2QN6B

Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the gtp and the gdp states
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
90
Chain Sequence
KVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 29
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 2qn6B00
3QSYB 1YZ7A 2QMUB 3CW2C 1Q8KA 2QN6B 2AHOB 1YZ6A 3J81j
chains in the Genus database with same CATH superfamily
3GONA 4DSKA 5K20B 1EAYC 1U0SA 2R8JA 3PJ9A 2D3OR 1UEUA 4DV7F 2J7WA 2AIRB 5KFYA 1QUPA 1VMBA 2VASA 3KLVA 2OP5A 1N48A 1IJFB 4ZCMA 3D28A 3RRGA 3OUYA 4CLSA 4DR6F 4WPAA 1QY7A 4NL5A 4DPTA 4F0HA 1TVRB 4DSFA 2HQGA 4O0IA 1NSQA 2QA4S 1RP5A 1FRXA 1ZM3A 4HDGA 1WDDA 3DMJA 4LF9J 3WQPA 4QOTA 2XSJB 5CZXA 2CWKA 3SQGA 1BMQB 1CPZA 4PEOA 1NM2A 3P5TL 2DEJA 3GJQB 1CS4A 4PZVA 5KFPA 4ZPCA 1K47A 1AROP 4DZ6A 2FY8A 3MPWA 4KT0C 5C2GA 2BJ7A 4NLSA 5SUHA 3W8GA 1X4AA 1YITS 2AJ1A 4IFVB 4PAAA 1U09A 4KH0B 3JSMA 5F8LA 4FF2A 4WWSA 5KFNA 2FJAB 2D7SA 4FKYA 3DCAA 3HMJG 3TAPA 2LQ8A 1M90T 3L95X 2HQCA 3J81U 2JFDA 3KG4A 4C0HA 4LF6J 2Q79A 4UW2A 2G0JA 4R5PA 4DF4A 1Z1ZA 2KT5A 1C2PA 4WP8A 3FZBA 1ZTTA 4ECVA 5IT9U 5DG8A 1YWXA 1YBUA 1XN9A 2I6WA 1OMSA 4V19X 2C22A 2YQ3A 5KOWA 4HH0A 3UN2A 1SJFA 4P2FA 2WVFA 2YNFA 1EZZB 3M2RB 4KYZA 1BQXA 4F50A 1W2IA 1CVJA 4C3KA 2FJEB 4QIFA 3PHTA 3CEDA 3ZC4A 4K4VA 1JIHA 3ILJA 3U02A 4EEYA 4OV1A 5HMYA 2J6UA 2DH8A 4LFAJ 5HQLA 2AJ0A 2DHXA 1AW0A 2HQFA 2VC1A 3RR7A 4LRFA 3WHIA 1BLUA 2MZSA 3DGPA 1VQ9S 1RISA 2W25A 2X3DA 1OQ3A 1YG0A 1HBUB 2HNZA 3LW5C 3W9JA 2BACA 2RVJA 3MR3A 4IQMA 3N01A 2KKHA 4WFNQ 4TYBA 5ETKA 2BE9B 1HBOA 4CDIA 3MMBB 2D69A 2YPYA 1DBDA 2JHEA 2M0GB 3OW2R 3NBPB 2PEBA 4DV6J 3IG1B 4MK9A 4NLXA 3MECA 1B3TA 2Z30B 1HBMB 2XHCA 3VQTA 1O0PA 3EVWA 2QC3A 3M2VA 3V81A 3BJYA 4QR1A 3CCVS 2ADCA 2ZDOA 1RT5A 2GX8A 3BM7A 3T41A 3GFHA 4IR9A 3BB5A 5KFLA 2KHCA 5KT7A 2W2QP 3CD7A 3ET6A 1FD2A 3V2UC 2QTWA 1KFSA 2DBBA 2FB0A 2UUAF 5GVQA 2CPXA 1XNQF 1Z4UA 3D54A 3U1NA 2FDNA 4CLYA 1RBAA 3PYFA 3CDAA 1U1KA 5RUBA 1C4CA 3GU0A 2DK2A 5HJYA 2K1RB 1FX4A 1S49A 2Y1RI 4HR2A 1Y10A 4DFPA 4U7UK 4LR8A 1PAUB 4OHVA 2J9DA 4Y2CA 3EZOA 1VQPS 4NZ0A 1GXTA 2BW2A 4ZPWR 3J81Y 4MIWA 3THTA 1YI2S 2VPWB 3BGLA 2GMLA 1VQSA 2VG5B 3MM8B 5IT9Y 1HYSB 2YNHB 2Q1LA 2LQ5A 3POTB 4M1KA 2J0WA 1G7CB 2LEPA 3MD1A 1HI0P 1R6VA 3AD9C 2E66A 3TJAA 1Z2ZA 2LXIA 3PVXA 4GO7X 3MUTP 1KOOA 4ZS6A 1LWEB 2DGUA 3LPYA 4WU2A 3Q24A 1TVRA 1VQ6S 1G2EA 3DLKA 1VQMS 5E3AA 3J7YU 1Q8LA 4BBYA 3QGIA 4CNYA 1QSLA 5GAHU 2D1CA 1EJ7L 2ZDPA 2HQIA 2D9PA 2OPRA 3FK4A 2B8PA 4BDPA 1YX2A 3LAMA 3M7VA 1IBKF 4UT4A 4DPUA 1XERA 4NYPA 5HQMA 2A2CA 2VJUA 3UN5A 2PSZA 4IOAQ 3FDSA 1VBKA 2G0CA 4JI7J 2KJWA 1S97A 2CYYA 4URSA 3NG8A 1FI4A 4W4MA 3IFEA 4IFVA 4NLVA 2RH3A 4DR7J 1EETB 2IVFB 2W7OA 4P75A 1VQ5S 2MDAA 4YMEA 3TOQA 2KU7A 1Q5VA 4CLTA 4JI3F 4DLGA 4M5JA 3TEGA 1YRUA 1FK9B 1N5SA 2C3PA 2WONB 2B4OA 3CDUA 1H6KX 1B0PA 1F9EB 4IR1A 1RBLA 2Y1JA 3I31A 2OPQB 1EKRA 4YR3A 4UOCA 2E5HA 3LGMA 3MPUB 1IR1A 3CSKA 4IO9Q 7FDRA 1S77D 4USMA 3GMGA 3AHPA 2OFHX 1IBMF 3CUNA 1JJ2R 1AXQA 5LSOA 1YVFA 3OSNA 3M2RA 3KHHA 2DR8A 1S0MA 2JFKA 3SSRA 2CAJA 3KFWX 2WK4A 4LRAA 5J1EB 2DHGA 3TANA 5I42A 3RTVA 5KT4A 3RW7A 4F4XA 4JI4J 4CCHA 2GJ2A 1RAHB 1UTAA 1KHWA 3US5A 3Q8RB 5DO2A 2EKNA 2L9DA 1MLAA 2D41A 2AX1A 3I87A 3QT7A 4JV0A 2IFXA 1RBOB 1L3SA 4ZVRB 2JVOA 2BJEA 3BREA 1YJNS 3SMZA 2ASDA 3GIJA 3PDNA 5D8HB 3HFZB 3WC0A 5KFWA 4A8WA 3NNCA 2RF2B 1HBUA 3GYGA 4P9SA 2EG2A 3EXCX 1S7HA 4ZPDA 4TY9A 3QAUA 3PKMA 2MZ1A 5ETQA 1KP6A 2C2MB 2F3JA 5B0EA 3KUGA 2KT3A 4QWCA 1VC0A 3MMBA 2PD1A 2VBYA 5IWAF 3G71S 2A10A 3BGFA 4RPFA 3NBPA 5U47A 3FMBA 4QWAA 1C4AA 1U0HB 1R27B 4LF8J 5C42B 4FYXB 3IG1A 4YB6A 5D4OA 2GQQA 3AAWB 3CPWR 3TAMB 2DY1A 1HBMA 4OHZA 1VJWA 1S0NA 4XIUA 4HI1A 3A3NB 3M6VA 3K8VA 3D66A 2OPPB 3NCRA 4ANDA 2R8IA 3E8OA 2QJ3A 4K4UA 2VODA 5DJBA 4CM2A 1VLYA 5E5NA 1X4BA 4WK3A 3W5ZA 2HAIA 2FGCA 5IQQA 2VC0A 4C8NA 3CDWA 4DV3J 4GVLA 1GK8A 2XHWA 2K1RA 3U1LA 4J5OA 1Q81T 2XZTB 3D1OA 5K8PA 4K4SA 1LXNA 4EUVA 4DFJA 2RQ4A 1LWXA 2E44A 3MHYA 2DGWA 2MYFA 2E9ZA 3KMQA 4AYBD 1FTCA 2VG5A 2M8DB 3MM8A 3ILLA 3B4MA 1SH2A 3B82A 2VHGA 2YNHA 1HD1A 3POTA 5KT5A 3FZ2A 3P45B 3AODA 4LIRA 2NREA 1GXLA 1WI8A 5EWGA 3NGTA 1MWYA 3TA1A 3V4IB 4IH5A 4NOHA 4AL5A 4Q45A 1WNEA 1H3DA 4K2XA 2HFZA 3MZIA 4LVNP 3TZWA 2OH2A 4FBUA 1LWEA 5F0UA 1HNWJ 4IH6A 3C8YA 3DYAB 3KK2B 3CJ3A 4KHRA 2ZOMA 2KH9A 2IRXA 2DNZA 1MNEA 3GB0A 1EHWA 1DLOA 4WZQA 3VGSA 1Y5IB 2FHJD 5L9NA 4RBTA 4DR5J 2ZUAA 2C2DA 4ZP9A 1WORA 2R7UA 2KFZA 4BWJA 1F0XA 1OPIA 4B3TJ 5ITHA 4XAKA 2DGSA 2MZQA 3W7BA 1Q0NA 1H2UX 3QT5A 3EICA 1RTHB 1LK5A 2CZ4A 3PFOA 1EETA 2XMUA 2W4CA 1IXKA 3TQ1A 2OELA 3BYPA 1PAEX 1U1RA 2NQPA 2G0IA 4OX8A 3DLBA 2GC8A 1DQ9A 3TAQA 4C4WA 1FK9A 4PRFA 2WONA 3CJ0A 4CLUA 1X8DA 2XY7A 2OPQA 1URNA 4EZ9A 3KHRA 1KOHA 4C3LA 2C2NA 3R1LA 2BDPA 4F04B 3QO9A 3NKYA 1RWUA 1FXRA 3UQSA 3NS5A 5J2NB 5A6PA 3CCWA 1FA0A 3OVBA 3FSXA 1S1TB 2B9WA 2UVRA 1AFJA 1RLCL 1KVKA 4CLZA 1ZZFA 3PM9A 4USWA 4TKTA 4OZ1A 1XMQJ 1VCTA 1TAUA 2CQPA 1KHVA 3H42A 1WHWA 3C66A 3OFHA 5CABA 4OYMA 4FXWA 5E0OA 5A8KB 3L4BC 4A8SA 4J9RA 1Q8IA 1WOPA 2BKPA 2CPDA 3CF5Q 3RBEA 2RF2A 1DQ8A 4RW8B 1I94F 1TKXB 4DV4F 1UZDA 5ETRA 4ELUA 3PW2A 1VQ8S 2HRUA 1OYDA 1K8AT 3K7RA 5DDPC 3EYZA 3DKDA 3VZHA 4Z37A 1VGYA 4FDFA 2W9CB 1UFKA 4GVBB 4A48A 4ER8A 1KEKA 2YTCA 2YY3A 1U0HA 1H0HB 3TP2A 5C42A 1EKSA 1B7FA 2MKSA 1K9MT 4V19J 3CCES 2L9NA 4J9UE 3G9CA 3HP6A 1NJXA 3C16B 5AJ3J 2KN4A 4X62J 3R97A 4Y2KA 4NCAA 3HO1A 3L9ZA 2POKA 3SQOP 2OIHA 2DJWA 4YHHF 1GQEA 2KL8A 4O23A 2M70A 4UOGA 2ZZTA 2Z2ZA 3M8PB 1TMJA 1RAAB 5K8NA 1RTIB 3MD3A 1Y9OA 2E7WA 3KNAA 2CJQA 2C3MA 3W1YC 1SH0A 1RTDB 4B9LA 4RJVA 1F2GA 4OFZA 1RWPB 3WX4A 1GTHA 2XS2A 3QGGA 1DJ0A 3U7JA 3QZ8A 2QA4G 2CJYB 2MQMA 3M1VB 1KFDA 3UNYA 1RJJA 2IMOA 2R2UA 4NLQA 2RU3A 4Z7CA 2AU0A 2NPFA 5KG0A 4OZJA 2KM8B 3ETOA 4KQZA 3H5YA 4CO0A 4UTGA 1N32F 1OQ6A 1B4SA 4XTTA 5MLCV 1BE4A 2R8HA 3LOUA 1RHJB 3FCHA 2AGOA 4NWBA 1E6YB 3ZZTA 2RMLA 2DPJA 2IDLA 5ETLA 4CH7A 4U6PA 4IRCA 3V4IA 1HR0J 4MAKA 2EI5A 4DV5F 4WIIA 4QU7A 4EO6A 1M5KC 5I3UB 3LH2S 4ED8A 5KFEA 2NPIA 2ABYA 1ACMB 3B4DA 5IT4A 3NGUA 2XZWA 1HWLA 3KK2A 3DYAA 1PKUA 3NCPA 5KFHA 2EFNA 2CJKA 2I0XA 1X5OA 2V8VA 5D78A 3BH6B 2Q6CA 5F41A 4JP8A 2BBEA 3VVTA 2DHHA 4PG8A 1VRQC 1LXJA 1I6JA 1DTQB 5ETNA 1GMUA 4K4ZA 3F44A 4DN0A 2YH0A 5DRKA 2EK1A 4I6YA 1QVFR 3MPYA 3PZPA 1CJUB 2VH7A 3AOBA 2J8SA 2JX2A 3KTQA 1ZZNA 2AEFA 1GXUA 3P49B 2R7OA 2CQ3A 1N88A 1RTHA 4OMFG 2ZVIA 4O3QA 1WHYA 4WFXA 3VQSA 3O5TB 2VFTA 1QAXA 4R25A 5KFZA 3RZAA 5DLGA 1N56A 3FJ2A 1RT3B 4LFBF 2HIQA 2LXFA 3H2VE 3CT9A 2G13A 3UI3A 2MTLA 3KG0A 1YZ7A 1MU2B 2MQPA 5LMNF 4I68A 2CQDA 3I6PA 2H1YA 4G3IA 1RTJB 4DV2F 2DR9A 2OKQA 4FF4A 5KG4A 3T9ZA 4P72A 1SL1A 3TRGA 1UETA 4JI3J 4WYLA 4UOHA 1FEHA 5J2NA 4U8YA 5K14B 3MTJA 4I6AA 1R8CA 1T9WA 1X9WA 2MLYA 2PO4A 5B7WA 5I3PA 3I5CA 3TI0A 1S1TA 3OSPA 2AF6A 2FJWA 3VAIA 3K89A 3SZ2A 4NLDA 4EO8A 4C3MA 1KTQA 4ES2A 3AD7C 4ECWA 2XCAA 4K59A 1CQMA 2NUUG 3T1HF 4OQJA 2FZCB 5A8KA 4ENOA 1KQGB 2QLBB 2QN6B 2RQCA 3IR5B 1D9DA 5GMDA 1QLNA 1TP7A 3HJFA 4B3MJ 4RW8A 3EM1A 3E2EA 1TFYA 1TKXA 2H5IB 1B7YB 4KGXB 3NS6A 3H8YA 2OGUA 2NSCA 4OYIA 1H72C 4DQQA 1GFWB 2XTJP 3FC9A 2W9CA 2P8IA 3ENAA 3ZTOA 4GVBA 1LWFB 2BM0A 4XPEA 3BSCA 2CJ9A 3MAHA 2HGLA 4Q8EA 3PEHA 4MKYA 4FVCA 3C16A 4ZCIA 1WD6A 2AW0A 4DR4F 4CLLA 4QW8A 4F3QA 1DURA 1TUWA 5LXYA 1IBLJ 2ZE2B 1T03B 1HHTP 3CJKA 1WKKA 4UUWA 2CKWA 1S12A 4H4KA 1SKSA 4CLFA 3UD4P 3M8PA 2ZEJA 1FRHA 4PWUA 4RNMA 2D3O1 1RTIA 2VQEJ 2UUTA 4QPXA 4WKYA 1RWWB 1RTDA 3HK2A 3CCZA 2VBWA 1T11A 3OL9A 4QYRA 1Q86T 2VUGA 4QJVA 4B9SA 4WTOB 4I1TA 1X4HA 1K0TA 1Q8BA 2RAQA 3I0SA 3HZGA 4H4KC 3M1VA 2BABA 1ZPVA 1HPZB 3R7BB 5BYRA 4UY8T 2VKZG 3J7AN 2EFGA 1SC1B 1X7VA 4I7FB 4EI2A 1HKAA 2WZ1A 1OY8A 3VAKA 1QTNB 2LA4A 3UVJB 3HFKA 1L3VA 1WSRA 3M6WA 4RNNA 1SJ4P 3R5AA 1KDNA 3C14B 1E6YA 4EK2A 2KM8C 2IYIA 4BS2A 3DXBA 4CNZA 4RUBA 1SKRA 1NBEB 3NP5A 5I3UA 2B56A 4P73A 1RA6A 4ZHRB 3EGNA 4DHVA 5D4LA 2FY1A 3FSYA 4U7CA 3NNAA 2LQJA 4CH1A 2HHVA 3N0VA 1YHQS 2V4RA 4HHUA 1T7PA 3KJVB 3UDVA 4HYKA 1HNZJ 3D3CJ 2VJVA 4DUZJ 1REGX 1ROFA 4ZN1A 4QWBA 4EFAC 3HSDA 1DTQA 4ZVUB 1NZAA 4TQRA 3HD1A 1QDUB 4ZJQA 4QYZK 4QZVB 3D6HB 1SXLA 4Y0FA 4IFYB 1C1CB 5C24B 1SJ3P 2E7XA 1QD1A 4P52A 1CJUA 3JTNA 2MY8A 2MQOA 3BR9A 1TUGB 4J9NA 3HSGA 2WVDA 4K4YA 3GQCA 3WDOA 1X5TA 4IKAA 1RLDA 1WOOA 2FJBB 2DH7A 1RT3A 2DCLA 4DPXA 3R1HA 1BXNA 1YRXA 3EJMA 4HHJA 1KRPA 3H90A 1MU2A 3OT9A 3CCTA 4ED5A 2ZITA 3KXDA 3DDNA 2E5JA 3MTKA 2RDJA 1RTJA 2X3GA 4DR3J 4OYBA 2HRYA 1XNRJ 4RKUC 5CYMB 3RGIA 4WTYA 1ZA1B 3RB3A 4F0KA 1WJ9A 5KAKA 2EFQA 1R6YA 2BJ1A 3G4SS 3I0RB 1DTTB 4RO0A 2MKHA 5DETA 4CTAB 2CJAA 2UVVA 1U48A 1F2HA 5GADI 4JI8J 4X4TA 3BF4A 1HWJA 2FHOB 2VOOA 4JI6F 2ALYB 4I2PB 4ZIVA 4IQXA 3J7A1 4DQSA 4A8FA 1CBKA 1FWPA 3KK3B 1SB6A 4QIGA 4BLGA 3ZZZA 5LOQA 2O3DA 4RL1A 1EP4B 2M2BA 2UVUA 3DU6A 1S6QB 4M94A 2ATLA 5KFXA 1LW2B 3OTEA 3H5XA 2MQQA 4G1PA 5C7PA 5L9XA 4LRDA 1VS3A 4K4XA 3D1HA 1DY3A 1KC8T 3DI6A 2BEFA 1XR6A 5T14A 2GV1A 4QR2A 2HHQA 3PFEA 2KRBA 4LF5J 2C1EB 2ZH5A 4MIBA 1MWZA 3CDEA 2I38A 1U8SA 2MEWA 3CCJS 5I4MA 1LWFA 1I94J 4LMZA 1O6XA 3M05A 2O67A 4DV4J 2ERRA 1VQOS 3JSYA 1OS5A 3BQ2A 2MLXA 4LUBA 4DX6A 1RT4B 4PR6A 3OLAA 4LBHA 3V6DA 1PJ7A 4WP3A 5K8MA 1VBZA 4NLPA 3MM7B 1V3ZA 5LMUJ 1XK8A 2ZE2A 1T03A 2XYGB 1RT1B 1SUQB 2OHDA 1B70B 5L1LA 3HHLB 3HVAA 2EEYA 2FJVA 1D8YA 5LXRA 1WELA 2HK3A 2COLA 1PCAA 3JYTB 1N36F 5F3ZA 2ZH4A 1XMOJ 4CT9A 5KG3A 4AQYJ 5C25B 1REVB 3PYDA 4WK1A 3D0HE 1U7LA 4WU3A 1FJGF 3FBBA 3VVUA 4ZITA 1NHUA 2DRBA 2C2RA 2Z8QA 4PKDB 3PXGa 2R7TA 4X4PA 3X1LB 4I7FA 5KFOA 3WX8A 3W5YA 3OBIA 4CWBA 1MN7A 2ILYA 2B43A 1LWCB 3QGPA 3M32B 3BDEA 3CO0P 1Y3JA 4TLQA 3UVJA 5IFMA 1SC6A 3ELHA 1QAIA 4EZ6A 4X4NA 4CYUB 3C14A 3GWCA 3UN3A 5KFIA 4A8MP 5E33A 4KIAA 2X1FA 1YJ9S 3TUJC 3M8WA 5KFBA 2QEXS 1EARA 2F8EX 2V50A 1D8ZA 2DNMA 4ZHRA 3K59A 1TV6B 2JEFA 3PY8A 5L1IA 3H4DA 4CLKA 1HWUA 2EC2A 2YWHA 3MMJA 3ILIA 1EQ0A 3KJVA 4J9PA 1K0VA 2K7KA 4LF9F 2EKYA 3WIVA 2HHTA 4DSLA 2PT0A 2JLEA 2DPIA 5HN0A 3MWBA 1RHQB 3NGKA 4IFYA 1C1CA 3HXMA 5C24A 4NMLA 1NAQA 2LCWA 3CIZA 1QSSA 1PILA 3IM8A 3CJRA 1U24A 2VONA 5FDLB 2DNNA 4EGLA 2A0FB 1VC6A 3E01B 3IR7B 4C8YA 3PV8A 1NKCA 1SIZA 1F3FA 4F25A 2ZM6J 1GMVA 3PR5B 2HFNA 5BYSA 3HVWA 2XM3A 4TNOA 3GJRB 5HI7A 1RXOB 1OYEA 5B0GA 5L8RC 1JJ4A 4USTA 4LF6F 3MM5A 2K8GA 2HVEA 1WTFA 4I56A 2H3EB 2IJRA 5CYMA 4Y2AA 5HO4A 4LFBJ 1N8RT 1A6LA 2E29A 3I0RA 2CPZA 3G82B 1DTTA 2UXBF 1PJ5A 1DZ5A 1ICEB 4NMXA 4CTAA 4M5HA 5HROB 1AT1B 4IYQA 2OMOA 2ZWOA 3KNGA 5ADZA 2HAFA 2W24A 2KO1A 3D3BJ 4I2PA 1R43A 3Q8VA 2CQ2A 3T9NA 1MMLA 3KK3A 3GFYA 1EP4A 4QCLA 1S6QA 4KKOA 3I9ZA 2PE8A 1HW9A 1LW2A 4QYZJ 1HA1A 1WWHA 3HSZA 3NLCA 2RQMA 1VQYA 3CCUS 2NZ4A 4F7VA 1VDHA 1WUUA 2YX1A 3KLEA 2HMIB 4PYDA 3E51A 1YJWS 2YBVA 4USHA 3QSYB 2IVYA 1CC7A 2J0QD 3PYGA 3ISZA 1FJEB 4GC7A 3FCWA 4IH7A 4JV1A 1VQ4S 1FVSA 2CWXA 1EIYB 2HIYA 1JLGB 2B3TB 4DV6F 1YJRA 5B0CA 2E7VA 3CJSA 3THVA 3VTIA 1RT4A 2DXFA 2Y0BB 3GIMA 1UJ4A 4ZLLA 1WEZA 3MM7A 2CG8A 4MH8A 1HW8A 3OJSA 4DR1J 2JZ5A 3CB4A 4I4BA 1SUQA 1XR7A 5IC4B 2CQIA 1WC6A 3HHLA 2UUWA 4MKBA 3BPDA 4OYAA 3K58A 2Q43A 3R5DA 2GO9A 3RR8A 3QIPB 5JVGQ 3TUIC 1YK9A 1HQ2A 1JK9B 3OR2B 3JYTA 2YNGB 4E2FB 1N5YB 1FDAA 5HMWA 2WB1D 2FIUA 4DX5A 2ZH7A 4NA3A 2V34A 5C25A 1REVA 4OHXA 3HPOA 4HT7A 2GHVC 2GQ2A 3VALA 3QT6A 4DDFA 2QE5A 3K57A 1RGVA 2DHAA 5L1JA 1PYTA 5ETVA 3TR5A 2GFFA 3QZ7A 1H2VZ 2P9CA 1LWCA 2AQ4A 3M32A 5D0EA 2ZBPA 2KB2A 4A8KA 1TL4A 1KSPA 4OJ1A 3DLJA 1H7WA 1VLOA 3GIIA 5E3RA 2W9BB 3CULA 2J76E 4L75A 1F1BB 2BKOA 4DEZA 2XC9A 3OL8A 2X1GA 1NDCA 3N4WA 2HEKA 1QM9A 5IT0A 4J91A 4YFUA 2YWGA 3HT0A 5CZVA 2AYMA 1TV6A 2ZC4A 5LSLA 4ITSA 3Q8SB 2MXYA 2K06A 1X0FA 3P6YC 3I4HX 3LUYA 3F56A 2J0XA 3R9LA 4FZVA 4DU8A 1S0OA 4NX9A 2E1AA 3M8ZA 3FKBA 1M5PC 2HHSA 2VICA 2F8MA 1HI1A 2DGOA 3R7NB 1N54B 3F41A 3GCXP 3ZZYA 4DQIA 4AL7A 2W4PA 2E1RA 2QMUB 2K2PA 2HPUA 3J7Z5 2FC8A 3C15B 2Y8YA 4HDHA 2VA3A 1FRJA 1AYEA 4MT1A 2NXEA 3AJ2A 5ETTA 1NK0A 3TVKA 5IZHA 4JI7F 4ALZA 2DO0A 1U47A 1DFDA 5FDLA 1OIAA 4UQGA 3NOGA 3LWMA 2ZHBA 4PXDA 3E01A 3M2UB 2FLOA 4KY3A 4K0KF 1X9SA 3PW7A 1H7XA 3D68A 4I64A 3ISND 2KTQA 4ZMMA 1N5TA 5B0BA 1JLEB 1G4CA 2GHPA 5H9EJ 3TYTA 1S99A 3KLIA 3UR0A 2R7SA 1N52B 2UZAA 4FYWB 5DQIA 1CQNA 3M8YA 1RCOB 3SCKE 5DDQC 4G6VB 4XO0A 1UPPA 1CEZA 3EMTA 2G9OA 1NO8A 2RRAA 2E9TA 2MY7A 4AFFA 3G82A 5KG6A 3QLHB 4Q7AA 4EBEA 1U49A 2XNRA 4R5PB 4M5DB 3CDBA 4IRKA 3HZEA 3LANA 2J0SD 4NA1A 3KYLA 1NK6A 5HBMA 4ES1A 2BRKA 1YJUA 2CNLB 5SZTA 5HROA 1IJEB 1RT7B 2EFPA 4JI4F 3OXLA 2KFNA 1P9QC 4X2BA 4MKVA 5M2UA 4BHQA 3CVKA 4OI6A 4KR0B 1MROB 4B3SJ 3IR6B 3MEEB 4F36A 3T5HA 2H65B 1ZOTA 4X65F 2V2KA 4O3RA 2QV6A 2U2FA 4I69A 1M1HA 3CMES 3FSIA 1BWEA 1LOUA 2VDIA 4ZPBA 4PXCA 2BVZA 2HMIA 4C9DA 1NEEA 2BMBA 3OFGA 3MURP 2K3KA 3DOKB 1NUEA 2QO3A 4K8RA 2ZC3A 3NMAA 3DGPB 2BX6A 4FP9A 1F60B 2CPHA 3CJQA 4BWMA 3MPVA 4R0JA 2J8AA 4DV1J 1JLGA 4F4AA 4F2RA 1XR5A 2WSCC 4LF8F 1QJHA 2Z4PA 4TLRA 3KJNB 1VBYA 1M5OC 4EWTA 3HVRA 3Q8YA 3ZXWA 3CIMA 3GV8B 1FJCA 1JLCB 2LMIA 2H48B 2B8QA 4TXSA 4LFCJ 4C97A 1WACA 2VPXB 4ILMA 1IQZA 2BYCA 3BO3A 5CA5A 4ZA1A 2V9WA 2VD3A 4KHMA 2JWNA 1Y7PA 1SJQA 3KHLA 5KT6A 2RD5C 3QIPA 4B02A 1ZA2B 5L39A 4OI2A 1Q53A 4OI1A 3OR2A 1RCXB 2YNGA 2HG4A 1TK5A 1N5YA 3GYXB 2BJ9A 1ZH5A 1NB7A 4XDDA 4DV3F 3RB6A 3MR2A 3ET6B 3CCMS 3KLFB 2IA6A 2XLIA 3HHKA 1I3OB 1IR2A 4C0OC 3P5BP 1QUVA 3ITHB 1YQHA 1N36J 2W1BA 3K5PA 2G2ZA 4RLEA 4C2MA 5CD4H 4K50A 2AJFE 3N28A 3KK1B 3B54A 1RB0A 3DGVA 1E6VB 1FJGJ 2PDAA 2ZJQQ 3UD5A 4EYHB 3VAFA 2L41A 2W9BA 2AJ4A 4JI2J 1KQFB 3TNVA 3TZZA 2W8KA 3VZIA 4W98A 3D2WA 4DJBA 1P27B 3GJTB 5F3TA 1SKUB 4N7TA 2EBGA 1FKPB 3MOZA 1UPMB 2WCXA 5LSRA 5DM6Q 5MAOA 2DKOB 4FPRA 2LFVA 4DUTA 1KONA 1ELOA 1HNWF 3DDIA 4HKQA 4MJKA 2P9EA 5DQGA 2KG0A 3OJUA 1J5EJ 2EG1A 4DR5F 4CLWA 1WI6A 5T7LB 3IC1A 1FDBA 2CQCA 1R0AB 2EFVA 4RR5A 2RQKA 4RX6A 3DLKB 5KFVA 1H74A 2B7BB 4B3TF 4OYZA 8RUCA 3CJ4A 1ZAXA 3C15A 2CQ0A 3ILOA 2FVPA 2V8GA 3MFHA 4LF7J 2OPRB 3R3TA 4ZOSA 3TUZC 1Q8KA 2ZWPA 4Y28C 1S7IA 1GNKA 3DM2B 3MR5A 3H5UA 4RW6B 3M2UA 4ZPTR 4ZIWA 2M7SA 1HIYA 1WG5A 2DY9A 3HHDA 3SXLA 3M6UA 2C3UA 3PO4A 4KFBB 3QRQA 5EX0A 2U1AA 2HBZB 2HRTA 5F8MA 4O4RA 1JLEA 5CYJA 3M6XA 2B4VA 2C2EA 2HHUA 2ZH8A 2RB7A 1SPBP 1RUSA 1VK8A 2DR7A 1VRTB 3W2WB 3CJ5A 3VV2B 3QLHA 2IAJB 4PG4A 4RW4B 4DSJA 1V6HA 5HANA 4M5DA 1R0BG 2OO4A 3BV8A 1NJWA 2PFFB 2G1DA 4ECUA 5D0HA 3BBBA 1XMQF 2OAUA 3JQMA 3GILA 1RT7A 2DRAA 4ELTA 4NEZA 2Z2YB 3O3LA 2HFUA 2UXBJ 2AZ1A 3T5LA 2V67A 3FEXB 1T9XA 2XNQA 5EX3A 3H40A 1N33F 2RNEA 1NHVA 1RDRA 5JVHQ 4MK8A 2ZBCA 1MROA 1YBAA 4J9MA 3MEEA 2ZH6A 1O8BA 5I42B 1GAOA 2L08A 2V68A 1Y5NB 4KH1B 4ED0A 2GZOA 2IA0A 1A0OB 2XMWA 1WKJA 1CULA 5J1NA 1YRTA 3K5MA 2JRSA 4Q44A 2XEXA 2W9AA 4PQAA 3DOKA 2NR0A 1B64A 1NSPA 2FPHX 1HNXJ 3M8QB 1JXEA 4WXOA 3PRDA 3N5FA 3DHWC 2CQBA 3AOAA 3CD5A 4QW9A 4LSZB 5B08A 1Y4ZB 3D4JA 1VK3A 2FVCA 3HDSA 1X5PA 2VPYB 3T1AA 2JNJA 2NXJA 3M4XA 4DCOB 4RZRA 1MW7A 3D7SB 1FNOA 2JEIA 4ZN3A 3A8EA 3PJWA 1JLCA 3OV7A 5AJ3F 4X62F 3ZO7A 5DZ7A 3T19A 3MGJA 1MMDA 3CCQS 4A8XA 5B0FA 2V8PA 3BDPA 4OJHA 2KXFA 4QBUA 2KZZA 1SCJB 1KLNA 2XB2D 1SJ1A 2XI2A 5BR8F 4USUA 1XEZA 2KYZA 4CI0B 1H2TZ 1U1OA 2V2VA 2Q6BA 4HLBA 3I96A 2QL5B 4FKXA 3LGHA 1RAGB 2V2ZA 5KFGA 3KKFA 2LP4A 3KLFA 1S9GB 1HNVB 1NHKL 4HI2A 3ITHA 2YQ0A 2CADA 2APOA 3SV4A 3LTOA 3KK1A 2HHHJ 4PPZA 3MOJB 1E6VA 1S1XB 4TVAB 3QQCD 2NLWA 2EW9A 2O01C 3EGVA 4E8UA 1KQSR 3EGZA 3UDLA 1IBCB 4WFAQ 1FKPA 2DYAA 1G6BA 1HR0F 4RNHA 3EE3A 3TQEA 3VR1A 3UR3C 3H20A 4DZDA 3R2DJ 3M8RA 2V8HA 4NYZA 2HWHA 3QJPA 2UUCJ 3NS7B 3DRPB 2R2SA 1DRZA 4UOFA 1RZMA 4YP3A 4MK7A 2DH9A 2HFOA 1RWMB 2CPFA 5J2QB 2XQCA 1FTRA 1FJ7A 2JL9A 2R3VA 3RW6A 1UVMA 1XMBA 4CO3A 4PXEA 1IVZA 3BZQA 4WZMA 3J7YI 2CNNB 5T7LA 2UXDJ 4NEYA 1R0AA 3B6BA 1Q95G 2QSWA 5GAHI 2A6MA 1RT2B 2Z56B 1DLOB 1IKYB 3PW0A 1S4EA 1NDLA 1JJCB 4AL6A 4QIVA 2HVDA 3O8WA 3I4PA 4ANEA 5KG2A 3JB9k 3SIPB 1BD6A 3DM2A 1FRKA 1RWKB 4N77A 4RW6A 4B08A 2HS4A 4W92B 4FF1A 3UWTA 4LREA 2K3IA 4DOZA 4ZJOA 2FZKB 4C98A 2GA7A 3AA8A 2RE1A 3TUPA 2W7PA 3HI9A 3KWMA 4KFBA 1KD1T 2YWEA 4B9VA 3R8YA 1NKBA 5EDWA 1GMWD 2XMVA 3QJLA 1YKWA 2IM0A 1YIJS 3GPAA 4K0KJ 2GHWA 2XMAA 1S6OA 1WKLA 2YKOA 3QJJA 1VRTA 1RHKB 3DLHA 3W2WA 3FBCA 4K2JA 2IAJA 2VG7A 4RW4A 4GRSA 3NGSA 3NRBA 3FMWA 4JUZA 4K4TA 3QO9B 3LP1B 3IBFB 1WEXA 5GMKa 5F8GA 2GGPB 4GMKA 2XWYA 3GP9A 5A76A 2MKYA 2VOPA 3R5GA 2Z2LA 1NLKL 1XTZA 2HKEA 4URQU 3RBXA 1BUXA 3TWZA 1GT8A 2YNIB 4QU6A 2PN6A 1U6ZA 2IM1A 2SXLA 2GQCA 4B3MF 3PIPQ 1M1GA 4UF4A 1EX8A 5AXKA 1FT8A 2V6AA 2AEMA 2YWKA 3AXMA 4DX7A 1NDKA 2ZNYA 2B9YA 3R6GB 2R4FA 3PTWA 4X65J 4C8KA 3T1YJ 3M8QA 3PRBA 2IVMA 1GX6A 1VQ7S 3GJSB 4IG3B 2GAGC 4F3OA 3KHGA 3ENWA 3BN7A 4TYAA 5F8NA 3GFZA 3CO9A 2WVEA 4C48A 3CCLS 1KN6A 4LF1A 1S1UB 1KNZA 3DC2A 4ANCA 1RYSA 3NGRA 2VFUA 2JLGA 1VC5A 3I82A 5AE3A 3W9IA 2ZH9A 3PO5A 5KT3A 3AOCA 1IBLF 2CNOB 3BBCA 4F26A 4BC7A 1FDNA 5HJXA 1HMVB 2PI5A 2VQEF 1ZM2A 2HW3A 4YEAA 4KJIA 4ILLA 2AEJA 2GIFA 2M8HA 4WCEQ 5I3QA 4IDKB 1QAJA 8ATCB 3JAMU 4BC9A 2HVIA 3UE2A 4I67A 1C0UB 3QMQA 1S9GA 1Q78A 2CIMA 4P7VA 4B17A 2VU5A 1RK8A 1HNVA 3O2IA 3BEGB 1S1WB 2B6AB 2PEHA 2YKAA 5HMZA 3A3OB 2CQ4A 3GR0A 1FKOB 4RWXA 4KGZB 2HZAA 2X51A 1S1XA 5B0DA 3MM9B 3THPA 4OYPA 3PX0A 1UVJA 4DL0C 1TK0A 4X4QA 2MZJA 1F9HA 4CT8A 2LXUA 4WXWA 1Q16B 2CDRB 1ZPWX 1VISA 2MKKA 2YKNB 2FZGB 3AFGA 3BR8A 1KTVA 3DOLB 3SDEA 3FVYA 4ZP6A 2L3MA 3UDEA 2C3YA 2DIVA 1XQIA 4G1QB 3SCLE 3DRPA 5KG5A 4B9NA 1WC4A 4NLTA 3G6ES 5J2QA 1UWAA 1CG2A 1SI9A 2D3ZA 1HNZF 2Y0SD 4Q43A 4DUZF 1P1LA 3JQKA 2BOPA 2OD6A 1RWNB 3FEZA 3SEOA 3GLJA 2QZ8A 1L3UA 3JTOA 1YBTA 4LVOP 3OLBA 1RT2A 3V6JA 2KT2A 4EBCA 1IKYA 1WHVA 4ZCKA 2N3LA 2PFDA 1S9FA 1WF0A 1JXVA 3UO0A 2DNLA 1NNDA 1YZ6A 1PIEA 3DN9A 4AD6A 4JI0J 3MAAB 2LVWA 3C6TB 1IN0A 2UXCJ 1FKAF 4FS2A 1C0TB 3GYNA 3FQLA 3F73A 1OY9A 1P6TA 2IBOA 4MTPA 2XMTA 1KS2A 3RAQA 2WW4A 1O5JA 1OWXA 1L5UA 2ZBIA 5DGBA 3DRRB 4JI1J 3GE9A 4IUFA 1NK4A 4DR3F 3O44A 1RI7A 1XNRF 3QIDA 2ASYA 3LAKA 1QVGR 3PG9A 1WOSA 1ZAVA 3Q86A 1UMJA 1LKZA 4ZVTB 2KZMA 1PGZA 2FVSA 1TELA 4X4OA 3P4UB 3KLHB 2FJXA 1HHSA 2R42A 5E41A 2AD9A 1FXLA 3BKFA 1WDTA 5ETSA 2ROGA 2F4FA 3JAMY 3ICLA 4OLOA 4JI8F 2VA2A 2LLZA 3LP1A 2O1PA 5KFSA 3TA0A 5DM7Q 4DR2J 3MEGB 2GGPA 2N82B 3G6VA 7AT1B 3J7ZT 4YDXA 2K7JA 3LP0B 3VGUA 2HNYB 1I51B 2HNDB 2ZVSA 3HKWA 3BGUA 2HS0A 4DX8H 3J81j 4QPTA 3ZZPA 3R5JB 2GMJA 2YNIA 1D3WA 3LA0A 3B78A 4KE5A 1RSCA 4MFBB 3LQVA 2RRBA 1N33J 3BGOP 5AXMA 2GW8A 4DS4A 2HQ3A 2FQQB 4DG1B 4OIXA 2E1MC 3WC2A 3G6XA 4P7TA 5A8WB 4LF5F 4YB5A 5HQ8A 4DU7A 3CE8A 1RADB 2VKRA 4B9TA 7FD1A 1UJ5A 3UW1A 4IG3A 3MR6A 4EU0A 2VFRA 3D6FB 4XDCA 3BO4A 4UZBA 3RAMA 3FEYB 1S1UA 3D0IE 1LK7A 2CPJA 2NXUA 2VQFJ 1T8EA 1SC4B 3QATA 5HLFB 3MI7X 2XSFA 1RKIA 1LW0B 2YQ1A 4X64J 1JX4A 2N3OA 4YR0A 2OPSB 3TVZA 2AX0A 2UUBF 5LMUF 3D1QA 3C46A 3VGVA 2W2NP 4YR2A 5ETMA 2AYGA 4ED2A 2JDJA 5B0AA 1HMVA 1RYRA 1Y00A 1KKHA 3R2CJ 4DPYA 5A0YB 1U2CA 4NLYA 1K1SA 1XBWA 4FS1A 1LEOA 1Q4RA 4RUAA 4B3OB 4KV8B 4FYVB 4IDKA 3CJKB 2M4MA 2P6TA 1XMOF 4OX6A 1WC3A 4AQYF 4DBQA 3TW0A 1C0UA 1L3TA 3K17A 3MDFA 3HKZD 4ED1A 4UZCA 2AGPA 2F4VJ 2R7WA 4F8RA 3QFWA 1FRIA 1S1WA 5BR8J 2B6AA 5F9NA 3MEDB 3IGVA 1T95A 3NY0A 1SV5B 5L46A 4TU7A 2HVZA 3TZXA 4NA2A 2AP6A 2GIQA 4L3KA 1FKOA 3I0SB 2QL7B 1U1QA 4ZVQB 5FD1A 5D0RA 1YTYA 3MM9A 4J9QA 3OTOF 3AD8C 5CXTA 5D15A 4LF2A 2ASLA 2CUYA 2HFVA 3W9HA 2R2RA 2ZHAA 3O1LA 3LALA 2YKNA 4EYIB 2B5JB 3DOLA 4OYWA 3NOCA 2WVBA 4FN5A 2ZNZA 3AY0A 4FXDA 2HHPA 4G1QA 3MM6B 5IC6B 2JEGA 1UL3A 3Q8PB 1GEHA 2MGZB 3GCWP 2DNOA 2P6SA 4NLUA 4LF4J 4NLWA 3L09A 5LL6d 1GX5A 4ILRA 1JNRB 1RHRB 4OHWA 2B0GA 1G3OA 2NXCA 3UPFA 3I5BA 4IO1A 4WE1B 3SSQA 3M9NB 2MJUA 2ZH2A 2XGPA 3MAQA 1B99A 3CJTA 2FHJA 2H54B 4F0MA 2HHWA 2MHEA 5BXIA 3HM9A 2CXEA 4ZK7M 2FJDB 3MAAA 3M9OB 2XO7A 3C6TA 1V9OA 2HK2A 1C0TA 2CQHA 5KG7A 1U6FA 2ZM6F 4X66F 1FRLA 2F5GA 4GKKJ 3RU0A 3HT3A 4QWDA 2RSQA 2KG1A 3OHBA 3AA9A 3DRRA 1UVLA 5EGYA 2MKJA 2LYVA 2XI3A 1FNXH 2I5JB 4DL4A 4ERDA 1S6PB 1FWLA 1KQKA 3R6LB 3FBFA 2BKNA 3ADAC 1FESA 4ID5B 2KXNB 1S9EB 4RW7B 3KLHA 2UVWA 3HD2A 2ADBA 3R7SB 4OX9J 1RWOB 1V3SA 3QWPA 1HWIA 3AB2B 3QWUA 1CLFA 3MEGA 4UY85 3DFEA 1UW4A 4V1Ak 2WSEC 1LFPA 1FX2A 4GO5X 3LP0A 3VGTA 2HNYA 1MN9A 3BGRB 3TX8A 3L7OA 1IKXB 2HNDA 2D74B 2C2OB 1N34J 2Q3PA 2HFSA 1PYOB 2W2MP 3PYEA 1ZTWA 4P2XA 5KFKA 2HZCA 3IS9A 1FF2A 2ZJRQ 1U1MA 4MFBA 4ZPAA 5JUMA 5CD4A 5HMXA 1H38A 3CC2S 1VFJA 4DG1A 4Y3CA 1Q82T 1I1GA 1MSWD 3CMQA 5A8WA 5IS2A 2HBYB 2DNRA 2LECA 1ZM4A 2MKCA 2IPOB 4OZ3A 1V5IB 4P2MA 2QL9B 3ZTQA 4DCPB 5C5JA 1V3RA 3DI6B 3MMCB 4X4UA 3OTBA 1OSDA 2BE2B 1VQNS 2Y1LB 1KVIA 2AKWB 1S4FA 4P74A 2M88A 4ETXA 4DLEA 3IM9A 4DV0J 5HLFA 1L3KA 1LW0A 4KTQA 2CQ1A 4Q8FA 2GVDB 2MZRA 2OPSA 3E3XA 4DR1F 4OYOA 2QFJA 3FQKA 4B9MA 5D77A 3UCZP 3V6DB 5KFFA 2NZCA 5M2RA 1NB2A 2E1PA 3A8KA 4NZ7A 5A0YA 2WRMA 4FYDA 1NPKA 2NUHA 2GNKA 4B3OA 1D9FA 4DL2A 4KV8A 4ZVEA 1HD0A 3I32A 1U1NA 2FVQA 4CLPA 1S0VA 2FTRA 5L38A 3N79A 4NPOA 3I5AA 3DHXA 1RAIB 4OV6A 1FE0A 2DXEA 4NXNJ 3MEDA 2WTFA 1X5SA 2C2ZB 1SV5A 2C3OA 2QSFA 1DHMA 1IWGA 3CD6S 3OTCA 4KHPJ 3OXGA 2ZOGA 2G4BA 1JNZB 2MQLA 3QPIA 4OI4A 4KGMA 1GH8A 3NAIA 3BQ0A 2OI2A 4N8OA 3CC7S 4JV5J 1TFWA 3EUNA 3TO8A 4DQPA 3IA0A 1X4CA 1T9TA 3ONQA 3GV5B 2B5JA 4OI3A 2XSJA 4O0NA 2RDDA 2E9RX 4L72B 3C6UB 4QWEA 1TQLA 5IV3A 1F5AA 4EBDA 1Y0HA 3MM6A 2BQUA 1APSA 3Q2TC 1HNIB 1JLFB 1HQEB 2CDQA 4ZPVR 3QBCA 3K8WA 5CYQB 3IGNA 1FEEA 3FUYA 2MGZA 3T5JA 3GG1A 1PC5A 2DNYA 3AH6A 3HFVA 1NK7A 3NXZA 5GAEI 1URRA 4JBCA 3Q23A 1HHQA 2E5GA 2GCFA 1OO0B 1S59A 2CPIA 4WE1A 1GTEA 4FF3A 1WC5A 3BPSP 4PQUB 3DXSX 1XJWB 5GAEU 1RAJA 5J1PA 3BBFA 1U1LA 4Y2IA 3PJXA 2MQNA 2JSXA 2H5JB 2XMMA 4DCJB 3OFFA 5DQHA 3JSBA 3QRPA 5DS7A 1UEVA 3DRYA 3H4BA 4AE5A 1W25A 2JC0A 2MHNA 2ZHOA 3TA2A 3KDOA 3A13A 3G6YA 3BSNA 3R5BA 1JKHB 4E98A 3DU5A 5BJRA 2HVHA 1T02A 2J9CA 2CQGA 4DN9A 1NJIT 2OSRA 1SL0A 1JLBB 3RG6A 2GVZB 4N41A 3BSAA 2I5JA 4RBVA 1S6PA 1SBRA 3TARA 4ID5A 4CRJA 2VBXA 4LBIA 1S72S 2A2DA 2I9SA 1S9EA 3Q83A 4RW7A 2RRNA 4NXMJ 3MM5B 1U2FA 3MCNA 5KFDA 2MMYA 2KI2A 1LFWA 5F0WA 2FLPA 4WJBA 2BXJA 2X7IA 4NZ6A 4ECXA 2QT7A 2CPYA 4YY3J 5F8JA 5F9LA 5CCMA 2V2QA 1F3VA 1QAYA 2GMHA 1HI8A 3BGRA 2VFSA 1XWLA 1IKXA 1UKUA 1HBNB 4JI5J 4YQWA 4B3SF 3G2XA 4Y00A 4OLPA 2AZ3A 3ULHA 1WSVA 4NRUA 1RWVB 1B0VA 1RACB 4UUXA 4ECZA 2QIFA 1VI7A 3K0JA 2ZH3A 4KKOB 2VFVA 3CW2C 4WF9Q 2R8GA 2XS7A 4A8QA 3PW4A 3NL0A 2AYBA 3MMCA 5EUHA 4DV1F 4ECRA 3KLEB 2UU9F 4ED4A 1LNQA 4OZ2A 2DTJA 2BE2A 1P1TA 4DFKA 3W63A 2HWTA 4ZP7A 3QRRA 2MQ8A 3R27A 2PA3A 5HP1B 5H1SV 3V6KA 2WSFC 2RKIB 4ETZA 1X4DA 1RHMB 2XLKA 4TQSA 2D9OA 3LGNA 4CO1A 4ED6A 3K5NA 1M0SA 2GVDA 1SH3A 2RILA 5IM0B 4LFCF 5FIIA 4AUKA 4GKJJ 4B3RJ 4O4GB 4HEA9 3JQJA 2WAQD 2V94A 1X4FA 2H51B 2R7QA 3IO1A 2V8DA 4PG6A 1Q5YA 2GJFA 5LM7E 1NSKL 1TL1B 1X60A 1SVDA 2IJNA 4DSIA 2UUBJ 4D3GA 1HYSA 3OL6A 1RE1B 2O5DA 2PA8D 2KVQE 1WG4A 4OYXA 4ZVHA 1R8AA 3TVYA 3PHEA 1DQAA 3D5MA 5KFAA 3UCGA 3ZFVA 4U67Q 2WOMB 1WC0A 4LBPA 5DGAA 2BJDA 5J2PB 4N76A 3N5BA 2CJXB 1FFGB 3JSRA 1T3NA 2G2OA 1FXDA 2IM3A 2HSEB 4DV7J 2BZ2A 3H7HB 2FUG9 3TZYA 2DGXA 3X3UA 4Y6IA 2PGCA 3VAHA 4OZNA 1KBRA 4HACB 4DR6J 2G1HA 4JI2F 2NYHA 4TU8A 1TUVA 3WZ0A 3OTOJ 3C6UA 2XMKA 1LV5A 4I0WA 4F4ZA 1MWQA 4N56A 4TY8B 1HNIA 1JLFA 1TKZB 1HQEA 1EB0A 1BC6A 4O44B 2HZVA 5CYQA 3IBWA 1PBAA 5LT5A 1OPZA 1NH7A 2VZ9A 1NXIA 3EDRB 1J5EF 2JEJA 1BHNA 2OSQA 1JLAB 1NJYA 4RBUA 2M9KA 2MB0B 3BS9A 1N6QB 2N4CA 2OFGX 4FYYB 3A8IA 2FYXA 2DNGA 3V4MA 1XIQA 3NEKA 2XO6A 2E1CA 2ZFHA 1QE1B 3BSOA 1UFLA 5KFTA 4PQUA 4LF7F 3DDKA 5IXUA 1UAWA 2PIIA 2OJ3A 2EVZA 1UVKA 4CO2A 1RABB 1D09B 2OMLA 4RW9B 4J9KA 4ELVA 5DG9A 4MIAA 3L7PA 4I6WA 3IWLA 1FHTA 3CTRA 2I8EA 3ZNJ1 2EK6A 2F9DA 2I1RA 3RBDA 1IWAA 1VHIA 1UP1A 1JKHA 5J1EA 3EX7B 2BV3A 2E5LF 3UCUP 4RNFA 1JLBA 4KAIA 4X66J 4EMDA 3EPGA 2ROPA 2GVZA 5EWFA 3GG0A 4ID8A 5D4NA 2M5YA 4ZJLA 1NJZA 1TKTB 2AMCB 3KLIB 3TJ9A 1Y11A 2W7AA 3N9UC 4M5KA 2MJNA 1KWMA 5KFCA 2QYCA 3TX0A 4AT1B 2YKMB 1F6TA 3VF0B 5DZ6A 2DGVA 5K8OA 2KRRA 2NS1B 4LRBA 3T5KA 2B9XA 4DF8A 1FERA 5K9FA 2HHXA 1AUDA 4ECSA 5KFMA 5HBMB 3DRSB 4DI6A 1HBNA 4WIQA 4P71A 4AXIA 2RIJA 2IBKA 4M5IA 2ZOFA 2FLNA 3TAMA 1J27A 2ACYA 4LQ3A 1ULRA 2B51A 4LJMA 4M95A 4C6AA 2BQRA 4G1IA 3ENQA 2FHMA 4B9UA 4Q2LA 3TJ8A 2WBMA 2OPPA 2PMZD 4A4JA 2Q66A 1HNXF 5DDOC 2QG9B 1JQGA 1RAOA 2XY6A 2P2CB 2QLJB 3OHAA 4P6QA 8AT1B 2ROEA 2BR0A 2QRRA 1RT6B 4C8ZA 1M5HA 5HP1A 4HH1A 2RKIA 2DXDA 4P2SA 2OUGA 3NNHA 3W2VB 3HLUA 2NCKL 5DDRC 4M5MA 3SCIE 3AQOA 2H4YB 3SCJE 5IM0A 3OPKA 3ZZUA 5K5MA 3A4TA 2UUAJ 1U4BA 2HYIB 1XNQJ 5A8RB 1ZYQA 2N4DA 4YB7A 4O4GA 2YH1A 1PJ6A 2Z57B 3RAXA 1IUJA 3V5RA 2DR6A 1TL1A 1H73A 2C42A 2FD2A 1YJVA 4ZVOB 5CCLA 4O3PA 2QX0A 2XS5A 3SFGA 1ZM9A 2EBEA 1OY6A 3Q8UA 2I2YA 2EXUA 2WOMA 2Z0GA 3CCRS 2DRDA 5KT2A 4P10A 5J2PA 2ZUGA 4M5LA 3HSJA 5D3GB 3S7RA 2GIRA 3KUHA 2RUGA 5F8HA 4CP5A 4A8OA 2ZJPQ 1X0PA 4UQTA 1FFWB 2HHHF 2G2YA 3IXQA 2PMHA 4F4KA 3OVAA 2V4QA 5E7OB 2IRUA 1CC8A 4BCAA 4HACA 5ETOA 1RU2A 5JJBA 4NCBA 1NRKA 1MG7A 2VPZB 5D0GA 5EHHA 4C7QA 3GIRA 2HLUA 3EWGA 2JLFA 4USIA 4DFMA 3O6QA 2IHR1 1A7GE 4ICLB 3A3PB 3FFIB 1PO6A 2YWFA 2R7XA 1D9AA 3KJFB 1N5QA 2OTJS 2RT3A 4WP9A 4TY8A 2UUCF 1TKZA 4JOUA 4O44A 3KJQB 3FBEA 2LQ9A 3OFEA 1JB0C 1Z2LA 1IBKJ 4YOEA 3GIKA 2DNPA 2LU2A 1UVIA 3RJMB 5HAOA 5M2PA 4CO4A 1JLAA 4G65A 1Y3KA 5CHCB 4IG0B 2F63A 3D0GE 3G96A 2ZD1B 2UXDF 3R5CA 2F7VA 1N6QA 2KJVA 2JVRA 3VAGA 1S76D 4K4WA 1QE1A 3MFIA 1VQKS 4A8YA 3NGDA 4DL5A 2JH3A 3N6LA 2CNKB 1PYSB 5KTQA 5DLFA 4X84A 1PC4A 4RW9A 1UA0A 4PYAA 1IQTA 3MXHP 4KC5A 5D6GA 1TL3B 2WB4A 5HVFA 2BW7A 2R9LA 3DLGB 3EPIA 4NE9C 1CJKB 1UW9A 4IOBA 4R8UB 1O51A 4CIOA 4X4VA 1IBMJ 4U96A 1V5VA 4USVA 3I56S 2VF3A 2D3UA 2GO8A 2XZDB 1T0TV 3WIUA 2RS8A 1T05B 3M9MB 2WW8A 3Q2SC 5KFUA 1ITPA 2Y3YA 4J9LA 1TKTA 5LJ5Y 1CSJA 3C3LA 3CD0A 2NSBA 4L6V3 4DPOA 5CQGA 2AT1B 3V6HA 2HBQB 1BGXT 4ES3A 4U7UD 3S6EA 3MUMP 1XC9A 1TTHB 2KHDA 2YKMA 3IRXB 3S1TA 1NZ8A 3M30B 3A8JA 4Z2XA 2YWWA 5A6WA 9RUBA 3NCQA 2DNKA 2N7CA 4PG5A 4NLRA 5FJ4A 3B8HA 3H59A 3DRSA 4H54A 4RWWA 1NH8A 2CFXA 2IIHA 1IKWB 2ASJA 2CVIA 3PNIA 1P9YA 3G8SA 1VRUB 5GAGI 2XCPA 5G4DA 5IWAJ 1QSYA 3H2LA 3MCSA 2AV5A 5AXLA 1WTBA 4Q0BB 2W2PP 3K5OA 5GAGU 4C8MA 4NRTA 1N4LA 3Q0AA 3T1YF 2HGMA 4F4YA 2EFOA 3RUBL 3BH7B 3GFXA 3HHEA 1CULB 2HS3A 4OHYA 2H9ZA 2FVRA 1RT6A 3BN4A 3LO3A 4WBFA 2CA9A 1U2RA 4U8VA 1BQMB 4NLGA 3CGIA 1CJVB 1S48A 3W2VA 1AB8A 5AE2A 3SYZA 2XYHB 4WKRA 3AJ1A 1ZS6A 2RDIA 4M5NA 2J6SA 2CZ9A 2UU9J 1U6BA 2OEJA 5BYQA 1HL6A 3L7UA 1A9NB 5A8RA 1HQUB 2AHOB 4IOCQ 2DR5A 2YXLA 3OTDA 2NYIA 1WEYA 4KPYA 2IYGA 3D9BA 4KB7A 4OJGA 5L1KA 4KRWA 2YKQA 1KR4A 2CVEA 2BA9A 2XWXA 2AJ2A 4QIEA 2VV5A 3JXOA 2XGQA 3H2UB 3OXFA 4J9SA 1S79A 5E3QA 2DVIA 2LEAA 5EWEA 3T6BA 4JB8B 4FBTA 2LEBA 4DUYF 5H9FK 4USJC 5D3GA 5CH7B 4H4MB 1JLQB 3GR1A 1SQEA 4PUOB 3VCDA 4ED3A 2L48A 4KO0B 3TEHB 3P96A 3D6TB 2ZZMA 3IAS9 3NWRA 4ECYA 2QLWA 3MCMA 3EGWB 5D4PA 4OJ3A 2OLWA 2KFYA 4CO5A 1FNMA 2B4PA 4NASA 2VG6B 2E5IA 3H0PA 3CNQP 2X1AA 1BWVA 2QFIA 1RU1A 2R8KA 2CPEA 2A6OA 4ICLA 1R31A 3AJDA 3AT1B 3FFIA 3W62A 3J80U 3H98A 4QR0A 4A46A 2EC0A 2LA6A 1T9UA 4OX7A 3HVTB 2O66A 2MLZA 1Y5LB 3PCOB 1UEKA 1RAFB 2Z58B 6AT1B 1AA1B 2ATCB 3KOAA 5KFQA 4IG0A 3MCOA 3A1YG 4PWDB 2ZD1A 2X1BA 1FD8A 4F4WA 3NWGA 2ZZNA 1HWKA 2DD8S 1W26A 2VDHA 4R0EA 1UA1A 3G86A 5LJ3Y 2OD4A 3PIOQ 1R7IA 2B4UA 1NK8A 2BM1A 1SQGA 3U1MA 2V5HG 2YX4A 2OTLS 3RYLA 2VL1A 4YN3B 4JI0F 4Y34A 4HTJA 3OQ2A 2J7KA 1NK9A 2IM2A 2UXCF 4FVMA 5K14A 4DWIA 3I9V9 1FDDA 3KMSA 3HHNB 1NMEB 1TL3A 3FGVA 3ZNUA 1M5SA 3BQ1A 3QSIA 2XY5A 4DQRA 4RUCA 3DLGA 1S5ZA 4ECQA 4K7QA 2QGFB 1CJKA 5GADU 2F8HA 4JI1F 3G87A 4L74A 4R8UA 3QAEA 1N0VC 1ZBTA 1KLMB 1D0EA 3DLEB 4CM0A 2FHKA 4HTIA 3IP0A 1T05A 4NI2B 4N47A 2WBRA 5HVHA 3CC4S 2BE7D 3HX9A 3W5XA 2UV8G 2E5LJ 3HJVA 3Q89A 4L73A 2RUSA 4C8OA 1S6UA 3GSDA 4DR2F 4DMZA 4NYOA 2DB1A 3IRXA 3M30A 4J9OA 2PMWA 3ISNC 4GC6A 2VG7B 1VBXA 1KVJA 3I55S 1G1XA 3T6JA 1TAQA 3VAJA 4QQBA 4U9RA 5IV4A 3UDCA 3WBZA 1JMTA 4IRDA 4ATNA 2V9KA 4DL3A 1IKWA 1SL2A 4PCQA 3G8TA 2IC3B 3MPDA 3FRYA 1RTZA 1VRUA 1B0TA 1RWXB 1ZETA 4F2SA 2C28A 4DXLA 1UJ6A 3SSSA 3PACA 1BY9A 2GAHC 2HURA 2EWHA 2FGOA 4Q0BA 3HHLD 5G0RB 1WF2A 3P3DA 3J80Y 6FD1A 3EDQB 2W01A 2XBPA 3PX4A 3HF5A 1T3OA 2A3JA 5HL7Q 4YS2A 1U45A 1S10A 3HULA 4YHHJ 3MUVP 1IM6A 1BQMA 1UWBB 2VQFF 1CJVA 4ZVGA 5KG1A 4LSNB 4JYAF 1UCNA 4X64F 4N5SA 3HCXA 1TL5A 1HPZA 5KFJA 5HK4A 1HQUA 2YKPA 2QMWA 1U26A 3RB0A 2HWIA 5E2QA 4F67A 3JTPA 2IJFA 1FCAA 5T41A 4FXVA 3CJ2A 5H9EK 2BQ3A 4PWWA 2M52A 2LKZA 2LU1A 3MMAB 2ZBQA 4XK8C 4RNOA 2M3DA 3RB4A 4WFZA 2MSTA 2NXNA 1WC1A 4M5GA 2BRLA 1J5OB 4ZP8A 1WG1A 2F4VF 1N32J 4DPWA 1F5CA 3Q8QB 4PPDA 4H4MA 1JLQA 2W4DA 3W65A 4L3NA 4PUOA 4KO0A 2QYGA 1JJHA 3D67A 4DV5J 5HVGA 5AT1B 1JWWA 1FVQA 2XMJA 3KG1A 3ZTRA 3BYRA 1N0UA 2VG6A 5GMEA 1OJ4A 1NSAA 3S8SA 2HBRB 4MYTA 5HATA 2UV8A 4C11B 2R2TA 2KVIA 1JXLA 5J2MB 1U1PA 3HVTA 2F1FA 3M8SA 3N6NA 2LDIA 4L76A 4FPIA 1NCLA 2OEMA 4TN2A 5ETPA 4U95A 2LDYA 3SDEB 1R8HA 4J90A 2XG8A 4LF4F 2YVSA 3CCSS 1SKWA 4YB1P 1QTMA 4PWDA 2VBZA 2DCUB 1CJTB 2J5AA 3W8PA 2UP1A 3SI8A 2B7CB 3W60A 2ACMA 4DL6A 4RU9A 2CZVC 2XYPB 1X9MA 2QA1A 4WFYA 2RJZA 1D1UA 3DOMB 1UVNA 4RUHA 2BANB 5KOXA 2KXHA 2RU9A 2W2OP 3ZTPA 3LF0A 5JXSA 3MR7A 1YJTA 4X4SA 1HFEL 2P9GA 2PC6A 2BOAA 5LMNJ 3U27A 2XULA 2H5EA 2QMXA 1FWKA 2J9DE 5AE1A 4DV2J 5H9FJ 3W64A 1C1BB 4GKKF 2JOQA 4J7CA 2ZBRA 1X31C 2ZKUA 3LP2B 3FRZA 1K44A 4HVZA 3GTYX 3IN5A 3JS9A 3D6MB 5A2QU 3ZZ0A 4I2QB 1KLMA 2VB6A 4OZ5A 9ATCB 3DLEA 5E3PA 1OSCA 1DARA 4Z7YA 2AGQA 1NKEA 3MEKA 3N6MA 4LFAF 2DISA 2JC1A 4NI2A 3P8BB 3KDNA 4USKA 4J37A 1NK5A 1IKVB 1U8WA 1MMNA 1WHXA 2L9WA 2N7YA 4OX9F 3CMAS 2GS8A 4C0BA 3EZUA 4NLOA 1TL7B 3KLGB 4C8LA 3H25A 3T1HJ 3PKYA 1VIXA 1NDPA 4ZLNA 1VQLS 3BO2A 1PBUA 4ZVSB 4ECTA 4X4RA 4E0DA 2IDEA 2OEKA 4OL8A 1VIOA 3IMQJ 1U25A 1N34F 2Y9HA 4OZ0A 1FRMA 4O3SA 4LSLB 1J2VA 4NCGB 1K73T 1S1VB 2IC3A 2GJIA 1IM4A 1NU4A 4YUDA 4ZVPB 1YJ7A 4MMOA 2WHOA 2HQDA 1RT1A 5G0RA 2IRYA 2DT9A 5JMNA 2AJQA 3S01A 2DGQA 2R7RA 2AWZA 4DS5A 2CG4A 4DR4J 5F8IA 2ALZA 3EXYA 4LRCA 1UWBA 4ZVFA 2QA2A 4DV0F 5HSPA 1S57A 1Q7YT 2LQBA 4FNHA 1PSDA 3QNWB 4LSNA 1R3NA 1AZSB 2FC9A 3HHLC 4MYUA 2V0NA 3G8QA 3ZTSA 2V63A 4PABA 1H98A 3IWXA 5FLXU 3DNCA 1HLWA 2RHQB 1AFIA 4J9VA 4LR7A 3L3CA 3AB4B 2IMWP 3OR1B 3AQPA 3K5LA 3RRHA 3NAHA 1P8GA 2DITA 3MMAA 4K5RA 3PEJA 3GV7B 3VAMA 4CYUA 4H4OB 2QLFB 1VHFA 1J5OA 3PR4A 1SQFA 2DHSA 2HGNA 4Y65A 1BQNB 3CJ8A 3CXCR 2V4JB 1R0CB 2MKIA 2FLLA 4PG7A 4NXNF 2BJ3A 1FFSB 5THWA 3OVSA 3IBCB 4FNIA 1TU0B 1TKDA 5A2QY 4KHPF 4DSEA 3IAM9 1RA7A 2F40A 3IRWP 5E3CA 3DLLQ 2RS2A 5CAAA 2CRLA 1NPPA 3PRVA 3OUYB 4DUYJ 3RRKA 2KDOA 1F5BA 4JV5F 2DEIA 2Z2MA 3IWNC 3RBZA 1K1QA 2MSSA 2QLXA 1UFWA 4LIWA 4XPCA 3VHQA 4Q5VA 4C11A 5J2MA 3BKTA 1VJQA 4ZDNA 3EVMA 3H5SA 3NMRA 1R8PA 3DMJB 1N5VA 1YSJA 4ZLJA 4LR9A 3MF5A 1TR0A 1PG5B 1TZ0A 5IQ6A 4M8LA 1Q79A 5AXNA 3SQGB 2P5VA 4DR7F 1R89A 3FCVA 3QGHA 1CS4B 3BKUA 1CJTA 1M1KT 4K5SA 4KGKA 2F65A 4OI0A 3SV3A 1X4GA 1VR6A 3FNNA 2V69A 3QFHA 4RU2A 3DOMA 3GSIA 2BANA 1TK8A 1FO1A 3JSMB 4OZLA 1LQ9A 4WYWA 2ZKTA 3ZZOA 2J9EA 1NPRA 1ZAWA 4O3NA 3PX6A 2A18A 1C1BA 2BUNA 4HL9A 4CQ1A 4KBIA 1RQ0A 3LP2A 2PI4A 1W2BR 4WFBQ 3LPEA 3C2PA 1Q1KA 2MPUA 4KGVB 5FLXY 4I2QA 2J7UA 4S0MA 2YNFB 3VWSA 2DO4A 2IY5B 1YLXA 1DAXA 4A47A 4JI6J 3T3FA 1IKVA 1VOMA 5EN1A 4NXMF 2AYEA 1GMWA 1F9FA 2MZTA 3LWLA 4O3OA 3W66A 4TU9A 5C2CA 1I5OB 4DL7A 1TL7A 3KLGA 2B9EA 2F9JA 3QYYA 6FDRA 5B09A 1X4EA 4YY3F 2EPIA 3A12A 1IR0A 3GZ7A 3OL7A 4HHHA 1YGYA 1UZHA 4M63A 4Q2MA 4AXJA 2YX7A 2JJ4D 3SBMA 2HNZB 2R7VA 4KPCA 4JI5F 1AUSL 4LSLA 4ZCLA 2HLTA 2DNHA 4NCGA 2WVCA 1EQMA 1YDLA 1FE4A 1S1VA 3EVOA 3UFCX 4JV2A 1HBOB 2YPZA 1T9VA 3K2YA 4YDDB 4N8NA 1WF1A 1HARA 2A1BA 1T94A 2DGTA 4QIWD 2ZH1A 3C19A 3MECB 2Y1IA 3IS9B 4CH0S 4W90B 4ED7A 2C2KB 2CJBA 3M2VB 3V81B 3QT8A 2W8LA 3AXKA 1RT5B 1RKJA 2J6TA 2BJ8A 2DNQA 3CWJA 3PW5A 1TMMA 1VYAA 3W61A 2XLJA 4LQ9A 3ETMA 4F02A 2KYXA 4LT6A 3KUEA 1AZSA 5KFRA 1R8BA 3ZZRA 1T9YA 3Q22A 3ENVA 3F0NA 2ILZA 4GKJF 4CZCA 4B3RF 1Q7LB 4MKAA 2DIUA 1W7WA 4JYAJ 4ZLPA 4PXBA 3OR1A 4Y2MA 4F3MA 4D3HA 3UNGC 1SC3B 2Y8WA 3W3SA 4HT5A 4KSEB 2VIHA 4H4OA 2H4WB 1RAEB 1M5VC 3UD3P 1SJRA 5DG7A 1SIWB 2RHSB 4URGA 5IOLA 1BQNA 2V4JA 1U02A 3EZ5A 3DRXA 3OD2A 3SFUA 4ZKAA 1RHUB
chains in the Genus database with same CATH topology
3QSYB 1YZ7A 2QMUB 3CW2C 1Q8KA 2QN6B 2AHOB 1YZ6A 3J81j
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QSY B;  1YZ7 A;  2QMU B;  3CW2 C;  1Q8K A;  2QN6 B;  2AHO B;  1YZ6 A;  3J81 j; 
#chains in the Genus database with same CATH topology
 3GON A;  4DSK A;  5K20 B;  1EAY C;  1U0S A;  2R8J A;  3PJ9 A;  2D3O R;  1UEU A;  4DV7 F;  2J7W A;  2AIR B;  5KFY A;  1QUP A;  1VMB A;  2VAS A;  3KLV A;  2OP5 A;  1N48 A;  1IJF B;  4ZCM A;  3D28 A;  3RRG A;  3OUY A;  4CLS A;  4DR6 F;  4WPA A;  1QY7 A;  4NL5 A;  4DPT A;  4F0H A;  1TVR B;  4DSF A;  2HQG A;  4O0I A;  1NSQ A;  2QA4 S;  1RP5 A;  1FRX A;  1ZM3 A;  4HDG A;  1WDD A;  3DMJ A;  4LF9 J;  3WQP A;  4QOT A;  2XSJ B;  5CZX A;  2CWK A;  3SQG A;  1BMQ B;  1CPZ A;  4PEO A;  1NM2 A;  3P5T L;  2DEJ A;  3GJQ B;  1CS4 A;  4PZV A;  5KFP A;  4ZPC A;  1K47 A;  1ARO P;  4DZ6 A;  2FY8 A;  3MPW A;  4KT0 C;  5C2G A;  2BJ7 A;  4NLS A;  5SUH A;  3W8G A;  1X4A A;  1YIT S;  2AJ1 A;  4IFV B;  4PAA A;  1U09 A;  4KH0 B;  3JSM A;  5F8L A;  4FF2 A;  4WWS A;  5KFN A;  2FJA B;  2D7S A;  4FKY A;  3DCA A;  3HMJ G;  3TAP A;  2LQ8 A;  1M90 T;  3L95 X;  2HQC A;  3J81 U;  2JFD A;  3KG4 A;  4C0H A;  4LF6 J;  2Q79 A;  4UW2 A;  2G0J A;  4R5P A;  4DF4 A;  1Z1Z A;  2KT5 A;  1C2P A;  4WP8 A;  3FZB A;  1ZTT A;  4ECV A;  5IT9 U;  5DG8 A;  1YWX A;  1YBU A;  1XN9 A;  2I6W A;  1OMS A;  4V19 X;  2C22 A;  2YQ3 A;  5KOW A;  4HH0 A;  3UN2 A;  1SJF A;  4P2F A;  2WVF A;  2YNF A;  1EZZ B;  3M2R B;  4KYZ A;  1BQX A;  4F50 A;  1W2I A;  1CVJ A;  4C3K A;  2FJE B;  4QIF A;  3PHT A;  3CED A;  3ZC4 A;  4K4V A;  1JIH A;  3ILJ A;  3U02 A;  4EEY A;  4OV1 A;  5HMY A;  2J6U A;  2DH8 A;  4LFA J;  5HQL A;  2AJ0 A;  2DHX A;  1AW0 A;  2HQF A;  2VC1 A;  3RR7 A;  4LRF A;  3WHI A;  1BLU A;  2MZS A;  3DGP A;  1VQ9 S;  1RIS A;  2W25 A;  2X3D A;  1OQ3 A;  1YG0 A;  1HBU B;  2HNZ A;  3LW5 C;  3W9J A;  2BAC A;  2RVJ A;  3MR3 A;  4IQM A;  3N01 A;  2KKH A;  4WFN Q;  4TYB A;  5ETK A;  2BE9 B;  1HBO A;  4CDI A;  3MMB B;  2D69 A;  2YPY A;  1DBD A;  2JHE A;  2M0G B;  3OW2 R;  3NBP B;  2PEB A;  4DV6 J;  3IG1 B;  4MK9 A;  4NLX A;  3MEC A;  1B3T A;  2Z30 B;  1HBM B;  2XHC A;  3VQT A;  1O0P A;  3EVW A;  2QC3 A;  3M2V A;  3V81 A;  3BJY A;  4QR1 A;  3CCV S;  2ADC A;  2ZDO A;  1RT5 A;  2GX8 A;  3BM7 A;  3T41 A;  3GFH A;  4IR9 A;  3BB5 A;  5KFL A;  2KHC A;  5KT7 A;  2W2Q P;  3CD7 A;  3ET6 A;  1FD2 A;  3V2U C;  2QTW A;  1KFS A;  2DBB A;  2FB0 A;  2UUA F;  5GVQ A;  2CPX A;  1XNQ F;  1Z4U A;  3D54 A;  3U1N A;  2FDN A;  4CLY A;  1RBA A;  3PYF A;  3CDA A;  1U1K A;  5RUB A;  1C4C A;  3GU0 A;  2DK2 A;  5HJY A;  2K1R B;  1FX4 A;  1S49 A;  2Y1R I;  4HR2 A;  1Y10 A;  4DFP A;  4U7U K;  4LR8 A;  1PAU B;  4OHV A;  2J9D A;  4Y2C A;  3EZO A;  1VQP S;  4NZ0 A;  1GXT A;  2BW2 A;  4ZPW R;  3J81 Y;  4MIW A;  3THT A;  1YI2 S;  2VPW B;  3BGL A;  2GML A;  1VQS A;  2VG5 B;  3MM8 B;  5IT9 Y;  1HYS B;  2YNH B;  2Q1L A;  2LQ5 A;  3POT B;  4M1K A;  2J0W A;  1G7C B;  2LEP A;  3MD1 A;  1HI0 P;  1R6V A;  3AD9 C;  2E66 A;  3TJA A;  1Z2Z A;  2LXI A;  3PVX A;  4GO7 X;  3MUT P;  1KOO A;  4ZS6 A;  1LWE B;  2DGU A;  3LPY A;  4WU2 A;  3Q24 A;  1TVR A;  1VQ6 S;  1G2E A;  3DLK A;  1VQM S;  5E3A A;  3J7Y U;  1Q8L A;  4BBY A;  3QGI A;  4CNY A;  1QSL A;  5GAH U;  2D1C A;  1EJ7 L;  2ZDP A;  2HQI A;  2D9P A;  2OPR A;  3FK4 A;  2B8P A;  4BDP A;  1YX2 A;  3LAM A;  3M7V A;  1IBK F;  4UT4 A;  4DPU A;  1XER A;  4NYP A;  5HQM A;  2A2C A;  2VJU A;  3UN5 A;  2PSZ A;  4IOA Q;  3FDS A;  1VBK A;  2G0C A;  4JI7 J;  2KJW A;  1S97 A;  2CYY A;  4URS A;  3NG8 A;  1FI4 A;  4W4M A;  3IFE A;  4IFV A;  4NLV A;  2RH3 A;  4DR7 J;  1EET B;  2IVF B;  2W7O A;  4P75 A;  1VQ5 S;  2MDA A;  4YME A;  3TOQ A;  2KU7 A;  1Q5V A;  4CLT A;  4JI3 F;  4DLG A;  4M5J A;  3TEG A;  1YRU A;  1FK9 B;  1N5S A;  2C3P A;  2WON B;  2B4O A;  3CDU A;  1H6K X;  1B0P A;  1F9E B;  4IR1 A;  1RBL A;  2Y1J A;  3I31 A;  2OPQ B;  1EKR A;  4YR3 A;  4UOC A;  2E5H A;  3LGM A;  3MPU B;  1IR1 A;  3CSK A;  4IO9 Q;  7FDR A;  1S77 D;  4USM A;  3GMG A;  3AHP A;  2OFH X;  1IBM F;  3CUN A;  1JJ2 R;  1AXQ A;  5LSO A;  1YVF A;  3OSN A;  3M2R A;  3KHH A;  2DR8 A;  1S0M A;  2JFK A;  3SSR A;  2CAJ A;  3KFW X;  2WK4 A;  4LRA A;  5J1E B;  2DHG A;  3TAN A;  5I42 A;  3RTV A;  5KT4 A;  3RW7 A;  4F4X A;  4JI4 J;  4CCH A;  2GJ2 A;  1RAH B;  1UTA A;  1KHW A;  3US5 A;  3Q8R B;  5DO2 A;  2EKN A;  2L9D A;  1MLA A;  2D41 A;  2AX1 A;  3I87 A;  3QT7 A;  4JV0 A;  2IFX A;  1RBO B;  1L3S A;  4ZVR B;  2JVO A;  2BJE A;  3BRE A;  1YJN S;  3SMZ A;  2ASD A;  3GIJ A;  3PDN A;  5D8H B;  3HFZ B;  3WC0 A;  5KFW A;  4A8W A;  3NNC A;  2RF2 B;  1HBU A;  3GYG A;  4P9S A;  2EG2 A;  3EXC X;  1S7H A;  4ZPD A;  4TY9 A;  3QAU A;  3PKM A;  2MZ1 A;  5ETQ A;  1KP6 A;  2C2M B;  2F3J A;  5B0E A;  3KUG A;  2KT3 A;  4QWC A;  1VC0 A;  3MMB A;  2PD1 A;  2VBY A;  5IWA F;  3G71 S;  2A10 A;  3BGF A;  4RPF A;  3NBP A;  5U47 A;  3FMB A;  4QWA A;  1C4A A;  1U0H B;  1R27 B;  4LF8 J;  5C42 B;  4FYX B;  3IG1 A;  4YB6 A;  5D4O A;  2GQQ A;  3AAW B;  3CPW R;  3TAM B;  2DY1 A;  1HBM A;  4OHZ A;  1VJW A;  1S0N A;  4XIU A;  4HI1 A;  3A3N B;  3M6V A;  3K8V A;  3D66 A;  2OPP B;  3NCR A;  4AND A;  2R8I A;  3E8O A;  2QJ3 A;  4K4U A;  2VOD A;  5DJB A;  4CM2 A;  1VLY A;  5E5N A;  1X4B A;  4WK3 A;  3W5Z A;  2HAI A;  2FGC A;  5IQQ A;  2VC0 A;  4C8N A;  3CDW A;  4DV3 J;  4GVL A;  1GK8 A;  2XHW A;  2K1R A;  3U1L A;  4J5O A;  1Q81 T;  2XZT B;  3D1O A;  5K8P A;  4K4S A;  1LXN A;  4EUV A;  4DFJ A;  2RQ4 A;  1LWX A;  2E44 A;  3MHY A;  2DGW A;  2MYF A;  2E9Z A;  3KMQ A;  4AYB D;  1FTC A;  2VG5 A;  2M8D B;  3MM8 A;  3ILL A;  3B4M A;  1SH2 A;  3B82 A;  2VHG A;  2YNH A;  1HD1 A;  3POT A;  5KT5 A;  3FZ2 A;  3P45 B;  3AOD A;  4LIR A;  2NRE A;  1GXL A;  1WI8 A;  5EWG A;  3NGT A;  1MWY A;  3TA1 A;  3V4I B;  4IH5 A;  4NOH A;  4AL5 A;  4Q45 A;  1WNE A;  1H3D A;  4K2X A;  2HFZ A;  3MZI A;  4LVN P;  3TZW A;  2OH2 A;  4FBU A;  1LWE A;  5F0U A;  1HNW J;  4IH6 A;  3C8Y A;  3DYA B;  3KK2 B;  3CJ3 A;  4KHR A;  2ZOM A;  2KH9 A;  2IRX A;  2DNZ A;  1MNE A;  3GB0 A;  1EHW A;  1DLO A;  4WZQ A;  3VGS A;  1Y5I B;  2FHJ D;  5L9N A;  4RBT A;  4DR5 J;  2ZUA A;  2C2D A;  4ZP9 A;  1WOR A;  2R7U A;  2KFZ A;  4BWJ A;  1F0X A;  1OPI A;  4B3T J;  5ITH A;  4XAK A;  2DGS A;  2MZQ A;  3W7B A;  1Q0N A;  1H2U X;  3QT5 A;  3EIC A;  1RTH B;  1LK5 A;  2CZ4 A;  3PFO A;  1EET A;  2XMU A;  2W4C A;  1IXK A;  3TQ1 A;  2OEL A;  3BYP A;  1PAE X;  1U1R A;  2NQP A;  2G0I A;  4OX8 A;  3DLB A;  2GC8 A;  1DQ9 A;  3TAQ A;  4C4W A;  1FK9 A;  4PRF A;  2WON A;  3CJ0 A;  4CLU A;  1X8D A;  2XY7 A;  2OPQ A;  1URN A;  4EZ9 A;  3KHR A;  1KOH A;  4C3L A;  2C2N A;  3R1L A;  2BDP A;  4F04 B;  3QO9 A;  3NKY A;  1RWU A;  1FXR A;  3UQS A;  3NS5 A;  5J2N B;  5A6P A;  3CCW A;  1FA0 A;  3OVB A;  3FSX A;  1S1T B;  2B9W A;  2UVR A;  1AFJ A;  1RLC L;  1KVK A;  4CLZ A;  1ZZF A;  3PM9 A;  4USW A;  4TKT A;  4OZ1 A;  1XMQ J;  1VCT A;  1TAU A;  2CQP A;  1KHV A;  3H42 A;  1WHW A;  3C66 A;  3OFH A;  5CAB A;  4OYM A;  4FXW A;  5E0O A;  5A8K B;  3L4B C;  4A8S A;  4J9R A;  1Q8I A;  1WOP A;  2BKP A;  2CPD A;  3CF5 Q;  3RBE A;  2RF2 A;  1DQ8 A;  4RW8 B;  1I94 F;  1TKX B;  4DV4 F;  1UZD A;  5ETR A;  4ELU A;  3PW2 A;  1VQ8 S;  2HRU A;  1OYD A;  1K8A T;  3K7R A;  5DDP C;  3EYZ A;  3DKD A;  3VZH A;  4Z37 A;  1VGY A;  4FDF A;  2W9C B;  1UFK A;  4GVB B;  4A48 A;  4ER8 A;  1KEK A;  2YTC A;  2YY3 A;  1U0H A;  1H0H B;  3TP2 A;  5C42 A;  1EKS A;  1B7F A;  2MKS A;  1K9M T;  4V19 J;  3CCE S;  2L9N A;  4J9U E;  3G9C A;  3HP6 A;  1NJX A;  3C16 B;  5AJ3 J;  2KN4 A;  4X62 J;  3R97 A;  4Y2K A;  4NCA A;  3HO1 A;  3L9Z A;  2POK A;  3SQO P;  2OIH A;  2DJW A;  4YHH F;  1GQE A;  2KL8 A;  4O23 A;  2M70 A;  4UOG A;  2ZZT A;  2Z2Z A;  3M8P B;  1TMJ A;  1RAA B;  5K8N A;  1RTI B;  3MD3 A;  1Y9O A;  2E7W A;  3KNA A;  2CJQ A;  2C3M A;  3W1Y C;  1SH0 A;  1RTD B;  4B9L A;  4RJV A;  1F2G A;  4OFZ A;  1RWP B;  3WX4 A;  1GTH A;  2XS2 A;  3QGG A;  1DJ0 A;  3U7J A;  3QZ8 A;  2QA4 G;  2CJY B;  2MQM A;  3M1V B;  1KFD A;  3UNY A;  1RJJ A;  2IMO A;  2R2U A;  4NLQ A;  2RU3 A;  4Z7C A;  2AU0 A;  2NPF A;  5KG0 A;  4OZJ A;  2KM8 B;  3ETO A;  4KQZ A;  3H5Y A;  4CO0 A;  4UTG A;  1N32 F;  1OQ6 A;  1B4S A;  4XTT A;  5MLC V;  1BE4 A;  2R8H A;  3LOU A;  1RHJ B;  3FCH A;  2AGO A;  4NWB A;  1E6Y B;  3ZZT A;  2RML A;  2DPJ A;  2IDL A;  5ETL A;  4CH7 A;  4U6P A;  4IRC A;  3V4I A;  1HR0 J;  4MAK A;  2EI5 A;  4DV5 F;  4WII A;  4QU7 A;  4EO6 A;  1M5K C;  5I3U B;  3LH2 S;  4ED8 A;  5KFE A;  2NPI A;  2ABY A;  1ACM B;  3B4D A;  5IT4 A;  3NGU A;  2XZW A;  1HWL A;  3KK2 A;  3DYA A;  1PKU A;  3NCP A;  5KFH A;  2EFN A;  2CJK A;  2I0X A;  1X5O A;  2V8V A;  5D78 A;  3BH6 B;  2Q6C A;  5F41 A;  4JP8 A;  2BBE A;  3VVT A;  2DHH A;  4PG8 A;  1VRQ C;  1LXJ A;  1I6J A;  1DTQ B;  5ETN A;  1GMU A;  4K4Z A;  3F44 A;  4DN0 A;  2YH0 A;  5DRK A;  2EK1 A;  4I6Y A;  1QVF R;  3MPY A;  3PZP A;  1CJU B;  2VH7 A;  3AOB A;  2J8S A;  2JX2 A;  3KTQ A;  1ZZN A;  2AEF A;  1GXU A;  3P49 B;  2R7O A;  2CQ3 A;  1N88 A;  1RTH A;  4OMF G;  2ZVI A;  4O3Q A;  1WHY A;  4WFX A;  3VQS A;  3O5T B;  2VFT A;  1QAX A;  4R25 A;  5KFZ A;  3RZA A;  5DLG A;  1N56 A;  3FJ2 A;  1RT3 B;  4LFB F;  2HIQ A;  2LXF A;  3H2V E;  3CT9 A;  2G13 A;  3UI3 A;  2MTL A;  3KG0 A;  1YZ7 A;  1MU2 B;  2MQP A;  5LMN F;  4I68 A;  2CQD A;  3I6P A;  2H1Y A;  4G3I A;  1RTJ B;  4DV2 F;  2DR9 A;  2OKQ A;  4FF4 A;  5KG4 A;  3T9Z A;  4P72 A;  1SL1 A;  3TRG A;  1UET A;  4JI3 J;  4WYL A;  4UOH A;  1FEH A;  5J2N A;  4U8Y A;  5K14 B;  3MTJ A;  4I6A A;  1R8C A;  1T9W A;  1X9W A;  2MLY A;  2PO4 A;  5B7W A;  5I3P A;  3I5C A;  3TI0 A;  1S1T A;  3OSP A;  2AF6 A;  2FJW A;  3VAI A;  3K89 A;  3SZ2 A;  4NLD A;  4EO8 A;  4C3M A;  1KTQ A;  4ES2 A;  3AD7 C;  4ECW A;  2XCA A;  4K59 A;  1CQM A;  2NUU G;  3T1H F;  4OQJ A;  2FZC B;  5A8K A;  4ENO A;  1KQG B;  2QLB B;  2QN6 B;  2RQC A;  3IR5 B;  1D9D A;  5GMD A;  1QLN A;  1TP7 A;  3HJF A;  4B3M J;  4RW8 A;  3EM1 A;  3E2E A;  1TFY A;  1TKX A;  2H5I B;  1B7Y B;  4KGX B;  3NS6 A;  3H8Y A;  2OGU A;  2NSC A;  4OYI A;  1H72 C;  4DQQ A;  1GFW B;  2XTJ P;  3FC9 A;  2W9C A;  2P8I A;  3ENA A;  3ZTO A;  4GVB A;  1LWF B;  2BM0 A;  4XPE A;  3BSC A;  2CJ9 A;  3MAH A;  2HGL A;  4Q8E A;  3PEH A;  4MKY A;  4FVC A;  3C16 A;  4ZCI A;  1WD6 A;  2AW0 A;  4DR4 F;  4CLL A;  4QW8 A;  4F3Q A;  1DUR A;  1TUW A;  5LXY A;  1IBL J;  2ZE2 B;  1T03 B;  1HHT P;  3CJK A;  1WKK A;  4UUW A;  2CKW A;  1S12 A;  4H4K A;  1SKS A;  4CLF A;  3UD4 P;  3M8P A;  2ZEJ A;  1FRH A;  4PWU A;  4RNM A;  2D3O 1;  1RTI A;  2VQE J;  2UUT A;  4QPX A;  4WKY A;  1RWW B;  1RTD A;  3HK2 A;  3CCZ A;  2VBW A;  1T11 A;  3OL9 A;  4QYR A;  1Q86 T;  2VUG A;  4QJV A;  4B9S A;  4WTO B;  4I1T A;  1X4H A;  1K0T A;  1Q8B A;  2RAQ A;  3I0S A;  3HZG A;  4H4K C;  3M1V A;  2BAB A;  1ZPV A;  1HPZ B;  3R7B B;  5BYR A;  4UY8 T;  2VKZ G;  3J7A N;  2EFG A;  1SC1 B;  1X7V A;  4I7F B;  4EI2 A;  1HKA A;  2WZ1 A;  1OY8 A;  3VAK A;  1QTN B;  2LA4 A;  3UVJ B;  3HFK A;  1L3V A;  1WSR A;  3M6W A;  4RNN A;  1SJ4 P;  3R5A A;  1KDN A;  3C14 B;  1E6Y A;  4EK2 A;  2KM8 C;  2IYI A;  4BS2 A;  3DXB A;  4CNZ A;  4RUB A;  1SKR A;  1NBE B;  3NP5 A;  5I3U A;  2B56 A;  4P73 A;  1RA6 A;  4ZHR B;  3EGN A;  4DHV A;  5D4L A;  2FY1 A;  3FSY A;  4U7C A;  3NNA A;  2LQJ A;  4CH1 A;  2HHV A;  3N0V A;  1YHQ S;  2V4R A;  4HHU A;  1T7P A;  3KJV B;  3UDV A;  4HYK A;  1HNZ J;  3D3C J;  2VJV A;  4DUZ J;  1REG X;  1ROF A;  4ZN1 A;  4QWB A;  4EFA C;  3HSD A;  1DTQ A;  4ZVU B;  1NZA A;  4TQR A;  3HD1 A;  1QDU B;  4ZJQ A;  4QYZ K;  4QZV B;  3D6H B;  1SXL A;  4Y0F A;  4IFY B;  1C1C B;  5C24 B;  1SJ3 P;  2E7X A;  1QD1 A;  4P52 A;  1CJU A;  3JTN A;  2MY8 A;  2MQO A;  3BR9 A;  1TUG B;  4J9N A;  3HSG A;  2WVD A;  4K4Y A;  3GQC A;  3WDO A;  1X5T A;  4IKA A;  1RLD A;  1WOO A;  2FJB B;  2DH7 A;  1RT3 A;  2DCL A;  4DPX A;  3R1H A;  1BXN A;  1YRX A;  3EJM A;  4HHJ A;  1KRP A;  3H90 A;  1MU2 A;  3OT9 A;  3CCT A;  4ED5 A;  2ZIT A;  3KXD A;  3DDN A;  2E5J A;  3MTK A;  2RDJ A;  1RTJ A;  2X3G A;  4DR3 J;  4OYB A;  2HRY A;  1XNR J;  4RKU C;  5CYM B;  3RGI A;  4WTY A;  1ZA1 B;  3RB3 A;  4F0K A;  1WJ9 A;  5KAK A;  2EFQ A;  1R6Y A;  2BJ1 A;  3G4S S;  3I0R B;  1DTT B;  4RO0 A;  2MKH A;  5DET A;  4CTA B;  2CJA A;  2UVV A;  1U48 A;  1F2H A;  5GAD I;  4JI8 J;  4X4T A;  3BF4 A;  1HWJ A;  2FHO B;  2VOO A;  4JI6 F;  2ALY B;  4I2P B;  4ZIV A;  4IQX A;  3J7A 1;  4DQS A;  4A8F A;  1CBK A;  1FWP A;  3KK3 B;  1SB6 A;  4QIG A;  4BLG A;  3ZZZ A;  5LOQ A;  2O3D A;  4RL1 A;  1EP4 B;  2M2B A;  2UVU A;  3DU6 A;  1S6Q B;  4M94 A;  2ATL A;  5KFX A;  1LW2 B;  3OTE A;  3H5X A;  2MQQ A;  4G1P A;  5C7P A;  5L9X A;  4LRD A;  1VS3 A;  4K4X A;  3D1H A;  1DY3 A;  1KC8 T;  3DI6 A;  2BEF A;  1XR6 A;  5T14 A;  2GV1 A;  4QR2 A;  2HHQ A;  3PFE A;  2KRB A;  4LF5 J;  2C1E B;  2ZH5 A;  4MIB A;  1MWZ A;  3CDE A;  2I38 A;  1U8S A;  2MEW A;  3CCJ S;  5I4M A;  1LWF A;  1I94 J;  4LMZ A;  1O6X A;  3M05 A;  2O67 A;  4DV4 J;  2ERR A;  1VQO S;  3JSY A;  1OS5 A;  3BQ2 A;  2MLX A;  4LUB A;  4DX6 A;  1RT4 B;  4PR6 A;  3OLA A;  4LBH A;  3V6D A;  1PJ7 A;  4WP3 A;  5K8M A;  1VBZ A;  4NLP A;  3MM7 B;  1V3Z A;  5LMU J;  1XK8 A;  2ZE2 A;  1T03 A;  2XYG B;  1RT1 B;  1SUQ B;  2OHD A;  1B70 B;  5L1L A;  3HHL B;  3HVA A;  2EEY A;  2FJV A;  1D8Y A;  5LXR A;  1WEL A;  2HK3 A;  2COL A;  1PCA A;  3JYT B;  1N36 F;  5F3Z A;  2ZH4 A;  1XMO J;  4CT9 A;  5KG3 A;  4AQY J;  5C25 B;  1REV B;  3PYD A;  4WK1 A;  3D0H E;  1U7L A;  4WU3 A;  1FJG F;  3FBB A;  3VVU A;  4ZIT A;  1NHU A;  2DRB A;  2C2R A;  2Z8Q A;  4PKD B;  3PXG a;  2R7T A;  4X4P A;  3X1L B;  4I7F A;  5KFO A;  3WX8 A;  3W5Y A;  3OBI A;  4CWB A;  1MN7 A;  2ILY A;  2B43 A;  1LWC B;  3QGP A;  3M32 B;  3BDE A;  3CO0 P;  1Y3J A;  4TLQ A;  3UVJ A;  5IFM A;  1SC6 A;  3ELH A;  1QAI A;  4EZ6 A;  4X4N A;  4CYU B;  3C14 A;  3GWC A;  3UN3 A;  5KFI A;  4A8M P;  5E33 A;  4KIA A;  2X1F A;  1YJ9 S;  3TUJ C;  3M8W A;  5KFB A;  2QEX S;  1EAR A;  2F8E X;  2V50 A;  1D8Z A;  2DNM A;  4ZHR A;  3K59 A;  1TV6 B;  2JEF A;  3PY8 A;  5L1I A;  3H4D A;  4CLK A;  1HWU A;  2EC2 A;  2YWH A;  3MMJ A;  3ILI A;  1EQ0 A;  3KJV A;  4J9P A;  1K0V A;  2K7K A;  4LF9 F;  2EKY A;  3WIV A;  2HHT A;  4DSL A;  2PT0 A;  2JLE A;  2DPI A;  5HN0 A;  3MWB A;  1RHQ B;  3NGK A;  4IFY A;  1C1C A;  3HXM A;  5C24 A;  4NML A;  1NAQ A;  2LCW A;  3CIZ A;  1QSS A;  1PIL A;  3IM8 A;  3CJR A;  1U24 A;  2VON A;  5FDL B;  2DNN A;  4EGL A;  2A0F B;  1VC6 A;  3E01 B;  3IR7 B;  4C8Y A;  3PV8 A;  1NKC A;  1SIZ A;  1F3F A;  4F25 A;  2ZM6 J;  1GMV A;  3PR5 B;  2HFN A;  5BYS A;  3HVW A;  2XM3 A;  4TNO A;  3GJR B;  5HI7 A;  1RXO B;  1OYE A;  5B0G A;  5L8R C;  1JJ4 A;  4UST A;  4LF6 F;  3MM5 A;  2K8G A;  2HVE A;  1WTF A;  4I56 A;  2H3E B;  2IJR A;  5CYM A;  4Y2A A;  5HO4 A;  4LFB J;  1N8R T;  1A6L A;  2E29 A;  3I0R A;  2CPZ A;  3G82 B;  1DTT A;  2UXB F;  1PJ5 A;  1DZ5 A;  1ICE B;  4NMX A;  4CTA A;  4M5H A;  5HRO B;  1AT1 B;  4IYQ A;  2OMO A;  2ZWO A;  3KNG A;  5ADZ A;  2HAF A;  2W24 A;  2KO1 A;  3D3B J;  4I2P A;  1R43 A;  3Q8V A;  2CQ2 A;  3T9N A;  1MML A;  3KK3 A;  3GFY A;  1EP4 A;  4QCL A;  1S6Q A;  4KKO A;  3I9Z A;  2PE8 A;  1HW9 A;  1LW2 A;  4QYZ J;  1HA1 A;  1WWH A;  3HSZ A;  3NLC A;  2RQM A;  1VQY A;  3CCU S;  2NZ4 A;  4F7V A;  1VDH A;  1WUU A;  2YX1 A;  3KLE A;  2HMI B;  4PYD A;  3E51 A;  1YJW S;  2YBV A;  4USH A;  3QSY B;  2IVY A;  1CC7 A;  2J0Q D;  3PYG A;  3ISZ A;  1FJE B;  4GC7 A;  3FCW A;  4IH7 A;  4JV1 A;  1VQ4 S;  1FVS A;  2CWX A;  1EIY B;  2HIY A;  1JLG B;  2B3T B;  4DV6 F;  1YJR A;  5B0C A;  2E7V A;  3CJS A;  3THV A;  3VTI A;  1RT4 A;  2DXF A;  2Y0B B;  3GIM A;  1UJ4 A;  4ZLL A;  1WEZ A;  3MM7 A;  2CG8 A;  4MH8 A;  1HW8 A;  3OJS A;  4DR1 J;  2JZ5 A;  3CB4 A;  4I4B A;  1SUQ A;  1XR7 A;  5IC4 B;  2CQI A;  1WC6 A;  3HHL A;  2UUW A;  4MKB A;  3BPD A;  4OYA A;  3K58 A;  2Q43 A;  3R5D A;  2GO9 A;  3RR8 A;  3QIP B;  5JVG Q;  3TUI C;  1YK9 A;  1HQ2 A;  1JK9 B;  3OR2 B;  3JYT A;  2YNG B;  4E2F B;  1N5Y B;  1FDA A;  5HMW A;  2WB1 D;  2FIU A;  4DX5 A;  2ZH7 A;  4NA3 A;  2V34 A;  5C25 A;  1REV A;  4OHX A;  3HPO A;  4HT7 A;  2GHV C;  2GQ2 A;  3VAL A;  3QT6 A;  4DDF A;  2QE5 A;  3K57 A;  1RGV A;  2DHA A;  5L1J A;  1PYT A;  5ETV A;  3TR5 A;  2GFF A;  3QZ7 A;  1H2V Z;  2P9C A;  1LWC A;  2AQ4 A;  3M32 A;  5D0E A;  2ZBP A;  2KB2 A;  4A8K A;  1TL4 A;  1KSP A;  4OJ1 A;  3DLJ A;  1H7W A;  1VLO A;  3GII A;  5E3R A;  2W9B B;  3CUL A;  2J76 E;  4L75 A;  1F1B B;  2BKO A;  4DEZ A;  2XC9 A;  3OL8 A;  2X1G A;  1NDC A;  3N4W A;  2HEK A;  1QM9 A;  5IT0 A;  4J91 A;  4YFU A;  2YWG A;  3HT0 A;  5CZV A;  2AYM A;  1TV6 A;  2ZC4 A;  5LSL A;  4ITS A;  3Q8S B;  2MXY A;  2K06 A;  1X0F A;  3P6Y C;  3I4H X;  3LUY A;  3F56 A;  2J0X A;  3R9L A;  4FZV A;  4DU8 A;  1S0O A;  4NX9 A;  2E1A A;  3M8Z A;  3FKB A;  1M5P C;  2HHS A;  2VIC A;  2F8M A;  1HI1 A;  2DGO A;  3R7N B;  1N54 B;  3F41 A;  3GCX P;  3ZZY A;  4DQI A;  4AL7 A;  2W4P A;  2E1R A;  2QMU B;  2K2P A;  2HPU A;  3J7Z 5;  2FC8 A;  3C15 B;  2Y8Y A;  4HDH A;  2VA3 A;  1FRJ A;  1AYE A;  4MT1 A;  2NXE A;  3AJ2 A;  5ETT A;  1NK0 A;  3TVK A;  5IZH A;  4JI7 F;  4ALZ A;  2DO0 A;  1U47 A;  1DFD A;  5FDL A;  1OIA A;  4UQG A;  3NOG A;  3LWM A;  2ZHB A;  4PXD A;  3E01 A;  3M2U B;  2FLO A;  4KY3 A;  4K0K F;  1X9S A;  3PW7 A;  1H7X A;  3D68 A;  4I64 A;  3ISN D;  2KTQ A;  4ZMM A;  1N5T A;  5B0B A;  1JLE B;  1G4C A;  2GHP A;  5H9E J;  3TYT A;  1S99 A;  3KLI A;  3UR0 A;  2R7S A;  1N52 B;  2UZA A;  4FYW B;  5DQI A;  1CQN A;  3M8Y A;  1RCO B;  3SCK E;  5DDQ C;  4G6V B;  4XO0 A;  1UPP A;  1CEZ A;  3EMT A;  2G9O A;  1NO8 A;  2RRA A;  2E9T A;  2MY7 A;  4AFF A;  3G82 A;  5KG6 A;  3QLH B;  4Q7A A;  4EBE A;  1U49 A;  2XNR A;  4R5P B;  4M5D B;  3CDB A;  4IRK A;  3HZE A;  3LAN A;  2J0S D;  4NA1 A;  3KYL A;  1NK6 A;  5HBM A;  4ES1 A;  2BRK A;  1YJU A;  2CNL B;  5SZT A;  5HRO A;  1IJE B;  1RT7 B;  2EFP A;  4JI4 F;  3OXL A;  2KFN A;  1P9Q C;  4X2B A;  4MKV A;  5M2U A;  4BHQ A;  3CVK A;  4OI6 A;  4KR0 B;  1MRO B;  4B3S J;  3IR6 B;  3MEE B;  4F36 A;  3T5H A;  2H65 B;  1ZOT A;  4X65 F;  2V2K A;  4O3R A;  2QV6 A;  2U2F A;  4I69 A;  1M1H A;  3CME S;  3FSI A;  1BWE A;  1LOU A;  2VDI A;  4ZPB A;  4PXC A;  2BVZ A;  2HMI A;  4C9D A;  1NEE A;  2BMB A;  3OFG A;  3MUR P;  2K3K A;  3DOK B;  1NUE A;  2QO3 A;  4K8R A;  2ZC3 A;  3NMA A;  3DGP B;  2BX6 A;  4FP9 A;  1F60 B;  2CPH A;  3CJQ A;  4BWM A;  3MPV A;  4R0J A;  2J8A A;  4DV1 J;  1JLG A;  4F4A A;  4F2R A;  1XR5 A;  2WSC C;  4LF8 F;  1QJH A;  2Z4P A;  4TLR A;  3KJN B;  1VBY A;  1M5O C;  4EWT A;  3HVR A;  3Q8Y A;  3ZXW A;  3CIM A;  3GV8 B;  1FJC A;  1JLC B;  2LMI A;  2H48 B;  2B8Q A;  4TXS A;  4LFC J;  4C97 A;  1WAC A;  2VPX B;  4ILM A;  1IQZ A;  2BYC A;  3BO3 A;  5CA5 A;  4ZA1 A;  2V9W A;  2VD3 A;  4KHM A;  2JWN A;  1Y7P A;  1SJQ A;  3KHL A;  5KT6 A;  2RD5 C;  3QIP A;  4B02 A;  1ZA2 B;  5L39 A;  4OI2 A;  1Q53 A;  4OI1 A;  3OR2 A;  1RCX B;  2YNG A;  2HG4 A;  1TK5 A;  1N5Y A;  3GYX B;  2BJ9 A;  1ZH5 A;  1NB7 A;  4XDD A;  4DV3 F;  3RB6 A;  3MR2 A;  3ET6 B;  3CCM S;  3KLF B;  2IA6 A;  2XLI A;  3HHK A;  1I3O B;  1IR2 A;  4C0O C;  3P5B P;  1QUV A;  3ITH B;  1YQH A;  1N36 J;  2W1B A;  3K5P A;  2G2Z A;  4RLE A;  4C2M A;  5CD4 H;  4K50 A;  2AJF E;  3N28 A;  3KK1 B;  3B54 A;  1RB0 A;  3DGV A;  1E6V B;  1FJG J;  2PDA A;  2ZJQ Q;  3UD5 A;  4EYH B;  3VAF A;  2L41 A;  2W9B A;  2AJ4 A;  4JI2 J;  1KQF B;  3TNV A;  3TZZ A;  2W8K A;  3VZI A;  4W98 A;  3D2W A;  4DJB A;  1P27 B;  3GJT B;  5F3T A;  1SKU B;  4N7T A;  2EBG A;  1FKP B;  3MOZ A;  1UPM B;  2WCX A;  5LSR A;  5DM6 Q;  5MAO A;  2DKO B;  4FPR A;  2LFV A;  4DUT A;  1KON A;  1ELO A;  1HNW F;  3DDI A;  4HKQ A;  4MJK A;  2P9E A;  5DQG A;  2KG0 A;  3OJU A;  1J5E J;  2EG1 A;  4DR5 F;  4CLW A;  1WI6 A;  5T7L B;  3IC1 A;  1FDB A;  2CQC A;  1R0A B;  2EFV A;  4RR5 A;  2RQK A;  4RX6 A;  3DLK B;  5KFV A;  1H74 A;  2B7B B;  4B3T F;  4OYZ A;  8RUC A;  3CJ4 A;  1ZAX A;  3C15 A;  2CQ0 A;  3ILO A;  2FVP A;  2V8G A;  3MFH A;  4LF7 J;  2OPR B;  3R3T A;  4ZOS A;  3TUZ C;  1Q8K A;  2ZWP A;  4Y28 C;  1S7I A;  1GNK A;  3DM2 B;  3MR5 A;  3H5U A;  4RW6 B;  3M2U A;  4ZPT R;  4ZIW A;  2M7S A;  1HIY A;  1WG5 A;  2DY9 A;  3HHD A;  3SXL A;  3M6U A;  2C3U A;  3PO4 A;  4KFB B;  3QRQ A;  5EX0 A;  2U1A A;  2HBZ B;  2HRT A;  5F8M A;  4O4R A;  1JLE A;  5CYJ A;  3M6X A;  2B4V A;  2C2E A;  2HHU A;  2ZH8 A;  2RB7 A;  1SPB P;  1RUS A;  1VK8 A;  2DR7 A;  1VRT B;  3W2W B;  3CJ5 A;  3VV2 B;  3QLH A;  2IAJ B;  4PG4 A;  4RW4 B;  4DSJ A;  1V6H A;  5HAN A;  4M5D A;  1R0B G;  2OO4 A;  3BV8 A;  1NJW A;  2PFF B;  2G1D A;  4ECU A;  5D0H A;  3BBB A;  1XMQ F;  2OAU A;  3JQM A;  3GIL A;  1RT7 A;  2DRA A;  4ELT A;  4NEZ A;  2Z2Y B;  3O3L A;  2HFU A;  2UXB J;  2AZ1 A;  3T5L A;  2V67 A;  3FEX B;  1T9X A;  2XNQ A;  5EX3 A;  3H40 A;  1N33 F;  2RNE A;  1NHV A;  1RDR A;  5JVH Q;  4MK8 A;  2ZBC A;  1MRO A;  1YBA A;  4J9M A;  3MEE A;  2ZH6 A;  1O8B A;  5I42 B;  1GAO A;  2L08 A;  2V68 A;  1Y5N B;  4KH1 B;  4ED0 A;  2GZO A;  2IA0 A;  1A0O B;  2XMW A;  1WKJ A;  1CUL A;  5J1N A;  1YRT A;  3K5M A;  2JRS A;  4Q44 A;  2XEX A;  2W9A A;  4PQA A;  3DOK A;  2NR0 A;  1B64 A;  1NSP A;  2FPH X;  1HNX J;  3M8Q B;  1JXE A;  4WXO A;  3PRD A;  3N5F A;  3DHW C;  2CQB A;  3AOA A;  3CD5 A;  4QW9 A;  4LSZ B;  5B08 A;  1Y4Z B;  3D4J A;  1VK3 A;  2FVC A;  3HDS A;  1X5P A;  2VPY B;  3T1A A;  2JNJ A;  2NXJ A;  3M4X A;  4DCO B;  4RZR A;  1MW7 A;  3D7S B;  1FNO A;  2JEI A;  4ZN3 A;  3A8E A;  3PJW A;  1JLC A;  3OV7 A;  5AJ3 F;  4X62 F;  3ZO7 A;  5DZ7 A;  3T19 A;  3MGJ A;  1MMD A;  3CCQ S;  4A8X A;  5B0F A;  2V8P A;  3BDP A;  4OJH A;  2KXF A;  4QBU A;  2KZZ A;  1SCJ B;  1KLN A;  2XB2 D;  1SJ1 A;  2XI2 A;  5BR8 F;  4USU A;  1XEZ A;  2KYZ A;  4CI0 B;  1H2T Z;  1U1O A;  2V2V A;  2Q6B A;  4HLB A;  3I96 A;  2QL5 B;  4FKX A;  3LGH A;  1RAG B;  2V2Z A;  5KFG A;  3KKF A;  2LP4 A;  3KLF A;  1S9G B;  1HNV B;  1NHK L;  4HI2 A;  3ITH A;  2YQ0 A;  2CAD A;  2APO A;  3SV4 A;  3LTO A;  3KK1 A;  2HHH J;  4PPZ A;  3MOJ B;  1E6V A;  1S1X B;  4TVA B;  3QQC D;  2NLW A;  2EW9 A;  2O01 C;  3EGV A;  4E8U A;  1KQS R;  3EGZ A;  3UDL A;  1IBC B;  4WFA Q;  1FKP A;  2DYA A;  1G6B A;  1HR0 F;  4RNH A;  3EE3 A;  3TQE A;  3VR1 A;  3UR3 C;  3H20 A;  4DZD A;  3R2D J;  3M8R A;  2V8H A;  4NYZ A;  2HWH A;  3QJP A;  2UUC J;  3NS7 B;  3DRP B;  2R2S A;  1DRZ A;  4UOF A;  1RZM A;  4YP3 A;  4MK7 A;  2DH9 A;  2HFO A;  1RWM B;  2CPF A;  5J2Q B;  2XQC A;  1FTR A;  1FJ7 A;  2JL9 A;  2R3V A;  3RW6 A;  1UVM A;  1XMB A;  4CO3 A;  4PXE A;  1IVZ A;  3BZQ A;  4WZM A;  3J7Y I;  2CNN B;  5T7L A;  2UXD J;  4NEY A;  1R0A A;  3B6B A;  1Q95 G;  2QSW A;  5GAH I;  2A6M A;  1RT2 B;  2Z56 B;  1DLO B;  1IKY B;  3PW0 A;  1S4E A;  1NDL A;  1JJC B;  4AL6 A;  4QIV A;  2HVD A;  3O8W A;  3I4P A;  4ANE A;  5KG2 A;  3JB9 k;  3SIP B;  1BD6 A;  3DM2 A;  1FRK A;  1RWK B;  4N77 A;  4RW6 A;  4B08 A;  2HS4 A;  4W92 B;  4FF1 A;  3UWT A;  4LRE A;  2K3I A;  4DOZ A;  4ZJO A;  2FZK B;  4C98 A;  2GA7 A;  3AA8 A;  2RE1 A;  3TUP A;  2W7P A;  3HI9 A;  3KWM A;  4KFB A;  1KD1 T;  2YWE A;  4B9V A;  3R8Y A;  1NKB A;  5EDW A;  1GMW D;  2XMV A;  3QJL A;  1YKW A;  2IM0 A;  1YIJ S;  3GPA A;  4K0K J;  2GHW A;  2XMA A;  1S6O A;  1WKL A;  2YKO A;  3QJJ A;  1VRT A;  1RHK B;  3DLH A;  3W2W A;  3FBC A;  4K2J A;  2IAJ A;  2VG7 A;  4RW4 A;  4GRS A;  3NGS A;  3NRB A;  3FMW A;  4JUZ A;  4K4T A;  3QO9 B;  3LP1 B;  3IBF B;  1WEX A;  5GMK a;  5F8G A;  2GGP B;  4GMK A;  2XWY A;  3GP9 A;  5A76 A;  2MKY A;  2VOP A;  3R5G A;  2Z2L A;  1NLK L;  1XTZ A;  2HKE A;  4URQ U;  3RBX A;  1BUX A;  3TWZ A;  1GT8 A;  2YNI B;  4QU6 A;  2PN6 A;  1U6Z A;  2IM1 A;  2SXL A;  2GQC A;  4B3M F;  3PIP Q;  1M1G A;  4UF4 A;  1EX8 A;  5AXK A;  1FT8 A;  2V6A A;  2AEM A;  2YWK A;  3AXM A;  4DX7 A;  1NDK A;  2ZNY A;  2B9Y A;  3R6G B;  2R4F A;  3PTW A;  4X65 J;  4C8K A;  3T1Y J;  3M8Q A;  3PRB A;  2IVM A;  1GX6 A;  1VQ7 S;  3GJS B;  4IG3 B;  2GAG C;  4F3O A;  3KHG A;  3ENW A;  3BN7 A;  4TYA A;  5F8N A;  3GFZ A;  3CO9 A;  2WVE A;  4C48 A;  3CCL S;  1KN6 A;  4LF1 A;  1S1U B;  1KNZ A;  3DC2 A;  4ANC A;  1RYS A;  3NGR A;  2VFU A;  2JLG A;  1VC5 A;  3I82 A;  5AE3 A;  3W9I A;  2ZH9 A;  3PO5 A;  5KT3 A;  3AOC A;  1IBL F;  2CNO B;  3BBC A;  4F26 A;  4BC7 A;  1FDN A;  5HJX A;  1HMV B;  2PI5 A;  2VQE F;  1ZM2 A;  2HW3 A;  4YEA A;  4KJI A;  4ILL A;  2AEJ A;  2GIF A;  2M8H A;  4WCE Q;  5I3Q A;  4IDK B;  1QAJ A;  8ATC B;  3JAM U;  4BC9 A;  2HVI A;  3UE2 A;  4I67 A;  1C0U B;  3QMQ A;  1S9G A;  1Q78 A;  2CIM A;  4P7V A;  4B17 A;  2VU5 A;  1RK8 A;  1HNV A;  3O2I A;  3BEG B;  1S1W B;  2B6A B;  2PEH A;  2YKA A;  5HMZ A;  3A3O B;  2CQ4 A;  3GR0 A;  1FKO B;  4RWX A;  4KGZ B;  2HZA A;  2X51 A;  1S1X A;  5B0D A;  3MM9 B;  3THP A;  4OYP A;  3PX0 A;  1UVJ A;  4DL0 C;  1TK0 A;  4X4Q A;  2MZJ A;  1F9H A;  4CT8 A;  2LXU A;  4WXW A;  1Q16 B;  2CDR B;  1ZPW X;  1VIS A;  2MKK A;  2YKN B;  2FZG B;  3AFG A;  3BR8 A;  1KTV A;  3DOL B;  3SDE A;  3FVY A;  4ZP6 A;  2L3M A;  3UDE A;  2C3Y A;  2DIV A;  1XQI A;  4G1Q B;  3SCL E;  3DRP A;  5KG5 A;  4B9N A;  1WC4 A;  4NLT A;  3G6E S;  5J2Q A;  1UWA A;  1CG2 A;  1SI9 A;  2D3Z A;  1HNZ F;  2Y0S D;  4Q43 A;  4DUZ F;  1P1L A;  3JQK A;  2BOP A;  2OD6 A;  1RWN B;  3FEZ A;  3SEO A;  3GLJ A;  2QZ8 A;  1L3U A;  3JTO A;  1YBT A;  4LVO P;  3OLB A;  1RT2 A;  3V6J A;  2KT2 A;  4EBC A;  1IKY A;  1WHV A;  4ZCK A;  2N3L A;  2PFD A;  1S9F A;  1WF0 A;  1JXV A;  3UO0 A;  2DNL A;  1NND A;  1YZ6 A;  1PIE A;  3DN9 A;  4AD6 A;  4JI0 J;  3MAA B;  2LVW A;  3C6T B;  1IN0 A;  2UXC J;  1FKA F;  4FS2 A;  1C0T B;  3GYN A;  3FQL A;  3F73 A;  1OY9 A;  1P6T A;  2IBO A;  4MTP A;  2XMT A;  1KS2 A;  3RAQ A;  2WW4 A;  1O5J A;  1OWX A;  1L5U A;  2ZBI A;  5DGB A;  3DRR B;  4JI1 J;  3GE9 A;  4IUF A;  1NK4 A;  4DR3 F;  3O44 A;  1RI7 A;  1XNR F;  3QID A;  2ASY A;  3LAK A;  1QVG R;  3PG9 A;  1WOS A;  1ZAV A;  3Q86 A;  1UMJ A;  1LKZ A;  4ZVT B;  2KZM A;  1PGZ A;  2FVS A;  1TEL A;  4X4O A;  3P4U B;  3KLH B;  2FJX A;  1HHS A;  2R42 A;  5E41 A;  2AD9 A;  1FXL A;  3BKF A;  1WDT A;  5ETS A;  2ROG A;  2F4F A;  3JAM Y;  3ICL A;  4OLO A;  4JI8 F;  2VA2 A;  2LLZ A;  3LP1 A;  2O1P A;  5KFS A;  3TA0 A;  5DM7 Q;  4DR2 J;  3MEG B;  2GGP A;  2N82 B;  3G6V A;  7AT1 B;  3J7Z T;  4YDX A;  2K7J A;  3LP0 B;  3VGU A;  2HNY B;  1I51 B;  2HND B;  2ZVS A;  3HKW A;  3BGU A;  2HS0 A;  4DX8 H;  3J81 j;  4QPT A;  3ZZP A;  3R5J B;  2GMJ A;  2YNI A;  1D3W A;  3LA0 A;  3B78 A;  4KE5 A;  1RSC A;  4MFB B;  3LQV A;  2RRB A;  1N33 J;  3BGO P;  5AXM A;  2GW8 A;  4DS4 A;  2HQ3 A;  2FQQ B;  4DG1 B;  4OIX A;  2E1M C;  3WC2 A;  3G6X A;  4P7T A;  5A8W B;  4LF5 F;  4YB5 A;  5HQ8 A;  4DU7 A;  3CE8 A;  1RAD B;  2VKR A;  4B9T A;  7FD1 A;  1UJ5 A;  3UW1 A;  4IG3 A;  3MR6 A;  4EU0 A;  2VFR A;  3D6F B;  4XDC A;  3BO4 A;  4UZB A;  3RAM A;  3FEY B;  1S1U A;  3D0I E;  1LK7 A;  2CPJ A;  2NXU A;  2VQF J;  1T8E A;  1SC4 B;  3QAT A;  5HLF B;  3MI7 X;  2XSF A;  1RKI A;  1LW0 B;  2YQ1 A;  4X64 J;  1JX4 A;  2N3O A;  4YR0 A;  2OPS B;  3TVZ A;  2AX0 A;  2UUB F;  5LMU F;  3D1Q A;  3C46 A;  3VGV A;  2W2N P;  4YR2 A;  5ETM A;  2AYG A;  4ED2 A;  2JDJ A;  5B0A A;  1HMV A;  1RYR A;  1Y00 A;  1KKH A;  3R2C J;  4DPY A;  5A0Y B;  1U2C A;  4NLY A;  1K1S A;  1XBW A;  4FS1 A;  1LEO A;  1Q4R A;  4RUA A;  4B3O B;  4KV8 B;  4FYV B;  4IDK A;  3CJK B;  2M4M A;  2P6T A;  1XMO F;  4OX6 A;  1WC3 A;  4AQY F;  4DBQ A;  3TW0 A;  1C0U A;  1L3T A;  3K17 A;  3MDF A;  3HKZ D;  4ED1 A;  4UZC A;  2AGP A;  2F4V J;  2R7W A;  4F8R A;  3QFW A;  1FRI A;  1S1W A;  5BR8 J;  2B6A A;  5F9N A;  3MED B;  3IGV A;  1T95 A;  3NY0 A;  1SV5 B;  5L46 A;  4TU7 A;  2HVZ A;  3TZX A;  4NA2 A;  2AP6 A;  2GIQ A;  4L3K A;  1FKO A;  3I0S B;  2QL7 B;  1U1Q A;  4ZVQ B;  5FD1 A;  5D0R A;  1YTY A;  3MM9 A;  4J9Q A;  3OTO F;  3AD8 C;  5CXT A;  5D15 A;  4LF2 A;  2ASL A;  2CUY A;  2HFV A;  3W9H A;  2R2R A;  2ZHA A;  3O1L A;  3LAL A;  2YKN A;  4EYI B;  2B5J B;  3DOL A;  4OYW A;  3NOC A;  2WVB A;  4FN5 A;  2ZNZ A;  3AY0 A;  4FXD A;  2HHP A;  4G1Q A;  3MM6 B;  5IC6 B;  2JEG A;  1UL3 A;  3Q8P B;  1GEH A;  2MGZ B;  3GCW P;  2DNO A;  2P6S A;  4NLU A;  4LF4 J;  4NLW A;  3L09 A;  5LL6 d;  1GX5 A;  4ILR A;  1JNR B;  1RHR B;  4OHW A;  2B0G A;  1G3O A;  2NXC A;  3UPF A;  3I5B A;  4IO1 A;  4WE1 B;  3SSQ A;  3M9N B;  2MJU A;  2ZH2 A;  2XGP A;  3MAQ A;  1B99 A;  3CJT A;  2FHJ A;  2H54 B;  4F0M A;  2HHW A;  2MHE A;  5BXI A;  3HM9 A;  2CXE A;  4ZK7 M;  2FJD B;  3MAA A;  3M9O B;  2XO7 A;  3C6T A;  1V9O A;  2HK2 A;  1C0T A;  2CQH A;  5KG7 A;  1U6F A;  2ZM6 F;  4X66 F;  1FRL A;  2F5G A;  4GKK J;  3RU0 A;  3HT3 A;  4QWD A;  2RSQ A;  2KG1 A;  3OHB A;  3AA9 A;  3DRR A;  1UVL A;  5EGY A;  2MKJ A;  2LYV A;  2XI3 A;  1FNX H;  2I5J B;  4DL4 A;  4ERD A;  1S6P B;  1FWL A;  1KQK A;  3R6L B;  3FBF A;  2BKN A;  3ADA C;  1FES A;  4ID5 B;  2KXN B;  1S9E B;  4RW7 B;  3KLH A;  2UVW A;  3HD2 A;  2ADB A;  3R7S B;  4OX9 J;  1RWO B;  1V3S A;  3QWP A;  1HWI A;  3AB2 B;  3QWU A;  1CLF A;  3MEG A;  4UY8 5;  3DFE A;  1UW4 A;  4V1A k;  2WSE C;  1LFP A;  1FX2 A;  4GO5 X;  3LP0 A;  3VGT A;  2HNY A;  1MN9 A;  3BGR B;  3TX8 A;  3L7O A;  1IKX B;  2HND A;  2D74 B;  2C2O B;  1N34 J;  2Q3P A;  2HFS A;  1PYO B;  2W2M P;  3PYE A;  1ZTW A;  4P2X A;  5KFK A;  2HZC A;  3IS9 A;  1FF2 A;  2ZJR Q;  1U1M A;  4MFB A;  4ZPA A;  5JUM A;  5CD4 A;  5HMX A;  1H38 A;  3CC2 S;  1VFJ A;  4DG1 A;  4Y3C A;  1Q82 T;  1I1G A;  1MSW D;  3CMQ A;  5A8W A;  5IS2 A;  2HBY B;  2DNR A;  2LEC A;  1ZM4 A;  2MKC A;  2IPO B;  4OZ3 A;  1V5I B;  4P2M A;  2QL9 B;  3ZTQ A;  4DCP B;  5C5J A;  1V3R A;  3DI6 B;  3MMC B;  4X4U A;  3OTB A;  1OSD A;  2BE2 B;  1VQN S;  2Y1L B;  1KVI A;  2AKW B;  1S4F A;  4P74 A;  2M88 A;  4ETX A;  4DLE A;  3IM9 A;  4DV0 J;  5HLF A;  1L3K A;  1LW0 A;  4KTQ A;  2CQ1 A;  4Q8F A;  2GVD B;  2MZR A;  2OPS A;  3E3X A;  4DR1 F;  4OYO A;  2QFJ A;  3FQK A;  4B9M A;  5D77 A;  3UCZ P;  3V6D B;  5KFF A;  2NZC A;  5M2R A;  1NB2 A;  2E1P A;  3A8K A;  4NZ7 A;  5A0Y A;  2WRM A;  4FYD A;  1NPK A;  2NUH A;  2GNK A;  4B3O A;  1D9F A;  4DL2 A;  4KV8 A;  4ZVE A;  1HD0 A;  3I32 A;  1U1N A;  2FVQ A;  4CLP A;  1S0V A;  2FTR A;  5L38 A;  3N79 A;  4NPO A;  3I5A A;  3DHX A;  1RAI B;  4OV6 A;  1FE0 A;  2DXE A;  4NXN J;  3MED A;  2WTF A;  1X5S A;  2C2Z B;  1SV5 A;  2C3O A;  2QSF A;  1DHM A;  1IWG A;  3CD6 S;  3OTC A;  4KHP J;  3OXG A;  2ZOG A;  2G4B A;  1JNZ B;  2MQL A;  3QPI A;  4OI4 A;  4KGM A;  1GH8 A;  3NAI A;  3BQ0 A;  2OI2 A;  4N8O A;  3CC7 S;  4JV5 J;  1TFW A;  3EUN A;  3TO8 A;  4DQP A;  3IA0 A;  1X4C A;  1T9T A;  3ONQ A;  3GV5 B;  2B5J A;  4OI3 A;  2XSJ A;  4O0N A;  2RDD A;  2E9R X;  4L72 B;  3C6U B;  4QWE A;  1TQL A;  5IV3 A;  1F5A A;  4EBD A;  1Y0H A;  3MM6 A;  2BQU A;  1APS A;  3Q2T C;  1HNI B;  1JLF B;  1HQE B;  2CDQ A;  4ZPV R;  3QBC A;  3K8W A;  5CYQ B;  3IGN A;  1FEE A;  3FUY A;  2MGZ A;  3T5J A;  3GG1 A;  1PC5 A;  2DNY A;  3AH6 A;  3HFV A;  1NK7 A;  3NXZ A;  5GAE I;  1URR A;  4JBC A;  3Q23 A;  1HHQ A;  2E5G A;  2GCF A;  1OO0 B;  1S59 A;  2CPI A;  4WE1 A;  1GTE A;  4FF3 A;  1WC5 A;  3BPS P;  4PQU B;  3DXS X;  1XJW B;  5GAE U;  1RAJ A;  5J1P A;  3BBF A;  1U1L A;  4Y2I A;  3PJX A;  2MQN A;  2JSX A;  2H5J B;  2XMM A;  4DCJ B;  3OFF A;  5DQH A;  3JSB A;  3QRP A;  5DS7 A;  1UEV A;  3DRY A;  3H4B A;  4AE5 A;  1W25 A;  2JC0 A;  2MHN A;  2ZHO A;  3TA2 A;  3KDO A;  3A13 A;  3G6Y A;  3BSN A;  3R5B A;  1JKH B;  4E98 A;  3DU5 A;  5BJR A;  2HVH A;  1T02 A;  2J9C A;  2CQG A;  4DN9 A;  1NJI T;  2OSR A;  1SL0 A;  1JLB B;  3RG6 A;  2GVZ B;  4N41 A;  3BSA A;  2I5J A;  4RBV A;  1S6P A;  1SBR A;  3TAR A;  4ID5 A;  4CRJ A;  2VBX A;  4LBI A;  1S72 S;  2A2D A;  2I9S A;  1S9E A;  3Q83 A;  4RW7 A;  2RRN A;  4NXM J;  3MM5 B;  1U2F A;  3MCN A;  5KFD A;  2MMY A;  2KI2 A;  1LFW A;  5F0W A;  2FLP A;  4WJB A;  2BXJ A;  2X7I A;  4NZ6 A;  4ECX A;  2QT7 A;  2CPY A;  4YY3 J;  5F8J A;  5F9L A;  5CCM A;  2V2Q A;  1F3V A;  1QAY A;  2GMH A;  1HI8 A;  3BGR A;  2VFS A;  1XWL A;  1IKX A;  1UKU A;  1HBN B;  4JI5 J;  4YQW A;  4B3S F;  3G2X A;  4Y00 A;  4OLP A;  2AZ3 A;  3ULH A;  1WSV A;  4NRU A;  1RWV B;  1B0V A;  1RAC B;  4UUX A;  4ECZ A;  2QIF A;  1VI7 A;  3K0J A;  2ZH3 A;  4KKO B;  2VFV A;  3CW2 C;  4WF9 Q;  2R8G A;  2XS7 A;  4A8Q A;  3PW4 A;  3NL0 A;  2AYB A;  3MMC A;  5EUH A;  4DV1 F;  4ECR A;  3KLE B;  2UU9 F;  4ED4 A;  1LNQ A;  4OZ2 A;  2DTJ A;  2BE2 A;  1P1T A;  4DFK A;  3W63 A;  2HWT A;  4ZP7 A;  3QRR A;  2MQ8 A;  3R27 A;  2PA3 A;  5HP1 B;  5H1S V;  3V6K A;  2WSF C;  2RKI B;  4ETZ A;  1X4D A;  1RHM B;  2XLK A;  4TQS A;  2D9O A;  3LGN A;  4CO1 A;  4ED6 A;  3K5N A;  1M0S A;  2GVD A;  1SH3 A;  2RIL A;  5IM0 B;  4LFC F;  5FII A;  4AUK A;  4GKJ J;  4B3R J;  4O4G B;  4HEA 9;  3JQJ A;  2WAQ D;  2V94 A;  1X4F A;  2H51 B;  2R7Q A;  3IO1 A;  2V8D A;  4PG6 A;  1Q5Y A;  2GJF A;  5LM7 E;  1NSK L;  1TL1 B;  1X60 A;  1SVD A;  2IJN A;  4DSI A;  2UUB J;  4D3G A;  1HYS A;  3OL6 A;  1RE1 B;  2O5D A;  2PA8 D;  2KVQ E;  1WG4 A;  4OYX A;  4ZVH A;  1R8A A;  3TVY A;  3PHE A;  1DQA A;  3D5M A;  5KFA A;  3UCG A;  3ZFV A;  4U67 Q;  2WOM B;  1WC0 A;  4LBP A;  5DGA A;  2BJD A;  5J2P B;  4N76 A;  3N5B A;  2CJX B;  1FFG B;  3JSR A;  1T3N A;  2G2O A;  1FXD A;  2IM3 A;  2HSE B;  4DV7 J;  2BZ2 A;  3H7H B;  2FUG 9;  3TZY A;  2DGX A;  3X3U A;  4Y6I A;  2PGC A;  3VAH A;  4OZN A;  1KBR A;  4HAC B;  4DR6 J;  2G1H A;  4JI2 F;  2NYH A;  4TU8 A;  1TUV A;  3WZ0 A;  3OTO J;  3C6U A;  2XMK A;  1LV5 A;  4I0W A;  4F4Z A;  1MWQ A;  4N56 A;  4TY8 B;  1HNI A;  1JLF A;  1TKZ B;  1HQE A;  1EB0 A;  1BC6 A;  4O44 B;  2HZV A;  5CYQ A;  3IBW A;  1PBA A;  5LT5 A;  1OPZ A;  1NH7 A;  2VZ9 A;  1NXI A;  3EDR B;  1J5E F;  2JEJ A;  1BHN A;  2OSQ A;  1JLA B;  1NJY A;  4RBU A;  2M9K A;  2MB0 B;  3BS9 A;  1N6Q B;  2N4C A;  2OFG X;  4FYY B;  3A8I A;  2FYX A;  2DNG A;  3V4M A;  1XIQ A;  3NEK A;  2XO6 A;  2E1C A;  2ZFH A;  1QE1 B;  3BSO A;  1UFL A;  5KFT A;  4PQU A;  4LF7 F;  3DDK A;  5IXU A;  1UAW A;  2PII A;  2OJ3 A;  2EVZ A;  1UVK A;  4CO2 A;  1RAB B;  1D09 B;  2OML A;  4RW9 B;  4J9K A;  4ELV A;  5DG9 A;  4MIA A;  3L7P A;  4I6W A;  3IWL A;  1FHT A;  3CTR A;  2I8E A;  3ZNJ 1;  2EK6 A;  2F9D A;  2I1R A;  3RBD A;  1IWA A;  1VHI A;  1UP1 A;  1JKH A;  5J1E A;  3EX7 B;  2BV3 A;  2E5L F;  3UCU P;  4RNF A;  1JLB A;  4KAI A;  4X66 J;  4EMD A;  3EPG A;  2ROP A;  2GVZ A;  5EWF A;  3GG0 A;  4ID8 A;  5D4N A;  2M5Y A;  4ZJL A;  1NJZ A;  1TKT B;  2AMC B;  3KLI B;  3TJ9 A;  1Y11 A;  2W7A A;  3N9U C;  4M5K A;  2MJN A;  1KWM A;  5KFC A;  2QYC A;  3TX0 A;  4AT1 B;  2YKM B;  1F6T A;  3VF0 B;  5DZ6 A;  2DGV A;  5K8O A;  2KRR A;  2NS1 B;  4LRB A;  3T5K A;  2B9X A;  4DF8 A;  1FER A;  5K9F A;  2HHX A;  1AUD A;  4ECS A;  5KFM A;  5HBM B;  3DRS B;  4DI6 A;  1HBN A;  4WIQ A;  4P71 A;  4AXI A;  2RIJ A;  2IBK A;  4M5I A;  2ZOF A;  2FLN A;  3TAM A;  1J27 A;  2ACY A;  4LQ3 A;  1ULR A;  2B51 A;  4LJM A;  4M95 A;  4C6A A;  2BQR A;  4G1I A;  3ENQ A;  2FHM A;  4B9U A;  4Q2L A;  3TJ8 A;  2WBM A;  2OPP A;  2PMZ D;  4A4J A;  2Q66 A;  1HNX F;  5DDO C;  2QG9 B;  1JQG A;  1RAO A;  2XY6 A;  2P2C B;  2QLJ B;  3OHA A;  4P6Q A;  8AT1 B;  2ROE A;  2BR0 A;  2QRR A;  1RT6 B;  4C8Z A;  1M5H A;  5HP1 A;  4HH1 A;  2RKI A;  2DXD A;  4P2S A;  2OUG A;  3NNH A;  3W2V B;  3HLU A;  2NCK L;  5DDR C;  4M5M A;  3SCI E;  3AQO A;  2H4Y B;  3SCJ E;  5IM0 A;  3OPK A;  3ZZU A;  5K5M A;  3A4T A;  2UUA J;  1U4B A;  2HYI B;  1XNQ J;  5A8R B;  1ZYQ A;  2N4D A;  4YB7 A;  4O4G A;  2YH1 A;  1PJ6 A;  2Z57 B;  3RAX A;  1IUJ A;  3V5R A;  2DR6 A;  1TL1 A;  1H73 A;  2C42 A;  2FD2 A;  1YJV A;  4ZVO B;  5CCL A;  4O3P A;  2QX0 A;  2XS5 A;  3SFG A;  1ZM9 A;  2EBE A;  1OY6 A;  3Q8U A;  2I2Y A;  2EXU A;  2WOM A;  2Z0G A;  3CCR S;  2DRD A;  5KT2 A;  4P10 A;  5J2P A;  2ZUG A;  4M5L A;  3HSJ A;  5D3G B;  3S7R A;  2GIR A;  3KUH A;  2RUG A;  5F8H A;  4CP5 A;  4A8O A;  2ZJP Q;  1X0P A;  4UQT A;  1FFW B;  2HHH F;  2G2Y A;  3IXQ A;  2PMH A;  4F4K A;  3OVA A;  2V4Q A;  5E7O B;  2IRU A;  1CC8 A;  4BCA A;  4HAC A;  5ETO A;  1RU2 A;  5JJB A;  4NCB A;  1NRK A;  1MG7 A;  2VPZ B;  5D0G A;  5EHH A;  4C7Q A;  3GIR A;  2HLU A;  3EWG A;  2JLF A;  4USI A;  4DFM A;  3O6Q A;  2IHR 1;  1A7G E;  4ICL B;  3A3P B;  3FFI B;  1PO6 A;  2YWF A;  2R7X A;  1D9A A;  3KJF B;  1N5Q A;  2OTJ S;  2RT3 A;  4WP9 A;  4TY8 A;  2UUC F;  1TKZ A;  4JOU A;  4O44 A;  3KJQ B;  3FBE A;  2LQ9 A;  3OFE A;  1JB0 C;  1Z2L A;  1IBK J;  4YOE A;  3GIK A;  2DNP A;  2LU2 A;  1UVI A;  3RJM B;  5HAO A;  5M2P A;  4CO4 A;  1JLA A;  4G65 A;  1Y3K A;  5CHC B;  4IG0 B;  2F63 A;  3D0G E;  3G96 A;  2ZD1 B;  2UXD F;  3R5C A;  2F7V A;  1N6Q A;  2KJV A;  2JVR A;  3VAG A;  1S76 D;  4K4W A;  1QE1 A;  3MFI A;  1VQK S;  4A8Y A;  3NGD A;  4DL5 A;  2JH3 A;  3N6L A;  2CNK B;  1PYS B;  5KTQ A;  5DLF A;  4X84 A;  1PC4 A;  4RW9 A;  1UA0 A;  4PYA A;  1IQT A;  3MXH P;  4KC5 A;  5D6G A;  1TL3 B;  2WB4 A;  5HVF A;  2BW7 A;  2R9L A;  3DLG B;  3EPI A;  4NE9 C;  1CJK B;  1UW9 A;  4IOB A;  4R8U B;  1O51 A;  4CIO A;  4X4V A;  1IBM J;  4U96 A;  1V5V A;  4USV A;  3I56 S;  2VF3 A;  2D3U A;  2GO8 A;  2XZD B;  1T0T V;  3WIU A;  2RS8 A;  1T05 B;  3M9M B;  2WW8 A;  3Q2S C;  5KFU A;  1ITP A;  2Y3Y A;  4J9L A;  1TKT A;  5LJ5 Y;  1CSJ A;  3C3L A;  3CD0 A;  2NSB A;  4L6V 3;  4DPO A;  5CQG A;  2AT1 B;  3V6H A;  2HBQ B;  1BGX T;  4ES3 A;  4U7U D;  3S6E A;  3MUM P;  1XC9 A;  1TTH B;  2KHD A;  2YKM A;  3IRX B;  3S1T A;  1NZ8 A;  3M30 B;  3A8J A;  4Z2X A;  2YWW A;  5A6W A;  9RUB A;  3NCQ A;  2DNK A;  2N7C A;  4PG5 A;  4NLR A;  5FJ4 A;  3B8H A;  3H59 A;  3DRS A;  4H54 A;  4RWW A;  1NH8 A;  2CFX A;  2IIH A;  1IKW B;  2ASJ A;  2CVI A;  3PNI A;  1P9Y A;  3G8S A;  1VRU B;  5GAG I;  2XCP A;  5G4D A;  5IWA J;  1QSY A;  3H2L A;  3MCS A;  2AV5 A;  5AXL A;  1WTB A;  4Q0B B;  2W2P P;  3K5O A;  5GAG U;  4C8M A;  4NRT A;  1N4L A;  3Q0A A;  3T1Y F;  2HGM A;  4F4Y A;  2EFO A;  3RUB L;  3BH7 B;  3GFX A;  3HHE A;  1CUL B;  2HS3 A;  4OHY A;  2H9Z A;  2FVR A;  1RT6 A;  3BN4 A;  3LO3 A;  4WBF A;  2CA9 A;  1U2R A;  4U8V A;  1BQM B;  4NLG A;  3CGI A;  1CJV B;  1S48 A;  3W2V A;  1AB8 A;  5AE2 A;  3SYZ A;  2XYH B;  4WKR A;  3AJ1 A;  1ZS6 A;  2RDI A;  4M5N A;  2J6S A;  2CZ9 A;  2UU9 J;  1U6B A;  2OEJ A;  5BYQ A;  1HL6 A;  3L7U A;  1A9N B;  5A8R A;  1HQU B;  2AHO B;  4IOC Q;  2DR5 A;  2YXL A;  3OTD A;  2NYI A;  1WEY A;  4KPY A;  2IYG A;  3D9B A;  4KB7 A;  4OJG A;  5L1K A;  4KRW A;  2YKQ A;  1KR4 A;  2CVE A;  2BA9 A;  2XWX A;  2AJ2 A;  4QIE A;  2VV5 A;  3JXO A;  2XGQ A;  3H2U B;  3OXF A;  4J9S A;  1S79 A;  5E3Q A;  2DVI A;  2LEA A;  5EWE A;  3T6B A;  4JB8 B;  4FBT A;  2LEB A;  4DUY F;  5H9F K;  4USJ C;  5D3G A;  5CH7 B;  4H4M B;  1JLQ B;  3GR1 A;  1SQE A;  4PUO B;  3VCD A;  4ED3 A;  2L48 A;  4KO0 B;  3TEH B;  3P96 A;  3D6T B;  2ZZM A;  3IAS 9;  3NWR A;  4ECY A;  2QLW A;  3MCM A;  3EGW B;  5D4P A;  4OJ3 A;  2OLW A;  2KFY A;  4CO5 A;  1FNM A;  2B4P A;  4NAS A;  2VG6 B;  2E5I A;  3H0P A;  3CNQ P;  2X1A A;  1BWV A;  2QFI A;  1RU1 A;  2R8K A;  2CPE A;  2A6O A;  4ICL A;  1R31 A;  3AJD A;  3AT1 B;  3FFI A;  3W62 A;  3J80 U;  3H98 A;  4QR0 A;  4A46 A;  2EC0 A;  2LA6 A;  1T9U A;  4OX7 A;  3HVT B;  2O66 A;  2MLZ A;  1Y5L B;  3PCO B;  1UEK A;  1RAF B;  2Z58 B;  6AT1 B;  1AA1 B;  2ATC B;  3KOA A;  5KFQ A;  4IG0 A;  3MCO A;  3A1Y G;  4PWD B;  2ZD1 A;  2X1B A;  1FD8 A;  4F4W A;  3NWG A;  2ZZN A;  1HWK A;  2DD8 S;  1W26 A;  2VDH A;  4R0E A;  1UA1 A;  3G86 A;  5LJ3 Y;  2OD4 A;  3PIO Q;  1R7I A;  2B4U A;  1NK8 A;  2BM1 A;  1SQG A;  3U1M A;  2V5H G;  2YX4 A;  2OTL S;  3RYL A;  2VL1 A;  4YN3 B;  4JI0 F;  4Y34 A;  4HTJ A;  3OQ2 A;  2J7K A;  1NK9 A;  2IM2 A;  2UXC F;  4FVM A;  5K14 A;  4DWI A;  3I9V 9;  1FDD A;  3KMS A;  3HHN B;  1NME B;  1TL3 A;  3FGV A;  3ZNU A;  1M5S A;  3BQ1 A;  3QSI A;  2XY5 A;  4DQR A;  4RUC A;  3DLG A;  1S5Z A;  4ECQ A;  4K7Q A;  2QGF B;  1CJK A;  5GAD U;  2F8H A;  4JI1 F;  3G87 A;  4L74 A;  4R8U A;  3QAE A;  1N0V C;  1ZBT A;  1KLM B;  1D0E A;  3DLE B;  4CM0 A;  2FHK A;  4HTI A;  3IP0 A;  1T05 A;  4NI2 B;  4N47 A;  2WBR A;  5HVH A;  3CC4 S;  2BE7 D;  3HX9 A;  3W5X A;  2UV8 G;  2E5L J;  3HJV A;  3Q89 A;  4L73 A;  2RUS A;  4C8O A;  1S6U A;  3GSD A;  4DR2 F;  4DMZ A;  4NYO A;  2DB1 A;  3IRX A;  3M30 A;  4J9O A;  2PMW A;  3ISN C;  4GC6 A;  2VG7 B;  1VBX A;  1KVJ A;  3I55 S;  1G1X A;  3T6J A;  1TAQ A;  3VAJ A;  4QQB A;  4U9R A;  5IV4 A;  3UDC A;  3WBZ A;  1JMT A;  4IRD A;  4ATN A;  2V9K A;  4DL3 A;  1IKW A;  1SL2 A;  4PCQ A;  3G8T A;  2IC3 B;  3MPD A;  3FRY A;  1RTZ A;  1VRU A;  1B0T A;  1RWX B;  1ZET A;  4F2S A;  2C28 A;  4DXL A;  1UJ6 A;  3SSS A;  3PAC A;  1BY9 A;  2GAH C;  2HUR A;  2EWH A;  2FGO A;  4Q0B A;  3HHL D;  5G0R B;  1WF2 A;  3P3D A;  3J80 Y;  6FD1 A;  3EDQ B;  2W01 A;  2XBP A;  3PX4 A;  3HF5 A;  1T3O A;  2A3J A;  5HL7 Q;  4YS2 A;  1U45 A;  1S10 A;  3HUL A;  4YHH J;  3MUV P;  1IM6 A;  1BQM A;  1UWB B;  2VQF F;  1CJV A;  4ZVG A;  5KG1 A;  4LSN B;  4JYA F;  1UCN A;  4X64 F;  4N5S A;  3HCX A;  1TL5 A;  1HPZ A;  5KFJ A;  5HK4 A;  1HQU A;  2YKP A;  2QMW A;  1U26 A;  3RB0 A;  2HWI A;  5E2Q A;  4F67 A;  3JTP A;  2IJF A;  1FCA A;  5T41 A;  4FXV A;  3CJ2 A;  5H9E K;  2BQ3 A;  4PWW A;  2M52 A;  2LKZ A;  2LU1 A;  3MMA B;  2ZBQ A;  4XK8 C;  4RNO A;  2M3D A;  3RB4 A;  4WFZ A;  2MST A;  2NXN A;  1WC1 A;  4M5G A;  2BRL A;  1J5O B;  4ZP8 A;  1WG1 A;  2F4V F;  1N32 J;  4DPW A;  1F5C A;  3Q8Q B;  4PPD A;  4H4M A;  1JLQ A;  2W4D A;  3W65 A;  4L3N A;  4PUO A;  4KO0 A;  2QYG A;  1JJH A;  3D67 A;  4DV5 J;  5HVG A;  5AT1 B;  1JWW A;  1FVQ A;  2XMJ A;  3KG1 A;  3ZTR A;  3BYR A;  1N0U A;  2VG6 A;  5GME A;  1OJ4 A;  1NSA A;  3S8S A;  2HBR B;  4MYT A;  5HAT A;  2UV8 A;  4C11 B;  2R2T A;  2KVI A;  1JXL A;  5J2M B;  1U1P A;  3HVT A;  2F1F A;  3M8S A;  3N6N A;  2LDI A;  4L76 A;  4FPI A;  1NCL A;  2OEM A;  4TN2 A;  5ETP A;  4U95 A;  2LDY A;  3SDE B;  1R8H A;  4J90 A;  2XG8 A;  4LF4 F;  2YVS A;  3CCS S;  1SKW A;  4YB1 P;  1QTM A;  4PWD A;  2VBZ A;  2DCU B;  1CJT B;  2J5A A;  3W8P A;  2UP1 A;  3SI8 A;  2B7C B;  3W60 A;  2ACM A;  4DL6 A;  4RU9 A;  2CZV C;  2XYP B;  1X9M A;  2QA1 A;  4WFY A;  2RJZ A;  1D1U A;  3DOM B;  1UVN A;  4RUH A;  2BAN B;  5KOX A;  2KXH A;  2RU9 A;  2W2O P;  3ZTP A;  3LF0 A;  5JXS A;  3MR7 A;  1YJT A;  4X4S A;  1HFE L;  2P9G A;  2PC6 A;  2BOA A;  5LMN J;  3U27 A;  2XUL A;  2H5E A;  2QMX A;  1FWK A;  2J9D E;  5AE1 A;  4DV2 J;  5H9F J;  3W64 A;  1C1B B;  4GKK F;  2JOQ A;  4J7C A;  2ZBR A;  1X31 C;  2ZKU A;  3LP2 B;  3FRZ A;  1K44 A;  4HVZ A;  3GTY X;  3IN5 A;  3JS9 A;  3D6M B;  5A2Q U;  3ZZ0 A;  4I2Q B;  1KLM A;  2VB6 A;  4OZ5 A;  9ATC B;  3DLE A;  5E3P A;  1OSC A;  1DAR A;  4Z7Y A;  2AGQ A;  1NKE A;  3MEK A;  3N6M A;  4LFA F;  2DIS A;  2JC1 A;  4NI2 A;  3P8B B;  3KDN A;  4USK A;  4J37 A;  1NK5 A;  1IKV B;  1U8W A;  1MMN A;  1WHX A;  2L9W A;  2N7Y A;  4OX9 F;  3CMA S;  2GS8 A;  4C0B A;  3EZU A;  4NLO A;  1TL7 B;  3KLG B;  4C8L A;  3H25 A;  3T1H J;  3PKY A;  1VIX A;  1NDP A;  4ZLN A;  1VQL S;  3BO2 A;  1PBU A;  4ZVS B;  4ECT A;  4X4R A;  4E0D A;  2IDE A;  2OEK A;  4OL8 A;  1VIO A;  3IMQ J;  1U25 A;  1N34 F;  2Y9H A;  4OZ0 A;  1FRM A;  4O3S A;  4LSL B;  1J2V A;  4NCG B;  1K73 T;  1S1V B;  2IC3 A;  2GJI A;  1IM4 A;  1NU4 A;  4YUD A;  4ZVP B;  1YJ7 A;  4MMO A;  2WHO A;  2HQD A;  1RT1 A;  5G0R A;  2IRY A;  2DT9 A;  5JMN A;  2AJQ A;  3S01 A;  2DGQ A;  2R7R A;  2AWZ A;  4DS5 A;  2CG4 A;  4DR4 J;  5F8I A;  2ALZ A;  3EXY A;  4LRC A;  1UWB A;  4ZVF A;  2QA2 A;  4DV0 F;  5HSP A;  1S57 A;  1Q7Y T;  2LQB A;  4FNH A;  1PSD A;  3QNW B;  4LSN A;  1R3N A;  1AZS B;  2FC9 A;  3HHL C;  4MYU A;  2V0N A;  3G8Q A;  3ZTS A;  2V63 A;  4PAB A;  1H98 A;  3IWX A;  5FLX U;  3DNC A;  1HLW A;  2RHQ B;  1AFI A;  4J9V A;  4LR7 A;  3L3C A;  3AB4 B;  2IMW P;  3OR1 B;  3AQP A;  3K5L A;  3RRH A;  3NAH A;  1P8G A;  2DIT A;  3MMA A;  4K5R A;  3PEJ A;  3GV7 B;  3VAM A;  4CYU A;  4H4O B;  2QLF B;  1VHF A;  1J5O A;  3PR4 A;  1SQF A;  2DHS A;  2HGN A;  4Y65 A;  1BQN B;  3CJ8 A;  3CXC R;  2V4J B;  1R0C B;  2MKI A;  2FLL A;  4PG7 A;  4NXN F;  2BJ3 A;  1FFS B;  5THW A;  3OVS A;  3IBC B;  4FNI A;  1TU0 B;  1TKD A;  5A2Q Y;  4KHP F;  4DSE A;  3IAM 9;  1RA7 A;  2F40 A;  3IRW P;  5E3C A;  3DLL Q;  2RS2 A;  5CAA A;  2CRL A;  1NPP A;  3PRV A;  3OUY B;  4DUY J;  3RRK A;  2KDO A;  1F5B A;  4JV5 F;  2DEI A;  2Z2M A;  3IWN C;  3RBZ A;  1K1Q A;  2MSS A;  2QLX A;  1UFW A;  4LIW A;  4XPC A;  3VHQ A;  4Q5V A;  4C11 A;  5J2M A;  3BKT A;  1VJQ A;  4ZDN A;  3EVM A;  3H5S A;  3NMR A;  1R8P A;  3DMJ B;  1N5V A;  1YSJ A;  4ZLJ A;  4LR9 A;  3MF5 A;  1TR0 A;  1PG5 B;  1TZ0 A;  5IQ6 A;  4M8L A;  1Q79 A;  5AXN A;  3SQG B;  2P5V A;  4DR7 F;  1R89 A;  3FCV A;  3QGH A;  1CS4 B;  3BKU A;  1CJT A;  1M1K T;  4K5S A;  4KGK A;  2F65 A;  4OI0 A;  3SV3 A;  1X4G A;  1VR6 A;  3FNN A;  2V69 A;  3QFH A;  4RU2 A;  3DOM A;  3GSI A;  2BAN A;  1TK8 A;  1FO1 A;  3JSM B;  4OZL A;  1LQ9 A;  4WYW A;  2ZKT A;  3ZZO A;  2J9E A;  1NPR A;  1ZAW A;  4O3N A;  3PX6 A;  2A18 A;  1C1B A;  2BUN A;  4HL9 A;  4CQ1 A;  4KBI A;  1RQ0 A;  3LP2 A;  2PI4 A;  1W2B R;  4WFB Q;  3LPE A;  3C2P A;  1Q1K A;  2MPU A;  4KGV B;  5FLX Y;  4I2Q A;  2J7U A;  4S0M A;  2YNF B;  3VWS A;  2DO4 A;  2IY5 B;  1YLX A;  1DAX A;  4A47 A;  4JI6 J;  3T3F A;  1IKV A;  1VOM A;  5EN1 A;  4NXM F;  2AYE A;  1GMW A;  1F9F A;  2MZT A;  3LWL A;  4O3O A;  3W66 A;  4TU9 A;  5C2C A;  1I5O B;  4DL7 A;  1TL7 A;  3KLG A;  2B9E A;  2F9J A;  3QYY A;  6FDR A;  5B09 A;  1X4E A;  4YY3 F;  2EPI A;  3A12 A;  1IR0 A;  3GZ7 A;  3OL7 A;  4HHH A;  1YGY A;  1UZH A;  4M63 A;  4Q2M A;  4AXJ A;  2YX7 A;  2JJ4 D;  3SBM A;  2HNZ B;  2R7V A;  4KPC A;  4JI5 F;  1AUS L;  4LSL A;  4ZCL A;  2HLT A;  2DNH A;  4NCG A;  2WVC A;  1EQM A;  1YDL A;  1FE4 A;  1S1V A;  3EVO A;  3UFC X;  4JV2 A;  1HBO B;  2YPZ A;  1T9V A;  3K2Y A;  4YDD B;  4N8N A;  1WF1 A;  1HAR A;  2A1B A;  1T94 A;  2DGT A;  4QIW D;  2ZH1 A;  3C19 A;  3MEC B;  2Y1I A;  3IS9 B;  4CH0 S;  4W90 B;  4ED7 A;  2C2K B;  2CJB A;  3M2V B;  3V81 B;  3QT8 A;  2W8L A;  3AXK A;  1RT5 B;  1RKJ A;  2J6T A;  2BJ8 A;  2DNQ A;  3CWJ A;  3PW5 A;  1TMM A;  1VYA A;  3W61 A;  2XLJ A;  4LQ9 A;  3ETM A;  4F02 A;  2KYX A;  4LT6 A;  3KUE A;  1AZS A;  5KFR A;  1R8B A;  3ZZR A;  1T9Y A;  3Q22 A;  3ENV A;  3F0N A;  2ILZ A;  4GKJ F;  4CZC A;  4B3R F;  1Q7L B;  4MKA A;  2DIU A;  1W7W A;  4JYA J;  4ZLP A;  4PXB A;  3OR1 A;  4Y2M A;  4F3M A;  4D3H A;  3UNG C;  1SC3 B;  2Y8W A;  3W3S A;  4HT5 A;  4KSE B;  2VIH A;  4H4O A;  2H4W B;  1RAE B;  1M5V C;  3UD3 P;  1SJR A;  5DG7 A;  1SIW B;  2RHS B;  4URG A;  5IOL A;  1BQN A;  2V4J A;  1U02 A;  3EZ5 A;  3DRX A;  3OD2 A;  3SFU A;  4ZKA A;  1RHU B; 
#chains in the Genus database with same CATH homology
 3QSY B;  1YZ7 A;  2QMU B;  3CW2 C;  1Q8K A;  2QN6 B;  2AHO B;  1YZ6 A;  3J81 j; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...