2QMXA

The crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
278
structure length
278
Chain Sequence
b'NWLIAYQGEPGAYSEIAALRFGEPLPCESFDDVFSAVTEQKADYAVIPIENSLGGSIHQNYDLLLRRPVVILAETFVKVEHCLLGLPGASVETATKAMSHPQALVQCHNFFATHPQIRAEAAYDTAGSAKMVAESRDKSALAIASKRAGELYGLDILKENLADEEWNITRFFCIAHENNPDISHLKVRPDVARQKTSIVFALPNEQGSLFRALATFALRGIDLTKIESRPSRKKAFEYLFYADFIGHREDQNVHNALENLREFATMVKVLGSYGVVNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prephenate dehydratase
publication title Structures of open (R) and close (T) states of prephenate dehydratase (PDT) - implication of allosteric regulation by L-phenylalanine.
pubmed doi rcsb
source organism Chlorobium tepidum tls
molecule tags Ligase
total genus 85
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qmxA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmxA02
1VSOA 2R71A 3ILTB 4AB5A 4KPTA 3RN8A 3TUIC 1LGBC 2HZLA 1Y3NA 4JB7A 3UP9A 4U21A 1AOVA 3MJNA 2QMWA 4H5FA 1MM6A 5F1QA 1MXYA 4PFUA 3K1PA 4H0WA 5B7DA 3N26A 4DXUA 4FIMA 3SEYA 5H8NA 4EDPA 2I48A 2QPQA 4TLMB 5HBCA 1JW1A 4KR5A 3CIJA 4F39A 4QSDA 2J0WA 1BKAA 4PE5B 3CI8A 4NWDA 4KFQA 4I8CA 4ELQA 2H9ZA 2V93A 3AAWB 3QYTA 5AA2B 3AB2B 2DWJA 4ZEIA 3I5OA 2KLFA 3PUXE 1ZIUA 3VXBA 4THIA 1ZTYA 3DDNA 1A8EA 3I6VA 2DYXA 3K02A 1B5IA 1MY4A 3HV1A 4HCWA 4N07A 4RPNA 2XXTA 3TZAA 3OENA 2E1SA 3A3CA 3K6VA 4EUOA 2XD2A 4GWOA 2RQMA 4OMBA 1QVSA 3H03A 3PPPA 3C31A 3IOUA 4KHZE 5CMBA 1SYHA 3G3GA 2VD3A 1R1NA 2OJTA 3PUYE 4LQ2A 5CMMA 4U1ZA 1XHYA 1TT1A 2M8CA 4U2RA 1PB8A 4PFWA 2QS4A 2O1LA 2Y84A 1VFDA 4G8MA 1B3HA 1B9JA 3FZVA 1TWYA 2UYFA 4LUBA 1O63A 3CR9A 4YAHX 3SEXA 5JK4A 4ZE8A 2AL5A 3IO4A 5I2NB 3Q26A 3FASA 3ODBA 2I0CA 1MXVA 1N7WA 2DXYA 3K6XA 3KN3A 1OIBA 4N6PA 3TTKA 1ZLQA 4R75A 1A40A 4MBPA 3VDFA 2NVUB 3IXQA 2ZYNA 1H76A 2IEEA 4U23A 3B6WA 3DM0A 1M5FA 3PPNA 3QUFA 3T22A 1BIYA 1ANFA 2D3IA 5L9SA 5CM6A 3M3FA 5AA1A 2E0SA 3C35A 2OBGA 3ENVA 3L6HA 3OEMA 1DMBA 4QFNA 2GFEA 4FAJA 1M5EA 1LCTA 3BBRA 1JNFA 1GVCA 1XVYA 3T9HB 3IOVA 1R6ZA 1MRPA 5EHSA 3ILUB 2JHEA 4GXAA 2O7IA 1L5TA 2HAVA 1M0SA 1B1XA 4ZEDA 1MQGA 5CBSA 2RKMA 1LKZA 4KYEA 3KSXA 2X26A 2DS9A 4IGRA 3K6UA 3OFGA 5J1DA 1DOTA 3TUSA 4GO7X 3C36A 4DE8A 1NMUA 2VGQA 4PFTA 1MQHA 4YKIA 4EQ7A 4NF8B 1B58A 3IOWA 1Y20A 3NRBA 5I59B 4GL0A 1B4ZA 1ZBMA 5H8HB 1F9BA 4QFOA 3C32A 3OO7A 4YU0A 2H9BA 2G29A 1QUKA 1Y1ZA 1GGGA 2ZNSA 3S9MC 2REJA 2REGA 1KS2A 3MWBA 1XC1A 5AA4B 3HHFA 1QW0A 1B32A 4YMAA 4KI0E 3CVGA 1LK7A 2RINA 1ZKBA 1OQGA 1MH3A 1YAEA 1LAHE 1N3WA 3VVFA 2XXVA 3O28A 4FJPA 1O8BA 5TPAB 5EHMA 3LC8A 3U72A 3MTJA 2DXRA 1LB8A 2A5TA 3TODA 5I57B 1Y4TA 2VD2A 4C1UA 3OEKA 3U8QA 1P1NA 3Q28A 4JBZA 3RPWA 2PA3A 5TP9B 3L7OA 3IL1B 4G2ZA 4ZEFA 2DWIA 3UK4A 3QIMA 4GQOA 2XXXA 5BUUA 4F19A 4OERA 1Y3PA 4JWOA 4GOTA 2HQ0A 4YB7A 1YPNA 2OCUA 2ANJA 4DCXA 1ATGA 1B0LA 3EN3A 1MY1A 3BKIB 2PT2A 1TFAA 3V89B 3FATA 1ELJA 4HCYA 1USYE 4YKPA 5A5XB 1II5A 1N0TA 2QRRA 3M8UA 5I58A 1B3LA 3EQ1A 3IB0A 3Q27A 3MC2A 3QAXA 3IR1A 1B7ZA 4KYDA 2DE3A 1D3KA 4R6KA 3N6TA 3OXNA 3TCHA 3GZGA 3IO6A 2FA7A 3KWMA 1UTHB 4OFLA 4GLIA 5LOMA 4EXKA 4U22A 2ONKE 3SKPA 3T9VA 3H06B 3GBAA 4GMKA 4JWXA 4EQBA 4DDDA 4PETA 1EZ9A 1ZU0A 3K0VA 1B1HA 1CB6A 5CMCA 2F36A 2GHAA 3OSQA 3IOTA 3MVXA 3K00A 4BDRA 2XXPA 4G8HA 4OFJA 3DP4A 1QULA 4U1OA 4F1YA 2PVUA 3O9PA 3TDJA 4E0WA 4G68A 4ESWA 1LCFA 1MY2A 3K01A 2NWJA 4NF4B 4DXCA 4ND9A 2ZYMA 3IJOB 5K2XA 1I6QA 1IUDA 4PWUA 5DT6A 1POY1 2X7PA 1IEJA 2XX7A 3O2AA 2I58A 4GL8A 5H8FB 2J0XA 2ZHOA 2I0BA 1PB9A 3C34A 3H6UA 3MP6A 3S9NC 1LFGA 4YZZA 2R6GE 5DEXA 4Q30B 3KEIA 1B52A 3PMXA 3WAEA 1JEVA 1GR2A 4BDOA 3RTWB 4RXLA 3CSGA 2V25A 1SYIA 4F31B 4XKQA 5ICTA 2DWAA 4R72A 3HO7A 2OLBA 1IXCA 3OSRA 1B46A 4BDMA 4L17A 2Q2CA 5IT4A 2YJPA 1KWHA 1DSNA 4PP0A 3V8XB 2DOJA 4H8JA 4QFPA 1YGYA 4EF2A 1N04A 4O3AA 4RA1A 2Z8FA 3SERA 3G3KA 3UORA 4EQ9A 1EZPA 3O97A 1FQFA 3QK6A 3H7MA 3ZS6A 2NUVA 3KFMA 3HPIA 2D5WA 1Y1MA 5I84A 3KGCA 4OQOA 1Y9UA 5F7VA 2DP8A 4OFOA 4H65A 5AA2D 1P99A 3IB2A 3FVGA 1TFDA 3MW0A 3VV5A 2KO1A 4XKRA 4ZECA 1EU8A 4Q0CA 1NKXA 1ZJLA 3O66A 1URDA 4NF6A 3TCFA 1HSEA 1LB9A 2O6AA 4P0GA 1Z7ME 5ICQA 4MLQA 5ITOA 4EXLA 3H6WA 1POTA 3W15C 2OK2A 2THIA 3THIA 3O6HA 1FTJA 3TUJC 1RWUA 3USDA 1MXZA 2QJEA 1IITA 5I56B 2DT9A 4Z0IA 3MBPA 3FJMA 5IT0A 1XOCA 4X1BA 1OVTA 3PMVA 2P9EA 4LQ5A 1LAGE 4YB5A 1UIVA 4IB2A 2F7BA 4WKMA 5I59A 3M3LA 4G77A 5CMKA 2I3WA 4BDLA 1UJ4A 4X1DA 1J1NA 1UJ6A 3MZBA 3FVKA 4OZ9A 1U8SA 2GHBA 3E4RA 3LR1A 2DVCA 1TXFA 3IORA 3RTFB 3D4CA 2HZKA 2RC7A 2NXOA 2PYYA 3OO8A 2Y7WA 1N3XA 4HS7A 4LVQA 3LSWA 2VOZA 5TPAA 3OMBA 4NE4A 1AMFA 4O3BA 1MQJA 3QXMA 5I2KA 1QUJA 3EHSA 1N7XA 5KDTB 2UVHA 2QL3A 4GFRA 4LZ5A 3MAMA 1SQYA 5JTYB 1O64A 2Y7IA 3SEUA 1VR5A 3RY3A 4RYAA 3RLFE 2QSXA 1JVXA 4LZ8A 1S7YA 3OO9A 2B65A 3OFHA 2DWHA 4C1TA 1JVYA 5CBRA 5K2YA 1EZOA 4XIGQ 2W7YA 3PV0E 3K4UA 1PB7A 4O3CA 4ONYA 4ZEKA 3U1OA 2V3QA 1Z7NE 2PBWA 1FQCA 3FXQA 5H8NB 5H8SA 2UVIA 3T9XB 2RE1A 2XXUA 1RKMA 1YBAA 3RGYA 4OHNA 3MVZA 2QRYA 3I3VA 4F29A 3P96A 1LBBA 1Q1KA 1ZMGA 2OWTA 2YLNA 4UA8A 3O6GA 3G7WA 2O51A 1GTKA 4XKNA 2VHAA 2F34A 2XX9A 1PBPA 4YKKA 3ZKKA 1MQDA 4QHQA 2UYEA 3Q29A 5DYHA 1URSA 2FNCA 3RNNA 5CRYA 4N13A 3R7XA 2O68A 5ISUA 4XTCQ 5EYFA 4OETA 1MXUA 4NMYA 1RYOA 4YMBA 1JETA 2GRVA 3OO6A 1JEUA 1EH3A 4DIGA 3CFZA 2QS3A 4LONB 3HCQA 4YKJA 3LBSA 4WEDA 3ZSFA 1T0KA 3VE1B 1S9TA 2Y7KA 2DTJA 4F18A 3DP8A 2FGCA 5FHOA 5ITPA 4GO5X 3O29A 3L6GA 3P7IA 3SESA 3LSFB 4G68C 5KCJA 3CG1A 1UTBA 1IXHA 1UIUA 2F78A 1JQFA 1P1UA 1SI1A 2O69A 3TEPA 3IAZA 1FTLA 3KN7A 3FXUA 3MPKA 4RPOA 1NL5A 4KCCA 4F1UA 4ZZAA 4XKPA 2AYSA 4ZE9A 1I6BA 3A09A 3N6UA 3JYRA 2LVWA 3OOAA 1NFTA 3MVWA 5DVFA 2I3VA 4JSDA 1LSTA 3M3KA 4KYSA 5KZTA 1MPBA 1FCKA 4R6HA 2RF1A 4F1VA 2F8DA 1P1QA 2Y7RA 3VVEA 1I6AA 2P9CA 3MAHA 3HN0A 5DVJA 1S50A 2PT1A 3FJ7A 4Q8RA 2Z22A 3OFFA 3LSXA 2F7CA 1D9YA 4RY1A 2Q88A 4FATA 4KCDA 2NYIA 3GLBA 1LK5A 3TQLA 3TFLA 4POXA 4Q5TA 1OQHA 1B6HA 5FHMA 3IK6B 3RUMA 1IXGA 2H5YA 4IO4A 3UA8A 2BJJX 1SW1A 5HPQA 1PEBA 1JW5A 4ZZEA 3K5PA 5FTIA 1USYH 3CFLA 3KSJA 1H45A 2H4IA 4DZ1A 3U93A 3MZ9A 3K2DA 4JSOA 3CSBA 1A99A 1B5JA 1UQWA 2V84A 2R9JA 3PPRA 5AA2A 2HXWA 1B3FA 3U7JA 3TCGA 2QMXA 4QFLA 2B3FA 1NH7A 3B6TA 5HM4B 3MUQA 2D21A 4ELRA 3H3GA 2CDQA 2V3TA 4ECFA 4OXVA 2HFBA 3LOUA 4X48A 5FTHA 2ZMBA 3VLVA 3SETA 3WAFA 4OTEA 2PX1A 3K1NA 1FQBA 1CE2A 2RCBA 5I56A 3UGWA 4M1VA 1B7UA 3C9HA 3TTLA 2HEUA 4PFYA 3PUZE 1MXXA 1WVJA 2XXHA 1O7TA 4R2FA 2LQJA 2I4BA 3H4ZA 5AE4A 2F5XA 1MG1A 1WDNA 2P0SA 4H6DA 5JEIA 3DP6A 1OLCA 3G3FA 4R73A 2DSFA 2A5TB 4QF9A 3RT8A 1FQDA 5I2NA 3ENQA 3ECRA 3KZGA 3IJXB 4P0IA 3T9UA 1B4HA 1A7LA 2PC6A 1H3DA 3K6WA 2ONSA 5L9OA 3TYHA 3W7BA 1B05A 3PD9A 4GXSB 1P1WA 2F6GA 3TELA 2MDAA 3GBBA 3PPQA 4IGTA 3W9VA 2AL4A 5IKBA 3T96B 4F3GA 3U94A 1RYXA 2VP1A 2RQKA 4IO3A 4JDFA 3KBRA 3RT6B 3R6UA 4BDQA 2NOOA 2F97A 4MLVA 2OWSA 1FQEA 4ESXA 3H6VA 2XHDA 4KQPA 1SDXA 1JW4A 3FJGA 1YTVA 4F2QA 2ABHA 2Y7PA 1PC3A 3G3HA 4NF5B 1SW4A 5TU0A 2ONRA 3TQWA 1SC6A 5I58B 3PMWA 3VXCA 3MQ9A 4R74A 1B40A 2ZXTA 1MY0A 1SBPA 4IO1A 1DTZA 2XD3A 1H43A 1NNFA 4QFKA 3FD3A 3FV2A 3FUZA 4I62A 4OENA 3G3IA 3S1TA 4GVOA 4OEVA 1Y4CA 3JV9A 4M4GA 2DE4A 5AA3A 3FV1A 2H99A 4GD5A 4G8NA 1Q35A 5DVIA 3C33A 3SDFA 4TQUQ 3TPAA 2XXWA 3Q25A 3ENWA 1FTMA 4GF8A 1A54A 1OLAA 2F6PA 2Z8EA 3UIFA 1PDAA 3V83A 1NNKA 3KOTA 1SD3A 4NF8A 4G68B 3MVYA 2F35A 1XVXA 3R26A 4FEDA 3GXAA 3VFJA 4P11A 5H8HA 3UW1A 4NMLA 2GH9A 1XT8A 2F8MA 3V5AA 1MDP1 2FYIA 4H5GA 2ZYOA 1FTOA 3IBWA 1M5CA 4U4XA 4KD5A 4FECA 1QJMA 4H67A 5AA4A 1B51A 2CMOA 4OEUA 4MF3A 4R6YA 1D9VA 3FVOA 3TMGA 5DEXB 1IQ7A 5H8QB 2V3UA 5L9MA 2UXAA 1VE4A 4M8LA 1IXIA 1M5BA 4X84A 1VFEA 5I57A 4G4PA 2RCAA 2ZNTA 1H44A 4OWDA 1MS7A 4GRKA 4OYVA 1LLSA 5TP9A 3FGSA 3EHUA 3K1MA 2PMSA 2IA4A 2ZNUA 3MP1A 5ELVA 3PPOA 3ZKLA 4UACA 4RK2A 3EPEA 1LAFE 4ZEBA 2RC9A 4QSEA 1LFIA 4JXIA 4LZ7A 2H98A 4X9TA 3ONMA 4F3PA 4IO6A 1NNPA 4TLLB 1N84A 3OFEA 5IAIA 3MPLA 3FVNA 3D4GA 2B3BA 5A5XA 2QS2A 4NWCA 3TAJA 1MQIA 1AIVA 2Q8JA 1SW5A 3KG2A 4R9GA 2O7UA 1Y7PA 3DHWC 1OMPA 1LAXA 3KN8A 1Y3QA 3KOSA 4RJZA 4PQJA 4NF6B 3DLNA 1UTHA 4YICA 4RNSA 1MPCA 2ESNA 1B3EA 2AIXA 1OVBA 3OELA 3N0VA 3HSTA 3CG3A 1I69A 2XXYA 2I49A 2P2AA 2CZLA 3DHXA 4JWYA 4QSCA 3S2VA 1FTKA 4Z7EA 1DPEA 4NEDA 2DE2A 5B70A 3PUVE 3S4UA 3O6IA 3O1LA 2O84X 3TUZC 1D4NA 4ELOA 3KJTA 3BFUA 1P1OA 3VLWA 4AQ4A 3LSLA 1QKBA 3SEVA 1LBCA 4LATA 4NF4A 3DC2A 3E13X 4F3SA 2ALUA 3U92A 3LUYA 4OESA 3PD8A 3EF7A 1HSJA 2F7AA 4IO5A 2I9SA 2P1SA 3IX1A 1GV8A 3TKDA 2QS1A 4U4SA 3F11A 3TTMA 5H8FA 5IS2A 3TTNA 4WXJA 3FXRA 1SI0A 1LFHA 2I4CA 3VLUA 2Q89A 4YB6A 2O1MA 3PGFA 5CI5A 3S9EA 2DQVA 3AXFA 5T41A 3W9WA 1MPDA 1NNTA 3TTRA 5I2KB 3N5LA 1URGA 3OBIA 4EF1A 5L8DA 2A5SA 3PU5A 4LA9A 4AB6A 1BLFA 4DLDA 1DPPA 4WEPA 3UN6A 1FW0A 5FIIA 3B7DA 4BDNA 5FHNA 4IO2A 3OD7A 1BTJA 1PBQA 2HCAA 4GIZA 2RC8A 1MDQA 3VVDA 2DVZA 3AB4B 4R2BA 1B3GA 1SW2A 1A8FA 3A3UA 4FE8A 3PUWE 4F22A 2UVJA 3DELB 1NH8A 2I6EA 4FORA 2YPNA 1A55A 3MZ1A 3RQTA 3CRBA 4BLAA 2XXRA 4NF5A 1ZPVA 3EHTA 1MH4A 3BFTA 2Q2AA 1AH5A 4ELPA 4F3BA 2LAOA 3HHGA 4ZDMA 4DCYA 1IIWA 4HTGA 2XX8A 1MXWA 1US5A 3G3JA 5CC2A 2XXIA 3CEDA 4MFIA 3CFXA 4ZS9A 4K3FA 1B2HA 1XS5A 4XXUA 4F2OA 1US4A 1B7HA 1SVXB 2F1FA 1B0HA 4NTLA 2Q9TA 1UJ5A 3HHEA 3E9XA 4IO7A 3MP8A 3N94A 4QRZA 4ISUA 1N76A 1MM7A 4I1DA 1M5DA 2HAUA 4POWA 1R9QA 2WKYA 5M2VA 5KCJB 3E3KA 1R9LA 1UTBB 2P9GA 2Z23A 1MY3A 3SEWA 3T93B 1QKAA 5JJBA 4I9DA 3T66A 4H1XA 3IB1A 4MH5A 1HSLA 3FIRA 1XTZA 4FEBA 2JOQA 1WODA 5BWJA 2ZYKA 2Z8DA 1BP5A 4IY6A 3JZJA 1AL3A 4IY5A 3S9LC 2UVGA 1QUIA 3B6QA 4TOZA 3H6TA 4C0RA 1PSDA 4OVJA 2QSWA 2XXQA 2OZZA 4HW8A 4E0XA 4R9FA 2X7QA 5H8QA 1IZ1A 1DTGA 4H8IA 5DTBA 3KJ7A 3C4MA 1FQAA 4LP2B 1YCJA 4RK9A 3QSLA 5KDTA 2G93A 1B5HA 2H25A 4DXBA 3QUJA 5JTYA
chains in the Genus database with same CATH superfamily
3MAAB 4NI2B 3ILTB 4AB5A 1LBWA 3FBCA 1TUVA 1ZZFA 1V3SA 3ILOA 4JB7A 2POKA 2RDDA 2GMJA 4HEA9 4RW4B 4E8UA 3KJVB 1MM6A 2VV5A 4ED4A 4H0WA 2XWXA 4B9VA 5B7DA 4CLLA 4CM0A 3SEYA 4IQXA 4G1QA 1IBMF 1RBOB 3V4IA 2QPQA 3DOKB 2JX2A 1DBZA 2XWVA 2DGWA 4PAIA 1NDPA 1RISA 1GEHA 4GRSA 1HNIA 3CPWR 1TVRA 2ZKUA 4I8CA 4DR6J 2O67A 2PO4A 3B78A 2DWJA 3W9HA 5KG3A 3I5OA 5FJ4A 4RW6A 3QWUA 4AQYF 4THIA 1ZTYA 1D8YA 2V50A 1JLCA 3I6VA 4P9SA 1G0HA 3GSIA 4L73A 2HGNA 2MQOA 2LEPA 2RT3A 2YX1A 3HV1A 4LF4F 2XWKA 1NKEA 3EZ5A 3OENA 3FEXB 2BJEA 3A3CA 3K6VA 1XMOJ 1YRUA 1E6YB 4ECYA 2XLKA 5EWFA 1K0TA 1VLYA 3A8KA 4OMBA 4DV3F 2KG0A 3IG1A 3UNYA 2YKPA 5HVGA 4EBDA 1NSKL 3H03A 4F4KA 4AXIA 3IOUA 2XMUA 2YTCA 1S6PB 3GJSB 4M5IA 1GXLA 2VC1A 2L41A 1JJ2R 2VD3A 1UPMB 5CMMA 5CQGA 3FBBA 4EYHB 2R8HA 4ZKAA 3D3BJ 1H74A 1RT5B 4Q2LA 3S7RA 3UFCX 2Q8MA 4DQQA 4YUDA 2YWWA 1PB8A 3IAM9 3KLFB 3QPIA 2KZMA 3NCQA 4G8MA 1B3HA 1PYOB 3NBPB 1J27A 2VQFF 1TKZB 1F5BA 5J2MA 5KG1A 1TWYA 2UYFA 1N88A 3TP2A 3MFIA 5D3GA 1T9UA 2HQ3A 1Q81T 4N8YA 4ZE8A 2AW0A 2QL5B 3BO2A 5I4MA 1UA1A 2RS8A 2UXBF 2WHOA 3DU5A 4WZQA 2UXCJ 4RW8B 1MXVA 2A1BA 3JTOA 1M5VC 4P10A 3K6XA 1NDKA 2M0GB 2MTLA 1VQ4S 3TTKA 3FMWA 4R75A 2HQFA 3EWGA 2NSCA 3CC2S 3GU0A 3PXGa 3IXQA 2ZYNA 5HMYA 3UPFA 3OR2B 3WC2A 4DR7J 3QWPA 1NK0A 3SQOP 2OPRB 1M5FA 3MCMA 2LDIA 1BIYA 3EVOA 2K1RB 1VQSA 1XMQJ 1FA0A 1DTTA 3C35A 3ZTQA 4V19X 4UW2A 1CQMA 4DR1J 4ZJOA 5F8HA 2JJKA 3L6HA 4JI3F 3HSDA 4QFNA 2Z8QA 2GFEA 5B0CA 3LGHA 2CQBA 3EM1A 1GVCA 3QJPA 4P73A 4ITSA 5M2UA 2HNDB 2AU0A 1RKJA 4NLTA 5IM2A 1R6ZA 3QAUA 1AYEA 5EHSA 3ILUB 2JHEA 2BABA 2BJ9A 2JFDA 3TAMA 1RWVB 2O7IA 3FNNA 3AA8A 2HAVA 2LA4A 1PC4A 3QYYA 4X4SA 1LWFA 2RKMA 1LKZA 1R0CB 3C6UA 4KYEA 1X4FA 2RH3A 1K0VA 5FDLB 1FRKA 3QQCD 4PUOA 2ZD1B 1X5PA 1DOTA 4A8OA 4NAPA 4A8SA 3C36A 4FYVB 5KT6A 5HAOA 4LF6F 4PFTA 5HN0A 5EX3A 2ZOFA 4PWDB 1TK8A 1Y20A 2KG1A 2PMHA 3TJ8A 1ZBMA 1HPZA 3CW2C 2RUGA 4QFOA 1S0OA 2XWIA 4O4RA 3C32A 4PAAA 4GVBA 3UR3C 1SH3A 3OO7A 2DCUB 2O5DA 4YU0A 4DUZF 1Y1ZA 1QVGR 3EMTA 2R7XA 2ZUAA 2V63A 1EQMA 3HHFA 2DNQA 4P6QA 1QW0A 2DD8S 2VB6A 3UN2A 2FHKA 4KI0E 2UV8G 3BM7A 1ZKBA 1BWVA 1Z1ZA 4JI0F 4JVDA 1OQGA 1MH3A 4CH7A 1S79A 4QIGA 3LW5C 4WBFA 1FJ6A 4QYRA 1DQ8A 2DXRA 1U0HA 1VI7A 2GIRA 3TODA 4DX5A 4PXBA 4I6YA 3OEKA 1OYDA 2W9CA 2LEAA 4GX6A 3Q28A 4JBZA 3HKZD 1YZ0A 3E78A 2E66A 1D3WA 4G2ZA 1SC1B 1Y10A 2GNKA 3QIMA 2BUNA 3NOCA 2YBVA 5KFNA 1WORA 2B4MA 2ZH3A 3BYPA 3QLHA 5BUUA 2FHJA 1KLMB 3RBEA 2MB0B 3TWZA 4KH0B 4OERA 2IIHA 1S9EB 2IM0A 2ZJPQ 4IG0B 1YPNA 2OCUA 2M3DA 4GC6A 1EZZB 1VBZA 1B0LA 2R8JA 4USWA 4ZCKA 3J80U 4ELTA 1JLBA 1USYE 3TUPA 3C15A 4QBUA 1IQZA 4CCHA 2XY5A 4Y0FA 2QRRA 3M8UA 1BLUA 3IB0A 1B7ZA 2EFPA 1VRTB 4OVRA 1WG5A 5KFLA 4FF2A 1J5EF 3N6TA 3TCHA 4HT5A 2QEXS 4WIIA 3GZGA 4YHHJ 2FA7A 3DI6B 4HDHA 4GLIA 5LOMA 4EXKA 3JSRA 2XMTA 2BOPA 1VBKA 2V68A 2CVEA 1FERA 3FCWA 3SQGB 4QIEA 2IRUA 5EQ9A 3HLUA 2D9OA 1MW7A 4GMKA 4C0HA 1PO6A 5E2QA 4A47A 1EZ9A 4RUAA 1X4BA 3K0JA 2C2RA 4H4MB 1N0VC 3SZ2A 2FQQB 1CB6A 2OUGA 1NV5A 1FPLA 3ZZZA 3OSQA 3IOTA 2OPSB 3K00A 2AKWB 2EKNA 4OFJA 1QULA 3OTOF 3BPDA 1RT6B 3SCLE 4DBQA 1U8WA 1FNXH 2GVZB 4DV2F 3O9PA 2HHPA 4E0WA 1ZA1B 4ESWA 4CO2A 3LTOA 4CLPA 8AT1B 1LCFA 5CZXA 4OHZA 1BY9A 2Y9HA 4LR9A 2QO3A 3CMAS 2VBYA 4DXCA 1M5SA 5CYQA 4NXNJ 1VQKS 2RD5C 1JXLA 5KFSA 2UUAJ 2GW8A 3VQTA 2V8GA 1ZM2A 5K2XA 5KFFA 4E2FB 4PWUA 3EUNA 2LCWA 1POY1 4Y00A 2IMOA 1X60A 3KLGA 5CCMA 2X7PA 1ULRA 1IEJA 1LBZA 4XIUA 1TFYA 2I58A 4MAGA 3G6VA 1NHVA 3G96A 4LBPA 1PB9A 3MF5A 3PRDA 3MP6A 1I6JA 1ICEB 3S9NC 5B08A 3R2CJ 3DRXA 5DEXA 3K57A 2Q1LA 3WAEA 4I2QB 1JEVA 1GR2A 2CEYA 1KVIA 1FPJA 3NWRA 2CQ0A 1RT7A 2HVDA 1NK5A 2DWAA 3NWGA 3HO7A 2OLBA 4I56A 3DXSX 4X64F 3OHBA 3HVTA 1QSSA 1LXJA 3OTDA 2APOA 2P5VA 4L17A 3M6XA 6FDRA 3LP0B 2Q2CA 5ET7A 3GE9A 3GR1A 4E98A 1KWHA 3QIPB 3HHDA 4DR2F 2PI4A 1Q8BA 2DNGA 1SV5A 3V8XB 1TKDA 1LBXA 2ACYA 2PFDA 1YZ7A 1KQFB 1N04A 1XC9A 3HX9A 4N77A 5HROA 4DUYJ 5C24A 1YDLA 2VOOA 3P45B 1EZPA 2CQ3A 2V4RA 3G8SA 3O97A 3QK6A 4JVIA 3AQPA 4K5SA 2K3KA 1Y1MA 5KTQA 2EBGA 5I3SA 4ZVTB 3MR3A 2DRAA 2VQFJ 2YWEA 4ELVA 5F7VA 2EG1A 2N3LA 5L1KA 4FPRA 5C2CA 1APSA 3HHKA 3FVGA 1TFDA 2KO1A 1C4CA 3LH2S 3BZQA 3O66A 1IUJA 4DR5J 3QZ7A 4PG4A 1LB9A 2OSQA 3MEDB 5ICQA 4QR1A 4MLQA 3MPWA 2GO9A 3R6GB 2PSZA 2XLJA 1V6HA 1PCAA 4YR3A 1YWXA 1VHFA 3W15C 3FSYA 2THIA 3O6HA 4YR2A 3CXCR 2YQ1A 3GFZA 3TUJC 1RWUA 2CFXA 3KLHB 1YJ7A 3PKYA 2V2VA 4DI4B 2X1AA 3PJXA 1FRIA 1NZAA 1X0PA 2CNKB 4X1BA 1OVTA 2AIRB 4LQ5A 4M94A 2F7BA 3M3LA 5CMKA 4F50A 3V81B 2IC3A 4BDLA 4IOBA 2DNLA 4NX1A 2F5GA 1I94J 3M9OB 4OZ9A 1TUGB 2GHBA 1RAGB 4LF1A 5EGYA 2DH7A 2H4YB 3E4RA 2WZ1A 2A6OA 5J1PA 3RTFB 3MAQA 2HZKA 2NXOA 5HP1A 3EJMA 4DLEA 4DL4A 1UEVA 3QJLA 2X3GA 3MM8A 3N4WA 3EZOA 4A8KA 4HS7A 3OD2A 3R7NB 3PVXA 3LSWA 1YBUA 2VOZA 1DFDA 4O3BA 2IVYA 2AGOA 4OL8A 2UVHA 2XYPB 4MIWA 3CMES 1FBPA 1WKLA 2RF2A 4LZ5A 5AJ3J 4NPOA 2EC2A 2HKEA 2JNJA 3RY3A 1UWAA 3UCZP 4X4UA 4RYAA 2WYPA 2QSXA 3KLIA 1YJWS 2HYIB 4OZNA 2RAQA 2YNFA 4C1TA 1U49A 1EZOA 2ZVSA 4XIGQ 2W7YA 2V3QA 2E44A 2VOPA 2PBWA 2W01A 3H5SA 4B3RJ 4G1QB 3V4IB 2XXUA 3IWXA 3HMJG 4J9SA 1KFSA 2W7OA 1LXNA 1T02A 1Y3JA 2XCPA 4FNIA 3D1OA 2W7AA 2ATLA 5AE2A 2ZBPA 1KQSR 4B9UA 5GMKa 2GHPA 4UA8A 3G7WA 3CF5Q 4NA1A 2VJUA 1AZSB 3MMCA 2K3IA 2ZZWA 3D6HB 3FSIA 4K7QA 3BBBA 3IS9A 4PGPA 4XO0A 3TA1A 5DYHA 1RAEB 3OXLA 1JLCB 2IAJA 1URSA 2WVCA 2FNCA 4LRBA 1UW4A 4PEOA 3R7XA 1PILA 3THVA 4PFRA 1NJXA 1MXUA 4NMYA 3PHEA 1ZM3A 2V6AA 3OO6A 4YMBA 2MZRA 4I6WA 1WHXA 5LDZA 4P75A 1EH3A 3OW2R 3HVRA 3IG1B 3HCQA 3C2PA 1WC5A 4I1TA 2CPXA 2GX8A 4BC7A 1T0KA 3RAMA 4K4XA 1S9TA 2DTJA 4F18A 2VFRA 3ZFVA 2PCRA 1HWJA 4MK8A 3P7IA 4HVZA 3SEOA 2CPDA 3SESA 2W2NP 5K8PA 3K5OA 4ED7A 1C1BA 1UTBA 3RTVA 1IXHA 5LMUF 4QW8A 2B7BB 3QMFA 2AWZA 3LGMA 3L3CA 4DUTA 1XBWA 5J2MB 3J7AN 2JL9A 1FTLA 4TN2A 4CZCA 1F9HA 1ZAWA 1FBFA 4ZZAA 1OQ6A 5D3GB 2RMLA 4ZE9A 1YZ6A 3SCKE 1KOHA 2CPYA 4K4YA 3MD3A 2QN6B 5F3TA 1NFTA 4JSDA 3J81Y 3M3KA 4KYSA 5KZTA 1BGXT 2VPNA 1MPBA 4FKXA 4IOCQ 1FCKA 4H45A 4QYZK 2FLOA 2RF1A 2QA4S 2FIEA 2RQCA 3VVEA 1VBYA 1I6AA 1F6TA 4RWWA 4ICLA 3A29A 2FLNA 5KOWA 3MAHA 2DGVA 3GFHA 1S1TA 4F4YA 5K8MA 3KDOA 3MMJA 1S50A 4PRFA 3KHGA 3FJ7A 4Q8RA 3B4DA 1Q79A 4MMPA 2Z22A 1SI9A 3LSXA 1DTTB 1I51B 4UT4A 4DV2J 1YKWA 4FBUA 2GQ2A 2FUG9 1XK8A 1SKSA 1OY9A 3TFLA 2ZZMA 2RB7A 3MI7X 5G4DA 2LA6A 2KH9A 1LWCA 2V34A 1HNXF 4I67A 1HYSA 4JYAF 3CMQA 3UA8A 4W92B 3UN5A 2XMMA 2KN4A 2AJQA 5HI7A 3JTNA 4TVAB 2CZIA 3TAMB 4J90A 3KFWX 3T5KA 1USYH 3CFLA 2H4IA 3U93A 1LWFB 1BD6A 1NI9A 1Q7YT 3C6UB 1KP6A 3TNVA 3MM7A 1S6QA 4IR8A 5AA2A 1F60B 4NLRA 4P47A 1RBAA 4UOGA 4UOCA 3UDVA 2B3FA 4QW9A 1PYSB 4ELRA 5A8WB 2KXHA 4OXVA 3W60A 4LR7A 4FYWB 2KYZA 5AE3A 3QIDA 4IDKA 1TV6A 3DLHA 1FFSB 3HFZB 5FTHA 2ZMBA 2PIIA 3GCXP 1HPZB 1UVIA 4OTEA 1XWLA 4YOEA 2E1RA 1OQ3A 2F3JA 1UEKA 1SKUB 4GVBB 5GAHI 1V9OA 4M1VA 1PAEX 2GIQA 4MHFA 3C9HA 2XWOA 2P3NA 3TTLA 2HEUA 4ZIWA 2E5LF 4XAKA 5KFCA 4M1KA 5L1LA 1O7TA 4I68A 1CSJA 1MNEA 5H9EK 1DJ0A 1S9GA 1FKPA 2LQJA 4RW7A 2DNZA 2F5XA 3AD8C 1WDNA 2P0SA 2DY1A 3A4TA 3O8WA 2XLIA 3WHIA 4R73A 3CO0P 1U0HB 1WC1A 3KJNB 3RT8A 3E01A 3VGTA 5I2NA 2CIMA 2W9CB 4OI2A 4PG7A 2MXYA 4P0IA 2W1BA 4MNCA 4IRKA 3HULA 1QJHA 5J1EB 1PKUA 2PC6A 3K6WA 1IWGA 2ONSA 5L9OA 5THWA 4GXSB 3MR2A 3KK2A 4OI3A 1U6FA 3QLHB 2UUBF 3FRZA 1P1WA 2MDAA 3FFIA 4NWBA 3T96B 3A3NB 3OPKA 4LF8J 1YX2A 4F3GA 1PYTA 2F7VA 2VA2A 3AODA 4ZN1A 1QTNB 4NLWA 3R6UA 2DHSA 4ESXA 3DMJB 3H6VA 1Q5YA 4Q44A 1HNVA 1INPA 3NS7B 4NL5A 3DGPA 4USTA 4PYDA 4WXWA 3C15B 1NK7A 3CNQP 4Z7CA 4NF5B 4DMZA 5IFMA 5TU0A 1J2VA 3TQWA 4ZPVR 1SC6A 4P52A 1SBPA 3EGVA 3R27A 1BHNA 4IO1A 5HQMA 4KB7A 4LRFA 3MEEA 1Q95G 1HIYA 2FHMA 1NNFA 3A8EA 3R7BB 3VGVA 3FD3A 1CJTA 2H5EA 1NV0A 3DRSB 1QAJA 4I62A 2JC1A 4EZ9A 3G3IA 4X62F 4GVOA 1N34J 4M4GA 4GD5A 4ED1A 1FWKA 1G3OA 3FEZA 4PCQA 4BWMA 5EHHA 3KG1A 3LF0A 4KAIA 1RJJA 4QU7A 1PDAA 1JLQA 3BKTA 3V83A 5A5LA 1N36J 2EBEA 1SD3A 4N4UA 4NF8A 2UUTA 2F35A 1DLOA 2R8GA 2ZFHA 3R26A 4FEDA 4GWUA 3ILIA 1VQOS 3D6FB 4P74A 3PW7A 1K44A 2JVOA 5CYQB 1X5SA 2GH9A 1XT8A 2L9NA 3TO8A 2A2CA 2C3YA 2FYIA 2HGLA 4U4XA 3VAHA 2Z58B 1U1NA 2AMCB 5KT4A 2HFOA 3QGHA 4RNNA 1R8PA 1R89A 4JI1F 2HHQA 2DXDA 2B43A 2OH2A 5AA4A 3BSNA 2YKOA 4OI6A 5KFPA 4LJMA 2GQQA 4NLGA 4NOHA 3FVOA 1VDWA 2VFVA 1NHKL 5DEXB 1IQ7A 1GMWA 2V3UA 2UXAA 1IXIA 2BANA 5DO2A 4C8NA 1FFWB 3JYTA 2YKAA 2HPGA 2CZ4A 1MN9A 4P3LA 2QL9B 2OFHX 4G4PA 1UETA 3QT7A 3R5CA 1FTRA 4GRKA 5HSPA 5TP9A 3K1MA 5K20B 2IA4A 2UVWA 4MIJA 2O1PA 1B7FA 3IWNC 5B0AA 3PPOA 3Q8YA 1QE1B 1SV5B 4UACA 2R7RA 1RKIA 3W5XA 2GQ1A 4Z7YA 5HLFA 2A0FB 4JXIA 1R6YA 3R7SB 3DOMB 1VLOA 5HROB 1T05A 5C24B 2C2OB 4F3PA 4IO6A 3HSZA 3Q8RB 1FXLA 4K4WA 3OR1A 4OZ0A 3K5LA 1N84A 3OFEA 1VIXA 5A5XA 3KBZA 4OMFG 5D8HB 4GBWA 1JKHA 4JV0A 4DWIA 1FI4A 2YPZA 4NWCA 1WC6A 1EJ7L 1MQIA 2Q8JA 3ZTPA 1FRLA 1SW5A 4DJBA 3RRGA 1S0MA 3ZZUA 5BYSA 3KK1A 1Y7PA 1IBLF 4NG7A 1LAXA 1Y3QA 3K7RA 1G7CB 4MFBB 3RW6A 2PGCA 3SXLA 4C8LA 3AD9C 2VQEF 5KG7A 1GAOA 2AIXA 4EWTA 3OELA 1TL5A 5JVHQ 4NQ8A 1AUDA 2CZLA 5DJBA 4JWYA 1RWNB 4LVOP 4QSCA 1RT4A 3S2VA 4ED0A 1FTKA 3HO1A 4GWWA 4MNIA 2DYAA 1RTJA 4HXVA 2R2SA 2CJBA 2FJVA 4IR9A 1YTYA 3PDNA 2B4VA 4KHMA 4O3NA 2PFYA 4F36A 2NXEA 3G9CA 4AQ4A 2IC3B 4CYUA 4OYBA 3ZO7A 3OSPA 4OX7A 2UVRA 1LBCA 1HNXJ 4LATA 1HQ2A 4LBHA 4JYAJ 2P3VA 2J9DE 2EFNA 3PACA 4WFAQ 3I9ZA 4HYKA 2Q43A 4JI2F 4F3SA 4FYDA 2E5GA 2BJIA 3EF7A 5IZ1A 1RQ0A 3HPOA 4IO5A 2FY1A 3VR1A 3SZPA 2R8IA 2MKJA 5GADU 3CCRS 5HP1B 3F11A 3TTMA 2OKQA 4QWBA 3FXRA 3MM8B 4MAKA 1LFHA 4DU8A 1HQUB 2VUGA 1B99A 1MWQA 2DNMA 4NX9A 2O1MA 3PGFA 4IFYA 2FHOB 1Z2LA 3WZ0A 2Z2MA 2HHVA 5T41A 1MPDA 3TTRA 3DYAA 4EF1A 3MR7A 4ZVGA 2A5SA 1BLFA 5HATA 2CZ9A 3C16B 1DPPA 1L3UA 4WEPA 5FIIA 2FY8A 4P7VA 2BDPA 2CDRB 3MOZA 3KC1A 3A12A 3KLIB 2D3O1 3G8QA 1ZAXA 2YNFB 2IRXA 1F2HA 1S6UA 2RC8A 1FK9B 3CULA 2QVUA 4I0WA 2DPJA 1RHKB 1SW2A 1SJ4P 3A3UA 3LWLA 2DHGA 1SUQA 2E5LJ 3LGNA 2YPNA 2VZ9A 4IG3B 3VQSA 2XXRA 3E8OA 1HKAA 2CQ4A 4Y34A 3GSDA 4B3MJ 3CO9A 4FS1A 1KN6A 1WEXA 2LXUA 1MH4A 4X66F 2M52A 2N7YA 2R8TA 2J0QD 1AH5A 3RB3A 3MMCB 4ELPA 2I0XA 3IGNA 2XS2A 2FVSA 2LDYA 4HTGA 1US5A 4DV1F 3G3JA 4HH0A 3D6TB 3UN3A 3IS9B 1VQ8S 1HWLA 2V67A 4TLRA 3D54A 3CEDA 2HFSA 1LWEA 4MT1A 4ZS9A 3ZZTA 4QJVA 3OVBA 3R5BA 4NLYA 4FBTA 4QU6A 1P1TA 1JXEA 4RO0A 2DR5A 2L9WA 2X1GA 1SQFA 3GMGA 1B0HA 2VFSA 1UL3A 2E7VA 2EEYA 1BQMA 1VQPS 2Q9TA 4BLGA 3ZXWA 2VBWA 3AQOA 2GAHC 4KO0A 2LQ9A 4I1DA 2KZZA 2HAUA 5F9LA 1NAQA 1AB8A 2OD4A 3KUHA 2E7WA 1ZETA 2IJRA 4DF4A 5D15A 2Q3PA 3G87A 1UTBB 5ETMA 1PAUB 1B0VA 4RWXA 4LSNA 1UA0A 3MXHP 3IB1A 4P2XA 1WF2A 3FIRA 4WFBQ 3Q86A 4U96A 3PX6A 3BGRA 3EGZA 3NXZA 3NCRA 5KFHA 1AL3A 2GS8A 2QE5A 4TOZA 4C0RA 1PSDA 1PJ5A 2A18A 2HNYA 2H4WB 2XXQA 4HW8A 1RZMA 1M1GA 1GTEA 1EHWA 5H8QA 1KD1T 2V9WA 3MGJA 2IYGA 4ICLB 4ZN3A 3C4MA 2XS7A 4DXLA 1S1TB 4XPCA 3HD2A 2G93A 4RW9A 2H25A 1AA1B 2UU9F 1VSOA 3I55S 3NGSA 4DI6A 2F65A 3RN8A 2XB2D 3CD5A 5LXRA 4ZVUB 3FSXA 5HL7Q 1XNRF 4O4GA 1LWCB 4U21A 1SPIA 1FRJA 1HYSB 4H5FA 4OVQA 5F1QA 2KU7A 3K1PA 1R8CA 3LUZA 3GWCA 2CQGA 5ETLA 3N26A 5D0RA 4DXUA 4FIMA 5C42B 2B6AA 3TEGA 1KEKA 2O3DA 1JW1A 4JI1J 3L95X 4KR5A 4N17A 2MEWA 3VHQA 2J0WA 3M8PA 2WW8A 4F4ZA 3QBCA 1SL0A 4KKOA 4WXOA 4KFQA 2HRUA 2DISA 3FBFA 3MM7B 1S6QB 3AAWB 2CQCA 2V8HA 3KJFB 5AA2B 2X1FA 2C42A 1JLEA 2KLFA 4C48A 3ENAA 1WTBA 4OZ3A 4G61A 2H65B 2QFJA 1A8EA 3HVAA 1QSYA 1D9AA 1B5IA 3T1BA 3R5GA 4HCWA 4ZLLA 4FBPA 2G0CA 1TV6B 1RXOB 2O66A 4EUOA 5LT5A 1S1UA 4GWOA 2RQMA 4USKA 5A8RA 3B82A 3RB4A 4K4SA 2GJ2A 1S1VA 1WNEA 3PPPA 1U7LA 2CAJA 3S01A 5F8GA 3GB0A 1HWKA 2OJTA 2BJ3A 3PUYE 4DZDA 1JNZB 4QXDA 1XHYA 3DRRA 1YJ9S 3JAMU 1S9GB 2AYMA 4PFWA 2O1LA 1I5OB 4RW7B 4C8YA 1B9JA 4TY8A 4LUBA 1IBLJ 4Y2MA 2AL5A 1HI8A 3QFWA 3C14A 4DR3F 3IO4A 3IM9A 5KOXA 3E01B 5I2NB 1WOPA 3S8SA 3GIRA 3ODBA 4MEVA 3CCLS 2I0CA 4ZK7M 1N7WA 1V5IB 2DXYA 4WWSA 1EKSA 2XYGB 5KFYA 3KN3A 4DQPA 3Q8UA 4N6PA 1ZZNA 4DQRA 1ZLQA 3KK2B 3N9UC 4MBPA 2NVUB 4B3TF 5AT1B 1H76A 3FFIB 2EVZA 2IEEA 2BJ8A 4U23A 3AY0A 2MSSA 5B0FA 1Q78A 5KFTA 2B9WA 2V9KA 3FQKA 3QUFA 4XDDA 2DPIA 1YLXA 4A8XA 5MLCV 3T22A 1MROA 1ANFA 2D3IA 5CM6A 2XI2A 1YRTA 5AA1A 2E0SA 3DGPB 2HMIA 5EQ7A 3ZTRA 5D4OA 2AJFE 3OUYB 4PWWA 5F8IA 3OEMA 1DMBA 5I7IA 2D74B 1LCTA 2ADCA 5HBMA 1JNFA 4DV4F 3O44A 3VAKA 2ZH4A 3GILA 2FD2A 4ED2A 4O94A 4IFVA 1MRPA 2DGXA 3GYGA 4HE0A 1MMLA 1U45A 5GMEA 4GXAA 1C1CA 4LQ9A 1Z2ZA 1L5TA 4GKKF 4B3SJ 4ZEDA 5CBSA 3U1NA 4J7CA 2WBBA 3KLEB 1U1LA 3NL0A 3KSXA 2C2NA 4GC7A 1RT3A 2XNRA 3QJJA 3K6UA 4EBCA 3M2VA 5JXSA 5F0UA 3TUSA 5DDPC 2XTJP 2AX0A 5HVFA 2ZBCA 3T1HJ 2G0JA 4C0BA 1JLQB 4QYZJ 3G86A 1MQHA 1TTHB 4YKIA 4NF8B 4C6AA 5ETKA 1VBXA 3NRBA 5I59B 2CPEA 1S1WA 4WU3A 4ED6A 4CTAA 4GL0A 1F9BA 3DLKA 4BDPA 1SVDA 1TK5A 4EI2A 3I5BA 5F8LA 3P5BP 5E0OA 2R2RA 2FYXA 3QRRA 4FXWA 2QLFB 4OV1A 3US5A 5IQ6A 4DQIA 1IBKF 3UR0A 2REJA 1KS2A 2RSQA 2CVIA 1Q53A 3O2IA 1VJQA 5AA4B 2F4VJ 3DDIA 1B32A 4F0KA 4DLGA 1MWZA 3CVGA 2HRYA 2RINA 2ASYA 2FZKB 5DDRC 3VWSA 3OQ2A 1JWWA 2KB2A 2SXLA 1O8BA 5TPAB 4I69A 1M5OC 3LC8A 5I3PA 3JYTB 2B4OA 3V5RA 4NA3A 2HRTA 5ETSA 3NGRA 1FNMA 2QVVA 1WJ9A 4BS2A 4DCJB 1RDRA 5TP9B 4RLEA 2GVDB 2E1PA 3NOGA 1S59A 1N32F 4DFKA 4Z37A 2AQ4A 4ZEFA 4PPDA 2KXFA 3UK4A 2RHQB 1X5OA 2XO6A 4PPZA 3NG8A 3QRPA 1DY3A 1Y3PA 3NAIA 5HLFB 3QGIA 1FVSA 1G6BA 1T05B 2ANJA 3KXDA 4DCXA 4H4KA 2DNYA 1S49A 1MY1A 1G2EA 3OR1B 1TFAA 3FATA 3G82A 4HCYA 4LN5A 1CQNA 5A5XB 4C8ZA 1JKHB 4OYMA 4LSLA 2VT5A 1B3LA 3Q27A 3BBCA 3MC2A 2MZSA 2OTLS 1TL1A 2Q6BA 4KYDA 3ZNJ1 1URRA 3L7UA 1IKVA 3OXNA 3POTA 3T6BA 5J2QA 2G2OA 1YJUA 4OFLA 4DPTA 3Q83A 4CNYA 4LFBF 1FVQA 4NYPA 1ZH5A 3T9VA 1S76D 3H06B 3DRYA 3TR5A 1IKXA 2J76E 1XNQF 4JWXA 1QAXA 3CD6S 1RT4B 1HI0P 1DHMA 1LW0A 1RTJB 4FNHA 1VQLS 2F36A 2CJAA 2C3UA 1Y5LB 4M5MA 2DR7A 2R7TA 3DP4A 2WSEC 1N5VA 2NSBA 4F1YA 2KQZA 3TDJA 1XNRJ 5ETNA 3U1LA 5IT9Y 3UNGC 4CRJA 3K01A 2JLFA 4UY8T 1SH2A 4N8GA 2NWJA 4CLKA 2WTFA 4OZ2A 4DFJA 4ZP8A 1Q82T 1PGZA 3GPAA 1RTDB 2WBRA 2VICA 3IJOB 2OMLA 2A6MA 3BEGB 2CYYA 1FE4A 1UW9A 3U1MA 2XX7A 3B6BA 1ZTTA 1Z4UA 4GL8A 1Y0HA 2KT2A 2E9TA 3K17A 5C5JA 1MG7A 4IFYB 1Y5NB 2XGQA 4ZVSB 4U7UK 4BDOA 4DSEA 3PFOA 3RTWB 4RXLA 4B9SA 3DYAB 1SYIA 3QRQA 4DEZA 4RW8A 4BCAA 1IXCA 3EVMA 3OSRA 1B46A 3K8WA 1X7VA 1YHQS 3RYLA 5HMZA 4K59A 2XULA 1FKOA 5ESYA 2BEFA 3GYXB 3BGUA 2V0NA 1NSQA 2WW4A 2PE8A 5GADI 4DQSA 1IXKA 2H1YA 3FBEA 3D4JA 1ZYQA 2MKIA 1YGYA 4EF2A 1JMTA 2OTJS 4HE2A 2BKNA 4RA1A 4L6V3 1SUQB 3G3KA 4LRDA 3UORA 4EQ9A 5A2QU 3T9ZA 3TARA 2OEMA 1FQFA 4CLWA 2DNHA 1FPFA 2NUVA 2CQ1A 2V2KA 3E3XA 5CD4A 5HK4A 2AJ1A 2YWFA 4ILMA 2OLWA 1N5SA 1Y9UA 5G0RA 5E41A 1FHTA 2DP8A 4LFCF 3UCGA 3H4DA 1R8AA 4OFOA 3IB2A 1GH8A 4ZECA 2HHSA 4URSA 4Q0CA 1HBOA 1LWEB 1PG5B 1UVJA 1Z7ME 4RBUA 2KM8B 2Z56B 1BQMB 1SC4B 3H6WA 4C9DA 5IGAA 4CT9A 1POTA 3PHTA 4O23A 3VAJA 1S10A 2UP1A 3USDA 5I56B 1LNQA 1WI6A 4Z0IA 3MBPA 2ZJQQ 4YDXA 3AJDA 1P6TA 1N8RT 1XOCA 3N79A 3RBDA 1TL7A 4YB5A 2MQQA 3P49B 2J9DA 4G77A 1XQIA 2FJBB 4MNPA 3QGPA 3SCJE 1DBDA 4LSNB 3MPDA 3UD4P 4X1DA 2WEFA 4KHPJ 4OX6A 4QZVB 3BGRB 4IH7A 2Q6CA 4XK8C 3GR0A 2HHUA 2IA6A 1PBUA 3LR1A 5DS7A 4ZJQA 4ZVHA 3D4CA 4USMA 2D3UA 4C8MA 2LMIA 1U4BA 2RC7A 5H9FK 3MPYA 2P6TA 4ZLPA 4CNZA 2BBEA 1SJQA 4DR6F 1IWAA 4LVQA 3R5DA 3OMBA 4NE4A 1AMFA 1MQJA 1TK0A 3OL7A 5K14A 1W2BR 3A1YG 2HIYA 1N7XA 2LU1A 5A0YB 4RW9B 2XXKA 1H2VZ 4ZITA 5KFQA 1SQYA 1O64A 1A0OB 4ED8A 1E6VA 3KK3A 3SEUA 4HLBA 2RILA 1XMOF 4LREA 5L39A 1S7YA 3OO9A 2HK3A 3OFHA 1KLMA 1NSAA 2XMWA 4N6KA 5CBRA 1S9EA 2BYCA 5SUHA 1NV2A 3E51A 4KFBA 3F44A 4ONYA 4ZEKA 2MJUA 2B6AB 2KXNB 5H8SA 1FPDA 3T9XB 5I42A 1YBAA 3RGYA 2DEJA 3TX8A 4Q2MA 3P96A 1SXLA 3Q22A 1ZMGA 2FHYA 2OWTA 2YLNA 2BE9B 3VVTA 4NF0A 4WYWA 4WFYA 2VKRA 1FX4A 1BQNA 2QSFA 4FN5A 3C3LA 2XX9A 4YY3F 4YKKA 3ZKKA 1JLEB 3S6EA 1MQDA 4OV6A 2H3EB 5KFAA 5KFUA 1O0PA 3Q29A 1FRMA 3H40A 2NXJA 4PG5A 4K0KJ 4HI1A 2ROPA 3RNNA 4NLDA 4N13A 1N32J 1WG1A 1TMJA 2IHR1 5ISUA 3SQGA 3ET6A 1NK4A 2B4LA 3W9IA 3CCWA 3D67A 3WC0A 4OETA 1T94A 3CJ8A 1RYOA 1JETA 1S1UB 3BJYA 2GRVA 2QA1A 1NV7A 3I9V9 5A8RB 4LBIA 4DR7F 2IM3A 2QS3A 4LONB 2ZZVA 4DPUA 1KA0A 2VBZA 2CNNB 3BO4A 1OY8A 2OPSA 2QLXA 4GO5X 3NP5A 4URGA 3O29A 1RLCL 1XMQF 1RT6A 5KT7A 1GMVA 2ZH6A 4S0MA 2RDJA 3A13A 4DR1F 2GZOA 3DRRB 5DZ7A 5CA5A 3KG0A 1P9QC 2H5IB 3ETMA 4USJC 5KFJA 2PT0A 1SI1A 1T95A 4TY8B 2BR0A 3RBXA 3KN7A 1RAJA 4F1UA 4XKPA 2AYSA 2HQIA 2Z2ZA 4PTKA 1BE4A 1I6BA 1R31A 1TQLA 4NCGA 4WF9Q 1KBRA 3FVYA 2BJDA 1B64A 3OOAA 1TKXA 4RBTA 3MVWA 5DVFA 2HNZA 3MECA 4ERDA 1HQEA 5KT3A 7FDRA 3BO3A 4ECXA 3T1AA 4R6HA 4A8YA 2J0SD 2Y7RA 1NPRA 2C2ZB 4OHVA 2CADA 4WE1A 1NJZA 1C0TA 5DVJA 3SDEB 5FLXY 2E9RX 2ZEJA 4DV0J 1MROB 3M32B 2W9BB 2JDJA 2ASLA 2XSFA 3BPSP 3HDSA 5RUBA 2E1CA 3CJ2A 2QG9B 2F7CA 4RY1A 5CCLA 3GIJA 4KCDA 2NYIA 2U1AA 3GLBA 3TQLA 3T0JA 5BR8F 3AJ2A 5HBMB 5D78A 1B6HA 2J9CA 3IK6B 1IXGA 1IKYA 4IO4A 1OO0B 5HPQA 3BYRA 4OZJA 1LV5A 5LL6d 4IFVB 1TUWA 5C2GA 1JW5A 1REVA 3U65A 3T1YJ 3K5PA 1M90T 3R97A 3H25A 2J6TA 1C1CB 2GJFA 2ZBIA 4WKRA 1H45A 4DZ1A 2MQ8A 1U09A 1MN7A 1CJVA 2R7VA 3K2DA 4JSOA 1RT3B 1M1HA 3CSBA 1A99A 1EX8A 1B5JA 4ZPWR 3CDWA 4OI1A 3SCIE 4Q43A 2R9JA 3M2VB 3PPRA 1U24A 5LSLA 5T14A 3U7JA 1EYKA 1F5CA 4QFLA 4Q5VA 1HW8A 4GX4A 3MEDA 2CDQA 2V3TA 4NZ6A 3TZWA 4LIRA 2HK2A 4DV7F 1W2IA 1KRPA 2JLGA 3SETA 1HNWJ 1L3KA 1SL1A 1JLAA 2PX1A 3IFEA 7FD1A 3KLHA 2RCBA 4B08A 1VQ5S 1EQ0A 3UGWA 3GYYA 2WB1D 3BQ2A 3ZZPA 2PN6A 4DL2A 4PFYA 3PUZE 1H6KX 4OHWA 4GWZA 4IQMA 1MXXA 4DL5A 2BM0A 1U1MA 3IBCB 4OLPA 1RE1B 2W2OP 3H4ZA 2EG2A 4F25A 4J9KA 3H90A 1VQ7S 4H6DA 5L8RC 1IMDA 5AXLA 5JEIA 3DP6A 4PFBA 4OJ3A 1FPKA 3H8YA 4N15A 4DX6A 1NV3A 4M5DA 1ROFA 4ZCLA 4HKQA 4PQUA 4YHHF 2FB0A 3HSJA 3UDLA 4Q0BA 1D0EA 1T9YA 3OVSA 4FVMA 1RWMB 3IJXB 3T9UA 1B4HA 3DCAA 2M7SA 1U6ZA 3TYHA 3W7BA 1B05A 2OPPB 1FDAA 3PD9A 3IFCA 4WP3A 3D28A 3TELA 3QSIA 3PPQA 2AL4A 4O7MA 2DIVA 3U94A 1Q8LA 4ES2A 3KBRA 5E7OB 3RT6B 1QUPA 2NOOA 4MLVA 3CCTA 4MJKA 3K8VA 3G82B 3WQPA 4U8VA 1LFPA 3M2UA 1SDXA 1YTVA 2E1MC 4F2QA 2OI2A 2B8QA 1PC3A 2VPYB 1FX2A 2ONRA 4LSLB 4O0NA 3ETOA 4KR0B 2F9JA 3PMWA 3W61A 4NXNF 2ZUGA 2UUAF 3L4BC 1TL1B 2XGPA 1DTZA 1S7HA 3KLVA 1TR0A 3IR5B 1HBMA 1IKVB 2LEBA 3POTB 4AD6A 4E0DA 4HACB 5J2QB 2Z2LA 3FKBA 5E3CA 1C2PA 2GHVC 4NYOA 4HHUA 2QYCA 3W2WB 3SSRA 4CO4A 1RADB 1IVZA 4OEVA 1AZSA 2HWIA 3BGOP 2ASJA 2JSXA 1IKXB 3F73A 2CPHA 3D0IE 2DR8A 1PBAA 3R5AA 4MK9A 4G8NA 1Q35A 3C33A 3M1VA 3SDFA 4TQUQ 2KRRA 2XXWA 3ENWA 1KQKA 3MR5A 5A8KA 1W26A 1OLAA 4HHJA 1LW0B 2KHCA 3MM6A 1RU2A 3EGWB 5D0EA 3VTIA 2W7PA 5GAGU 1QD1A 2BMBA 3Q89A 3BN7A 2WCXA 4ED5A 2DNRA 5HJXA 5H8HA 3UW1A 1SQGA 4ZPTR 3OVAA 3TJAA 1RHJB 4QWCA 2CRLA 4EZ6A 2MSTA 4DUYF 3BB5A 2UXDJ 2XMJA 2BVZA 2EKYA 4JVCA 1YJRA 3AT1B 3OXFA 4WP8A 3UVJA 1SJ1A 1D09B 4U7UD 2P2CB 4L3NA 1U1PA 2DBBA 4ZVOB 1JJ4A 1B51A 2H48B 3W8GA 1UFWA 3MEGA 2R7SA 1D9VA 4MK7A 3JAMY 4FF4A 4YY3J 4WFXA 1XI6A 3MOJB 2GO8A 4Y3CA 3KNGA 2ZBRA 3I5CA 1FDNA 4RUBA 1FBGA 4CIOA 5D0HA 3TRGA 5T3JA 5I57A 3I4HX 4X4OA 4J9LA 2EW9A 3F0NA 4DR5F 4P56A 2FZCB 3M30B 4HTIA 5ET8A 4OYZA 3RU0A 4OYVA 1FKOB 3EHUA 1IMBA 3BN4A 3EDRB 2XYHB 3MP1A 1UFKA 5ELVA 1FKAF 3ZKLA 3MCSA 4RK2A 2CPFA 3EPEA 1LAFE 2RC9A 4O3QA 4W4MA 4P2SA 1X31C 3RW7A 4CP5A 1CG2A 3VGUA 5KFVA 2H98A 3CWJA 1RDXA 2EFQA 3FDSA 3ONMA 4ZCMA 1T9VA 1NNPA 2PMZD 3IRXA 4KPCA 2QGFB 1XIQA 2Y5LA 1RT2A 4UZCA 1AFIA 2R3VA 1EYIA 2X1BA 2QS2A 2OX3A 1IKWB 3PYFA 4HDGA 5G0RB 1I94F 3KG2A 4CLUA 2O7UA 2XMKA 3KG4A 1OMPA 2NREA 2BW7A 4QWEA 5D4NA 2BJ1A 3CTRA 1HBOB 4RJZA 1FFGB 3DLNA 2OGUA 3VAGA 2DR6A 4I40A 2K06A 5IV4A 1SC3B 3CD7A 1B3EA 1MU2A 2L3MA 4RNHA 2ZH2A 3GG1A 3LALA 4DX7A 2EFOA 1FTCA 5KFOA 1X4EA 4DPYA 5KFXA 4JI7J 5GAHU 3W63A 2P2AA 3DHXA 2NUHA 2DKOB 2R42A 5D4PA 4AFFA 3CJSA 1SQEA 2Z57B 4EFAC 4NEDA 3DLEB 3IO1A 2DE2A 3W62A 2AZ1A 3GFYA 3MMAB 4MYUA 5A8WA 5AJ3F 2KM8C 2FLPA 4L72B 1ZTWA 2O84X 4PAKA 3TUZC 4ELOA 3KJTA 4X4QA 1SPBP 4WU2A 1TL7B 1DRZA 3BF4A 2QT7A 3VLWA 4NLSA 4USIA 4BHQA 5DQHA 1QKBA 1VR6A 5BR8J 5DETA 4UZBA 2B51A 4GX3A 4NF4A 2CJQA 3OHAA 4TU7A 4AL5A 3DOLA 2ALUA 3U92A 5JUMA 4B3RF 2UV8A 2ZDOA 1Y4ZB 1UEUA 3KHRA 3IX1A 4YEAA 5J2PB 3OTBA 1WC0A 5H8FA 5IS2A 3K59A 4WXJA 1OJ4A 2B9XA 1VC6A 1SI0A 4GWYA 3VAIA 3A8JA 3S9EA 1VCTA 4TKTA 4LF2A 5ETTA 1NNTA 2W8LA 5K14B 3N5LA 1NPKA 2XQCA 1HW9A 3V6DB 2FIUA 4USHA 4HHHA 1S72S 4DLDA 1VGYA 5J1EA 1E6VB 1QAIA 3KK3B 3B7DA 3MM5A 4KH1B 1T3OA 4DV7J 3HZGA 4IO2A 4TU8A 4P2MA 1WDDA 1RDYA 4GIZA 2E7XA 4LFAJ 1MDQA 1WOSA 4ZPCA 4KFBB 3IBFB 3RRHA 4R2BA 1N52B 5EYGA 1RI7A 1A8FA 3PUWE 3DMJA 1NH8A 1RCOB 5I42B 3MPVA 1KHWA 3QAEA 1A55A 1G1XA 1VFJA 3MZ1A 2KHDA 1WHWA 4BLAA 4NF5A 1XMBA 2AX1A 2CA9A 4DG1B 2M2BA 2M88A 3BFTA 4PFIA 2Q2AA 2BZ2A 2W2MP 4FF3A 4F3BA 1BQNB 3SIPB 2LAOA 3HHGA 1S4EA 2RNEA 4ZDMA 3EICA 1PJ6A 1MXWA 3L9ZA 8ATCB 3PW4A 2XXIA 3TZXA 3DRSA 2W8KA 4MFIA 4O7IA 4ILRA 4OANA 2YH1A 3MUVP 2NXCA 1B7HA 3ET6B 2HS0A 1SVXB 1ZS6A 1CEZA 2DNPA 2F1FA 5AXMA 4JUZA 3TA2A 4ZJLA 4IO7A 3CDAA 4EK2A 2CJKA 1K9YA 4QRZA 1JLGA 3GIIA 4K50A 4JP8A 1N76A 2DHHA 4N6DA 1FJEB 4POWA 1R9QA 3Q8QB 1VDHA 4NXMJ 3NS5A 1HI1A 1KQGB 3RPLB 4M95A 4YFUA 1VMBA 1Y00A 5KG2A 2Z23A 4L76A 1J5OA 2XNQA 1QKAA 4PXEA 2BA9A 4MH5A 3JQJA 3CCJS 1XTZA 5L1JA 2JOQA 3BGFA 2DHAA 2YWHA 2Z8DA 4IY6A 4NCGB 4IY5A 3S9LC 1MLAA 3Q0AA 1YQHA 2N3OA 3B6QA 3JQKA 1TKXB 3B50A 4LR8A 2HNZB 3MECB 1HQEB 2Y0BB 5LJ5Y 4FP9A 1NXIA 4OVJA 4ILLA 3WBZA 2OZZA 1RHMB 2X7QA 4CWBA 1KR4A 1IZ1A 1IR1A 4HR2A 4H8IA 4FZVA 2GQCA 3VVUA 1ZBTA 2WVDA 3KJ7A 4WE1B 1C0TB 2OPQA 2YX7A 4RK9A 3QSLA 5KDTA 4JV2A 2YNHA 1B5HA 3W8PA 4M5HA 2F63A 3TUIC 2JWNA 1QE1A 1F3VA 3BDEA 3I96A 1AOVA 2QMWA 2CZKA 2F9DA 2J5AA 1MXYA 3DOMA 1IKYB 1RWXB 1MMDA 1UWBB 1L3SA 1N33J 1T03A 2DNNA 1OS5A 2MKYA 4CM2A 9ATCB 4EDPA 1REVB 4B3OA 1FBEA 2ROEA 3CIJA 4F39A 5A2QY 4G1PA 2E29A 4KPYA 1BKAA 1GK8A 4RL1A 3L09A 1CJVB 2QZ8A 1SL2A 1XEZA 2KL8A 3QYTA 2HZAA 3AB2B 3ITHA 1HR0J 3PUXE 2VASA 4MFBA 2VDIA 4LQ3A 1ZIUA 3HT0A 2DK2A 3ZZRA 5H9FJ 1WHVA 3DDNA 2FPHX 2GFFA 1JP4A 4R8UA 1MY4A 4Y28C 4RPNA 3TZAA 3TA0A 2YNGB 3FGVA 4NCAA 2E1SA 3DLBA 2MJNA 3HZEA 4H4OA 4CLFA 4DCPB 3PR4A 2QYGA 2IVFB 1JLAB 3D5MA 2UZAA 4NA2A 4LF8F 1FWLA 5IC4B 4O3PA 3ZNUA 5CMBA 2Y5KA 4UABA 3G3GA 1VK3A 4PCDA 2HLTA 1S6OA 1R1NA 3M8YA 2JEIA 1O51A 3EYZA 3OJSA 4U1ZA 4ATNA 2V2ZA 4DV5J 2M8CA 1RWKB 2F4FA 2Y84A 1VFDA 3UWTA 3GFXA 3NKYA 3IR6B 3FZVA 3EXCX 2BQUA 2IJNA 4UQGA 3CR9A 4M5DB 2VPOA 4RJVA 2FDNA 1Q8KA 2EWHA 4PQUB 4Q0BB 1TL3A 2MY8A 5IXUA 1CLFA 2DB1A 4UQTA 4N56A 1VJWA 1RAFB 1OIBA 1HQUA 1N34F 3I0SA 3JTPA 1A40A 5JVGQ 1I1GA 2WAQD 2YKNB 3ZZ0A 1B70B 2OAUA 5ETPA 5EUHA 2XEXA 3C16A 4PBQA 1MWYA 4IOAQ 2NLWA 5KG5A 3K58A 3HI9A 1EIYB 1TP7A 5L9SA 4XDCA 2FZGB 1N36F 4OJHA 4DF8A 4I2PB 4AXJA 3M2UB 3TX0A 4JV5J 2OBGA 3ENVA 4UUWA 1FSAA 3PKMA 2DVIA 1JLFA 2HGMA 1FK9A 4FAJA 4EO6A 1M5EA 1FCAA 1AW0A 4H4KC 1BMQB 2ZZXA 3BBRA 2KT5A 2WOMB 1RA7A 1XVYA 2B9YA 3T9HB 4U67Q 3MMBB 1HBMB 4IG3A 1RHQB 5K8NA 2AP6A 2BE2A 4ZMMA 4WPAA 3BR9A 4ECRA 2HBZB 4NGUA 1M0SA 1B1XA 1MQGA 2J7KA 2GMHA 2OP5A 2BKPA 2X26A 4TY9A 4WFZA 2DS9A 4TNOA 3NGTA 5J2NB 3NGUA 1N5YB 3M1VB 4XTTA 5LOQA 2G0IA 3I4PA 3SYZA 4JBCA 5A8KB 1TFWA 3MM6B 5LSOA 1U1QA 4DE8A 4ZP6A 1LFWA 1QLNA 1V3RA 3UI3A 4EQ7A 4X4VA 3MFHA 2DGQA 3IOWA 2W4PA 3T5JA 4JI6J 5H8HB 1RYSA 1T11A 3SI8A 3LA0A 5ETQA 2FC9A 2HSEB 2V2QA 3DFEA 2KFZA 4MMOA 2H9BA 2G29A 4NEYA 2NUUG 1QVFR 2QLJB 3UVJB 3S9MC 3N28A 4AT1B 3J81U 3BSOA 1LBVA 2ACMA 3MWBA 5GAGI 3TAQA 3MEGB 4YMAA 2HFNA 5DDQC 1LK7A 1I3OB 5F3ZA 2A2DA 3Q23A 3OSNA 3CJ3A 3HFVA 3TQEA 5KAKA 1WWHA 3O28A 2Y0SD 1PC5A 3TZZA 3P3DA 2CNOB 3MTJA 5KG6A 3IWLA 5I5PA 4JOUA 1CC8A 5I57B 4DU7A 1Y4TA 4D3HA 1SJFA 1N5QA 1H7XA 1LQ9A 1P1NA 4XF5A 3RPWA 3L7OA 4CH1A 2V94A 3HVWA 2AYEA 4KXPA 8RUCA 2RHSB 1B0PA 5LMNJ 1NBEB 1WOOA 4NCBA 4TYBA 4F19A 4GOTA 2HQ0A 5B09A 4YB7A 5L38A 1NK8A 2IMWP 4V1Ak 5IZZA 5D77A 3EN3A 4M5JA 3BKIB 1CJUA 2CNLB 2DXEA 3IRXB 2BRKA 1YJTA 1RT2B 2IDEA 1IJFB 4LF7F 1NO8A 2LFVA 1ZPWX 3DGVA 2HVEA 1KA1A 3EQ1A 3J7Z5 2B4PA 4TQSA 3IR1A 2XZTB 1NUZA 5C42A 4IRCA 1JQGA 1D9FA 4NN3A 3CCQS 4F26A 1FJCA 4L3KA 4NEZA 3IO6A 3KWMA 2R7OA 1MU2B 4U22A 3M7VA 1GFWB 3V6JA 3SKPA 4GBVA 2Q74A 1N48A 2NYHA 4ZP7A 3UDEA 1D1UA 1FT8A 3GBAA 2WSFC 4DDDA 4PETA 3T5LA 1ZU0A 2MQLA 1FEEA 1B1HA 1K1SA 5IM0A 4WP9A 1HMVA 3GV7B 5CMCA 2YWGA 2GHAA 3ZZYA 3IR7B 2Y1IA 3HHLD 3QNWB 1U6BA 2IVMA 3HHLB 2RRAA 2PVUA 4JI4J 3H5UA 1D9DA 3Q2TC 2FTRA 4MH8A 4P9KA 5GAEI 4NF4B 3M6UA 2W24A 3NGKA 4ND9A 2U2FA 2HBYB 3DOLB 3PRVA 4OX9J 2VH7A 4V19J 5CYMA 3TI0A 1IUDA 1S0VA 4YN3B 5DT6A 4KGXB 2XWYA 1EP4B 2HIQA 2ALYB 1IMAA 2XBPA 4B3MF 2PI5A 2PA8D 4Y6IA 4ECSA 5H8FB 1FXRA 1R27B 1RUSA 2B7CB 4ETZA 2ZHOA 2I0BA 3WIVA 3C34A 4KC5A 3T5HA 3H6UA 2XMVA 3RB6A 1LFGA 4YZZA 3JSMA 3QO9A 3HXMA 3MUMP 4Q30B 4P72A 1RU1A 3CSGA 4F31B 4CLTA 4XKQA 3CD0A 4CO0A 3G6XA 3PNIA 3CHGA 4WFNQ 5KT5A 1RBLA 5E3RA 1DURA 4DHVA 4BDMA 4DPXA 3NNCA 3MM5B 1S12A 4CLSA 1MSWD 2FIXA 2WRMA 4WK1A 2YJPA 2COLA 4DL7A 1DSNA 5KFBA 1UAWA 4U8YA 3T41A 4XPEA 2ERRA 1P27B 2DOJA 4O3AA 3BV8A 4ZLNA 4KTQA 2JEFA 2Z8FA 4M5GA 3SERA 3FBPA 5J16A 3H98A 2QX0A 3TYTA 1YITS 4IH5A 2V8DA 2OWZA 3UD3P 4WZMA 3KFMA 3HPIA 1C4AA 2D5WA 3MZIA 3OUYA 5EWEA 1KSPA 1HBUA 3KGCA 4DDFA 3UDCA 1HNZJ 4OYAA 4OQOA 1IR2A 4O44A 2WVEA 4F7VA 3LPEA 4H65A 1KC8T 1UP1A 3AFGA 2GA7A 2H51B 1U48A 2VJVA 1FJGJ 1NKXA 1TMMA 1XJWB 4OHYA 1JK9B 3RAXA 4P0GA 1K47A 5I3UA 4KRWA 4NMXA 3DLGA 4A8QA 4EXLA 3KLEA 4RZRA 2R7UA 5EX0A 2OK2A 4LRAA 1JLGB 1FTJA 4J37A 2VG5A 1NMEB 5LJ3Y 1IITA 1VISA 3ILLA 3FJMA 5IT0A 2B0GA 3ISPA 2CZVC 3PMVA 1H2UX 1NCLA 2P9EA 3KOAA 1LAGE 2EPIA 1UIVA 5CHCB 4IB2A 5I59A 4WKMA 4C98A 3CJTA 2RKIA 1J5OB 3M8ZA 3VV2B 3PX4A 1N4LA 2L08A 2YNIA 1J1NA 2AEJA 3VAFA 2DDKA 3BGLA 3MZBA 2AJ4A 3FVKA 1R0AB 4LIWA 1Q86T 3MYUA 2KVIA 2RVJA 2DVCA 2QV6A 3EZUA 1TXFA 4X65J 3IORA 2IRYA 4QPTA 4F2SA 5IV3A 3DLJA 1BK4A 1TZ0A 4JV1A 3I32A 2UUCF 1IBCB 1N3XA 1WELA 1B4SA 4OLOA 5TPAA 4FF1A 3D7SB 3QXMA 5I2KA 2OPQB 4ZLJA 2R2UA 5KDTB 2YNHB 2QL3A 5IOLA 1VS3A 4P8BA 2GVDA 2K7JA 4LF9F 1GX5A 2BV3A 1HL6A 5AE1A 3MM9B 4LZ8A 1LOUA 3CC4S 2DEIA 2B65A 2DWHA 4R0EA 4R5PB 2E5IA 4DR4J 2LKZA 4PXDA 3TANA 4CO5A 4N8NA 1PB7A 3U1OA 1T03B 1FQCA 3FXQA 1WDTA 1GT8A 3P5TL 4NZ7A 2UVIA 4ECZA 5IZ3A 2RE1A 3GQCA 3DN9A 1RKMA 2YY3A 4OHNA 3HM9A 4HTJA 4NZ0A 4B3OB 2Z30B 2QRYA 4F29A 2AT1B 3MEKA 4OYOA 4IO9Q 3SV3A 2QVRA 3Q2SC 4WIQA 4AE5A 4F2RA 2QFIA 1GTKA 4XKNA 4MTPA 1SIZA 4G65A 3ITHB 4QHQA 3CJ0A 5D4LA 3CT9A 1FF2A 2IDLA 4R8UB 1FBHA 2CWXA 2H54B 2O68A 4XTCQ 2DIUA 5EYFA 4ALZA 1QSLA 3CJRA 2VFTA 3EPIA 4AS5A 4H4OB 3RB0A 1NV4A 2DRBA 1XR6A 4DI3D 1ELOA 1KVJA 4FXDA 4YKJA 4WEDA 1YI2S 4ER8A 2KJVA 3VE1B 2FGCA 4ZPBA 1OYEA 5FHOA 5ITPA 3QGGA 3LSFB 1QY7A 3LP2A 4G68C 4ECQA 2QL7B 3CG1A 4LF7J 1UIUA 1H98A 1OPZA 4N91A 1FDDA 2HZVA 4C3KA 2G2YA 1JQFA 3THTA 1P1UA 2HHHJ 2O69A 4J9NA 2ZE2A 1RTDA 4F3MA 1BUXA 3TAPA 3MPKA 4RPOA 2HHTA 1NL5A 4UF4A 4KCCA 2JEJA 3BDPA 3R1HA 3A09A 2ADBA 1Q8IA 3JSYA 4QIVA 3CJ5A 2XHWA 9RUBA 1TL3B 3N01A 3TEHB 3FK4A 1P9YA 2I3VA 1LSTA 4B3SF 5IWAF 1X4DA 3EXYA 3I0SB 1P1QA 2P9CA 4NRTA 3KHLA 2B8PA 4DL3A 5F8MA 2DGUA 2XG8A 3HJFA 4MJOA 3GP9A 3T1HF 5K9FA 3V4MA 1YG0A 3U27A 1F9FA 4EUVA 2IYIA 1CJKA 2OIHA 1S97A 1D9YA 4P1EA 3K89A 4FATA 2ZWPA 1LK5A 3N6LA 2CZHA 1JLFB 3CIMA 4Q5TA 2YX4A 1OQHA 3ADAC 1UVLA 5U47A 1Q16B 3CCSS 2VONA 2H5YA 2RQ4A 4NLXA 2BJJX 2MQMA 4ID8A 2LQBA 1U1KA 3HCXA 1PEBA 2BE2B 3J80Y 2F4VF 4PGNA 2PFZA 3FMBA 2HLUA 2HBRB 3KSJA 2DO0A 2XSJA 2L5VA 1D8ZA 1SJRA 1F9EB 4DSJA 1B0TA 2V84A 4JI5J 1NNDA 3C6TB 2QC3A 2DGOA 4F3OA 2C2MB 2DJWA 2M70A 1NUYA 3B6TA 3NOHA 2ATCB 5A6PA 4HT7A 2D21A 3H3GA 1UCNA 4ECFA 2MKHA 3LOUA 2ZC3A 1S9FA 4U9RA 2MPUA 2XI3A 3SFGA 3V6HA 2W4DA 1S0NA 3KTQA 1KOOA 2ZC4A 3B54A 2KR0A 2AHOB 1FWPA 3K1NA 5M2RA 1FQBA 4RUHA 4OA4A 5I56A 2FBPA 2F3DA 1B7UA 4MIBA 3OXGA 2ZNZA 3CGIA 4J9VA 3X1LB 1IBMJ 1H7WA 1WVJA 2XXHA 4N47A 2FJWA 5E5NA 3EX7B 5AE4A 1MG1A 2YXLA 1IMFA 3PEJA 5CH7B 4I3YA 1OLCA 1IM6A 1DTQA 1RT1B 4B9TA 1NUXA 2MY7A 3W64A 1HFEL 4AQYJ 1FQDA 3FCHA 3FZBA 3ENQA 3MURP 4G1IA 3ECRA 3KZGA 1FPIA 1B7YB 1RYRA 1H3DA 4LF4J 3ROJA 1X4HA 1VHIA 1YVFA 2EFVA 3H5YA 3M05A 4DV3J 2DR9A 2F6GA 3D1HA 1X5TA 2EC0A 2WK4A 1RYXA 2VP1A 3D9BA 5A0YA 4G3IA 2WYKA 5BYQA 4BDQA 1TAQA 1RA6A 1CJUB 1FQEA 4FS2A 3IGVA 3DXBA 2XHDA 3IMQJ 4XFEA 2Y7PA 2MKSA 4YMEA 3G3HA 5B0GA 3FCVA 3UO0A 1U1OA 2J7UA 4DN0A 2Z2YB 3D66A 3MQ9A 4AL7A 1B40A 2YKMB 2ZM6F 1MY0A 3JXOA 3SSSA 2G9OA 4KGVB 1R7IA 1H43A 1EETA 2DRDA 4KYZA 1QDUB 2PD1A 4J91A 1L5UA 3FV2A 2JC0A 5KT2A 4ECUA 3LV0A 2UXBJ 4FVCA 2WB4A 1UZDA 2N4DA 4OX8A 3GIKA 2UUCJ 5BYRA 1Y4CA 3W66A 5AA3A 2B5JA 3PIOQ 4P7TA 2E1AA 4NASA 4KY3A 5DVIA 4K2JA 4KGMA 4C8KA 4Y65A 1FTMA 2RUSA 4GF8A 5IM0B 1HMVB 4YR0A 4UOFA 4YQWA 4X4PA 2VL1A 2J8AA 4LF9J 1S1XA 1NNKA 2AYGA 3AXKA 4LF5F 3KOTA 2DGSA 2BQ3A 1VRUB 1DQ9A 5E3QA 3Q24A 1WI8A 2M9KA 1S5ZA 3MVYA 3R9LA 2D3ZA 3NNHA 4MX6A 3GXAA 3VFJA 1OMSA 1QAYA 2FVZA 4JI3J 1NB7A 3D3CJ 4DSKA 1Y5IB 4PF6A 3MCOA 3AOCA 1DK4A 3H7HB 2F8MA 3V5AA 2BOAA 1MDP1 5CYMB 4HE1A 4H5GA 3HHLC 2ZYOA 1FTOA 1H2TZ 3IBWA 1M5CA 4KD5A 6FD1A 4KGKA 2KT3A 3I56S 2L9DA 4FECA 4C4WA 1QJMA 4H67A 5T7LB 3RYDA 4OEUA 4MF3A 5KFGA 4AUKA 1SIWB 3I82A 4TU9A 3JSMB 3QO9B 3TMGA 1UVMA 3ZC4A 5L9MA 1IJEB 1FJ7A 4LMZA 4M8LA 1VE4A 1M5BA 2BQRA 3CC7S 1NUEA 4X84A 2ILYA 1WACA 2X3DA 2QJ3A 2WSCC 5CYJA 2KFYA 5LM7E 1U2FA 4KV8B 1VFEA 2C3PA 3J7A1 1CS4B 2RCAA 3MDFA 1H44A 4WJBA 4Y2CA 4W90B 4OWDA 4J9PA 4Z2XA 3MR6A 1RWPB 4LF6J 3FGSA 2J6UA 2KFNA 2PMSA 2YVSA 3GV5B 2Y8WA 4OYWA 1K9MT 1T0TV 3OV7A 2NZ4A 2F3BA 3H4BA 4ZEBA 2XM3A 1IR0A 3SDEA 4F4XA 1LFIA 3RR7A 4R25A 3FXBA 3M32A 2W9BA 2LYVA 2FLLA 2O01C 3LP1A 4DUZJ 2HAFA 4WK3A 3D0HE 2I6WA 3FVNA 3I87A 2AGQA 1HBUB 1HNIB 2B56A 1TVRB 1VQ9S 4USVA 4KHPF 4JI0J 4O44B 1AIVA 5HMWA 2IFXA 4ZPAA 3OLBA 1VQYA 4R9GA 5E3PA 3W1YC 2YQ3A 2FVQA 1FPEA 3RG6A 2HG4A 4RW6B 3CUNA 2IBOA 4MKVA 1UTHA 4YICA 2OEKA 2AV5A 4RNSA 5IWAJ 1PIEA 1AWBA 5I3UB 2ROGA 3DLGB 3BR8A 3HSTA 3CG3A 1TELA 2XXYA 5KFZA 2I49A 2V4CA 2HFVA 5CD4H 2LXFA 2XO7A 4BWJA 3OJUA 1RTHA 2VG5B 2OJ3A 3GV8B 2GJIA 5B70A 5D6GA 4ED3A 4ZCIA 3PUVE 3O6IA 5ETRA 3O1LA 4H54A 3QT5A 1D4NA 1FTAA 4NHBA 1F0XA 3DM2A 1AFJA 4WTOB 2Y1RI 1RSCA 3AOAA 2RKIB 2G13A 3LSLA 2GC8A 3SEVA 2YNIB 2AGPA 1A6LA 3L7PA 4ETXA 1U2CA 1EYJA 3E13X 4PE3A 3CCZA 5A6WA 3LUYA 4OESA 2HZCA 3PD8A 2D41A 2X7IA 3RRKA 3B8HA 1HSJA 1J5EJ 2F7AA 1FRPA 2I9SA 1K8AT 3CDBA 1GV8A 3TKDA 3ZZOA 1G0IA 3G6YA 4U4SA 3SMZA 1QTMA 3TTNA 1CPZA 3GIMA 2ZKTA 2I4CA 2R8KA 2YH0A 3WX4A 3AXFA 1WEYA 3ISZA 1O5JA 1YRXA 5I2KB 3PEHA 1NSPA 2R7QA 3OBIA 5L8DA 4ZS6A 4CDIA 3QT8A 1U1RA 3CCVS 4K0KF 1SBRA 3V6KA 3IC1A 3G71S 1RAOA 4ZP9A 1FW0A 1RP5A 4ES1A 3OTOJ 4BDNA 3F41A 5FHNA 3NY0A 2OPPA 2YPYA 2QMUB 1KNZA 5KFKA 2CXEA 1PBQA 4OJGA 2HCAA 1NKBA 3VVDA 2DVZA 3AB4B 1A7GE 3KNAA 2UVVA 4FKYA 2UVJA 5IZ3B 3B4MA 2CQHA 4K4VA 4DN9A 4ZVEA 2WONA 2FVRA 3IAS9 4ZVQB 4J9QA 3RQTA 3CRBA 2ALZA 2JJ4D 3EHTA 4RR5A 3R6LB 1FXDA 2EFGA 1TU0B 4PDHA 3PTYA 1GXUA 3JS9A 3EE3A 4OIXA 3GTYX 2AZ3A 5DRKA 1NJYA 3N6NA 2V4JA 4DL6A 3EKIA 4DCYA 4HACA 4PUOB 2XX8A 5CC2A 2YKQA 2D3OR 4OVPA 2IM2A 4QWDA 2KRBA 4F3QA 2JFKA 1B2HA 3CSKA 4X64J 1US4A 3W2WA 4EYIB 3HKWA 1HWUA 4FDFA 5IT9U 2M8HA 1IQTA 3JB9k 4DR2J 3ULHA 2VG7A 4ISUA 3EPGA 3VGSA 3R8YA 2J6SA 4DV0F 4PZVA 1M5DA 4P2FA 2MZ1A 1X4AA 2WKYA 3DLLQ 3LP2B 5DDOC 3E3KA 1R9LA 1XR7A 4QWAA 2OFGX 2CJXB 5H1SV 4DS4A 3SEWA 1NEEA 4USUA 1RLDA 5JJBA 3T66A 4PC9A 5FD1A 1RABB 1HSLA 4CQ1A 2KKHA 2ZE2B 5B7WA 2PDAA 1WODA 2ZM6J 4X8RA 2BE7D 2HVZA 5HVHA 2BW2A 2ZYKA 5EQ8A 3K5NA 1BP5A 2CKWA 2DH9A 3LO3A 4CLYA 4EGLA 4DFMA 4K5RA 4DX8H 3T1YF 4X04A 1N0UA 3PYEA 2HQGA 3BBFA 3H6TA 4KBIA 1M5HA 3B8BA 2MLYA 2VODA 2GGPA 5DQGA 2QSWA 2LLZA 1Q9DA 4E0XA 4F4AA 4R9FA 2MGZA 1RWWB 1DTGA 3T6JA 3N6MA 5DTBA 2FHJD 3ISND 1KKHA 1UTAA 2N4CA 1FQAA 1VC5A 4LP2B 1YCJA 2XHCA 4RU2A 4P1LA 3CCMS 3M30A 3IN5A 4DXBA