A 3TTKA 3JV9A 5TPAB 3G7WA 3TUIC 2J0XA 3ENQA 3OO6A 3KSXA 1N0TA 2X7QA 4QSDA 4GWOA 3O2AA 4DCYA 1IQ7A 1N3XA 1UQWA 2R9JA 1URDA 2I4CA 3BBRA 3IXQA 4ELOA 1H3DA 1L5TA 2ALUA 1XS5A 3KZGA 1TT1A 5TU0A 3QYTA 1D9VA 1LSTA 2DOJA 4Z7EA 1FQCA 1MS7A 5KCJB 3O6GA 3C9HA 5H8HB 4GMKA 1P1QA 2A5TA 4OETA 3RTFB 3WAEA 5TP9A 1OQHA 1MY3A 3FXUA 3O6HA 3PUYE 3ZS6A 4GVOA 3KN7A 4NMYA 4ZDMA 5JJBA 3VXBA 1LLSA 1MM7A 1XVXA 4OENA 1LBCA 1Y3PA 1VSOA 1YCJA 3K1MA 3KN8A 1PDAA 1JQFA 4OWDA 4BDMA 3MVXA 5H8SA 1QJMA 2VD3A 3MVWA 4QFOA 3PPRA 2P9GA 4R9FA 1A7LA 3OFFA 5FTHA 1Y4TA 3C32A 1UIVA 4UACA 1VFDA 3E13X 2DXRA 3LBSA 1JEUA 2DYXA 4IO4A 2DE4A 4RPNA 2F97A 4YKKA 3PUXE 3DM0A 1HSLA 4FJPA 2I48A 3CSBA 1Y1ZA 4Q30B 1P1OA 1SW2A 4U4XA 5DEXB 1B3GA 2ZNUA 5DVIA 5CM6A 1M5BA 1QW0A 3ZSFA 3IO6A 1KWHA 2D21A 1VR5A 3T93B 3R26A 3OENA 1WODA 3EF7A 3DC2A 3KEIA 3QIMA 3U1OA 4JSDA 2PT1A 1A8FA 3VVFA 3O1LA 3PPPA 3G3HA 1MXYA 5BUUA 2DTJA 4NF5A 3G3GA 4RJZA 4YAHX 1A54A 4KYEA 4M4GA 1RYOA 4ELPA 5DEXA 1H76A 3T66A 1ZU0A 3H6TA 3TTNA 3FIRA 4E0WA 4MF3A 3PGFA 4DXCA 3G3FA 4KQPA 1P99A 1MQHA 1Y1MA 2F78A 2XX7A 4NEDA 2ONSA 3OO9A 1ATGA 1IEJA 3CFZA 4MH5A 1DPPA 4XKPA 1AIVA 1AOVA 3T9XB 3MP8A 5FHOA 2AL4A 4BDLA 3IAZA 3N0VA 5I2KB 3GXAA 3SKPA 1PBQA 4ND9A 1AH5A 3HHFA 3VE1B 4QHQA 4IB2A 4BLAA 4LUBA 3T9UA 1FTLA 2G29A 3HCQA 2HAUA 4YICA 3A3UA 3KJTA 3KBRA 1UTBA 4M1VA 4N07A 3TTMA 4P11A 1DPEA 3DELB 2FYIA 3R6UA 4WKMA 5DYHA 3CFXA 4QSCA 1NNKA 3CG1A 3MTJA 1R9QA 2ZYOA 5I2KA 4H1XA 3QK6A 3THIA 1MPCA 4LONB 1J1NA 2F7BA 3GLBA 4DXBA 3EPEA 5AA2A 4HW8A 2P9EA 3IOVA 2NYIA 4GL8A 1R6ZA 3RLFE 5F7VA 3SDFA 4RNSA 4R74A 3IBWA 2OJTA 5M2VA 3FVKA 1CB6A 1LCTA 3FVNA 4JWXA 3RQTA 5I59A 3ILUB 2LAOA 3KOSA 2PA3A 3K5PA 4RA1A 2HEUA 1US4A 1NNPA 1B7UA 3DP6A 4F29A 4F1YA 4JXIA 1OLCA 3H7MA 3K4UA 3U94A 3T22A 3H6VA 3UA8A 4EQBA 4YMAA 1OMPA 1M0SA 4OEUA 4OVJA 3Q29A 1UJ6A 2VP1A 1B3EA 2GHBA 2GHAA 1RWUA 2Q8JA 3VLWA 2RCBA 3MVYA 3T9VA 4RK9A 2XD3A 2XHDA 2H99A 2VOZA 4NE4A 5JTYB 1KS2A 5FHNA 1GV8A 1GVCA 5I57B 3EHTA 3MVZA 5FTIA 3SERA 3H3GA 3QUFA 1B6HA 5KZTA 4QSEA 2F6PA 2DVCA 3S1TA 3OBIA 3GBAA 3MP6A 2RC9A 1WVJA 3C31A 3OMBA 3TCGA 4FORA 4MFIA 3VDFA 1DTGA 3PMWA 1US5A 4EQ9A 4TLMB 1FCKA 2QMWA 2DT9A 4OXVA 1OVTA 3MPKA 4R6HA 1MDQA 5I2NB 4EXLA 4GO7X 3PV0E 3IB1A 2E0SA 4PFTA 4KD5A 5I57A 2AIXA 3ZKKA 3PPNA 2QSXA 5DTBA 3M3FA 3IJXB 5I58B 4H65A 4AB5A 5EHSA 2HZLA 3FZVA 3LR1A 2F35A 5L9SA 4L17A 4LATA 2XXXA 3HO7A 1H45A 4IO7A 1Z7NE 5H8NA 3TEPA 4Q0CA 4H6DA 2PMSA 3UP9A 2R71A 4G2ZA 2F1FA 3U72A 1A8EA 5ELVA 3TZAA 3N94A 1AMFA 2XXRA 1Y3NA 3W9VA 4F19A 3VXCA 2JHEA 3KWMA 3K6WA 1M5FA 2PX1A 1ZPVA 3UW1A 4RY1A 2XXWA 5DT6A 4GOTA 2V3QA 3AXFA 1FTMA 1O8BA 1RYXA 4TQUQ 5CMKA 2CMOA 4LA9A 2I3VA 5I58A 3MW0A 3B6WA 1B5IA 2O6AA 1MDP1 1O7TA 1URSA 3PUWE 2QMXA 2X26A 4ELQA 4YB7A 1YBAA 4U23A 2Z8DA 2PBWA 1XT8A 2Q2AA 1M5EA 5HPQA 1O64A 4GF8A 4YKJA 1B2HA 1NH8A 1LGBC 3K6XA 5CBRA 5TP9B 4OQOA 1Y7PA 5CMCA 4F3SA 3IOWA 1OLAA 4H8IA 2I49A 4EQ7A 2YLNA 3SEXA 4ZE8A 4EF2A 4JB7A 3OD7A 2O1LA 4X1BA 2ONKE 1FTKA 3W15C 2W7YA 3FJMA 3K1NA 3JZJA 1SBPA 1SVXB 1PSDA 1B58A 5ITOA 3MC2A 2I0CA 5I56A 4H67A 4KYSA 2QS4A 1D4NA 1URGA 1LFIA 3G3JA 1B4HA 3K01A 2GH9A 3CG3A 1IZ1A 1SYIA 2F8MA 4FAJA 1BKAA 4HCYA 3MUQA 3Q25A 1MXZA 2QPQA 4DDDA 2ZXTA 1XOCA 2RC7A 1MPDA 1MG1A 1SC6A 2P9CA 3SEVA 1VFEA 4DCXA 2ESNA 3MP1A 1Y9UA 3OO7A 1MRPA 4FECA 3TODA 1PBPA 3PUZE 1PC3A 1B0LA 1RKMA 4GXSB 1MQIA 4FE8A 4O3BA 2RC8A 4NTLA 5DVJA 1YAEA 3Q27A 4ZE9A 3FD3A 3V5AA 4F1VA 1M5DA 2O84X 1NNFA 4NF5B 3MZ1A 1MXUA 4KYDA 3KG2A 3SEWA 1XVYA 3MZ9A 1OQGA 2XX8A 2QSWA 4Z0IA 3HHGA 2GFEA 1Q35A 2XD2A 4G8MA 4THIA 3KFMA 3IX1A 1MY2A 3IB0A 3IK6B 3KSJA 5ITPA 3C36A 4LVQA 3K6VA 2ANJA 2I3WA 3H4ZA 3Q28A 4X48A 1MXWA 2DSFA 2OLBA 1PB9A 4KCCA 4M8LA 1POY1 3OOAA 1MY1A 2QRYA 3SETA 2ZYKA 1TXFA 3MZBA 1ZLQA 3FXRA 4OFJA 2ONRA 4R9GA 4QF9A 2Y7RA 1GR2A 3VVDA 4UA8A 1DTZA 1DMBA 4U4SA 1O63A 1UTBB 1LCFA 1XHYA 1YGYA 1BIYA 2OZZA 3LSXA 2KLFA 4YU0A 1FQAA 1Y20A
chains in the Genus database with same CATH superfamily
4P73A 3OL9A 2WSFC 4C8NA 3MFIA 5L38A 1I69A 3O66A 3ZZZA 3H2LA 3ENVA 4AFFA 4BDNA 4ANEA 2J0QD 1WI6A 3M30B 1CC7A 1FDAA 2GGPB 3FVOA 4OA4A 3QO9B 2JL9A 2HHVA 3PUVE 4NCBA 4WPAA 2OWZA 2G1HA 2FJVA 1Y4CA 3GPAA 1NL5A 4OLPA 4C9DA 1TQLA 3I5CA 5SZTA 3HT0A 2AJQA 4X4OA 5KDTB 3PPOA 3CJ3A 1RT3A 2AJ1A 3KK2A 4F1UA 1IXCA 1JW1A 3NG8A 4LVNP 3I4PA 1HWIA 2FJBB 4QIWD 3TANA 4EO8A 4ECUA 3Q26A 4PE5B 1INPA 1OIBA 3TUZC 3LPEA 2RF1A 2YNGA 1IJFB 3TZYA 1OY9A 1JB0C 3CJ4A 2AP6A 3HKZD 4JI8F 2NXOA 3RBZA 2ZNSA 4QW9A 4XKNA 2BRKA 2HEKA 4YR0A 3I96A 2BJEA 3FGSA 1N48A 4I62A 2FVQA 1B0PA 4WYLA 4JI6F 2HQ3A 3Q83A 4WK3A 5D0GA 1FPBA 5KDTA 3RBEA 1B5JA 2NXNA 3HHLA 5AXNA 5M2PA 1WG5A 1VE4A 5F8GA 3MAAB 1H6KX 2KH9A 1SB6A 4F4AA 5D3GA 4I2QB 2XO6A 5J2NA 4P72A 2F34A 2UUWA 1HNXF 2B4MA 2E7VA 3N6UA 4TQSA 1C4AA 9RUBA 3CR9A 3P96A 5B0GA 3K2YA 5K20B 2HFZA 4JB8B 2F6GA 3I9ZA 4QCLA 1N33J 1SW4A 1RHKB 4C98A 3SEYA 1TL3A 2RSQA 3AOAA 4PFBA 1T9YA 2DJWA 3JSMA 2OI2A 4X66F 4AQYF 3MOJB 4QPXA 2HQCA 2ASYA 3CEDA 1QTNB 1NK4A 3CDWA 4YEAA 1JVYA 2RIJA 2WVDA 1SPBP 2X1GA 3D4GA 3EPGA 4JSOA 2CRLA 1HYSB 4DSFA 1ELJA 2DP8A 2DVIA 4GWZA 2YWFA 2YKQA 3TJ9A 1U1MA 1U6ZA 1A40A 5IWAF 1RAFB 1D9QA 1TKXA 4G8HA 1KQKA 4OL8A 4ZECA 2HG4A 2VQEJ 1QE1B 2PE8A 3EQ1A 1VBZA 1FEEA 2QG9B 2HRTA 4XEQA 1B7ZA 3M3KA 3VVUA 1TL5A 3UVJB 3QIPB 2YKMA 5EHHA 3AB4B 4M63A 2YKAA 2AYGA 2D3IA 3EKIA 5ETTA 3GIIA 3EPIA 4A8XA 1H7WA 5L9MA 5H8FA 4DV5J 4A8FA 3LP1B 4BWJA 3EHUA 1UEUA 4NASA 1CQNA 3ZZRA 4XPCA 5EHMA 1TFYA 2NUUG 2U1AA 3M2VA 3MPVA 2RKMA 3FFIA 5FIIA 4OYVA 2DRAA 3FXBA 3GBBA 3QUJA 4XXUA 1TUGB 4I7FB 1VIXA 2HFVA 1UWBB 1FPLA 2WKYA 3NP5A 4QWAA 4DLGA 3H6UA 4DR1J 4OI2A 4ANDA 4AE5A 3UWTA 4GXAA 3S9LC 4PYAA 1WF1A 5K9FA 5D4PA 1VQKS 3ILTB 4TQRA 1TELA 3F0NA 3H5YA 3HSTA 2FIEA 3DYAA 2IEEA 4NHBA 3A3OB 4RK2A 1WD6A 2Y7WA 4NLVA 2GCFA 2E5LF 2HPUA 3BPSP 2FGCA 3MM6A 2KXFA 3C15A 1D8ZA 4C11A 3JQKA 1NHUA 2CKWA 3HT3A 4IDKA 1HI8A 3ECRA 3FV2A 4F67A 1GXTA 2B4LA 3IG1B 3KJ7A 4U2RA 4LVOP 3EYZA 1EZZB 2HQ0A 3HV1A 4LBIA 4X65J 2VKRA 3MMCA 4JV5F 3SFGA 2BJ1A 3DI6B 4PAFA 2ZHAA 2CPEA 1EETA 1E6VA 3BR8A 3SV4A 4H0WA 1ROFA 4LIWA 3A29A 4NZ7A 3CXCR 2AV5A 4R75A 1YJNS 3ADAC 1YKWA 3KOTA 1KLMA 2REGA 5IS2A 2FC8A 1S72S 2W2PP 2LU2A 2C2DA 1CVJA 5CMBA 3DFEA 1V5VA 1AROP 3A3NB 4GWXA 3IR7B 3A13A 3IG1A 3M2RB 4ZCLA 4DDFA 1GMVA 2OFGX 3AXKA 5DO2A 3PZPA 2B0GA 5HROB 3FEZA 3VZIA 3J7A1 2OEMA 3UN2A 2E9RX 2C3OA 3T9NA 4LSNB 4N6PA 5H8QB 5EX0A 3OFGA 1OY8A 3KGCA 1JIHA 1GQEA 2B9YA 4QZVB 5TPAA 1YI2S 3NOHA 2PI4A 4BDQA 4QRZA 2VODA 4G68C 3A4TA 4NE9C 4LR7A 3NGDA 3R1LA 1S5ZA 4OZ2A 4Q0BA 1R3NA 2BJIA 4FVCA 4JV1A 5JMNA 1KVKA 1PB8A 1ZAXA 3IRXA 1WOSA 3ZTQA 1YIJS 1Z7ME 1SBRA 7FD1A 3JYRA 3HFUA 3PU5A 1NEEA 3DGVA 1S1UB 3TQEA 2GA7A 1I6QA 2ZYNA 2GS8A 3CCLS 1NNTA 4PDDA 5LM7E 4Q8EA 5EQ9A 3MD3A 2V84A 2RQMA 4P0GA 4GO5X 1TK0A 2I9SA 2CNNB 2FLNA 2Z8EA 2LLZA 2WHOA 3PMXA 2UV8G 1NK8A 5B0DA 1VLYA 5H8QA 4E0XA 3PEHA 3SFUA 3DRRB 5H8HA 1P1LA 2PFFB 4M5HA 1IXGA 1RTIB 4G3IA 2ILZA 1WEYA 3KLGA 1ZETA 3AA9A 1HBUB 4DV4J 4PP0A 1SW5A 1K44A 1HA1A 4HH1A 3JXOA 2LQ9A 1UVMA 4OI6A 2MMYA 1FHTA 1WWHA 4NX1A 2HNYA 3JSBA 3SSSA 5JUMA 4K4WA 4ONYA 2Z58B 2AYBA 1YX2A 3DDIA 5KFWA 2ZHBA 1VRTA 3T1HJ 2W01A 3WAFA 1UEKA 3SQGB 1W7WA 2V2ZA 5M2RA 1OWXA 1F5BA 2UVGA 4M95A 4IO9Q 2KG1A 3P6YC 4EZ6A 5H9EK 4B9NA 4RW6B 5K8OA 1RTJB 1VQ5S 1FVQA 1R9LA 3KHHA 2K3IA 2QZ8A 3TZWA 4Z37A 4GWWA 1FPJA 3HVRA 1C0TB 4CT9A 1NJXA 3UD5A 1S12A 1LAXA 5EQ7A 3TUJC 5D6GA 2XB2D 3N79A 2AX0A 3VR1A 3FJGA 3O5TB 3OXFA 3SQGA 1GH8A 1HWKA 4OYWA 4LF2A 1F5AA 3LANA 1ACMB 3IOUA 2XXPA 2V3UA 4P52A 3O9PA 3D1RA 2HZAA 4DV7F 4RW6A 3VAJA 1LAHE 4MIJA 2ZNZA 2I0BA 1GTKA 1JLBB 3VLUA 4HH0A 3AJDA 1MW7A 2KXHA 1NMEB 4WXJA 2V4QA 4X04A 2H9BA 1NFTA 1VRQC 1TMMA 1SIWB 1RSCA 1YTYA 2RQKA 3GB0A 2A3JA 1F9BA 5BYSA 1RHQB 2G0JA 4ZJLA 3MYUA 1TKZB 5AXKA 1CE2A 2B6AB 2ZYMA 2XXTA 4KCDA 4IFVB 3TQ1A 1U0HA 1HWLA 1FPDA 1QUVA 1NO8A 4X4PA 5AE4A 3MAHA 5EN1A 4LQ2A 7AT1B 3BBFA 5D4LA 2OPRB 1UZHA 2DE3A 1LW0B 4CLSA 2G93A 1P27B 5IQ6A 1DK4A 4OZ3A 4CCHA 2VPZB 4PGPA 3IN5A 2FUG9 1SKUB 2C3MA 2AJ2A 1VGYA 3BSOA 1DTTB 5J1DA 3V4IA 2GQ1A 5LT5A 1IKVA 1MMLA 2H5IB 5HVGA 2XXUA 3TAJA 2AEJA 4L76A 1H98A 1D9DA 1RTZA 4CH7A 2QYCA 2X51A 2PFYA 4UY8T 3LGMA 3HPIA 1FERA 3A3PB 4R8UB 4IFVA 3THTA 4KSEB 2Z2LA 3W2VB 1LW0A 2CG4A 5C42A 2QRRA 3KC0A 1U09A 4MIWA 3V5RA 1QUPA 1HHTP 2MXYA 4C8LA 1NK7A 2ZH1A 2HHHJ 3SEUA 2FJDB 4ETZA 3AHPA 2I4BA 3UN5A 3D6FB 4GKKF 3I3VA 1RQ0A 3PX4A 2DXYA 2HNDB 4CNZA 3S9NC 2H4IA 4BHQA 1ZM4A 3X3UA 2AZ3A 1N7XA 3W62A 1DURA 3IWXA 3UK4A 2XO7A 2FHKA 1HQEA 4WCEQ 3OSPA 1TK5A 3B54A 5GAGI 2G4BA 1SCJB 1J5EJ 4Q43A 2XSJA 3LQVA 3MEEB 2GIRA 2ZD1A 1KKHA 5ICQA 4QIGA 1TWYA 2AEFA 5LSRA 3TVZA 1B3HA 4JBZA 5IT0A 4MFBA 2OEJA 4EBCA 1YZ6A 1S6PB 3R5CA 4ZP9A 3NGRA 1RKJA 5CYJA 1CNQA 3OEKA 4RWWA 3KG0A 4P0IA 3PO5A 1Q86T 4M5IA 3G82A 1YPNA 4DS5A 2IVYA 1IUJA 4USHA 3QJLA 1RBAA 1LW2B 1QD1A 3ZZTA 3H03A 4BC7A 5C24A 2HRUA 2NXJA 3CCJS 1LAGE 3IGVA 5JTYA 1Q78A 1N7WA 4TLLB 4DUYJ 4IH6A 1EHWA 3CIZA 4OZ0A 4K4XA 4ZP6A 2EFNA 4YHHJ 4RXLA 2ZH8A 3W60A 3CDAA 2BOPA 1S1VA 3K58A 4NLOA 3P5TL 4N91A 4PEOA 1OPZA 1XTZA 4J9LA 2YPNA 4I3EA 1RK8A 2OUGA 5HLFB 4RW9A 4WEPA 1FKOA 3IO4A 5FBPA 1AA1B 3POTB 5CC2A 2YNIB 5D78A 1LW2A 2UXAA 3NOCA 1EP4A 4WIIA 1XEZA 5I3UA 1NPKA 4F3OA 4F2QA 2IJFA 5I2NA 2HKEA 2O7IA 3TELA 1RHJB 4CDIA 2CDQA 4OYBA 1N54B 5EGYA 4G4PA 1JJ2R 4UTGA 1CQMA 3ITHB 1T05A 3EVOA 4O94A 1L5UA 2HHUA 3GWCA 1CJVA 2MLYA 3KUHA 3GYGA 4R73A 1WOOA 4IR9A 1RP5A 4CYUA 4PFYA 1GX6A 3Q22A 1S76D 1RHRB 5HLFA 1HNWF 3RZAA 3HHNB 2CPXA 3MF5A 1M1GA 2H98A 4DL5A 2M8CA 2PC6A 1S7YA 4LBHA 3RR8A 1LFWA 4FYDA 3JV9A 3TTKA 3G7WA 5C25B 1Z1ZA 2F65A 5E3PA 3OO6A 1ZM9A 1LBVA 2HVHA 4ALZA 4Y65A 3O2AA 4O4GB 2XMMA 1N3XA 2O3DA 4M1KA 2R9JA 1JLFB 2WONA 4B3SJ 4P1LA 4K59A 4ZVTB 3PW7A 1K73T 3BBRA 2NXEA 1TR0A 3IXQA 3OLBA 1RLCL 2L3MA 4TU8A 2DH9A 5B7WA 2FIUA 5B0CA 3K5MA 4NZ0A 4IG0B 3KHGA 2KL8A 3TW0A 2CQCA 3O6GA 3C9HA 4GMKA 3KLIB 1XNRF 2AX1A 3BV8A 4LF5J 3RW7A 2P8IA 1RWPB 2F9DA 1TFWA 2R2UA 4GVOA 4NMYA 4KFBB 1LLSA 1MM7A 2C42A 1LBCA 1YCJA 3KN8A 2HHWA 2LYVA 4ED1A 1JQFA 1JLFA 4LSLB 5KFXA 3HPOA 1LOUA 3MVXA 3NCPA 5H8SA 1IM4A 5LDZA 1VYAA 1M90T 3LV0A 2K06A 4FXVA 3GILA 1FDBA 3ONQA 4HHUA 2VPOA 4NI2B 1N5VA 4RUCA 4IG0A 2ZZVA 4QXDA 2YX7A 1H74A 4IO4A 3UDEA 4EYHB 4ILLA 5E0OA 3PUXE 3H5XA 1IR1A 1HSLA 1Y5NB 5E3CA 3UE2A 2I48A 2V2VA 3LO3A 1Y1ZA 1H38A 2P2CB 3IM9A 2X1BA 3DGPB 4DQIA 1WTFA 3MEGB 1B3GA 2IA0A 1VK3A 3PY8A 1QW0A 1XMBA 1GXUA 2VG5B 4RW7A 1VBYA 2D21A 1Q0NA 1JK9B 1LV5A 3DRXA 4DUTA 3MMJA 2D7SA 3AODA 1VR5A 2DEJA 1UW4A 3R26A 3OENA 4PAIA 3FEXB 4K50A 4ZLNA 1HNIA 3BDEA 3FC9A 5F8IA 2NZ4A 1ZTTA 4WP8A 1UWAA 2CA9A 2WVBA 1WG1A 1B0VA 2YWHA 3G3HA 5A8KA 1AW0A 1DJ0A 3EXYA 3QT6A 1R43A 4M4GA 3GZ7A 2OH2A 2NSBA 1RYOA 2XYHB 3CIMA 3AY0A 1WUUA 3PX6A 1NJYA 3CJSA 3MEGA 1JXLA 5CABA 3FIRA 1S57A 3KJNB 4ZVEA 1ZOTA 2RKIB 2W8LA 2DXDA 1V5IB 2AF6A 4ED5A 1RXOB 4KQPA 4UABA 4M94A 1Y1MA 2WB1D 4LF1A 4MKYA 2XX7A 5DETA 1KSPA 1IEJA 2MQMA 4MH5A 1Q8KA 1DPPA 5LTCA 2CJ9A 3NXZA 3T9XB 3MP8A 3Q86A 2XA5A 4GRSA 3W2WA 1BC6A 1YRXA 1PILA 3N0VA 4GKJJ 5I2KB 3DLLQ 2E7XA 2J6SA 3SKPA 3C16A 2E7WA 1AT1B 1PKUA 2HRYA 3KLEA 4ND9A 1CLFA 4KGVB 3HHFA 1G7CB 4N81A 4MJOA 4ICLB 3VE1B 1W26A 1X7VA 4QHQA 1KN6A 2I5JB 4O4RA 2MGZB 2HAUA 3IS9B 3CCTA 4DWIA 2BBEA 3A3UA 3PHEA 5HJYA 1SJ4P 3KBRA 4B3MJ 1UTBA 3KK1A 4N07A 3TTMA 2DIVA 1WHXA 1MN7A 3MR7A 1VK8A 1CULB 3R6UA 2FYIA 4ES1A 4I68A 3A12A 1XN9A 3D54A 1IBMJ 5FDLB 2M9KA 3MCSA 3V6HA 2B51A 4RUHA 3RRGA 3CG1A 4PCQA 2ZYOA 5I2KA 1WC1A 3GLBA 2QVRA 3EPEA 1JJHA 4Q44A 3IOVA 5F8NA 5A8WB 2CPIA 4BBYA 2I5JA 1HHQA 3VALA 4AL5A 4R74A 4LFBJ 2FC9A 2MGZA 5A6PA 4F2SA 2OJTA 1CB6A 4XIUA 3H4DA 4J9RA 2DHAA 2DITA 1Y9OA 3ILUB 2XY5A 3KOSA 2BKPA 4DUZJ 3PACA 2HEUA 4EK2A 1US4A 1LWCB 2BEFA 1X5OA 4M5KA 3LWMA 1N36J 1GMWD 4XTTA 3M9MB 4DBQA 3H7MA 2PA8D 3Q8QB 4EQBA 4YMAA 2W25A 1FBGA 3KJQB 4FXWA 2J9EA 2HZVA 1OQ3A 3RB4A 1U1LA 2VP1A 1FDNA 2XTJP 3NS5A 1KHWA 3VLWA 1DARA 4UZBA 3SCIE 1FSAA 4PG4A 1HIYA 2VOZA 4WZMA 2VFUA 5IXUA 1GV8A 2KT2A 3EHTA 1HARA 1KDNA 1SI9A 3VCDA 2ROPA 3MUMP 4DQQA 3Q0AA 1ZPWX 4OVTA 5KZTA 2IDEA 3DLKB 2DVCA 3GCWP 3U27A 1FWPA 3BZQA 3MM8B 2IDLA 3GBAA 1ZYQA 3UDLA 2VG7B 4FF1A 1HL6A 2WCXA 3C8YA 3C31A 4FORA 2HGMA 1Q81T 3K5OA 1REVB 4Y28C 3BN7A 2GJFA 4PUOA 3TA2A 4OX9J 4I3YA 3ZC4A 1K47A 4TLMB 4DV3F 1DFDA 2DPJA 3NOGA 3MPKA 2NCKL 4EWTA 5KG3A 1MDQA 2X3GA 2PT0A 4GO7X 3DRYA 3T1AA 4PFTA 4KD5A 2R2TA 1U2CA 4OHWA 1IMAA 2AIXA 4DSEA 4CTAB 2FHJA 3RU0A 4H65A 3TJ8A 4IQXA 2BW7A 5KG2A 4WYWA 2HZLA 2ZH6A 4JYAJ 3FEYB 3KNGA 2AYEA 2VG6A 3FZVA 1SC4B 3NEKA 2J9CA 4D3HA 2HHQA 3MM8A 5D4NA 2HQDA 4G1QA 4GBVA 4B3TF 2UXCF 2IAJA 2EFQA 1H45A 2W2MP 4KPYA 3R9LA 5H8NA 1E6YA 6AT1B 4FPIA 3N9UC 2PMSA 4G2ZA 3H0PA 2C2NA 1A8EA 3PR5B 1WF2A 3SV3A 5AE3A 5ETQA 1WHYA 1F6TA 2XXRA 3E3XA 1Y3NA 4O3NA 1NUEA 5LXYA 3B4DA 1JLGA 2BJ9A 4USIA 3BO2A 1KOHA 3K6WA 2MYFA 1M5FA 1GT8A 3NCQA 1ZPVA 3UW1A 1RDYA 5GADU 1BWEA 1FXLA 4F0MA 1RYXA 3NAIA 2E66A 4TQUQ 5CMKA 3QMFA 3TVYA 1S97A 2O6AA 5HVHA 1MDP1 1QM9A 3ENAA 1URSA 3T6BA 2H5JB 1SQEA 2RMLA 1YZ0A 4ELQA 5CYQB 4DFKA 4YB7A 1S0NA 3HHLD 2G2OA 2KI2A 4U23A 1MROA 1XQIA 4IG3A 5J1NA 2Z8DA 1NLKL 2O5DA 1XT8A 5IT9Y 1RA7A 3LP0A 1VCTA 2ASLA 3PTWA 2PMHA 1UCNA 1VQOS 1I5OB 2DGTA 1U1QA 5TP9B 1VQ4S 4QR2A 3ILJA 5IZ3B 4F3SA 3D68A 4WKYA 3F41A 2UVRA 3QMQA 2I49A 1U2FA 4MX6A 3PHTA 3F44A 3D0IE 3UCZP 3QIDA 4DR7J 2OPPA 5LJ3Y 4A8OA 5H1SV 1TUWA 4F0KA 4X1BA 4RU2A 1FTKA 3W15C 2Q1LA 4O0IA 2MKYA 1TU0B 4YOEA 1SVXB 4HEA9 1FWLA 3AA8A 3QQCD 1Q5VA 5FLXY 2Q3PA 4CO2A 3MC2A 4WU3A 2ZZNA 4KYSA 3HF5A 2LDYA 5F3ZA 2F5GA 2XNQA 1B4HA 2FJWA 3UCGA 2GH9A 1FJGF 3CG3A 1CSJA 2FB0A 3MEDB 2DGSA 2B7CB 2RRNA 5EDWA 4HCYA 3J7AN 3R2DJ 4QPTA 1MXZA 2KZMA 4DDDA 1MG1A 4NLTA 4KRWA 2KJWA 3TZZA 2ESNA 4R0EA 5ETPA 3BO4A 3OO7A 1NU4A 3PJ9A 1PBPA 5F3TA 1PC3A 1DBDA 5EUHA 1K8AT 3RAXA 4GXSB 1FPEA 4NYZA 1Y3JA 1RWXB 3OR2A 1EKSA 1LWFB 2QA4S 3C3LA 4N41A 4O3BA 2D69A 2UUTA 2ZJQQ 1KHVA 3OHAA 5DVJA 4ZE9A 3LTOA 3V5AA 3US5A 4NF5B 3MZ1A 3AOBA 3BH7B 3KG2A 4UT4A 4WU2A 4IOCQ 4EO6A 3TZXA 1OQGA 3QATA 2E5GA 4DF4A 3R97A 4Z0IA 4H4MB 4QBAA 2GFEA 5F0UA 2XD2A 1N0UA 4G8MA 2ZKTA 5IGAA 3KFMA 1YXIA 4TXSA 1M5PC 1YJUA 3IB0A 1H0HB 3C36A 1UA0A 5KFUA 3H4ZA 1FXDA 3Q28A 4X48A 2ZEJA 1JJCB 1Y5IB 2DSFA 2PMZD 1O5JA 3A8IA 1QSSA 2FJXA 4B9UA 3MUVP 2UUAF 4L73A 1FO1A 1XMOF 5ET8A 1MY1A 2RUGA 3J7Z5 3OTOF 1QAJA 3HO1A 2AGQA 2ZYKA 3N5FA 2D3ZA 4OI3A 2MB0B 5CA5A 2IYIA 1HNZF 4JI8J 4PXCA 3PW0A 4C8KA 1H7XA 1FNMA 1KOOA 4DCPB 4QF9A 4NMXA 2Y7RA 1KFDA 2J8AA 3KJVB 2OSRA 5HMXA 2RJZA 4DQSA 4JI6J 3GV7B 2X3DA 4U4SA 3EVWA 3FBEA 1YGYA 3M1VA 1GK8A 1BIYA 4HDHA 2JLEA 1J2VA 4ZPVR 3BPDA 4KGKA 1FQAA 4ZA1A 4OZ1A 2C2KB 1C1BA 1RT1A 4HTJA 2DHSA 4LZ8A 1FFWB 3D9BA 3O97A 3ISZA 3T1BA 3D6HB 3MPLA 3BYRA 1A99A 1XC9A 4DR2J 3DRSA 3T0JA 4FKXA 3EGVA 3H8YA 4C1UA 1LFGA 1FX4A 3O44A 4W92B 4KKOB 5AA2B 3FUZA 3EN3A 3KJVA 4BCAA 1CG2A 4Q5TA 2V93A 1FBEA 3CIJA 2MKCA 2O1MA 2PEHA 2WW4A 2WSCC 3NWRA 4LF4F 1U1KA 1BUXA 2FTRA 4PWUA 4X66J 4AQYJ 1H44A 2QJEA 2QLWA 3IORA 3OFEA 2E1CA 2L9DA 4POWA 4MCOA 3SSRA 4JBCA 3UI3A 2XS5A 1U47A 3D5MA 2L41A 1JQGA 3RRKA 3AT1B 1IXKA 5I59B 5DW8A 4DV0F 3QRRA 2MLZA 3JQJA 2QL5B 4IRCA 8RUCA 4K3FA 2FHOB 2W7AA 2JEFA 5IT9U 3TEGA 2J0WA 1YJ7A 4IGRA 1BP5A 2YNFB 4USMA 3Q89A 5IWAJ 1NV6A 1VQSA 4NLUA 1WJ9A 3R27A 3LAMA 2P6TA 4KKOA 3DKDA 5EWGA 2UVIA 4USTA 2XHWA 1QVSA 4IH7A 2BXJA 5KOWA 4RNNA 1AFJA 1X9WA 5AA1A 2KTQA 5CZXA 3CTRA 2B7BB 2ZVSA 3I9V9 2B3FA 2VIHA 4X2BA 2ZFHA 2CIMA 4XKQA 3CJ0A 4P75A 2YTCA 3S4UA 4O3CA 1P1UA 4DPUA 2RE1A 3IM8A 3PRDA 2Z23A 3MR2A 1D3KA 1RZMA 2KO1A 2XC9A 1SV5A 4RLEA 1Y0HA 2DNOA 4DU7A 4K2XA 4NF6A 2XMJA 5G0RA 4BDRA 3S8SA 2YNFA 1YSJA 3PNIA 2MDAA 3I4HX 4MEVA 3W9JA 1B3TA 4OYZA 4U8VA 3PD9A 4OV6A 2CQBA 3M8WA 4ELRA 1DOTA 3GMGA 4EUVA 4IFYB 2K1RB 2Z8QA 1LAFE 4CI0B 1ZBMA 1ZIUA 3KN3A 1IKXB 2DWIA 5K2XA 2OELA 4F04B 1SW1A 3LSLA 2THIA 1P1WA 5L46A 2QS1A 2FHYA 3J80U 2RDJA 4DX6A 3KMSA 4DV2F 2E5LJ 2MQ8A 3MBPA 1PC4A 3PMVA 2MKJA 5J2PB 2EFVA 3I5BA 5ET5A 3H5SA 5E3RA 4ES3A 2B3BA 4G68A 5KFAA 4EBDA 3PKMA 3OXGA 5IT4A 1MXVA 1AYEA 3CFLA 4V19J 2LP4A 3HDSA 4NXMF 3ETOA 3I5OA 4OJHA 1HQUB 2RH3A 4JV5J 1B4ZA 5KFOA 4IFYA 1B9JA 3T96B 3TFLA 3MOZA 3I6VA 1A55A 2VQFF 4YMBA 2UVJA 1NBEB 1IKXA 4N8OA 4IO3A 3M8SA 1N6QA 2N7CA 4ZCIA 4ZPCA 4UQGA 4LF8F 3EWGA 5DG9A 1C0UB 3RRHA 3L4BC 4DR3F 3P4UB 1FI4A 1GGGA 2ZZMA 3SESA 2IYGA 4I4BA 2HFUA 1AXQA 3JB9k 2QC3A 2DHXA 2XXVA 1TL7B 2EBGA 2C1EB 5AA4A 2EW9A 2ZBCA 4HXVA 2LQ8A 2AMCB 4RWXA 3EMTA 3G8QA 4QR1A 3VQSA 4D3GA 5A5XA 1R31A 1JNRB 2XYGB 4N13A 1FWKA 3GIRA 2CJXB 3LGNA 4RUAA 5ICTA 4P6QA 2VB6A 3CW2C 3CC7S 2QFLA 5IM0A 4PG6A 1WKKA 1UTAA 1NDPA 1B40A 1FPKA 1JVXA 2HNZB 1IXIA 4ECXA 1EJ7L 5EX3A 3G8SA 3BB5A 3RTVA 3S7RA 3JTPA 3N26A 1HBNB 3CCSS 3LSFB 3SIPB 1X4HA 1TL7A 2Y8WA 1VIOA 1FBDA 1HSJA 4ZEDA 4YKIA 2H1YA 1SJQA 1PYTA 2Z2ZA 3RYLA 4Z7CA 2A5SA 2O51A 4ZVQB 3OSNA 4LMZA 3AJ1A 5F8LA 3LUYA 4CQ1A 2OPSA 1KR4A 1R1NA 4V19X 4DLDA 4QIEA 4L3NA 5T7LA 1USYH 3TCFA 1LK5A 1WDTA 1MU2A 2GX8A 1QULA 1FE4A 2HNZA 1X4EA 3C14A 3V4MA 4DI3D 1KRPA 1B51A 2DS9A 2BJJX 3C35A 1B7YB 3B7DA 3TMGA 3ONMA 2DRDA 1HI1A 4ZOSA 4F22A 1TP7A 3PV8A 1T03A 4O3QA 3U92A 2K7JA 3CJ8A 4H5GA 5LMUJ 4OX6A 1HPZB 3HHKA 4HTIA 3MWBA 2Y7KA 4PFUA 2FLLA 2BJ7A 3R2CJ 1PBUA 1CS4B 2GW8A 2Y5KA 1ANFA 4X64F 5I7IA 3MJNA 2M8DB 2I6EA 1MLAA 3GU0A 1MQJA 4LZ5A 2FNCA 3BF4A 1D3WA 5CCMA 4NWDA 2V8VA 4KPCA 1ZM2A 4EFAC 3L7UA 1B64A 1AZSA 3UNGC 1FKAF 3BGRB 1RCXB 4YB6A 1FD2A 1YJRA 2H5YA 4JI4F 1KQSR 4OVPA 3FK4A 1OPIA 3GJRB 1MXXA 4DR5J 5B0FA 1R0AA 3CSGA 4K7QA 1HPZA 2QFJA 3H6WA 1CJKB 2DWJA 1SJFA 1RACB 3GFYA 4DV7J 2IC3B 3TO8A 3CCRS 5H9EJ 2KYZA 2CZ4A 1DY3A 2GIFA 2NPIA 5AE1A 2HMIA 4R2BA 2AGPA 5KCJA 4K4TA 2MZRA 4LIRA 1T3NA 1TKTA 2WTFA 4DSKA 4XDCA 5KG0A 2HWHA 1BLUA 3TYHA 2ZBPA 2UYFA 2HAFA 1D0EA 3TJAA 4POXA 1N34F 3WHIA 1LFHA 1SXLA 2Z30B 3U65A 3TRGA 4ECYA 4OZ9A 2F3JA 4ZHRB 1K9MT 5DQGA 2ZHOA 2PVUA 1SJRA 3PYGA 4DZDA 2QE5A 2DY9A 3L9ZA 2WB4A 3CNQP 4OHYA 2D3O1 2OKQA 1VQMS 2IVMA 4A47A 5DDOC 4IY5A 4OFLA 2ABHA 4ECRA 1B3LA 1NV1A 2F63A 2M8HA 3NMAA 4FATA 4MLVA 2XLIA 2GAHC 2HVZA 1SKWA 1Q7LB 2NYHA 5DQIA 1M5CA 3IR1A 5GAHU 4KHRA 2RB7A 1W2BR 2JJ4D 2ZNTA 3N01A 2V63A 3HM9A 3DHWC 3MMAB 1HBOB 3DXSX 1HW8A 4JI2J 2Q74A 1OMSA 4ZHRA 4IRKA 2VGQA 2IVFB 4OMBA 2QO3A 4I8CA 1F9FA 1QDUB 4OIXA 3L7OA 4OYMA 4PDHA 3R5JB 3KLHA 2CYYA 3TX8A 4NLDA 3D0HE 1JEVA 2LQBA 5KT3A 3ISND 2YWKA 1MH3A 1S7HA 3NBPB 3DOMA 4I64A 5BXIA 4B9LA 2L08A 4P9SA 3R5AA 4GKKJ 2B5JA 2E1RA 1PO6A 1TL4A 4OHVA 4JWOA 2REJA 1R8HA 1Q9DA 3FCWA 2WOMB 2CZVC 4CLZA 4QBUA 5K5MA 4CLWA 4ID5B 3S9EA 1S9GA 1M5VC 1V3SA 1MQDA 4OTEA 1U0SA 1JW4A 4NCAA 2DVZA 1WC6A 4PFRA 1OS5A 1Q53A 5CMMA 5D15A 2WBRA 5IZ1A 3ZFVA 2XXHA 2MZTA 4GVBA 2Q88A 3M8PB 2WYPA 1S6UA 2OD6A 1RABB 4EUOA 2GVDA 3HSJA 4QFLA 1RAAB 2L9WA 4ZLLA 4AD6A 3TQLA 1IITA 3NBPA 4O8MA 2CQ4A 3RN8A 2O69A 4O44B 4FIMA 4NF4B 2QA1A 1SJ3P 2IA6A 2UVVA 2UV8A 4NLYA 3CF5Q 4EEYA 3CO0P 3HX9A 4ZVOB 3PM9A 2WVFA 4MYTA 1BHNA 5B0EA 1ELOA 4Q5VA 2A2DA 2EPIA 5LL6d 1QKAA 5B70A 1PGZA 1DQ9A 1TAQA 4ID5A 2J76E 1HI0P 4OEVA 4DIGA 4PG5A 2C22A 4F4WA 2MQQA 3DDNA 1FQEA 1MNEA 2OK2A 3CMAS 2GVZB 3QSLA 2LXFA 2ATLA 4NA2A 2FVPA 1RT2A 4WKRA 2CVIA 1RWKB 3TKDA 2ZE2A 2R7UA 3EJMA 3LUZA 4DX7A 4O44A 3AD9C 3O29A 4U1ZA 4F4KA 3KYLA 1TAUA 3OTCA 3QSYB 1B1XA 2VFTA 3QT8A 3ILOA 5J16A 1JLCB 4A8WA 1OO0B 2HBQB 4KIAA 2Q9TA 3EM1A 3QZ8A 1XMQF 4YDDB 2C28A 1OIAA 4NLPA 4PABA 2MZ1A 4WE1B 1BD6A 2OGUA 4KC5A 4DXUA 2UUCF 2BACA 1S10A 3RTWB 4O7MA 3J7ZT 1IKWA 5J1EB 1FESA 4DPYA 1DRZA 3LSWA 1QAIA 4C0HA 4Q8RA 2OO4A 2NPFA 3L6GA 2DY1A 3I56S 4OLOA 2NLWA 4QU6A 2O67A 1FT8A 2ZWOA 2CPFA 2QL3A 3B6QA 5AXLA 3CWJA 2CQIA 3I32A 4DJBA 2QS3A 1HNWJ 1JLCA 1N5TA 5D8HB 4I40A 2XYPB 5L9XA 1XI6A 3OVSA 1CJUA 3FZBA 3TVKA 4NWCA 3W9WA 3N5LA 4PXDA 4QFNA 2XMAA 2HVEA 4Y2MA 5J1EA 1JP4A 3U8QA 2JVRA 2XXYA 5A0YA 2KFNA 1NMUA 2DNNA 3FDSA 3NCRA 4RNMA 4EDPA 2F5XA 3IA0A 4YMEA 2BZ2A 1NCLA 4OVQA 3DDKA 2DH7A 3M6VA 1T8EA 3IR6B 5HI7A 3W65A 2RS8A 1RE1B 3FVGA 1N4LA 2HK2A 4X4QA 2IA4A 2FA7A 3FRZA 2PFZA 4DPXA 3VVEA 3KXDA 3H59A 4U9RA 4N6KA 4IO2A 4HLBA 3TDJA 4AS4A 3L6HA 5KFSA 3Q24A 4HDGA 2XULA 2V8DA 2DISA 3VLVA 2ZOMA 5CI5A 3IL1B 4OHNA 5F1QA 5BWJA 2RDDA 2C2ZB 3R5GA 1JLAB 3S2VA 3CMES 3BFUA 3DNCA 5KT4A 2UVUA 2IFXA 3K02A 1NUXA 2QLXA 2DCUB 2ABYA 4B02A 3PR4A 3V2UC 4IO1A 2RF2A 3KNAA 5DGBA 4P7TA 1B5HA 3PRVA 1G2EA 2FHMA 2V6AA 3DM2A 4PETA 4M5JA 5L9OA 3ET6B 1K0VA 4WP9A 3BIGA 5D4OA 2V5HG 5J2QB 4QQBA 3VHQA 3ZZUA 3TUIC 2PCRA 4NLWA 2ASJA 1LBZA 1GX5A 3QFWA 3PKYA 3KSXA 4E0DA 5IM2A 3QSIA 4QSDA 5I42A 2IJRA 4GWOA 3RPLB 1DHMA 3NGTA 5E3QA 3JYTB 1WTBA 2QJ3A 1HBMA 1UQWA 2C2RA 2MQPA 4WTYA 1URDA 4KV8B 2DGUA 2GV1A 3CD0A 4ELOA 2NSCA 1L5TA 5D0HA 2QMUB 2L48A 1XS5A 4QWEA 3KZGA 5TU0A 2RUSA 4ED2A 2DOJA 4CWBA 2AIRB 2FZCB 4MNIA 2CQ2A 4ZP8A 4F4ZA 4Y2CA 3W5XA 1DZ5A 1M1KT 4P2MA 1P1QA 1NAQA 4ZP7A 2HSEB 4XF5A 2D74B 3FXUA 2DD8S 3UR3C 1BQXA 2PFDA 2DHGA 3ZTOA 2HS3A 4ZK7M 1NV0A 1NV3A 5IZZA 3VXBA 4DSIA 1T3OA 1XVXA 2MLXA 4OENA 1Y3PA 3CVKA 2MKKA 5KFLA 3H42A 4AT1B 2C2OB 4ZKAA 4GWUA 4KV8A 2YQ0A 5KFHA 3PPRA 2P9GA 2F9JA 4KGZB 1H2TZ 2FHJD 1QGXA 3C32A 1U02A 2B4OA 1RAOA 4UACA 3E13X 5BJRA 1IQZA 4CNYA 4DFJA 4C2MA 1S0MA 4F4XA 5HN0A 1V9OA 2ZDPA 4IR8A 1RDXA 2Q43A 1BXNA 1SUQB 4FF2A 4R5PA 3CMQA 1P1OA 3PJXA 2GQQA 3GFHA 2NQPA 3Q8UA 4Q8FA 4LF7F 1X4GA 4CLUA 4KB7A 5DVIA 2O01C 2R2SA 5CM6A 9ATCB 1JWWA 3ZSFA 3DRPB 1G0IA 3IO6A 1TL1A 3LH2S 1IBLF 3OTEA 5A8RB 3HD1A 3MR6A 3AOCA 3BKTA 5HMWA 1JXEA 4C0BA 3EF7A 2HYIB 2PT1A 2CEYA 1A8FA 5IC6B 3VVFA 3I6PA 3HVWA 3C6TA 1XNQF 1U6FA 2BANB 3PPPA 3M32B 1YJWS 2DTJA 2DR5A 3G3GA 4RJZA 2COLA 1RKIA 3F56A 2WX9A 2KVIA 1YDLA 3E01B 3NNHA 4EI2A 3T66A 3MM5B 1Q8LA 2OEKA 1GNKA 4E0WA 1NJWA 4MF3A 3P8BB 4O3RA 4CLLA 2ZOFA 3AD7C 1HKAA 3HSGA 3PXGa 1CEZA 4AXIA 1P99A 3M6UA 1TZ0A 3OO9A 2UZAA 3UCUP 1FPFA 2ILYA 2YWGA 4OVRA 1AOVA 2ASDA 1KFSA 5DM6Q 2RQCA 1CJTB 1FF2A 3M32A 4B08A 1IWAA 2VC0A 5KOXA 5ETOA 1C1CA 4NCGB 2U2FA 3GXAA 4OYPA 1PJ5A 2ZH4A 3FSIA 4DV4F 4FYVB 3V6KA 3GG1A 1RWWB 2KDOA 4RX6A 3UDVA 4BLAA 4LUBA 4GC7A 3DLEB 4DR4F 1Q8IA 2UU9F 4DG1B 2HQFA 2PSZA 5CH7B 2B4VA 1DPEA 4WKMA 1U1NA 3DU5A 3CJTA 3DLBA 5DYHA 1RTDA 2DNKA 4PWDB 1NUWA 4KGMA 4DCOB 1R9QA 2FZKB 4B3RF 3O2IA 3THIA 4U7UK 1J1NA 2F7BA 3M30A 4DOZA 3K0JA 2GGPA 1U45A 2A6MA 4OYOA 4DV3J 4GL8A 3QO9A 1R6ZA 1RA6A 3RLFE 3VQTA 5E7OB 2XI2A 4XAKA 2EXUA 5M2VA 4Y2AA 3FJ2A 2GQCA 4JWXA 2AJ4A 2AD9A 3RQTA 3M6XA 2HIYA 2H3EB 2LMIA 2BV3A 2PA3A 4JP8A 4CZCA 1Z2LA 1NZAA 2UXCJ 4F1YA 3T22A 3UA8A 3ZZ0A 2AWZA 3MMBB 3H2VE 4OZNA 5KFFA 4UQTA 1UJ6A 4U95A 5HSPA 2VZ9A 2GHBA 2BQUA 1NZ8A 3U1MA 3T9VA 1YQHA 3RG6A 4MNPA 3UDCA 2HFSA 1HMVB 3IAM9 5FHNA 5T14A 5I57B 1QAYA 5FTIA 1KONA 3MAAA 4DQRA 3O8WA 1RHMB 3MPDA 3H3GA 1J27A 1B6HA 3THPA 3BGOP 2CPJA 4I2QA 2KVQE 4K4ZA 4K4VA 3DMJB 3MMBA 4KBIA 1T9XA 5DQHA 4F3MA 2RHSB 2XY6A 3Q8PB 3CCQS 1M5OC 3OMBA 3TCGA 2K8GA 4MFIA 4C7QA 2KYXA 2VBYA 2QVUA 2CNKB 4KO0B 3GFXA 3PMWA 5A6WA 2DNYA 4ZPBA 1NSQA 4EQ9A 2KG0A 4P3LA 3PCOB 1FCKA 2XWYA 1SH2A 2N3OA 2Y8YA 4PPDA 1JLQB 2YX1A 5B09A 3PV0E 3IB1A 1HMVA 3L95X 3OJUA 5I57A 3PPNA 3MDFA 1NHKL 4Y00A 2XMTA 2XS7A 2QFIA 4FF4A 2ZH2A 4W90B 3HP6A 1HYSA 1P6TA 2VOOA 3DCAA 2VPXB 3LR1A 4FP9A 2F35A 7FDRA 4ZPDA 4OZ5A 2QGFB 3HO7A 1D8YA 1CPZA 4M5GA 3TI0A 1WG4A 2QIFA 2QLBB 3GV8B 4H6DA 2R71A 3QAEA 2UXBJ 4KO0A 3BKFA 4JV0A 5ELVA 5MLCV 2R8GA 1FJGJ 3PO4A 1AMFA 4C48A 1QE1A 3KHRA 2V68A 4F19A 1YJ9S 2JHEA 1WC5A 1IJEB 3EVMA 4USJC 1U48A 2XXWA 4HT5A 3UVJA 4GOTA 2V3QA 4O3PA 3QIPA 2H48B 2LEAA 3AXFA 2P6SA 1FTMA 5IV3A 4X62F 3TYTA 2HW3A 1Q79A 3CD5A 2I3VA 2IHR1 2F4FA 3LP1A 2PDAA 2KXNB 1FRXA 2DHHA 2O66A 3NGUA 2Z4PA 3W63A 1U24A 2D9PA 2LA4A 1UL3A 4UF4A 4DN0A 4A8KA 3GJSB 1RTHB 2W1BA 5HPQA 3CSKA 4MAKA 4I7FA 1TV6B 2R8HA 1TK8A 5CBRA 1UWBA 1S77D 4B9MA 4F25A 1FE0A 3C2PA 4H8IA 4P56A 2IM0A 2VA3A 1VQ6S 4EQ7A 1D9AA 4ZE8A 4EF2A 2NXCA 3S01A 4CH1A 4QIFA 5B08A 5JVHQ 2D41A 3SI8A 1U7LA 3QGGA 4JB7A 3OD7A 1GTEA 2CFXA 2ONKE 3IFAA 1NHVA 3FJMA 5H9FK 3K1NA 5CD4H 3QLHB 2R7VA 2WEFA 1B58A 1ITPA 4LR9A 3T3FA 3HZEA 4YHHF 3N5BA 5ITOA 5CZVA 5HQ8A 2UUAJ 3HXMA 1R8AA 4N47A 1XMOJ 2ZDOA 3G96A 2WW8A 1TV6A 3FVYA 3OTOJ 1RAEB 4OVSA 1K0TA 1RWMB 1HNZJ 1NKCA 4PAAA 1S4EA 3K01A 3DI6A 1S1TB 2C2EA 3SCJE 1VRUB 4FAJA 1WHVA 4CT8A 2QPQA 5F8MA 4E2FB 4P47A 2DPIA 2YH0A 1BGXT 1XOCA 4J9QA 3BDPA 1SC6A 2P9CA 3SEVA 1VFEA 4KJIA 4PQUB 3GIJA 4A48A 3KUEA 3P3DA 3CJKB 5AT1B 3MP1A 1Y9UA 1MRPA 4Q2LA 4RNOA 4LRDA 3TODA 2ZJPQ 2ROEA 3PUZE 4OX7A 3LPYA 1B0LA 1RKMA 3NLCA 4PXEA 1MQIA 4FE8A 2VASA 4ECVA 3J7YU 2RC8A 3K5NA 1DTQB 5JVGQ 2EVZA 2GMJA 3SDEB 3CDEA 1SPIA 3M2RA 3FMBA 4PG7A 1SH0A 1IR2A 3D66A 5C2CA 4ZIWA 4WFNQ 4F1VA 2JX2A 2DXEA 2J6TA 5DLGA 5HROA 2ZH7A 3OLAA 1NNFA 1VRUA 1Q95G 5AJ3F 2F4VF 4KYDA 4PR6A 5I3QA 3SEWA 4LSNA 4YR3A 1M5KC 2BM0A 2XX8A 2QSWA 4RW8B 2F40A 3CD6S 2CZ9A 2F7VA 3CJKA 2GO9A 4QR0A 5A76A 1MY2A 1SKRA 4FPRA 3KSJA 2WBBA 1UFLA 4L72B 4DV0J 4B3SF 4ZJOA 1WSVA 1VQYA 1KTVA 2VONA 5HP1B 3BGUA 5IFMA 4PKDB 1G4CA 1APSA 3D7SB 4JVCA 1DTQA 3SDEA 2JZ5A 2V69A 4M8LA 1S1UA 3M9OB 3ILLA 4QWCA 2QTWA 1XBWA 1S9EB 1ZZFA 1WKLA 5KFKA 1TXFA 5KFBA 2ZUAA 3FXRA 2ONRA 5DDRC 5DDQC 1TVRB 5KAKA 3DRRA 1GR2A 1RTIA 3VVDA 2BOAA 2V8HA 1DTZA 2KT5A 5I3PA 1HBUA 4K5RA 3QGIA 2MZQA 3OUYB 2VKZG 4K5SA 1UZDA 2KB2A 3NGKA 4I6AA 4UOGA 1Y20A 1N5YB 2EFPA 4M5NA 4K2JA 4JV2A 1DAXA 1Y10A 2VJUA 3RY3A 2Q89A 3FASA 3MM7B 4OESA 3I31A 3F11A 1EQ0A 3A09A 5FD1A 2GZOA 1RTJA 1S1WB 4DL3A 4OQJA 2NOOA 4OJ1A 5I3SA 2KQZA 2MKIA 2GO8A 3E3KA 4LZ7A 4KHPF 3WZ0A 4YN3B 4HI1A 5K8MA 2ZMBA 2YNHB 4I6YA 5ETKA 3TAMB 1C0TA 4LFCF 2V3TA 1RT4B 4R25A 1NI9A 2OHDA 1AB8A 2EFOA 3U1NA 4CM2A 4DV2J 2RCAA 5HQMA 3USDA 4MAGA 2HGLA 3BSNA 3GJQB 2R8TA 3R3TA 2UVHA 2B9EA 1F9EB 4DL6A 3U93A 2JVOA 4NXMJ 3JTOA 4N7TA 5CBSA 1FJCA 1ZKBA 2CAJA 2Z57B 2E1AA 4NEZA 1LEOA 1C4CA 1JLBA 2XI3A 2VQFJ 1AUDA 1OQ6A 2MTLA 1I3OB 1EAYC 4NPOA 4MH8A 3TAMA 4LF8J 1B3FA 1MQGA 3D1OA 2CWKA 3T9HB 3S9MC 2CVEA 1D09B 1TKZA 1N76A 2B6AA 1TUVA 4MKVA 4C8YA 5LXRA 2EBEA 1UPMB 2YKNB 4RYAA 3RT6B 1YJVA 3C4MA 1LK7A 2LA6A 2OPRA 3M05A 1H72C 2OD4A 3DU6A 4XDDA 3OL8A 4ELTA 4JVIA 1FQBA 4MLQA 5KFQA 2KR0A 4IO5A 1DTTA 2DNGA 1ZAVA 4ESXA 2BRLA 5E3AA 2FIXA 2BJDA 1JKHB 1NDKA 2XWKA 4MMPA 4XTCQ 1T94A 4PZVA 4ZEIA 3AQPA 4DU8A 1HD1A 3UIFA 4PFWA 1SI1A 1VQ8S 3D6MB 2M4MA 1PCAA 1UPPA 1X5TA 3T19A 4GBWA 3TX0A 4R8UA 5CXTA 2RAQA 1TTHB 2I6WA 4IY6A 2W9CB 1U1RA 4DX5A 2BYCA 3W2VA 1N32J 5F8JA 1RT7B 1Q1KA 1RU2A 4MIAA 1PG5B 3DOLB 4ED8A 2FZGB 1B0HA 4X1DA 5LJ5Y 2H54B 3G8TA 4QJVA 1K9ZA 1S49A 3FQKA 4G61A 4OERA 3T5LA 3M8UA 1JKHA 1G3OA 2M5YA 3FKBA 4GQOA 4WFXA 2B8PA 3I82A 5IC4B 2AEMA 4B3OB 2HNDA 3MZIA 3V81B 3HFKA 2OX3A 1YG0A 2EKYA 2M0GB 2KHDA 1BQMB 1LWXA 2O7UA 4EYIB 2F3BA 2RRBA 2NVUB 4DL2A 5IOLA 1NK6A 1Z2ZA 1TFAA 4G8NA 3MEEA 1FKPB 5FHMA 1SQGA 2DR7A 4RU9A 2R7OA 5GVQA 3BO3A 3E8OA 5EWFA 3VV2B 4PC9A 2V4JB 5HVFA 1S6PA 3SCLE 3I0SB 4X64J 2N3LA 2K3KA 1NV5A 3M8YA 3QNWB 3BN4A 4C1TA 4M5DB 4H4OB 1HD0A 3LGHA 4DMZA 4ZCKA 1NV7A 1B46A 4DI4B 3ISPA 5HMYA 3ZNJ1 4ECFA 2CG8A 1TFDA 3AAWB 4JI4J 3VAFA 2AYSA 2HBYB 2MJUA 3R5DA 1PYOB 2VHGA 1D9YA 2HHPA 3O6IA 1ZTWA 3ILIA 2IJNA 5I56B 2IMOA 5GADI 3TP2A 4KPTA 4OHZA 1EKRA 1N04A 2Y3YA 5GMDA 1X4FA 2EFGA 2JOQA 3PJWA 5I84A 1SVDA 4J90A 1ZTYA 2BQRA 3FBFA 4H4OA 3BKIB 2ZH5A 1WNEA 4NEYA 3IBFB 2FPHX 3MCOA 3POTA 2YNIA 5CYMB 1URNA 4RUBA 3E4RA 3K6UA 3NAHA 2MQLA 1U6BA 3EUNA 2R7WA 2HLUA 2I38A 2KM8C 1RI7A 2WVCA 3BGFA 1BLFA 2P3VA 4NWBA 3ITHA 2FDNA 2CZLA 5JK4A 4WBFA 1FK9B 1N0VC 5CCLA 1FJ6A 1U2RA 2VFVA 4I2PB 5K14B 3ROJA 2Z8FA 4TY8B 3W8GA 2EG1A 3EHSA 3OSQA 4RPFA 2DO4A 3X1LB 5KTQA 4GLIA 4MIBA 4ECWA 1FVSA 5HQLA 4P2SA 2V2QA 4YY3F 5C25A 5IAIA 4F02A 4HR2A 2UYEA 2CUYA 3OSRA 4O4GA 3FUYA 1UVIA 4NXNF 2GJIA 2VHAA 4Q7AA 2FVZA 1BQNB 5J2MB 4O7IA 5ETRA 2E9ZA 4YKPA 4DCJB 2I1RA 1I1GA 5K14A 1JNFA 3Q8VA 1X60A 1BTJA 1MSWD 3A8JA 1T0TV 5ADZA 4F2OA 2YJPA 5F41A 4FN5A 1IMFA 4I1DA 4J5OA 1SL0A 4IGTA 3B6BA 5LOQA 3H25A 4R6YA 3KLIA 2ZJRQ 2DE2A 2GNKA 3UNYA 5L39A 3QYYA 1VHIA 3OPKA 2VC1A 4KFBA 4HACB 4IKAA 3DHXA 1YK9A 2QN6B 3D1QA 4LSLA 2Y9HA 3PDNA 4CLKA 3R8YA 2ZWPA 3Q8YA 2ADBA 1SKSA 3TQWA 3PD8A 3JAMY 4NLRA 2CZKA 1B70B 1MY4A 4NI2A 2MPUA 1IUDA 2QLJB 2LFVA 1RAIB 2DIUA 2W7PA 4F3QA 5I4MA 3TARA 1X4CA 3BQ1A 4IQMA 4LF6J 1MWQA 1V3RA 5B0AA 4U21A 1S48A 3A3CA 1LKZA 3V89B 4QYZK 2CJYB 4HACA 1G0HA 2HBZB 4RKUC 1RT3B 2LU1A 3CC4S 4OMFG 1K9YA 5KFNA 4G77A 3ZNUA 1FRLA 4FZVA 3BFTA 3DGPA 3RUMA 2LCWA 2XG8A 2OIHA 5AA3A 4JDFA 2F8DA 3D4CA 4NZ6A 3JTNA 2VG5A 4LRFA 2B9WA 3RUBL 3TNVA 3DP8A 4QFKA 2QYGA 1GTHA 2FJEB 3FJ7A 1EX8A 2LDIA 2Y7PA 2YNGB 3BM7A 2VDIA 2XMUA 3B4MA 4F4YA 3TA1A 4NA3A 4FBPA 2E1PA 4G1PA 3QGHA 4U8YA 2XM3A 1XMQJ 2DKOB 2GFFA 2AU0A 1H43A 3CCWA 4DV6F 2ATCB 5K8NA 3WIUA 1FFSB 2XXQA 4PFIA 1M5SA 1RWOB 2UUCJ 3HHLB 4C3MA 3DN9A 1UVKA 5LMNF 4F50A 5JXSA 1QY7A 3Q8SB 1U8SA 1IR0A 2R3VA 2RKIA 5D3GB 5D77A 2X7IA 4ZZEA 2VA2A 5J2NB 1JMTA 2OSQA 4QU7A 4KTQA 4ZS9A 2YVSA 1QVFR 2L5VA 1IM6A 1IIWA 3TTRA 3T1YF 2AJ0A 2FVCA 4R6KA 4GFRA 1RT6B 2Z56B 1TL3B 2Z2YB 4USUA 3H06B 3CI8A 2X7PA 3UD4P 1S4FA 3JSMB 4H46A 4ICLA 3V83A 4HCWA 1N5SA 2QV6A 3IS9A 1I6BA 2HHMA 2DGWA 1UTHB 4DL4A 3TPAA 4MK8A 4LQ5A 3P45B 1MH4A 1CULA 2JRSA 4FEDA 2CEXA 1QUKA 4I9DA 5L8RC 4DR2F 3I55S 3HHEA 4UZCA 5FDLA 1YVFA 1SDXA 3E78A 1TKXB 2MZSA 3PEJA 4TKTA 4Y34A 2RU9A 1RT6A 1RISA 4QOTA 4O23A 2KHCA 1U26A 3D3BJ 2YQ1A 2H5EA 2XS2A 3T41A 1ZJLA 2YKMB 3EGNA 3M7VA 1X4AA 1VHFA 5A8WA 3M3LA 2Z22A 3B50A 1URRA 5DZ6A 2EG2A 1MPBA 5F9NA 5H8FB 4LF9F 3G6XA 1UTHA 3TA0A 3SMZA 4KQZA 3ELHA 5KG7A 3M2VB 4ZJQA 2K2PA 1PAUB 3FFIB 1LWCA 1RAJA 4DR6F 4H8JA 3K7RA 5CRYA 3VV5A 3W7BA 1UKUA 3EGZA 2AJFE 4CO4A 2DGOA 3OW2R 3RR7A 1FPGA 4ETXA 2H4WB 3MD1A 1KLNA 1UP1A 3QAXA 1XIQA 4U96A 4F3BA 3OELA 3MAMA 3IFCA 3DYAB 1XK8A 1NSKL 4J9UE 4DHVA 1QKBA 3OHBA 4HHHA 3OR1B 4GC6A 3EZUA 1VQPS 3MM6B 3E9XA 3C15B 1KVIA 4EXKA 4C11B 2AL5A 2ZC4A 4J91A 3PFEA 2MKSA 3JAMU 2LKZA 2JWNA 4C8ZA 4IDKB 2BMBA 3DLKA 4ISUA 1KBRA 1OSDA 2W7OA 1FEHA 3DLGB 4OANA 2ZZTA 1YLXA 2VG7A 1A6LA 4DE8A 3HSZA 4HTGA 3MMCB 4JI7F 2E9TA 4AB6A 1H73A 2D5WA 3HZGA 1EETB 1REVA 4N76A 4ZCMA 1E6VB 1B1HA 4ZITA 3R7XA 1SIZA 3RAQA 1PB7A 2XX9A 2JLGA 4ID8A 1NJIT 5EYFA 3UORA 4PYDA 2GIQA 3D67A 1SQYA 3IB2A 1KLMB 3EX7B 1B32A 3OR1A 4JI0J 1FRPA 3W61A 3R7SB 2YPYA 4OI4A 4CTAA 3HN0A 4PPZA 4DI6A 1Q7YT 5ET7A 2VL1A 2P0SA 3NS7B 4N6DA 3GYXB 3DLGA 1S6OA 4R72A 4FYYB 4L6V3 2DGVA 4HS7A 2XLJA 4ZEBA 5LOMA 4TNOA 1UJ5A 2CPHA 2WBDA 3VAGA 2DRBA 3KBZA 3TTLA 4OJGA 5B7DA 1FD8A 3RAMA 4FF3A 1Y5LB 4NLGA 1SD3A 3ZZPA 2NUVA 2NREA 1EH3A 1VBXA 1KA1A 3K00A 4CO1A 4JI5F 2F36A 3ZZOA 5TPAB 1VDWA 1WI8A 2JJKA 3ENQA 4CLTA 3UO0A 5KFDA 2CXEA 4F36A 2FQQB 2I2YA 2YWWA 4QYRA 1N0TA 4Q0BB 5KT2A 4LF7J 1QTMA 3ETMA 4DL7A 4DCYA 2J7UA 2R8IA 3IRXB 2LXUA 4AUKA 1IBKF 4QWBA 1GFWB 6FDRA 3RBXA 2KFYA 2GMHA 5CYQA 3NL0A 1IBLJ 1H3DA 1AUSL 2VICA 3M8RA 1TT1A 2ZZWA 3QYTA 1LSTA 3QGPA 3K59A 4ZLPA 4YP3A 4Z7EA 5IQQA 1XNQJ 4K4SA 4L3KA 5H8HB 2CZHA 4M5LA 4OETA 4DN9A 3RTFB 3WAEA 5TP9A 1MY3A 5IZ3A 3KLGB 4F7VA 2N82B 3O6HA 2V50A 3PUYE 1UVLA 1VLOA 3GSIA 4OZLA 4ED4A 5U47A 3ZS6A 5JJBA 3MEKA 2CNOB 3VGTA 2NXUA 4A8SA 5ETLA 1VSOA 1ZM3A 3EZOA 2XLKA 4RW4B 1FX2A 2J7KA 2HNYB 5GAEU 3AJ2A 1R8BA 1X5PA 1NK9A 4BDMA 3SEOA 2GJ2A 1VRTB 2VD3A 4P8BA 4H54A 3VWSA 3J80Y 3MVWA 1QAXA 4Y2KA 4R9FA 1A7LA 3HK2A 3OTDA 2BW2A 5ETMA 5EQAA 5THWA 1Y4TA 3H4BA 3LBSA 4P2XA 2HURA 4N4UA 1BWVA 4RPNA 4DZ6A 2YBVA 2BKOA 2EWHA 3DM0A 3MEDA 3MR5A 2Q8MA 4FJPA 4YS2A 2DNHA 3I0RB 4L75A 4Q30B 4DR4J 1SW2A 3VGSA 2UU9J 4RW4A 4U4XA 5DEXB 4FS2A 4WXWA 3FBPA 1EYJA 2XXKA 4B9VA 1M5BA 2KRBA 5LMUF 2HLTA 1VJWA 1LWFA 2OTJS 3IFEA 1HHSA 4NYOA 2B3TB 2KJVA 3LALA 5EYHA 2Y1JA 4B3RJ 1R0CB 3W8PA 3LWLA 1U8WA 1MXYA 4UOHA 4NF5A 2G0IA 3IC1A 2YX4A 4I0WA 4HHJA 2JEJA 3I0RA 3BR9A 2HGNA 4YR2A 4KYEA 4H4MA 3AFGA 5DEXA 2V0NA 1H76A 3SBMA 4NX9A 2XMVA 3TTNA 5EQ8A 4WIQA 4DR5F 4F8RA 3PGFA 4DXCA 2HQGA 4F26A 1U0HB 2KKHA 5IV4A 1NNDA 5GAHI 3G3FA 4I6WA 2MSSA 3HFVA 1MQHA 3HVTB 2GMLA 4NEDA 3M2UB 1ATGA 3A8KA 4ZVUB 1HNXJ 2DNLA 5DLFA 4MJKA 3T9ZA 3UN3A 4AL7A 4F2RA 3V4IB 4M5MA 3RBDA 4FKYA 4BDLA 1IKVB 5KFZA 4ZN3A 1C2PA 4I67A 1PBQA 4P2FA 5HBMB 3MSTA 4DL0C 1KZ8A 1AWBA 3AD8C 1EYKA 2EI5A 1FTLA 2A10A 2LXIA 2G29A 3HCQA 2A2CA 1FTCA 1RDZA 3KJTA 4M1VA 1PJ7A 4LJMA 6FD1A 3MCMA 3HVTA 4P11A 2DO0A 3FBCA 2FY8A 1IWGA 3M2UA 4OYIA 5C42B 1YZ7A 4OHXA 3CCES 3K89A 1SQFA 1AFIA 1ICEB 2Y1RI 3IO1A 5ETNA 4Y2IA 3GR0A 4DPTA 1NNKA 3N6LA 3MTJA 2OPQB 4JI3F 4H1XA 3QK6A 5FJ4A 1MWZA 1MPCA 1FNXH 3FGVA 5HBMA 4DXBA 3UQSA 5AA2A 3TAQA 2NYIA 3GSDA 1RYSA 5F7VA 3SDFA 1OY6A 1Y11A 4RNHA 3IBWA 4JI2F 1HQEB 2XGPA 3FVKA 3J81j 3EICA 2XWIA 1LCTA 3I87A 5I59A 5LSLA 1HW9A 4MMOA 1IMCA 2XSJB 2FYXA 3RB6A 5AXMA 3K5PA 1IQTA 2RRAA 2ZD1B 4DX8H 1NNPA 3DP6A 2HS4A 5GMEA 4F29A 4C97A 2WSEC 4JXIA 2EK6A 4DV1F 4MFBB 2OPQA 3H6VA 3GIKA 3KDOA 2CJKA 3WC2A 1M0SA 2IM1A 4CLPA 1IKYB 5KFMA 3G82B 4C0OC 4DLEA 2YWEA 4TU9A 2G0CA 1B3EA 2J8SA 3SSQA 1D1UA 4DS4A 3I5AA 2Q8JA 5C24B 2RCBA 1X4BA 4RJVA 4E8UA 2H99A 4X62J 4NE4A 5JTYB 2AGOA 3NS6A 1KS2A 1GVCA 4YFUA 3QUFA 3G71S 3G87A 1UFWA 2F6PA 4IUFA 1VISA 1YBTA 3S1TA 4X4RA 4ZVFA 1S1VB 3MP6A 2G1DA 2RC9A 1LBXA 5DS7A 5KFTA 1F5CA 3F73A 2UUBF 3OL7A 2CQ1A 1IKYA 4CO5A 2PEBA 1RU1A 2R8KA 3VDFA 1DTGA 4RW9B 2J0SD 4KT0C 1FKOB 3R1HA 1EQMA 3FQLA 3CDUA 2G2YA 2K1RA 3IGNA 1REGX 1EP4B 2QMWA 5I3UB 2DT9A 3MXHP 1DCUA 4OXVA 3OQ2A 4P9KA 1OVTA 5I2NB 4QW8A 5CHCB 2E0SA 2JC0A 2IRUA 4TYBA 2QSXA 5HMZA 2W8KA 3PFOA 3IJXB 5I58B 4AB5A 4ED3A 4OX8A 1T05B 5J2PA 5BYRA 4NYPA 2VBWA 1CJVB 5L9SA 2DGXA 4L17A 4LATA 2V8PA 3L09A 4ZVSB 2XXXA 4F0HA 1Z7NE 1Q16B 3GLJA 4CYUB 1JNZB 3QWPA 1QLNA 3LA0A 5BR8F 1P9QC 1H2UX 2JLFA 1HQUA 1R0BG 1PYSB 4EU0A 3CUNA 3TZAA 2Y0SD 1LWEB 3GFZA 1FNOA 4TLRA 4EZ9A 1NRKA 1VC6A 3VXCA 4H45A 2PX1A 1M5HA 1EYIA 3RJMB 1KD1T 3WC0A 4NGUA 4ILMA 4Z2XA 4G65A 2CMOA 3R5BA 3OT9A 2B43A 3QRQA 5I58A 1C0UA 5H9FJ 2FD2A 3U1LA 4ZVRB 1B5IA 2WONB 1O7TA 2CPZA 3PUWE 2QMXA 1RAHB 3MAQA 2X26A 2CPDA 2HFOA 1BY9A 1L3VA 1SH3A 1YBAA 4C8MA 1NPRA 1S0OA 2DNZA 2PBWA 3IBCB 2Q2AA 3FSYA 4HE0A 4K0KF 4MNCA 4GF8A 2G13A 1F2HA 1B2HA 4C3LA 1LWEA 4MKAA 1L3SA 3K6XA 4FS1A 1PJ6A 1HR0F 2MHNA 1T9TA 5AJ3J 2F4VJ 4HI2A 1Y7PA 3LAKA 3MURP 5KFPA 3CC2S 3HKWA 3K57A 3TWZA 3IOWA 3MECB 1MMNA 2M7SA 2ZM6F 3Q23A 2W2QP 4ILRA 3GTYX 4XO0A 3SEXA 2D3UA 3CCVS 1M1HA 2RU3A 4HT7A 3PYEA 2O1LA 3KHLA 3K17A 2MKHA 3JZJA 1HBNA 2APOA 4FVMA 4I56A 1I94F 4PXBA 4LRAA 5HAOA 1T11A 2D1CA 1TKDA 3W64A 3VAHA 3QWUA 2R9LA 2I0CA 1VQNS 4ECSA 2HXRA 4H67A 4W4MA 4USKA 1LFIA 4NRTA 3G3JA 1ULRA 5GMKa 4JVDA 3AH6A 2I0XA 4HKQA 3VGUA 1SYIA 2VH7A 3MECA 3CD7A 4USWA 1BKAA 2OTLS 4CP5A 3Q25A 1PIEA 3TAPA 1XERA 2ZXTA 2K7KA 2RC7A 1MPDA 3N6NA 4KR0B 2VUGA 3GONA 3GYNA 3PYFA 4DCXA 1L3KA 3T5JA 4FECA 3D4JA 4OJ3A 1NJZA 4RW7B 1UFKA 4URSA 1IBCB 1WEXA 2GAGC 4IOBA 1NUZA 2HVIA 4HL9A 3L3CA 2WVEA 1HNIB 2XZTB 3HJFA 4NTLA 4H4KC 1YAEA 3Q27A 5DG7A 3FD3A 2FVRA 2DK2A 1F2GA 1M5DA 3ZO7A 1CS4A 2O84X 5A8KB 3FZ2A 1KQGB 5KFYA 4NOHA 3MZ9A 1RWVB 4KHPJ 1VFJA 3C19A 1DQAA 4LFCJ 2BE2B 4THIA 3BGRA 3MR3A 3VTIA 3A8EA 3IK6B 1JX4A 1RUSA 2DEIA 2ANJA 4EMDA 1QJHA 4JI1F 4NL5A 4AYBD 5RUBA 1MXWA 2MQOA 2OLBA 1PB9A 4U7CA 1CJKA 4ZIVA 1I6JA 1H2VZ 2OLWA 3MGJA 2R42A 2MQNA 2ZBQA 2IC3A 3W2WB 2EEYA 4ZPAA 4IYQA 2BJ8A 4J37A 5HATA 2CQDA 4HVZA 3C16B 3MZBA 1ZLQA 5KFEA 4OFJA 3KLEB 2DB1A 5EYGA 3OV7A 1T9UA 2ZBRA 4R9GA 3KOAA 4NLSA 4UA8A 1FBCA 4Q2MA 4B17A 3N28A 5KT5A 2BE2A 1SL2A 4UOCA 2Z0GA 2VBZA 5MAOA 3QPIA 1UTBB 2EKNA 3KK1B 2CPYA 1Z4UA 2OZZA 2KLFA 4IH5A 3FCHA 4LFAF 4E98A 2IM3A 2ZC3A 4PCDA 1X0PA 2ZNYA 2RDIA 5E41A 1QUJA 4LBPA 2QA4G 3B8BA 1J5OB 2CWXA 1FQDA 3D3CJ 1X9MA 1GXLA 3CT9A 4U67Q 2LVWA 2VFRA 4ZZAA 3THVA 4KYZA 1ZZNA 3ZTSA 2IRXA 4DEZA 1NK5A 3NRBA 4PBQA