2QNEA

Crystal structure of putative methyltransferase (zp_00558420.1) from desulfitobacterium hafniense y51 at 2.30 a resolution
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
476
structure length
476
Chain Sequence
GLLPKYNILTEDQVQKIHENTMKILEEIGIEFEYEPALEVFRREGQKVEGKRVYLTREFVESKLKSAPAEFTLHARNPENNVVIGGDNIVFMPGYGAPFIYELDGSRRKTTLQDYENFAKLAGASKNMHLSGGTMAEPQDIPDGVRHLQMLYSSIKNSDKCFMGSAEGKERAEDSVEIAAILFGGKDVIKEKPVLVSLINSLTPLKYDERMLGALMAYAEAGQAVIIASLVMAGSTGPASLAGTLSLQNAEVLAGISLAQSINPGTPVIYGSTSALSDMRSGSLSIGSPECALFISASAQLARFYGVPSRSGGGLNDSKTVDAQAGYESMMTLMAANLTGVNFVLHTAGILQYFMAMSYEKFIMDDEIAGMLLHYMKGYTFDEDGMAFDVIEKVGPGGHFLTQKHTRKNHKREFYTPTLSDRSAYDTWAKEKLETKQRAHARWQQILANYVPPALDPEIDAKLQAFIAQRGKEVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of putative methyltransferase (ZP_00558420.1) from Desulfitobacterium hafniense Y51 at 2.30 A resolution
rcsb
source organism Desulfitobacterium hafniense
molecule tags Transferase
total genus 167
structure length 476
sequence length 476
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.480 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 2qneA01
4YYCA 2QNEA
chains in the Genus database with same CATH superfamily
2Y1HA 1XJBA 5FOOA 4QG6A 2V5BA 3W1LA 5EMJA 2UBPC 2W66A 3FXYA 5ABTA 4H7CA 2GLKA 1TG7A 4PUWA 1WDWA 3L67A 3CB3A 2G4FA 1G0CA 1GCYA 3RG6A 4HSHA 2DQXA 3TSDA 4AEEA 3N73A 2ACUA 4F0LA 2E67A 1GKPA 2D2JA 1U1UA 2Y6ZA 3QOKA 1TX0A 1X1ZA 5HPOA 1H7XA 3W84A 2HJPA 1B30A 2V2HA 8XIAA 2FMOA 5EL1A 5E0CA 4B5VA 4B5SA 4MYAA 1WDQA 5KZDA 4H83A 4UUIA 2YA2A 5LNVA 4U10A 4PFHA 4UR9A 3SURA 2Y0FA 3K13A 3P62A 3S1WA 3PR2A 4U33A 4DWDA 1HJWA 1XSJA 2E8ZA 1NU5A 1VC4A 5DY3A 3TXVA 1RPXA 1XPYA 2J77A 4YMZA 4HA3A 4GIYA 1FRBA 1ISXA 4OHQA 2NQHA 3WQVA 4M7TA 1OF8A 1TQXA 3BAJA 3VOFA 4DBUA 1A0EA 3TOYA 1B3ZA 3AXHA 1MZRA 2DVXA 2OOGA 5DN1A 2P0OA 5M1TA 2E3ZA 2BV9A 1BGAA 4UCGA 2I7GA 4P8XA 3DAQA 3JW7A 2J24A 3WNOA 3KW3A 5A8GA 1P48A 4IPIA 2ZUWA 2JALA 3CQJA 4AY7A 3NPUA 2CZVA 3W23A 3W1UA 2WVTA 3FA4A 4I8DA 1W5OA 4DF0A 4LPCA 1DHKA 1SFSA 1TZ7A 1J0ZA 4DLFA 2LLEA 1J2WA 1VENA 2PPGA 3MJMA 4CEUC 4HD5A 4N6EA 4UR7A 3N9RA 2YCKX 1E9LA 1YKWA 1LL7A 1VJIA 3PG8A 4ASTA 3W1PA 1QPNA 1UWIA 3SBFA 1MNSA 1MXSA 3J7HA 2V9DA 3KVLA 4BF5A 3VMOA 4LS2A 3RRXA 2MUCA 1Q5MA 1NWSA 1ZCCA 4NI3A 4NUWA 2Z29A 4MWAE 5EY5A 1MSSA 4EPBC 3MC5A 5AY7A 3T42A 1ZZMA 3N2MA 3WH5A 4JTRA 3E02A 3ANYA 3L9CA 2P8BA 3B4YA 4YYFA 4MSSA 2XFWA 1Y8BA 2A2IA 2GYIA 4EAMA 1E0TA 1C8YA 2EEXA 2CZEA 1LT8A 1N8WA 2JQXA 4EANA 5CPLA 1TV4A 3WBWA 3D0CA 4N4PA 4I5RA 1VD6A 1V77A 4DBDA 2W63A 1XKYA 5I78A 4Q4PA 4E38A 2PCQA 4DHGA 1DWAM 2V69A 3T4WA 5IHRA 1DPMA 3VOGA 3KVKA 2VXNA 4ZB5A 2Z1WA 1WYIA 1IHIA 2E40A 1XCXA 1ITQA 3B40A 3ZJKA 4MAZA 3KZPA 3MUZ1 2WMJA 3ONBA 3CV1A 1XUUA 5BWAA 2Y7DA 2PDWA 4C6DA 1OIFA 5H8MA 4Y90A 1CXKA 4DB7A 1TV5A 1TWWA 3LHVA 3GU2A 3EOEA 1QTWA 4DIAA 5AYYA 3DGRA 3IRDA 1KXHA 4LBSA 2HS6A 1R86A 2JF6A 1LOQA 3EWDA 4QDWA 4GZ7A 2OSWA 3RU6A 1DJQA 1TMQA 1UD8A 1C7TA 1CLKA 3KL0A 3TROA 5M3WA 3PNZA 2NLIA 4XD4A 2Q01A 3W73A 4G2DA 3WD0A 5CGMA 3B0YA 3FN9A 2CW6A 4K1WA 3BWWA 5D2VA 4ZQNA 2ZRVA 2BASA 2VCBA 3VNMA 3WSUA 4WX2A 3QV9A 3LU2A 1ZTVA 4WJXA 1AUSL 3O16A 3S2CA 3BL3A 3V18A 4B4FA 1B3VA 5CZTA 2V5JA 3BXWA 4UFIA 3HTWA 1I6NA 2CU0A 1H61A 3DC8A 4DJFA 5ABFA 3LENA 5I6SA 4K2SA 1IV8A 4O4WA 1TTJA 2FLIA 2P10A 1XYBA 1DE6A 1SU5A 4Q4MA 4KS0A 3TWBA 2NWSA 4MB5A 3UETA 5HWNA 1SW3A 1M7JA 4IZGA 3VCNA 1OQFA 3WMSA 1ML1A 1R3TA 1E0VA 4JKLA 2Z00A 1LRNA 3BG3A 3BOFA 2UY5A 3CHVA 1Q6OA 3W1AA 4FLQA 3NIYA 4XKMA 4ENLA 3I3EA 1GZJA 4AD4A 1UZ1A 2Y7EA 4IPJA 3UVIA 1WKDA 4IHCA 4B4HA 2Q3RA 4TIMA 2CC0A 2V63A 5HWJA 3ZLFA 1FA2A 3VKAA 3PBWA 4PRWA 5L6UA 4O1DA 3DHPA 4IMFA 1HKMA 2HDJA 4MIMA 4GGBA 2ZUSA 3GR8A 3W7QA 3UF9A 2PRLA 4PBFA 1FH7A 5AECA 4LV9A 4L6HA 1ENUA 3UXKA 4IPLA 3T2OA 3CHFA 3LM3A 2FGBA 1I45A 4C6FA 3XIMA 2ZXBA 2DH2A 1IYXA 3ZZ1A 2PU1A 4K37A 4LYRA 1IQ8A 1H60A 4MZYA 3BTNA 2DJLA 3EWUA 3R8GA 9XIAA 3N3MA 3NZPA 1A0DA 3N18A 4L6OA 2OVLA 1R46A 1AJZA 2XIOA 4FOJA 2D69A 5JXQA 2DW6A 3VE7A 4FXRA 4DJDA 2QCLA 2BGSA 1V02A 1Q45A 3W72A 2PLJA 4Z0JA 3M5VA 1VFTA 4HNNA 1P7TA 1TPB1 3ZT7A 4YLWA 2IPWA 4W85A 4KESA 3WH6A 3T8QA 2CZDA 4K8GA 3W3OA 2DPEA 3PPCA 2GOKA 2YA0A 2D23A 3AYTA 3B9AA 4TMBA 4Q3MA 1WBJA 4NNAA 2GJPA 3FJLA 2VZVA 4K68A 2HK0A 4YVVA 2NV9A 4DXXA 4LNYA 1W0MA 4Q8TA 3THDA 5IDZA 3VPLA 4IMDA 2OWCA 2FGLA 4TO8A 3PFMA 4ZFMA 4MDOA 3L5LA 1SO6A 3NEHA 3CL6A 4FF5A 4XQ6A 1PEZA 3E2QA 4H6EA 4N4QA 3WYZA 3D3AA 1XRTA 1AFSA 2YL8A 3GIYA 5FSEC 2YXOA 3LK6A 2CKRA 1KM5A 3FHQA 3BQ5A 1UP2A 1HT6A 1OX6A 4GIEA 3CMGA 4LVAA 4G5DA 3VK5A 2ZDRA 1O4UA 3I10A 1FWWA 5AHEA 4B5XA 4RKAA 3BZGA 3IIXA 3WJYA 2Z6IA 2GVEA 2WMHA 5HINA 4TX9A 2G37A 4PTVA 5GNZA 1VPXA 2GJLA 5TIMA 1A3WA 4CQAA 3VFLA 4UZSA 1MNZA 3VCCA 4AD3A 4QS6A 3PBVA 2XIMA 1JI2A 4R34A 3EPOA 3EWXA 3WD4A 1KBKA 4GLEA 2ZX7A 1N82A 4EPDC 4WKAA 1N8IA 1VFLA 1PUDA 3AWNA 4NX5A 4S23A 1XQKA 5KITA 3FGCA 5LHFA 3KLKA 5C7VA 3AHTA 1XBZA 4UFLA 5C2CA 4JQ3A 3W28A 4JQ2A 2CKSA 3TP4A 3DUGA 4C6CA 1KTNA 5T8GA 1IF2A 4LALA 5I07A 1SW7A 2I1OA 3DCPA 1OYBA 1J12A 2PC8A 4LAMA 1DXFA 3WLRA 2OT0A 4N7QA 3T07A 1M5WA 1OCJA 1AQFA 3BK0A 4MTVA 3GNRA 2NUWA 4GQGA 3DHFA 5BMWA 3TXZA 3PF3A 2FTWA 4MY1A 3S2LA 2W91A 1FHDA 3HGJA 1M65A 3EB3A 4ZO7A 3BAYA 4DUOA 2ZX6A 1GOXA 3LXCA 4YPJA 3CMJA 2BDQA 5EFFA 2H6RA 4XK2A 4D72A 1EJ7L 1S5MA 3ZJ6A 1E1CA 4PMNA 5M17A 3PB0A 4O14A 3KHJA 4WY0F 1WE5A 2QPUA 3PP7A 3LSCA 2WXDM 4XAZA 1QW8A 2OFJA 1DJNA 4AZ6A 5GNYA 3A3HA 1F5ZA 3S9YA 2ZUMA 2ACQA 3KTXA 4H9VA 3SQMA 4DLMA 4ALDA 3G0XA 4OBSA 4MVAA 1ZBVA 4GUHA 1JUEA 2WMGA 2Z1BA 1VBRA 3NSNA 3HQNA 3CHDA 1UQZA 1YTDA 4XIMA 2V82A 3VOCA 3EEGA 4RZBA 3GH7A 5DMYA 4INFA 2P50A 2GGHA 2OEKA 2IKHA 2CWXA 2B7NA 3GW3A 1PVNA 3KLLA 1AK5A 4Z2IA 1QASA 2IMRA 2Y5SA 3C4UA 3L5MA 4FAMA 4IH3A 3UG3A 3C0LA 4NAEB 4RE4A 1UWSA 2YJQA 2YZ5A 3G2GA 3CO4A 1B3YA 5FL0A 2FZDA 3L2MA 2Y5JA 4UB9A 3IJ9A 2OZ8A 4BEQA 3T0CA 5CGQA 2DV0A 2IPGA 1B3OA 1DJZA 4GNJA 1K02A 3BAKA 2X05A 3CV2A 4QBXA 4HTBA 4UWMA 3L4YA 4M6VA 4XBKA 2YCIX 1KXQA 2Y62A 1XRSA 4J1OA 3CTTA 1C29A 4H8HA 4WHBA 3P7YA 1IIGA 1UWRA 2VD9A 1H5VA 3GNDA 3RX3A 1WAWA 1PKLA 4MPQA 2PDGA 3UWQA 4WEVX 4MB4A 3CAVA 2HBXA 3B9DA 3EX1A 3VGHA 4Z1CA 3V5OA 1ZJAA 1DJXA 4R7JA 1ZNNA 3CC1A 3VZYA 1JZ5A 3QOMA 5AC8A 3IGHX 1SMAA 1YX1A 4TXEA 5ECUA 3SGZA 2BB0A 3NQ7A 5FESA 2EPLX 3GHSA 3U4AA 3FDKA 5A94A 3DIPA 3TJIA 1RJQA 1TR1A 1EC9A 3CK5A 1OFPA 4GK8A 4QQUA 1HKKA 1UR8A 3RMEA 2X1IA 2DZSA 4IGHA 3E96A 3NQGA 5EMUA 2A6NA 1TWIA 3STGA 3VIOA 1Z89A 1S3TC 2H3BA 1T96A 1OCBA 1SPQA 4EF8A 4IQDA 3AHXA 1KM2A 5FF7A 1UBSA 3IJDA 3EKGA 3KE0A 3L4ZA 2J62A 2HMCA 4Z2JA 2X0SA 1JI1A 1I2RA 3KDNA 3L12A 1RSCA 3AZRA 3DG3A 4GXWA 3GQYA 1GQNA 2VX7A 4KCWA 1ITCA 2PDUA 2OR2A 3IGUA 1NFGA 1S2UA 3D47A 1W5QA 2Z0IA 3UWWA 1XLFA 1TCDA 2RAGA 1XLJA 1WZAA 3U4FA 3PZUA 2DVTA 1R8LA 4GYKA 4KWUA 1EC8A 3GVRA 3IJLA 4UTLA 3CIWA 4D6CA 3E38A 2QCHA 2Y8KA 4KWOA 2FKPA 3R58A 1P6CA 1F6YA 1K70A 4YVXA 3LYEA 2ESCA 1TV7A 2R82A 3KHDA 3KBNA 5T26A 2DT3A 1PHQA 4NJGA 2J9ZA 4DVOA 3QTGA 3T0BA 1R38A 1JDFA 2QNEA 2ZXAA 4DF2A 3I6TA 4YU1A 4F2UA 1F9CA 2XM1A 4V1YA 4WSHA 2IKIA 1JDDA 4WDTA 3M47A 3CUZA 3WJZA 2EG8A 4C90A 4F0RA 3WQEA 5D8WA 5E70A 3E49A 3MMUA 2XINA 1OFRA 1UKOA 1M1BA 3THAA 2DFAA 3CWNA 3LV5A 2OOFA 4JYFA 2VC5A 3IJ7A 2V5DA 1ZAIA 3MANA 2V67A 4QGCA 1P6WA 2X09A 5BNKA 2H3DA 5FEPA 1I2QA 3H2FA 4GH1A 3I65A 1CGXA 2I14A 2Q8XA 3SIMA 1YPIA 6REQB 2OGJA 3G1YA 3G1DA 4L56A 1NWRA 4DPQA 4R3UA 1LCOA 2BHUA 5XINA 5JBDA 1B2YA 4UQAA 2IPJA 4K7VA 3H21A 4FLRA 5EBAA 4ILSA 4N02A 4FNUA 4LX4A 4UOQA 4K7YA 3WLJA 4NZ5A 1SUXA 3GH4A 3PWAA 3ME3A 3H2EA 2ZZ5A 5DT5A 1WDDA 3CPRA 1EA0A 4JKKA 1G6CA 3PULA 4F2TA 1R3RA 3HGRA 5GJPA 1QOQA 7TIMA 3FHAA 1DKWA 2WHLA 4YCPA 4IFKA 3UA4A 4QIUA 1UD2A 2XFYA 3E5BA 1KC7A 2UY4A 3PPGA 4NJIA 1DE5A 1UP3A 1LM1A 3P81A 2VZOA 1JNEA 2GL5A 2VEMA 1J0JA 2QCEA 2J78A 4PBGA 2D3NA 3IVSA 5TF0A 2TYSA 3GTXA 3G1AA 1XLMA 4NYYA 5FKYA 3K4AA 5HUOA 3I7QA 4US5A 3W7DA 4JIQA 1I4NA 1OX4A 1KKRA 2XH4A 4RR4A 5FF4A 3UZXA 5T9CE 3PZIA 4W4QA 2VZSA 4PTWA 3ZS4A 2EGZA 3KX6A 4KW2A 1UH2A 4JX6A 4Z1AA 1FHVA 5BMXA 4IMGA 3I6EA 1TPFA 1EC7A 1NIUA 1RCQA 5I77A 2ISSA 3M4HA 2ZFAA 1VKFA 3NFUA 2QYGA 4D6GA 5IXEA 1P0NA 1LZOA 3BPWA 4GVIA 1V02E 4IMAA 4O15A 4LY4A 2XH2A 1MUCA 4M5PA 3EPMA 1E55A 1H4PA 3TNOA 2GUUA 1C8VA 3NPWA 1BQGA 4ICCX 3TTSA 4R53A 4L9XA 5D02A 4YJ5A 2X2YA 3UXDA 2FFIA 3K2GA 3R0DA 1K9FA 3BAWA 1GG1A 3LCXA 3NQFA 2YZRA 2PP0A 4AIUA 3N2BA 1I75A 1VYRA 2P1FA 3CEPA 4EP8C 3W7JA 4IT1A 4PCNA 4IUOA 1HKWA 4P2VA 2JKPA 3GU9A 1JCMP 4DWSD 5FAJA 5L9FA 1JQXA 5D9MA 1Q63A 1QI0A 4O1EA 4IGSA 3OG3A 5AVHA 4XZMX 4W8LA 3VA8A 3CQ0A 4IIHA 2OZTA 1EGMA 1W54A 1TE1A 4U3AA 2OSXA 3CM4A 1LLZA 2BY2A 1ZY9A 2WMFA 5DXYA 3GX9A 1M7XA 3GNNA 4OZOA 5J5DA 3T08A 2VNCA 3BICA 1W8SA 4FX6M 4Q4KA 1EWDA 4ZFCA 1UPPA 1WKEA 3DXIA 4DELA 3ORWA 4UQCA 2DSWA 3GKAA 2VX4A 1TVNA 5D05A 1CLXA 2XSXA 3GFXA 3TJLA 4HZ6A 3AIBA 1XGDA 5HXMA 4PEKA 4FNQA 1RA0A 3LBCA 4W86A 2WZEA 4HHLA 3LCFA 1V0MA 1RK5A 4P7QA 4NF7A 3I68A 3C3UA 3WQGA 3IAQA 2GVYA 3V7PA 2VURA 2P3EA 4JHMA 1CB2A 1MQQA 1K8XA 2PGRA 3WF1A 4MWAC 1MMFA 1ME7A 2WHKA 3ZJ8A 2Z7GA 3SB0A 2PTZA 4AWUA 4EAYA 2INZA 1EQPA 4LUSB 7TAAA 3ABSA 3LHYA 1TJ2A 3PZTA 1FCQA 1A4MA 2ZTJA 3V16A 4PSRA 2PDNA 1R3YA 1KA9F 4TVDA 3RO6A 5DANA 3UW6A 4JDBA 1UG6A 3CGTA 5KTLA 4WGHA 1R3WA 4UOZA 3VOJA 2HSAA 1LWIA 3M5XA 2ZZ2A 1BSLA 2PDQA 3W1XA 2PBGA 4ORIA 1D3CA 3STFA 3MHUA 2J4GA 3NQAA 1P0KA 4P7NA 3WDIA 3MJYA 1DIOA 1SZEA 3IV3A 4YNGA 3IS4A 3N4AA 3RJYA 4H9MA 2HVMA 1LQ0A 1POJA 1H50A 3ELFA 5CJMA 3IRSA 2PTWA 4AQLA 1U22A 3HPZA 4AEFA 2BG5A 1ZENA 4AXKA 2WZHA 5HQMA 1MFUA 4WR3A 3OLDA 4NZ3A 3KTCA 2Z25A 3KRSA 4GUJA 1XHGA 5REQB 4XVEA 4FNPA 2NWRA 1UD3A 1V5XA 4IIBA 4JTDA 4JY9A 1CW2A 4XZLX 2RH9A 3IUHA 2VUYA 1VFMA 2G95A 4OFCA 3DOPA 4P7OA 3DN5A 4AYSA 3WD1A 1JYNA 1UD4A 1PYFA 2W92A 5CC3A 1TIWA 1PZ3A 2YBTA 2PTDA 4ZB2A 3N6QA 3WL1A 1V6YA 3UNDA 4GOAA 4LANA 3SDOA 3VIHA 4MJMA 4LBRA 5MKGB 2NXHA 3PJTA 4JTKA 3FA5A 1JYVA 4JNZA 3UD6A 2ZZ4A 1H7RA 3PAJA 1V6XA 4UTUA 2J6XA 4LCQA 2H9AB 3JR2A 1Q13A 1WAUA 3LGGA 3TYCA 3W83A 1NTHA 3SECA 1F2JA 3WK1A 2XFFA 1Y5WA 2E68A 1LBLA 1QFEA 1ADDA 3BJTA 4N6FA 4QS5A 1UCWA 1QCWA 1HL2A 4NJJA 4F40A 2ZE3A 1XIDA 4QQ3A 3T55A 4FLOA 3TAOA 4POCA 4DN1A 1MO0A 1EX5A 2CLEA 3POHA 4QSFA 3VGGA 1R85A 3AOFA 2AQVA 4OV4A 3RX2A 2INFA 4MNKA 2HXTA 1R30A 1FWTA 1V51A 1OFBA 2OXNA 3WNMA 2Y88A 3MO4A 2J7FA 5FF0A 2WNQA 3BZJA 3C8FA 2D1ZA 5C9RA 2F8QA 3SRHA 4JN8A 2A7PA 1O94A 2FFCA 3SCUA 3BC9A 1YEYA 4Z1BA 1EJTC 3TYUA 1W5NA 2EKCA 1VBUA 2GPTA 4Y2WA 1VP5A 4XISA 3KOXA 1W3IA 5IOBA 2A79A 2FZ8A 1PBGA 2DIJA 4LUJA 4KT2A 5U4NA 3VUSA 2WNZA 1QXLA 1GKQA 3BW4A 3TJ4A 2DT2A 3NUKA 5I5RA 4D6HA 3M0LA 3RXZA 2Z27A 2Z26A 1E71M 1OBAA 3WUGA 4I9AA 2WHMA 4HCDA 3U7VA 1EUAA 4EPKA 1QDSA 4PTNA 2YL6A 4HIBA 1BQCA 1JFXA 4ZQCA 3JVAA 1R2RA 1EX1A 2GSJA 3WQPA 2OX1A 1NP0A 3S9IA 2AAAA 3VD5A 3RCYA 3M5YA 5E1QA 3DBPA 3BCDA 2VD8A 1RD6A 3ITTA 1JYXA 2WW5A 5B80A 1UR1A 3KWXA 3QLDA 3LGDA 3PZVA 4HJFA 3LI1A 4D6JA 2A3BA 2QF7A 3K1DA 3A24A 4C6JA 2BGNE 1XIBA 4ZXOA 4F0HA 1Q6RA 1OFQA 2J6VA 4M81A 1RH9A 1ADOA 5EMKA 2P5NA 2QEZA 4DEFA 1E43A 4E8GA 4J35A 2ZRXA 1UR0A 3O6AA 5LNUA 3GC5A 4LYQA 1W32A 4XKYA 1L6SA 5LSMA 3T2QA 2YSWA 3H2CA 4RDWA 4X3ZA 3W2UA 2CESA 1I1XA 3SCSA 4ZSUA 3WN6A 4AX7A 4GKLA 3WLIA 2CHNA 4C65A 4O57A 5CSUA 2R1LA 4B91A 3W2JA 4HTYA 4Q8NA 1JD9A 1EP3A 3QQWA 5I3HA 4PYSA 3LCIA 3T0TA 3BQ6A 4LUTB 2C91A 4AXNA 1EJXC 4IMCA 4ORMA 3ITCA 1NOWA 1ZP4A 1DIKA 4KCTA 3QHNA 2GGJA 3U3HA 2DVUA 3M7SA 5IFPA 2OZ3A 1C9DA 2G97A 3ZWSA 2GWNA 4NQ1A 2B7PA 3FKKA 3QMTA 4QISA 3PVFA 5CQ1A 4JNYA 1F8IA 4JDYA 4Z08A 5C7HA 1T6MA 1IE7C 1D7FA 5HMSA 1WP6A 3A47A 1LQAA 1NF0A 4ZO6A 1REQB 1H09A 1E51A 4ZMGA 3LTPA 1VCFA 3ZO9A 1A5LC 2J7CA 1BHGA 3AJ7A 4AISA 2G50A 4FOUA 1S2TA 3N17A 4H1ZA 5ENLA 4EIVA 4H01A 1OB0A 6REQA 2J8FA 5DCEA 1LDCA 1XCFA 1UBPC 2A5HA 4H41A 2QUVA 1EO7A 2WPBA 3H4WA 3O05A 5BU9A 2TAAA 3GSMA 3HG3A 1YE4A 2IS7A 1XH1A 1C91A 4DJEC 5HR6A 1DXEA 3R11A 4LXFA 4L6DA 1HVXA 2MNRA 1RQHA 4BK9A 3EPNA 2UZ9A 1G4EA 1NF7A 2YDAA 4HPHA 1MWOA 2J9YA 3WF3A 3E0WA 4HOZA 3AIEA 4JBRA 3CQIA 3OPSA 4Z2GA 3RN6A 2QUUA 3GTNA 4J4KA 1KFEA 2I17A 4CN1A 8TIMA 3F2DA 1ZU8A 4QG8A 3VTRA 3TTOA 1XLAA 4A2RA 1W5PA 1GWJA 4HP5A 1HO4A 3WLPA 3INPA 5JUVA 3E3HA 3N6JA 1DJGA 3EWCA 1UWTA 1QU4A 4A3RA 2HWGA 2RDXA 4AY8A 5CBJA 1EDGA 5LGXA 2QUNA 1PZ0A 1US2A 3WLSA 1KXVA 5BCAA 3DECA 3WKZA 1RUSA 1XR2A 2P88A 4YTUA 1SO3A 3FEMA 4U2ZA 2E09A 3RK8A 1C8XA 3C2RA 5K2ZA 3NGFA 2YCLB 1XYLA 1EJRC 1R3SA 1YTKA 2WPGA 2XWEA 3RUBL 1M7PA 1UA3A 3LUTA 3WQCA 2GSHA 1U83A 3WQ8A 4LYKA 2QUTA 1NOFA 4W8AA 2G5WA 3SAZA 1OC7A 5E93A 3T7VA 1I8JA 2ISWA 3S1VA 2PODA 2CBVA 1NAL1 1D3GA 1W3TA 2R6OA 1IZCA 2HV5A 2J7HA 4QJ3B 3PJXA 1VJZA 3W07A 1FH8A 2QV5A 3QZAA 3HB9A 1XYFA 3K1GA 2V5KA 3L0KA 3FEQA 3B8SA 4J27A 4MLRA 2IPFA 1JF5A 3S47A 4BF9A 3TDFA 3A64A 1KGUA 1OABA 3FKRA 2XM2A 3IGSA 4HNVA 3L21A 3I7SA 4GE8A 3M0IA 3W7CA 4RDYA 9CGTA 1EPVA 2O55A 3BURA 4B2DA 2OYLA 2NVCA 3R4IA 3H7RA 1UIPA 1W1YA 1J10A 5J8LA 4N0RA 1O95A 1GOQA 3W37A 4GUGA 4UQ9A 3HQOA 1ZCOA 1U5VA 1EEPA 1XG3A 2C15A 1EP2A 2EO7A 2V38A 4QHRA 4DBWA 1LWJA 2Z24A 3GZ3A 3K8MA 3N34A 3TIMA 1H7NA 1ITUA 1ZJBA 3BLEA 3MP3A 4C91A 5BXRA 2ZX9A 4GCAA 2IUZA 2E5BA 3OBKA 3CV6A 3PWIA 4FF7A 1K03A 1JZ2A 1E4MM 1CLVA 3W26A 3C2FA 3C56A 3T0AA 1OGGA 3H26A 2HNEA 3D3FA 4DM2A 5XIAA 1VEOA 2ACSA 2VCCA 1F6KA 4D1IA 4IISA 1TCMA 2PDHA 3W87A 4RNJA 1PKMA 2CLHA 3W6MA 2EJ1A 3MTWA 2QS8A 3WDRA 3VNIA 2ABBA 3CAQA 2IKJA 1LBFA 2W4XA 2WJZA 3PG9A 3XINA 2C13A 1FKWA 3GR7A 3CPGA 3A9BA 3WF4A 3NZQA 4LF1A 3DGBA 4FLSA 3HG2A 4PMJA 3AXXA 4H04A 2E1WA 1JCLA 1WOAA 4H19A 1P4CA 3VKBA 3WZ0E 2BY3A 1TSIA 1V7YA 1MUWA 3FFSA 2VR4A 2REQB 3EDJA 2XISA 3CL7A 3VIGA 1VFHA 1D8WA 1PDYA 2BY1A 1F61A 3LGEA 3O07A 1SFTA 3TE9A 4XUGA 3CUGA 4FB7A 5C71A 1VF8A 2VZUA 2WK2A 3WLNA 5D4YA 2ZZ6A 5AYBA 1J0KA 2L5HA 3TQPA 4OJYA 4DM1A 1W1A1 1S1PA 5K9DA 1VYSX 4HN4A 4RXGA 4BHYA 1W91A 1CENA 3UY7A 2J75A 1GUVA 2CHRA 1EQCA 3NO5A 5HQEA 1OFAA 2R91A 2JGQA 2FHFA 2YCJA 4WCJA 4PUMA 3OOQA 1LRQA 4XD5A 3W81A 3TX9A 3PZGA 3VMNA 1ZS2A 2QMJA 4C1KA 1EJUC 5D9NA 3OYZA 2YXXA 4FI4A 3CUJA 3OIHA 1GYLA 1J6PA 1EJSC 4DJFC 3QR1A 4AMAA 1D3HA 1ZP3A 5D9OA 3ZT6A 1GG0A 5CPNA 3AXIA 4RLIA 4Y9OA 3PBYA 4YIWA 1EWEA 3R94A 4HMCA 1EBHA 2DSKA 2ZX8A 1EOKA 3C0SA 3PY2A 4QDMA 4RV8A 3GIPA 1H1NA 1W5MA 3AC0A 3S83A 3TN3A 3WFAA 3RF9A 2DZVA 4GI6A 1VHNA 3RU8X 4DF1A 1OSEA 3GDRA 4HPXA 4IMEA 1Q65A 3QMSA 1KM1A 4GA8A 2DP3A 1KRAC 3M16A 3SR7A 3TV8A 3LLXA 1O66A 2OQLA 3UEQA 2PZ0A 1EH9A 3I4KA 1X1OA 1BXCA 4FX8A 2PWGA 1WNOA 4OUIA 4AMCA 1PV8A 3M0HA 2OEJA 3E12A 3MWCA 1YNYA 2ZRUA 3DFPA 2FVKA 2OEMA 1TIMA 2A3LA 5JMUA 2ISDA 4Q8PA 3BGGA 4AZBA 2O9RA 3VC5A 1VQTA 2ZYFA 3A22A 1XPGA 5BOFA 4J3SA 4AYGA 2C19A 1UWQA 1VBHA 2R24A 3CLMA 3W7IA 2XHYA 4BI6A 2JBMA 1GVIA 5LA0A 5KZ6A 4KWSA 1HX0A 4KERA 2O0TA 1CXEA 2PAJA 2ZXQA 4LTSA 2KAUC 3GR4A 4G56A 4UQEA 1ELSA 1E6SM 3S8HA 4JTIA 1AD4A 1C93A 4UBPC 3V36A 4ZR8A 1XBXA 4L5ZA 2BVDA 1F7BA 3VIFA 2VDGA 4GZJA 4OOUA 5LIYX 3BH4A 5AHFA 1XF0A 3TN6A 5F4WA 3TNBA 5G2HA 3S0CA 1G7VA 3CXOA 3NM1A 4XBSA 1PKNA 3SEPA 1QNSA 4BEUA 3HM7A 5FF3A 3SUVA 3FCPA 5D2TA 2YDSA 2X7WA 4TV5A 5MF5A 1KBIA 4PCTA 3CIVA 3IUDA 1UR9A 2ZBTA 1EL3A 2YL9A 2DIEA 1SJAA 3TAKA 3NJ3A 3A4XA 4J7RA 5HNRA 2PUZA 4IP5A 2H90A 2VRQA 1QUMA 1QNPA 2ABAA 1J8VA 1V3KA 1VPQA 3W86A 1XS2A 1RQBA 1L6WA 3AAMA 3F4NA 4NX0A 5C55A 5A6SA 4O10A 3W0KA 3UGRA 2EPKX 3VD4A 1PKYA 1DIEA 3AJXA 2YBUA 3OYXA 4O4VA 2ZTKA 5BROA 2DH3A 3UG8A 4Q4QA 3VE9A 2BHYA 3AIWA 4JEJA 3S1UA 2RDWA 2WM1A 1U2YA 1IEWA 2YFNA 1Q6CA 4S3DA 4QP0A 5DRCA 1X8FA 2VOMA 3CNYA 3PN8A 1CGWA 3BV4A 1O5RA 2VGFA 2NUYA 3FJ6A 1EDTA 2Q3OA 3UERA 4NYUA 1H7PA 3R12A 1XRVA 3IK2A 5A95A 4QCEA 1VYPX 1AQMA 4N42A 5F2IA 4K8HA 4I9MA 4XX6A 1FXQA 4XB3A 3CZKA 3BG9A 4H8VA 1FBAA 4P8VA 4LH8A 3MI3A 2C8NA 3GXNA 2BXYA 4Q4SA 5H2ZA 4LV4A 3JRKA 1DIDA 2GGGA 1S3HA 5EFDA 3UXAA 5FAGA 1XINA 3F5KA 1Z6KA 2GZXA 1TO3A 1IR2A 1QWGA 5I0DA 2ZXDA 3BGJA 3NOEA 2CZFA 4PCPA 3WH8A 2O9PA 1ECEA 1A47A 2XN2A 3E1F1 2GVLA 3KOFA 3ERPA 3W38A 2WVVA 2X0HA 3E0FA 3LPOA 6XIMA 1AG1O 3KUMA 4F9JA 4NI8A 2TSYA 3R25A 3WQ6A 1VB9A 4N9EA 1OCNA 2FPYA 4HMNA 2J7DA 2A1YA 3EA2A 3RLHA 4S3GA 3FK4A 1SFLA 1W31A 4NL1A 1LRTA 4OV9A 1KM3A 3P61A 2JGYA 3EDKA 2QCFA 3CBWA 1GTEA 4EF9A 1EYEA 1LG1A 2VFIA 4O52A 3VNYA 2GDQA 4MDPA 2EG7A 4S3BA 4F8XA 1CXHA 1QBAA 3E5PA 3QGKC 4EACA 3ONCA 1UQYA 4GX8A 1MZHA 1BRLB 4XAFA 1PIIA 1DWJM 1IEQA 3NQMA 3TA6A 2WWCA 3WUFA 4C1LA 4YWSA 3PNUA 2OX4A 1JPIA 2GK1B 3P0XA 4P7LA 1HJVA 4BQ2A 1KM4A 1W9UA 1GT8A 2YOCA 3P5YA 3W2KA 4N2YA 2J74A 4BS0A 1EP1A 2ZA2A 4L1GA 2QIWA 4QCFA 5A2AA 3D46A 4HCHA 3AUJA 3S5SA 2YL5A 3IANA 4LNCA 1RP9A 3WBXA 1H7OA 1ZL1A 1BYBA 2DQWA 1H51A 5EB8A 3G5EA 1XICA 3OLEA 1RBLA 4I5XA 2E0PA 2E6YA 1JDEA 1XC4A 1N55A 3VDCA 1OIMA 2WMIB 3RLGA 1QI2A 4IPNB 2QGHA 1ZJHA 2PDLA 3G1SA 4JQ4A 4DBEA 1Q6DA 5AOUA 2MANA 3CIXA 4GVFA 2VEIA 1QNOA 4OBRA 4C1NA 1QPOA 1E9YB 1YHTA 4OIFA 4CNSA 1SM9A 4U28A 4WIWA 1J0IA 4Y8FA 1GVOA 2O4MA 4L64A 1RJPA 1EBGA 4D6FA 3LXBA 3GBEA 3H2MA 5AVNA 3W2NA 3W70A 3WF0A 3V5CA 2O7SA 4B9ZA 4Q8QA 3VDBA 2PBOA 5B7YA 1XUZA 1AD1A 5KINA 2IXVA 1TFVA 4EE9A 1ZGDA 2GFTA 2A3EA 2QJIA 3HQPA 5CXPA 4K8EA 1EZ2A 1UD5A 4DRSA 2G4JA 3F4WA 5DCDA 2NV1A 2NXGA 2FIQA 3V0UA 3GNPA 3RAOA 4F66A 2W0UA 3FSUA 4DZIA 3AQUA 3FAWA 4LVGA 2XVNA 2PFHA 2E9MA 1QNQA 1UA7A 1E72M 1TPWA 6TIMA 1V79A 3KL3A 2NX9A 3AHYA 2O9OA 4UR8A 1F3WA 2RHGA 2DZBA 2FJUB 3LSBA 3ZVHB 3EMCA 2YDQA 3NQEA 3F4CA 4AWSA 4B15A 3E74A 4S3KA 4BCEA 3B03A 5CAHA 5FJIA 3L5AA 3QSTA 4X63A 2OLHA 5JBFA 2WSYA 1RY8A 3H55A 4LBUA 3G0UA 3SGGA 2BBFA 3MMDA 3FLUA 1AVAA 1SJBA 1TV2A 3AMLA 1QOPA 3ARPA 4KPLA 2B81A 1RBOB 1P43A 4QEEA 3QTPA 1QATA 4E5TA 3P84A 1Q6EA 3AZSA 1RHCA 4HPNA 5A6AA 3ZYZA 4FNTA 4QLLA 3W1MA 1ZHAA 2EHHA 1Y5VA 4HNUA 5IBXA 3I4EA 2QJJA 4MB3A 1E3ZA 3F5JA 1VLWA 4MFEA 3RO8A 4DY1A 1B3WA 4CD4A 4JL2A 1SW0A 2TPSA 3AWOA 4W87A 1GKRA 5E0FA 2VI0A 4CU6A 2D0HA 1BYAA 2CLKA 1CI1A 1QK2A 3CWOX 1TPVA 1JJKA 3APTA 1SO5A 3T05A 4NZJA 1JUKA 2X16A 4QLJA 3BOLA 3SY1A 1D9EA 3KVMA 3OGRA 3ZJ7A 3R2GA 8A3HA 1S2VA 5A6KA 3MSYA 4WUIA 2J9XA 3QMRA 2YA1A 3NQVA 1US3A 4FIRA 3HIJA 3W1NA 2CWNA 3LEPA 5G4HC 1KBJA 1T8XA 1LUCB 1GTHA 4JTTA 1HZYA 1X98A 4JAWA 2OWWA 3DKJA 4JIPA 4TOQA 2WLYA 3E2SA 1UASA 1OGSA 2BTMA 3EOLA 4PA8A 3W01A 3OO2A 2DSUA 3WH7A 1OC5A 3THUA 5D33A 2YB4A 3ISIX 1NDWA 2BGQA 1WDPA 3TCSA 1WX0A 1F4HA 3TLLA 5HAOA 1QBBA 1XYZA 3M1ZA 4DWSB 1RVKA 4DYKA 1V4YA 1V3IA 5IHSA 2INEA 1NWUA 4MKVA 3U5YA 4MJZA 1E6QM 4FS9A 3OBEA 5E6YA 4GFSA 3V5FA 1EO5A 1HGWA 3WCZA 1AZ1A 3O3RA 3RR4A 1EUNA 5TNVA 3OP2A 4S3FA 3S5ZA 3UR2A 4AD2A 1SJCA 3U2ZA 5CJNA 1HFBA 4NZ1A 1DORA 4C6LA 2QQ6A 4ZOEA 5F7UA 2BMBA 2B7OA 2WC4A 1XLEA 1AW2A 5FA5A 4L80A 4PSPA 3O63A 4WD0A 1TRDA 1UPMB 3GUWA 2XVKA 3EKZA 4HKPA 3UYIA 2IQ0A 5T9BG 1W56A 1EF3A 1XIHA 2YCEA 3WBYA 3GKFA 1FTXA 5D38A 4Z2LA 2BOGX 2BS9A 5JH1A 1CXLA 1TA3B 1KW1A 3W7KA 4UFKA 2HVOA 2HROA 4JFWA 4D8AA 4OBTA 3RLUA 3M0VA 1NWTA 3LV6A 4QNWA 4GINA 4LFYA 4PGLA 1JCXA 3MVIA 2Y63A 4MHBA 4MWAB 1FWAC 1XYCA 5E09A 2AKMA 1FX6A 4J3WA 2XIQA 5HUPA 1PZ1A 3MW7A 3S46A 2BWGA 4C5YA 4BQ4A 1UB3A 7REQA 3GTIA 3IVUA 4UCFA 4IFOA 2CPUA 2VFDA 3NVTA 3S5OA 3GHUA 3VYLA 2G96A 3FSTA 2XZ9A 3G24A 5G1TA 3QY6A 1XC6A 1Q3NA 3SJNA 3WJXA 3WDHA 1HKIA 4YS1A 5AZ1A 2DORA 3H12A 4NNCA 4GVHA 4E2BA 4O18A 3MHGA 4AD0A 3EA3A 2DW7A 3DBNA 1E6ZA 1Z48A 2XPKA 1B9BA 1FP8A 4G7EB 5CSSA 5KZMA 4HNCA 4WDWA 1KLYA 1Q7QA 1H49A 1RV8A 1JAKA 1CB7B 3FYPA 1L6FA 2PD9A 1GNXA 3VXGA 1A5BA 3DENA 1SFJA 2QVNA 2VGBA 1IZKA 2F61A 3CUFA 3QH2A 1EGVA 5HBFA 2F6KA 3G18A 3N1AA 3NNTA 4O17A 4PMQA 1G4TA 4RCXA 1Q7ZA 3AXKA 5CPSA 4AW7A 2BX7A 3A13A 3QLLA 4NVTA 4AEOA 3R1ZA 3KXQA 3EX4A 2DDXA 1W6TA 1W9BM 2RJHA 4L65A 2WANA 4QE5A 3CZ8A 2JEPA 4O54A 4I6KA 4HU0A 4ONVA 5EYWA 1XRFA 1H62A 1XLHA 3AYSA 2QDHA 2QF8A 4OT7A 3QFWA 1KCLA 1BWVA 1A5MC 1AZ2A 2PEVA 3ABQA 4BF7A 5F4SA 2WNWA 3AHVA 1Q66A 3GRIA 2ZUTA 2A7RA 2AGKA 3UYCA 4LEFA 3EZ4A 1VFFA 3GZAA 4GNVA 1RK6A 2UWFA 4GFIA 3OVRA 3N2CA 4GYPA 4I9JA 2W61A 3DYOA 1I0DA 3GAYA 1B4KA 3K4DA 1T5AA 1DTNA 3CS2A 4AIOA 4K1GA 3KM8A 2CETA 4KKXA 2OCZA 4DI8A 1VH7A 1GOIA 3WEOA 1JCTA 3KS5A 3WG6A 1GVRA 3MWAA 4V2XA 2DT0A 1UIOA 4HB7A 2AL2B 1BWKA 2Y89A 3SGUA 1S1RA 1RBAA 1TJRA 2Y61A 3VGFA 3VX0A 2V8ZA 3LHWA 4AF0B 2G3JA 1MW2A 4HA1A 1XX1A 2Q71A 1E15A 4XAYA 5FSDC 2HISA 1O68A 3LLDA 1KBLA 4MLJA 1XQLA 4YTQA 3GVQA 1AH0A 4W7VA 4QEHA 5CC7A 1CGUA 1KR0A 2V3EA 1RVGA 1Z32X 4U31A 1A49A 6CGTA 1OFOA 3VOIA 1PCKA 2C0HA 5HULA 3ZR5A 2OTDA 2R94A 4GQRA 2VEPA 4JS3A 2ZX5A 3N25A 3GY1A 2OJPA 1OG6A 4L7ZA 4HHHA 3K46A 4JTJA 1I1WA 3AMGA 4REQB 3UJ2A 3KFTA 4WY0B 3TSMA 3SY5A 3VX1A 1E40A 4HCLA 2AKZA 4IIEA 2X1UA 4ZO8A 1TE6A 3F4DA 4ES4A 1QAPA 4DAFA 3TVAA 2PU0A 3R10A 4XZBA 4H3DA 3P60A 3IJQA 3HG5A 3HURA 2PRHA 1GYMA 4G6CA 4FXSA 4GIAA 5A1AA 4A21A 4ADTA 3DFHA 1RXOB 3KCOA 2QT3A 1Q6LA 5FJJA 3WDQA 1IT7A 3B8VA 4PRRA 2PCEA 1TV3A 3ARSA 4IX2A 4LAZA 4E4FA 1J01A 2OGYA 1KB3A 3A5VA 2CZ5A 4PMXA 1UJQA 1XDLA 4E3TA 4Q33A 2XDFA 4GCXA 3U5UA 4E8CA 2Z2UA 3FVDA 4HPGA 1P6BA 1XLKA 1T99A 4NSBA 3QVQA 3EDEA 3TSBA 2OO0A 4BKNA 3B0UX 3QZEA 3A4JA 1XDJA 3UR8A 3HF3A 3QY7A 1VFSA 1BXNA 5D2XA 3TU9A 1R2TA 2HS8A 3R8RA 3T9PA 1DWHM 3IIPA 1UROA 2PRMA 2GK1A 4KFOA 1NH6A 1UJPA 5AYZA 2E5CA 2GVGA 4F4RA 1ZAJA 3AMCA 4YYCA 3TEVA 5G4WA 2ZQ0A 3VD9A 5F2GA 3VGEA 3REQA 3LCWA 3KOZA 1FCBA 3FV9A 4JIRA 3AZTA 4TR9A 2HNHA 1GHSA 5TQLA 3GXTA 3SIZA 4JKMA 1YYAA 3HZ3A 4HBKA 1F05A 1UKTA 2WMIA 5A69A 3OVQA 4WSJA 2X2GA 2YB1A 4Q6XA 2XZ7A 5A8NA 1E6PA 2VOTA 1PXGA 2DZXA 2OLAA 2XN1A 1R6WA 1JG9A 1JGMA 2NQZA 4H6RA 1CBGA 1WXZA 1TPEA 3B04A 3G22A 3P0WA 4A3QA 4GX9A 1A5NC 4H9YA 2E9LA 3MHFA 1OFDA 3F5LA 3PWGA 4PCFA 4PMDA 4E8DA 3GK0A 2NSXA 3WLMA 2CLFA 4YXGA 5AZ0A 4NKCA 4DYJA 4QE1A 4GZIA 5TD4A 3HPFA 4H6KA 5C2GA 4F0SA 4GI4A 2RGLA 1KCZA 3SUTA 5JU6A 3MY9A 1JXKA 4GYFA 4FO4A 1MW0A 4PB5A 4NAFA 1W37A 1JXJA 3TYBA 4ROPA 2GUYA 3UQNA 5M5DA 4ZBCA 3BSGA 1R7AA 4CNPA 2DZUA 3TYZA 4Q4RA 3Q67A 1V0KA 2XUCA 1TTIA 1MXGA 2OYMA 3OEXA 2PF8A 1HVQA 3MZNA 1QW7A 1XM3A 4CU7A 3QRHA 3ITXA 2VDIA 1I9CB 3CH9A 2FZBA 2I5QA 2ASHA 2VQUA 4PODA 2WNNA 3MSGA 3CL8A 3WLOA 5I00A 1UR4A 1PX8A 3VD3A 1E5JA 3CZGA 2QAFA 5BYWA 3RMJA 4Q8VA 5DY2A 1FWFC 3L4TA 4OTKA 4TQTA 3W27A 1UUOA 2F84A 3VAVA 1E9ZB 5LXEA 1TYGA 1CPUA 2QV4A 5D09A 4JTLA 5KMYA 3C2YA 4S3CA 1I60A 1A53A 3UPBA 2YLLA 3Q4DA 1SZRA 3IAPA 1WXYA 1TVLA 4U2YA 2EPOA 4CCCA 1XYMA 4NT0A 5C54A 1ICQA 4L1XA 1A5UA 3EKLA 7ENLA 1AQHA 1RR2A 2CXGA 1J79A 3GYEA 2PWEA 4UTMA 3EX6A 1QHPA 3OVGA 4AVNA 1R3VA 1KRMA 1RA5A 4XBJA 4AX6A 5D03A 2Y8VA 1EB3A 4ZE4A 2I9UA 1KGWA 3UT0A 3KBVA 1UZDA 1WUEA 4Q22A 3AIVA 1V7AA 5KZEA 1JRCA 4A29A 5AHIA 2GWGA 5I23A 1JCJA 2JEQA 4CGTA 4KEMA 3GB6A 1HJSA 4AZ7A 1S5WA 4LT9A 1ICPA 5LKYA 1GQJA 3WJWA 5HNTA 3HV9A 2F9RA 4IP7A 1K7EA 2D2HA 4UTWA 1NDYA 3OZPA 1XGZA 4Q8MA 4W9TA 3T81A 4GG9A 3S9ZA 3FJ4A 3WQOA 3I3BA 3WLHA 1CX9A 2J25A 2PDIA 3M46A 1LWHA 4B3LA 1JYWA 2P53A 3SCWA 1S38A 3Q37A 3FA3A 3ECQA 1K77A 1JDAA 4HNOA 1RCXB 3NZ1A 2IW0A 3TWAA 1NM9A 3QQ0A 1JPKA 2PGEA 1R3QA 4BWLA 4L4OA 3UR5A 1CXFA 3B97A 3LB0A 3SN0A 3TQ0A 3ARYA 1KTBA 3HMJG 1DP0A 4S39A 1QJWA 3W85A 2QJGA 1GOKA 4V15A 3JS3A 1BVWA 4ZA0A 4ZGYA 4TTGA 3P8IA 1E1EA 1Q8AA 3M9YA 5A2BA 5E9AA 3FXGA 4HQVA 2W9MA 4DWSA 4E4PA 5AHLA 3RRAA 3WENA 1PDZA 5A6MA 4FR1A 4LS1A 5JVLA 3GYCA 3BJFA 3DG6A 1MDLA 2GVJA 3M44A 4L4MA 3WNPA 4UTKA 4Y9NA 3L4XA 4ACZB 3L0NA 3QGVA 2WQDA 1T40A 3FDGA 2V6AA 3L2IA 2WV8A 1SSGA 3G3MA 4GI8A 1PIFA 1LLWA 1XG4A 3CH0A 1H11A 5AHMA 1CIUA 4C6NA 4R5EA 5DMLA 3GTHA 1KV8A 2A85A 1RP8A 2J27A 4HNTA 3NPVA 3EMZA 1VR6A 3N2OA 4IG2A 1O1ZA 5EMMA 1O5XA 5CZKA 2HBVA 1YBQB 2EAWA 3BLDA 5CLTA 1XW8A 4KEUA 2CFFA 1ZBKA 5A8OA 2CLLA 2KX9A 4HK6A 5HNUA 3IEBA 4URIA 1TZZA 5D9PA 4PUNA 4KRUA 4JICA 4HU4A 1HL8A 1K1DA 2E9BA 1SVDA 3SN1A 2J47A 4C6EA 1X7IA 1IIHA 1YADA 3M43A 1XLGA 3DYMA 4O1CA 4AG0A 4ML4A 3MA8A 2ADAA 3UPMA 3SCQA 3N6HA 1OC6A 2FDSA 4ZODA 4QRNA 4Q7IA 1CTNA 2BP1A 3QBUA 3GNOA 4LF2A 4MMWA 3M0ZA 3NO3A 3F7JA 3GXFA 3ZR6A 2SFPA 3N4FA 1XH0A 3MMTA 1ONXA 3FW6A 3RM8A 4AFYA 2XIJA 3GTFA 3H2AA 3O06A 1LOLA 6PTDA 3VGDA 3MBFA 2NZLA 4LS0A 1YDVA 4L61A 1KFLA 4EWJA 3ATYA 2ZVRA 1CYGA 4CN4A 4XSLA 3NDOA 5LHEA 3POCA 4P8WA 1UKQA 1PO9A 2XGZA 3C6CA 4A05A 3EAUA 4R7OA 5HOSA 3BG5A 1UWUA 4NY2A 3TJXA 3IGXA 4B2DD 1NJJA 3E0VA 4GHRA 5ABFB 4HSOA 2QJHA 2Y8UA 1XLLA 2NQ5A 1FOBA 1DWIM 5JQ9A 3L68A 1CT5A 1S5NA 3SY8A 3AI0A 1FH9A 3VABA 3P3BA 4M19A 4XZHA 1B4EA 1LROA 4R9OA 2I56A 1P1XA 5C5YA 2W62A 4HHPA 3GBDA 1K8ZA 1FP9A 4PB3A 1CGYA 3S5YA 1RJRA 2EPHA 3DDMA 3SW6A 1EXPA 3QPYA 3SUWA 5A8QA 1UKSA 4WJ8A 1EYWA 1AL7A 1OJXA 3B3DA 5HA7A 3DZ1A 1QI4A 2WO5A 3AICA 3G1RA 4X9SA 4JFUA 3AFBA 1XI3A 2BOFX 4NXSA 3VNJA 4RK8A 5G5IA 1UZ4A 4D1JA 1V8EA 4ZTXA 2VVNA 2NT1A 3CB8A 3VOHA 2ZOXA 3LPGA 5BRQA 3BMWA 4BA0A 2WZTA 3VKCA 4XZWA 4X9YA 1LLOA 4CUCA 2DIKA 3E9AA 3N14A 2DUXA 4ZTYA 5FD0A 3XISA 4AF0A 2WSKA 1G5AA 1OG0A 3HG4A 3LG3A 1TPDA 1R5YA 2WHJA 1PIGA 2PMQA 5D37A 3RGTA 5AYXA 1H7WA 2QUMA 3OB8A 3UXLA 4O8RA 5K9CA 1DV7A 4Z1YA 3VIKA 2ZUVA 3CHEA 1EPXA 1Y0EA 2GDUA 3PB2A 1OYAA 6ALDA 2KZHA 2WVSA 1P7TB 4XUYA 4I5UA 3LN3A 3UP8A 2W6RA 4S3EA 1ME8A 3VIPA 2QKFA 2NT0A 5I3IA 3IIOA 4RE2A 3KRUA 4CQCA 4PUEA 4GGHA 1WDSA 4NXKA 3EWZA 4KWVA 3ITGA 3KBMA 4CQ9A 2FVMA 4Z0SA 2DZTA 4B16A 3IWPA 4IJBA 2PA6A 1SZGA 1YMYA 3G6MA 4EOUA 3QW4B 5J5RA 3TQVA 6ENLA 2P8CA 2PI6A 1M04A 4JXCA 5KSWA 3BMVA 3SCNA 3M0KA 2ZRZA 2OT1A 5C9WA 3FVMA 3MKKA 3H23A 1V6UA 1WBHA 3EGJA 3G8RA 5DEZA 4GXPA 3IACA 4D8ZA 4MAVA 3USBA 3LPPA 1BTMA 4A3UA 3BE7A 3UG4A 3WNLA 1A80A 1F3TA 3V0TA 3B8UA 2HK1A 2C79A 1SR0A 2J7EA 4RW3A 3W6LA 1OEPA 1AQ0A 2VFEA 3DESA 3WD2A 3TN5A 2F38A 3G1XA 3VI2A 3M0XA 2VGIA 1YLVA 5EU9A 3CLWA 2PE4A 3QN3A 5I3JA 1G1YA 1IEVA 1TV8A 3CUHA 4ZB0A 1LQ2A 1GOWA 4MGGA 3FNDA 3SI9A 3CEUA 2XSBA 3QEZA 1YIXA 3P93A 3UJSA 3SCOA 2D2OA 3MI6A 3G3DA 2PGWA 1XBVA 2E77A 3MUCA 4AZIA 4EWND 5IFTA 4C6KA 1UYQA 1S2AA 1KWKA 3OA5A 5ABGA 1Q85A 2QVHA 4PUKA 3NYZA 2J79A 3VMPA 3BMXA 3NAVA 3LDVA 2OKOA 2WC7A 1B54A 3C0QA 3S42A 3QZ6A 3JU2A 5U7SA 3NQ2A 1JZ8A 5EBUA 1BVZA 1QI3A 1SO4A 3KRZA 5CKSA 3ID7A 3LCLA 2PDPA 4JEQA 3CAKA 1VBGA 3BSMA 3E2RA 3P6LA 5E6ZA 4HYWA 1FFQA 3UA3A 2ZRWA 3UVAA 1QNVA 1NOUA 5EKYA 5LZLA 1E1CB 1XKJA 2D73A 3MYOA 1IWPA 1Z44A 4XZNX 3GD6A 3UCCA 5HATA 4MM1A 4UXDA 3A3WA 2R1NA 4DI9A 5DLCA 3HGOA 2X1TA 3IJIA 3H70A 2I5IA 4FX7A 1ODZA 2WM0A 1A0CA 3OTRA 3CHCA 4OU1A 4JZ5A 1K7XA 4HU8A 3AS2A 3AALA 1Q6FA 3W6YA 3VINA 4QE4A 2QDEA 2Y4SA 4YWIA 2QDDA 1KRCC 1M41A 1YDOA 3G1VA 3S5NA 4GD0A 3O0FA 4CVWA 4OE7A 4H8NA 5SWUA 2ISVA 4X2PA 3QKZA 3W7NA 4HNLA 1MRQA 1X8CA 4E2VA 3KS6A 4JPGA 3W7HA 4TX6A 1TRIA 3BARA 1J5TA 5I79A 4EPEC 3WIJA 3P2VA 4LYPA 4A8LA 2X30A 4WDXA 5I24A 1TX2A 1E6XM 3DHUA 1FWHC 2VC6A 4QROA 4FK9A 1F76A 3TKFA 4HYRA 2VMFA 1IWBA 4PMOA 5BWFA 2W27A 3PSWA 5A6BD 3SUUA 4ZQOA 3SRKA 2GJNA 1XIJA 4O0KA 2QIIA 3O1NA 4J3UA 3LERA 4LVBA 4GY1A 2Z28A 3PZQA 2ICSA 3HPXA 2XIBA 2DZPA 3WNNA 5BOOA 5M03A 2WCGA 3UESA 1V03A 4R33A 3W1QA 4NG3A 3SRFA 3K5XA 3WQWA 3V1PA 4PCSA 4DNHA 3PSVA 1MI3A 3WDPP 4M8UA 4AZGA 5E5CA 1M68A 3H2OA 4LU0A 5C8BB 4O0QA 1V0LA 2I57A 1VAHA 2ZADA 2E7FA 2WJEA 3VDHA 3W75A 4JFSA 3CAWA 3WX7A 3SFWA 3KOYA 2FGZA 1IEIA 3ALFA 3EX2A 2RJGA 4IXXA 1DVJA 2V5CA 1UC5A 4B90A 3S6TA 4MYXA 2NUXA 4FIQA 4UQDA 1Z8AA 1YXDA 3DFTA 1XDMA 3VDGA 1H0GA 3T09A 1W3KA 2ZIDA 3JZEA 4E2DA 2A4AA 3TN4A 2QDGA 3BLFA 4W5UA 1PPIA 4BZYA 3RHGA 3TYAA 3UZJA 4D6EA 3DFQA 2A7NA 3AUOA 4LAUA 3DC0A 5MHBA 1DOSA 3ALGA 1AW5A 1K9DA 1TTQA 3RFAA 3VO0A 3WUBA 4WK9A 1E3XA 1W17A 5C6MA 3TZFA 1VS1A 1E0UA 2F2HA 4MWAD 3S1GA 2YPIA 1J9YA 2VC9A 3G0SA 3SFKA 1WZLA 2P0IA 4NJHA 1KFBA 2WZIA 2PGFA 3N15A 5C9ZA 1C3FA 2QR6A 4CNNA 3V35A 2C3ZA 3N4EA 5H8PA 2AMGA 4O19A 1YW1A 3Q94A 4RZ4A 1W1TA 2WCAA 4Q8OA 4DNMA 1BYCA 2X41A 4KEVA 1ZAHA 4F9DA 4JYDA 3BANA 1QHOA 3NQ6A 1FWJC 2F6XA 1A5CA 4ACZA 1G4PA 3H22A 3PZOA 3N19B 2DY3A 3Q58A 3RIKA 4MKSA 1G4SA 2VWTA 1HG3A 4UC5A 3U9IA 5C70A 4Z17A 2XFRA 4ICNA 4S2BA 4HOWA 2WKJA 4IM4A 3VKKA 5H8UA 2BZNA 2XVGA 4QDPA 2OELA 2BLEA 1C90A 4Q4OA 1RCOB 1OWQA 4XAPA 1CDGA 3WFLA 1YQ2A 2OO6A 1FDJA 1HUVA 2PF0A 4C7FA 4UIOA 2PZNA 1WUFA 3ARQA 1BF6A 4NP7A 1UW9A 4GJIA 1VCVA 2VWSA 3LD5A 2VJXA 2C7FA 2QGYA 2HQAA 4IICA 3QSRA 1YBQA 2A6LA 3EDDA 4GQQA 2ZE0A 4M1RA 4GXMA 4OUEA 4TTUA 4LRSA 3AS0A 3ZR4A 2R8WA 3DH7A 1M9HA 3W71A 3WMCA 4E3VA 5E9XA 2V3FA 3BCFA 4KIEA 3HPSA 1W1ZA 4GUFA 4NHVA 3B06A 5HJLA 3THCA 5CG0A 2AOSA 3VIIA 1G7UA 1ISYA 1BLIA 2J7BA 3SUSA 1A3XA 1TJ1A 5DO8A 2ANUA 3B0XA 2Y5EA 2ISFA 3EOOA 5I7GA 3T4CA 4O28A 3U7BA 4CQBA 4FNRA 1MEIA 3B9OA 4PL2A 3TW7A 4FNSA 4CNTA 4H6QA 2ZA3A 3HA1A 3FY1A 1IT8A 2XWDA 3S4TA 1RD5A 1XFCA 3MZ2A 1LP6A 5F2MA 4AIEA 2Q6ZA 3WLQA 1YE6A 2R14A 3UY8A 1XWYA 2BSLA 1XLDA 4GACA 3ANVA 3PTKA 4IWWA 4IFKB 3G1HA 4JTAA 1ESWA 5GJNA 1W3NA 1CECA 4KH2A 1W9DM 4ATLA 3HMCA 2PP3A 3M0YA 2PWVA 1KR1A 4IGMA 4H9TA 4J3ZA 4NAEA 2WBGA 3KOWA 1E0XA 1G69A 3O6YX 3BAXA 1M7OA 1PSCA 4C5ZA 3NM3A 4OGZA 3R7MA 2VM8A 4CU8A 2Y7GA 4NNBA 1TPC1 3APGA 1KO0A 2D24A 1PJ9A 4RNIA 5FJOA 4FXJA 3A5FA 1ZUAX 3LXAA 3T1GA 3URNA 3QR3A 4UTTA 1OX4B 3FX4A 3MI2A 2ATMA 1OINA 5PTDA 5IBXC 3MDUA 1PCWA 4A2SA 1XGEA 3CMFA 3MSRA 4JCMA 2VO5A 1XP3A 4HYVA 3PZMA 3R0KA 1M3UA 2JFEX 4KGJA 1WXJA 2FHCA 1FWEC 4S1FA 1JRBA 5AN7A 3OW1A 5JBEA 1S39A 3N12A 3HPAA 1YDNA 2VFHA 2VX6A 2PP1A 1VGAA 4R7WA 1UOZA 3EXRA 2W67A 2X0YA 4DPPA 1TWSA 1UMLA 3NQBA 3CV7A 3UWUA 2BNJA 1TUXA 4E6MA 3DKLA 1W3LA 3ARXA 4DZAA 1VHCA 4JQAA 4GBDA 3NPXA 3HFYA 4Z2HA 2WJDA 5DBTA 2RDTA 1S5TA 4DO6A 1ZRQA 1JFHA 3CT2A 3F2BA 3W4RA 2IQTA 3LRKA 4U5IA 3QYQA 4MJ4A 3H53A 1PHWA 2CXEA 1QWKA 1GZGA 2PDBA 3GG0A 3URBA 5FIPA 1HXJA 1SQ7A 2H8XA 2D0GA 3L0GA 3LMZA 2C0AA 3EDFA 3C3NA 4MADA 3FJNA 4PUJA 3WK2A 1ZBCA 1EIBA 2WJFA 4GH3A 4ATWA 1KLZA 3A3XA 4GPNA 3EB4A 8XIMA 5RUBA 1V93A 2YIHA 1L6GA 4DUWA 4MFDA 3QQ1A 3SCTA 5LIXX 1ONWA 1GHRA 1JPHA 1EZWA 1NP2A 5AC6A 4JR5A 4AVFA 1OZQA 4HN8A 1W3HA 1K8CA 5LXXA 2WLZA 2W79A 2JK2A 3CYVA 3QF0A 1V6TA 1LL4A 2EPMX 2PSNA 2XSAA 2EG6A 1JPDX 2HTMA 1EKOA 4FP1A 1W2PA 4I9TA 2R1KA 4Y8EA 2GGEA 3PTMA 4HPJA 2ALRA 2QCDB 2EXOA 2ZWYA 4Y9PA 4C6IA 1MVYA 3GM8A 1Y65A 2CCRA 3MMWA 3QM3A 1QMLA 2GJXB 1E9IA 5EGRA 3GE7A 4AZHA 5KETA 1THFD 4UMAA 3BW2A 3MKCA 4IQEA 1V0NA 1XYAA 3BAIA 4TX8A 2VZTA 3S3GA 4UTHA 3CU2A 1T41A 2P3ZA 3TZNA 1L2UA 4BY3A 1OYCA 3OU8A 2G41A 1PX4A 4UTJA 3PUEA 4NASA 3H8AA 1LF1A 3M6YA 3GXMA 3KWSA 2VEKA 2W5FA 1E1FA 4JOMA 5TAOA 3WBEA 1XL9A 4PMRA 3F2CA 4JN6A 2JE8A 4UNLA 3CTLA 4LQ1A 1JL8A 3C61A 3UXIA 2VTFA 3U0HA 4KIRA 4V1XA 1JZ7A 2OPJA 5HMDA 4PC8A 4QM1A 3NL6A 3OJGA 2FB2A 4EX4A 1UWAA 5ABEA 5I3GA 1X6NA 3COTA 3DFNA 3K4WA 3MUXA 3U2EA 4QNEA 1OY0A 3JUGA 3O0KA 4S3AA 3A4AA 3ZOAA 4ZSTA 2VR2A 4K39A 4QITA 2FZMA 2FJKA 4HJWA 1KTCA 4DJED 5HK4A 3QHMA 1W2VA 4RW5A 2X7VA 1SMDA 4A8RA 2BHZA 1H2JA 3S2MA 2C71A 3GH5A 2PDFA 3H4GA 4UNIA 4IJCA 4B9YA 4LCSA 1PTAA 3TYEA 1TZ9A 1B0IA 3SRDA 3AIRA 3P74A 2XH0A 2ZWZA 2D20A 1XIEA 5H6HA 1LORA 1UOKA 4S38A 2E25A 2E28A 5G2IA 4JGDA 2V5LA 3R43A 4N9BA 5DRIA 2G3IA 4XV0A 3LM7A 4QLKA 1X96A 4AAJA 4ACYA 1B3XA 5CGTA 3V3WA 1GOMA 1QRQA 2AMXA 4HVXA 4EXAA 3T44A 3RDKA 3WQDA 5C2XA 4HK5A 1CGVA 1LYXA 1SJDA 5EMYA 4CCZA 4B92A 3GHTA 3R79A 2A3AA 4YL2A 3W1RA 1UUMA 1WO2A 3NR0A 2PDXA 4MY9A 3GLCA 5DF0A 3C5QA 1QW9A 2PLKA 4QJ4B 1TR9A 3TH6A 1YNQA 4JNMA 1X1NA 3W7MA 1OGBA 3STPA 1EXBA 2NQ9A 1BD0A 3U57A 1JNDA 1FY6A 4M6QA 2JKEA 3G6LA 1JR1A 3DFSA 1BWLA 3RPDA 2YGYA 3L7RA 1E6NA 2Z1SA 5CEWA 5GPRA 4GYPC 3PUDA 3A23A 1QPKA 2QW5A 2CLMA 1GOOA 1DQWA 3OQEA 5CBIA 3GO2A 3VDAA 2ZC8A 1OM0A 4W8BA 1O5KA 3LLFA 1BTCA 2NVAA 1TQJA 5LYRA 1D8CA 1MUMA 4M6UA 1S2CA 3UWVA 4NIRA 4PUDA 4AD1A 5I3FA 1P0EA 1J2BA 4ZE5A 3MP4A 2WSQA 2X1RA 4RNHA 3N29A 4M1BA 3STCA 1ITXA 3AISA 1JQVA 1AW1A 1IXOA 1H5YA 3R0UA 1ZPTA 3EXTA 4CNOA 1F3XA 3A12A 1ZFJA 3VU2A 3MUY1 3KDOA 1OZMA 4XIAA 4UTIA 4ERGA 1C8QA 1WA3A 1R47A 1WV2A 4H00A 4J3VA 3WK3A 1J5SA 2VDHA 5FJPA 5TBOA 4I7WA 1GJWA 4X61A 4KGLA 4EK7A 3ARZA 2GJRA 3GHRA 4X60A 1BSIA 1FWBC 1TJ0A 4HMDA 3PFRA 3DFOA 2F2KA 1MDRA 3UJFA 1K6WA 3QFEA 4HZ7A 5GQBA 5D2WA 3WQFA 4M7SA 3GW0A 2A3CA 1Y5XA 3G8EA 4ATDA 4BFAA 1P0BA 1K7FA 3ZQ9A 2QXWA 5CPOA 1MRAA 1Q2RA 1VLIA 4PTXA 1BF2A 3HJZA 2J8TA 4UNKA 4EXBA 3PK7A 1AMKA 1J11A 1ADSA 3TW9A 1VEMA 3NVDA 3L23A 3MUAA 4IP4A 5HJXA 2HPMA 1EHAA 3NCOA 1VJSA 5HR7A 2FPVA 3C86A 1M53A 3URAA 3NA8A 3DERA 3M41A 1DJYA 3WLTA 1SYTA 1LG2A 5CCZA 3MSDA 2HXUA 4MUZA 2FHBA 2Y85A 4GISA 2C14A 5BZAA 1DQXA 1UH4A 1JVNA 1U33A 1H0IA 2OG9A 1TJPA 4XKYB 1X39A 2YW3A 3UNTA 1YPXA 3NURA 2GQAA 2ZC1A 2V3DA 1DEDA 3WLLA 5FEXA 1R7OA 4ZQPA 2YXGA 4D71A 1XIFA 4LUSA 3OBAA 3SJ3A 5M2FX 1GYNA 3TCEA 3VC6A 5LNSA 3R5EA 3N11A 3M0JA 2F6UA 4HGXA 4HMEA 4UQBA 3ZT5A 4A4AA 3GU1A 2WSRA 3NSMA 1NY1A 2ZRYA 5IDIA 5LNRA 4MG4A 4I8YA 1W1IE 4XVDA 2FH8A 2C16A 3AMKA 1OHLA 3E6EA 1WQ5A 3H7VA 2Q8LA 4M3PA 2JF7A 3DI1A 1K6AA 4H8UA 1O6IA 1GVYA 2J13A 1GORA 3B9NA 1LTDA 1TMLA 4LAKA 4PB4A 3LNPA 2ZICA 1VIWA 3TQKA 1J93A 4QXIA 4ZCWA 3EXSA 3MP5A 2GDVA 4GMEA 1N7KA 1DXIA 4DJFD 3CPUA 3NQCA 1BFNA 1FVPA 1LL6A 3C8NA 1MQRA 3DEQA 2V3GA 4CCDA 5BXSA 3DI0A 3W2MA 4NRRA 3VCRA 2NQJA 1UC4A 1HN1A 2CYGA 1FCVA 2OU4A 3GVWA 4PEEA 1BYDA 1GK8A 1BPLB 3FIGA 3HO8A 2G8ZA 3P14A 4LVFA 4ZVJA 1YDYA 1N8FA 4GO8A 4J40A 2VQTA 1IEXA 5REQA 3NWRA 1GVFA 3K8KA 4GY7A 2RKXA 2Y7FA 3IJ8A 5D04C 1Q7MA 4Q7NA 1ISVA 4M80A 2WWDA 4FEZA 1ALDA 2O56A 4QJ1A 4DX3A 4RE3A 3EA1A 2QCCA 3NL2A 4L4PA 5AC4A 3A4WA 1NQ6A 2V2DA 4LWWA 3V75A 2CNCA 1LOSA 2XGIA 3LY0A 5FJUA 4ERAA 2OKTA 5MKGA 1FWDC 3RILA 3UFYA 4AH7A 4DBSA 4LC6A 1RPKA 3EEZA 1IXPA 3I3DA 1R0MA 1ZBWA 4YHEA 1GQKA 2IXUA 3IV8A 4LRTA 3L66A 7A3HA 3GUGA 4UZUA 4JHOA 2H9AA 4C6PA 4HA0A 5G1MA 4F2BA 1FXPA 5FACA 1PYMA 2C18A 4C6BA 1AODA 3W7LA 1O7AA 4FSAA 3S6DA 3RLVA 3WD3A 1QVBA 5CJ5A 1KWGA 2FPTA 3AO0A 4ML9A 4B5TA 3LBOA 5C9UA 3GIQA 4K6AA 2NXIA 1PTGA 4WXZA 4DQWA 3WQ5A 4K3ZA 4XWUA 1H63A 1CXIA 3OLIA 3WELA 3GWQA 1PZ2A 1UZHA 5GNXA 4TVCA 1H1YA 4NILA 4OKDA 1H1ZA 1JIBA 4DJDD 3NZRA 4HK7A 4DJDC 3E0IA 2TMDA 1HKJA 2DEPA 5CC6A 3PTQA 1EFZA 2QULA 5LNWA 2VGGA 3KZSA 3I6RA 2ZDSA 1E4LA 4KQNA 3N2XA 3W53A 3GVGA 4GRSA 2EF9A 4TV6A 4GC4A 4CD8A 2CLPA 3MBDA 3CZLA 3TTEA 4XD3A 1J4EA 3CUIA 4L9YA 2QCNA 4JFTA 4PUUA 4K36A 2HRWA 1K8YA 1CEOA 3AU2A 4KF1A 1DQUA 3DU0A 2AAMA 1ZALA 4UTWC 5AC5A 2POTA 4Q32A 4GJJA 2B31A 4A35A 3WMBA 3SSJA 2XVPA 4JIHA 4NJKA 3GNXA 5D2YA 3L65A 3U8GA 4GBUA 4EXQA 3NG3A 1V3MA 5F1VA 1HJUA 1KBBA 3VD7A 5A8MA 3ZSTA 4FHAA 2BVTA 1HO1A 3D6NA 3N9KA 5B7ZA 1D2KA 4M0XA 4BWLC 5KEZA 9XIMA 2O92A 2FQIA 4ROQA 5H1WA 2E5DA 2Q09A 1SSDA 2XJ7A 4UFJA 3URQA 2WBKA 1R9XA 3RX4A 2VR5A 2FDMA 2JIWA 2WAGA 4WVXA 3PPHA 4DWSC 5DBUA 1KQZA 3ARRA 3AS3A 1BEUA 1XSKA 3KCLA 3BLLA 3GAKA 5CPMA 1F8MA 4ERIA 1RLDA 1AH3A 4DXVA 3D5HA 2W3ZA 3QY8A 3BLIA 1AJ2A 4FPSA 1JCYA 4WOZA 1C9WA 1E0WA 3MKVA 3MCOA 4CN6A 2CBIA 3W9ZA 1ICSA 3LTYA 4JTHA 1OT1A 4LUTA 2DT1A 2CEQA 4FMVA 1K4GA 3H54A 2G3NA 4QR6A 2QCDA 4KFPA 2QZRA 1MQPA 1NDVA 3OZMA 4PULA 2FYMA 1QOXA 2GJXA 3ZLHA 2PDMA 2ZKMX 3QPZA 3AYVA 1XIMA 3BVJA 3NO1A 3SM0A 1JD7A 2RUSA 1B90A 2Z6JA 1UH3A 1V6VA 5HWMA 3T0DA 2PWFA 3SCVA 4M51A 2CBUA 3QC3A 2XN0A 6XIAA 2GQ9A 5FI8A 1Q6GA 1EOMA 1TWDA 3E2VA 3LTSA 3UCQA 1REQA 2PB1A 3BSHA 3HGSA 3W76A 2VEFA 1MFVA 3W7PA 2O4QA 3KBJA 3VKJA 3QR0A 1W9PA 2DU2A 5BOEA 1J0YA 3IUIA 4GVGA 3SQLA 4CCEA 1VZWA 1F73A 2RDUA 4H9ZA 2D0FA 4B5WA 5DXXA 4DUVA 2ZA1A 2VHLA 1E5NA 1WDRA 1PL9A 4ZQMA 2C1GA 2V68A 4G1NA 3QV6A 1AL8A 3WBAA 1IT0A 3W2LA 2F7FA 1YXCA 3CZJA 1PWMA 4WGXA 1H41A 4XAGA 3CT7A 5FJRA 3APYA 2DUZA 3GFYA 4ZOBA 2B0MA 1E56A 4DAIA 4C6OA 4I7UA 3CUXA 4BJHA 1O12A 1NFBA 2CERA 2POZA 3LRLA 2X40A 6A3HA 2GQ3A 1B1YA 3SSZA 1VBJA 3ATZA 3IVTA 4P7RA 3QGAC 3TONA 5A8PA 3AYRA 3H7UA 1RALA 3HJEA 3FAXA 2FH6A 3UZ5A 4RX0A 3IIVA 4JTFA 1L0PA 1L2QA 2OZ0A 2FTYA 4JFVA 4PTMA 4Y9MA 1HP4A 1A4LA 1G9HA 1JZ4A 1I2OA 4W93A 3BUVA 2QAPA 4KEZA 3NZGA 2R1MA 3CQHA 2GOUA 1L6YA 1U5HA 2YCLA 4K38A 3QV8A 4HHMA 4XG1A 2QJMA 4RDVA 3WF2A 1S5VA 1QO2A 2Y24A 4NZCA 3EX3A 3GXDA 4AC1X 3W7RA 3OGSA 1TREA 3FS2A 3B8WA 4A8IA 3CYJA 3M0MA 4O53A 1YXYA 4UTFA 1L8NA 1I2NA 2E6AA 3VIMA 4CLMA 4W84A 3OIXA 5CSRA 1T8QA 1JF6A 1M6JA 1X97A 1GZ1A 3SADA 2CLIA 3GDKA 1OVDA 4PZVA 5FL1A 1GQIA 3T78A 3F1QA 1UUQA 1J18A 1T0OA 5A6TC 4FALA 4JYEA 4JX5A 4E0CA 5K4XA 3UU0A 2VL4A 4ICMA 4Z42C 3GG8A 1KFKA 2V2CA 4M6PA 1ZJIA 1WKYA 1W1B1 2B7QA 1XXXA 2ODOA 1BG4A 1FFRA 1BAGA 3IIZA 1FWNA 4C7GA 2J88A 5I3KA 1OADA 3PHAA 5DMMA 3U48A 5HQLA 3TK7A 7ODCA 2H8ZA 4GYJA 2WYSA 2XGBA 3TUUA 3CZEA 5F4XA 1A5AA 1HIZA 3P8JA 4KRZA 2JIEA 4WJEA 1PAMA 2PWHA 1MEHA 1W1PA 1QO5A 4MPKA 4GKTA 1SZNA 3WUEA 3LMYA 4CQ8A 5BXPA 1XIGA 4C6QA 4AHPA 4ZOCA 3CWHA 4A6GA 1QHZA 3QW3A 1UMYA 5JIPA 4E4UA 2YDRA 4XSMA 3W02A 1V3HA 3W24A 3GXIA 2XVLA 3O9NA 4PR4A 4ZEPA 3EWYA 4PMUA 3LCGA 3MQTA 2PDYA 4LOCA 5D30A 2Z1VA 4HU3A 2AGTA 2REQA 1BVNP 4O1BA 4C7DA 5EA9A 1MW1A 1OCQA 1YRRA 3OHMB 1AA1B 2ZVIA 1GEQA 2NVDA 4AD5A 3TLQA 1FDZA 5FEWA 1JEZA 2VCAA 4JL1A 4ZL1A 2G3MA 8CGTA 5H91A 1PB0A 2WVUA 3ZXWA 3TTYA 5CSYA 3MV11 4BR1A 3NDZA 3OODA 4J3XA 5C9XA 4GNKB 2WKGA 1KFJA 2NQLA 3ARWA 2J8GA 1SZFA 3BCJA 2DUAA 2DJXA 1CWYA 5BW6A 2QCMA 3HU7A 4MUPA 4AWEA 2CHOA 2DSZA 3AS1A 1NELA 4W7UA 3U2CA 2WVVB 2AQOA 4HT3A 3N9SA 3P82A 3PPFA 1XD0A 2XIIA 4O1FA 4R9XA 4US6A 2OQHA 4N9DA 2XG9A 2I16A 4RXFA 1KD0A 1J0HA 2NW0A 3WEZA 1K9EA 2ZUNA 4YTSA 3NXLA 1A50A 3FYOA 1PWLA 1OFEA 1U1JA 3VNLA 5G2WA 3STEA 4GI9A 2WQPA 1XBYA 4TMCA 3KP0A 3T6CA 1D7KA 1Q4WA 1FQ0A 4US5D 4B5UA 1ODUA 3LZ3A 3TMLA 3IK4A 4M24A 4WQ6A 2Z4GA 3TC3A 2WMKA 1U5JA 1B5TA 3JZUA 4Y9AA 5G1YA 3UZYA 3ZMRA 4AZCB 5K3VA 1JUBA 4A3HA 1Z69A 1QNRA 3TFCA 3NQDA 3LS9A 1UP0A 1DJIA 3DHDA 3W7EA 1HF6A 4ADUA 1B9ZA 3B8IA 3RCMA 4LJ3A 4TU1A 4W5ZA 3E0LA 5BRPA 5LIWX 5HNNA 5CG7A 2V30A 1KCKA 1GW9A 2QHAA 1RQEA 4RPQA 4Q7BA 3LPFA 3HOJA 4M82A 1VRXA 1L8PA 4ZQRA 3SCRA 1Z42A 3L4WA 1F6PA 2G0WA 4PMYA 4AUBA 2ZZ1A 2Q02A 1WOBA 2Q8ZA 3VNDA 2RFGA 2O9TA 3OQ8A 5LIUX 3Q45A 4CNUA 1E73M 1GVSA 4ZZ9A 1F74A 4V33A 3W82A 4AZ5A 4C1NB 2D3LA 1SR9A 1TPUA 4R27A 4WXYA 4RL3A 1P0DA 1RLCL 1DHPA 2C1HA 4BQ3A 2OLSA 1B31A 8RUCA 1GVEA 2XYLA 3ABRA 4H9UA 3P80A 4Y7EA 4Q8UA 1EJVC 3LNMA 4LW7A 4OWGA 3G77A 1PS9A 4KRTA 7PTDA 1EJWC 3LHTA 1EHNA 3B0PA 5CZ0A 1KXTA 2WCSA 3AXMA 1HTIA 1JAEA 3TR2A 2BXZA 2IQDA 2IKGA 3TW6A 1TB3A 1V08A 1NDZA 4JHZA 1KCXA 4RUBA 4CD7A 4HZMA 2UY2A 3II1A 1ONRA 1VPYA 1BKSA 2ON3A 2QPSA 4JCLA 3NXFA 3W25A 4JY8A 4IGNA 4L4LA 1S46A 4G7FA 5AB3A 4IL2A 5CAKA 1E70M 4L9ZA 4DO5A 3M64A 3MT1A 2UV8G 5HPCA 4UMBA 1E6RA 1OK6A 5CZSA 3EB2A 3W29A 1ZLPA 4J5NA 4I90A 3FYYA 5CLWA 3BLKA 1TUFA 4YTTA 5FF2A 4LUYA 4LEQA 3BV7A 2WB5A 1X38A 3Q65A 3ARUA 3RR1A 1Q2SA 1DWGM 1BG9A 2VT0A 2VKZG 1WZKA 5FJTA 4D2JA 3NYDA 3KRBA 2YW4A 5LA1A 5EPDA 2OSYA 2PTXA 3W22A 1ONEA 2B4GA 4Y6GA 1EA9C 4N9CA 4QG9A 3GFZA 3ZWTA 5DELA 3IPWA 1F4AA 2HZGA 4W7WA 1X6UA 3OA3A 4IOTA 2PDCA 4XZ9A 2Y2WA 3BO9A 1ISWA 3LQLA 1JCNA 3CQKA 3LA4A 5ECVA 4AY1A 4O12A 1JDCA 2PD5A 3KL5A 4R88A 1V6WA 4WKHA 2ONEA 4PTDA 2HVNA 3GDMA 1G01A 2YBVA 5JIWA 5E0KA 1FWGC 2DSVA 2AQWA 3KBSA 2BVWA 3P5ZA 1NEYA 1A5OC 4XZIA 1DJHA 3ZIZA 3M07A 1KFCA 1FKXA 2WC3A 5AKQA 3ICJA 3O6DA 3R6IA 2OB3A 1XLBA 4IIGA 3LI0A 3OHIA 4IIDA 2ALDA 4H2HA 5LA2A 4M56A 5T91A 3ZFHA 2VELA 4GO9A 4I3GA 4PFMA 4LB3A 1Q6QA 1VRDA 1C7SA 4CVUA 3B8DA 1Z7AA 1QPRA 5A6JA 3A6OA 2FZ9A 5C0QA 3O8AA 3DG7A 4R85A 1KFWA 3OLGA 4RJEA 1A3HA 3AROA 5GVJA 4ADSA 2GUBA 4YN5A 5CPQA 3KBWA 4C60A 5K7JA 1XISA 4F79A 1VIZA 3AIQA 2E4TA 3TFXA 3AIUA 1NSJA 3O6CA 1ISZA 4GJ1A 3N3TA 2NSOA 4AHOA 3SO7A 3PANA 4JIEA 1BRLA 4JTQA 3ZVIA 1U1HA 4LVDA 3W1TA 2TRSA 1PTDA 4MOZA 1OK4A 1HJXA 2XH7A 3H6OA 4MB1A 3TC7A 4F48A 3R8HA 2VVSA 2PDJA 4I7VA 4FXFA 1TKKA 3MCMA 3M6DA 1FCUA 3KAOA 3MPGA 4D6DA 2Z1KA 4UOJA 1X6LA 3GXPA 1K4HA 3OGVA 3ABZA 2BVYA 5I3DA 3LHUA 5FEZA 1Y7VA 2YFOA 5LIKX 3MS8A 5AC7A 1PX3A 1B57A 4GIRA 1Z41A 4L1WA 1GGOA 2JKAA 1R9ZA 2QJNA 3W74A 3QJAA 4NZ4A 4V28A 4CD5A 3O15A 4MNLA 4WLCA 3U6WA 4KWWA 3VZXA 1JULA 1MXDA 3THQA 4Q6JA 5I09A 1TPH1 4GQBA 1Q4NX 4DO4A 5HJYA 3NSXA 5IRPA 4AB4A 4UTTC 2CBJA 5A3HA 3W7OA 7XIMA 3EWBX 1OD0A 3WQ4A 3GDBA 4IQLA 1UKPA 2NV2A 4AWTA 5K4ZA 2CIPA 4MNMA 3A9IA 2O7QA 4IUGA 3RJXA 3A21A 3UWEA 4RE0A 7REQB 4ZO9A 3RM4A 1VFOA 5D8ZA 3PAOA 2BFGA 3NQ8A 4ECLA 4F0MA 3LZ5A 3TTQA 2X8RA 4WRHA 2VX5A 3OVPA 4CKQA 2UY3A 4GUIA 2YX0A 3GDTA 3N13A 3VFCA 3BLOA 4GZEA 3VKDA 2PTYA 3NTYA 1XIIA 2EQDA 4XO7A 5CZJA 3HV8A 3QYSA 1W3JA 2A21A 5CC5A 1ZB5A 3ENLA 4A8NA 4YTRA 1JZ3A 5BU6A 2Z2BA 3OG2A 4PBEA 3UG5A 4G1KA 3H4XA 3VNZA 3PUGA 1FDYA 4KBXA 3WDJA 2EBNA 1WCGA 3AU6A 3UCDA 4ZXLA 3TYDA 1WPCA 4X0VA 1GVQA 4BI5A 3HN3A 1FHUA 4AU0A 1I2PA 4KCVA 1GW1A 4AIBA 3ZVHA 2VEGA 1TTPA 4IQJA 1A5KC 2VYOA 1VFUA 3EOSA 3PBGA 1FWSA 3R13A 3VZZA 1MW3A 5HMEA 3KCJA 4BI7A 2OQYA 4YHGA 5LGZA 2BXVA 1IGWA 3MVTA 3CJPA 4WDUA 2Z2AA 3W00A 1R9YA 3UPWA 3IARA 3QPEA 3DFYA 3L4UA 1GPFA 3I7RA 4MJ2A 3WH9A 3PS7A 3ITVA 1ZSXA 1F07A 4DZHA 3M5ZA 3M7WA 1E4NA 2P76A 3HBLA 3T2PA 2HEJA 1GJUA 3GS6A 2PURA 2YKKA 1IR1A 1H3GA 3ABOA 1BGGA 4O50A 4UFHA 5CPTA 1J96A 4GY0A 4F0KA 4TVUA 3WO8A 1NQKA 4QSHA 1FWCC 2ZCGA 3UBPC 1DL3A 1X7FA 4IL0A 4ZENA 4AHQA 3VM5A 4TUFA 1GQLA 1QK0A 1JGIA 3N2TA 3LOTA 3PJUA 4J2PA 4H2CA 2V81A 2HCVA 1GJPA 1EGZA 1T7LA 1DWFM 3EOUA 3RM9A 3MB9A 1EEXA 4JTUA 1US0A 1XSIA 3EYPA 1OT2A 3V0SA 4GC3A 2PLMA 3QHOA 1FWRA 1UR2A 5K9XA 2HE5A 1XFBA 2Z7KA 4RPPA 2EJAA 3PJWA 1LUCA 4QFUA 3EMQA 3UZWA 5BRBA 3S1XA 1HL9A 1OF6A 2WOQA 1K9TA 3T40A 5A6BA 3R89A 1KQYA 4UFMA 4IFRA 1KM0A 4PMZA 2E6DA 3AHZA 4CD6A 4CEXC 4U4MA 4Z2KA 1W8GA 4C6MA 4DXKA 4JQ1A 4FR6A 4DZ5A 3WFZA 2PC4A 2QPXA 4EVZA 2NLYA 1R87A 4W88A 3BJSA 4MY8A 1HGYA 1RZMA 3L2LA 1WB0A 2EPNA 1OD8A 4KMQA 2OODA 3GC2A 4GQ0A 3LHZA 2E8YA 3ARTA 2PWUA 4AVOA 4LB4A 4IXHA 4LGXA 5A6LA 3PM6A 4OOZA 5GJMA 3WK0A 2E1DA 1W9XA 3BOXA 3V1HA 3KTSA 3B0VC 3C2VA 1GPWA 3MO7A 5ABHA 3C0JA 2Y70A 4PH6A 4DUXA 1M01A 5HANA 1TVPA 4OVXA 2FMNA 3O7UA 2FTPA 1BKHA 3ANUA 4X22A 3AMDA 2HE8A 4HA4A 3LBMA 4PN2A 1Z9AA 2A0NA 4WSKA 4PL1A 3YPIA 5CBBA 1GEHA 3WLKX 3BW3A 1LJYA 2D2GA<