2QNEA

Crystal structure of putative methyltransferase (zp_00558420.1) from desulfitobacterium hafniense y51 at 2.30 a resolution
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
476
structure length
476
Chain Sequence
GLLPKYNILTEDQVQKIHENTMKILEEIGIEFEYEPALEVFRREGQKVEGKRVYLTREFVESKLKSAPAEFTLHARNPENNVVIGGDNIVFMPGYGAPFIYELDGSRRKTTLQDYENFAKLAGASKNMHLSGGTMAEPQDIPDGVRHLQMLYSSIKNSDKCFMGSAEGKERAEDSVEIAAILFGGKDVIKEKPVLVSLINSLTPLKYDERMLGALMAYAEAGQAVIIASLVMAGSTGPASLAGTLSLQNAEVLAGISLAQSINPGTPVIYGSTSALSDMRSGSLSIGSPECALFISASAQLARFYGVPSRSGGGLNDSKTVDAQAGYESMMTLMAANLTGVNFVLHTAGILQYFMAMSYEKFIMDDEIAGMLLHYMKGYTFDEDGMAFDVIEKVGPGGHFLTQKHTRKNHKREFYTPTLSDRSAYDTWAKEKLETKQRAHARWQQILANYVPPALDPEIDAKLQAFIAQRGKEVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of putative methyltransferase (ZP_00558420.1) from Desulfitobacterium hafniense Y51 at 2.30 A resolution
rcsb
source organism Desulfitobacterium hafniense
molecule tags Transferase
total genus 167
structure length 476
sequence length 476
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.480 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 2qneA01
4YYCA 2QNEA
chains in the Genus database with same CATH superfamily
2BB0A 2F2KA 3CWOX 4ZQNA 2PPGA 3MPGA 3QEZA 4NJKA 1W3NA 4C1LA 1PYMA 4LV4A 3IGHX 1W32A 1LWHA 5CC7A 3T09A 1XLHA 4TMBA 4BQ4A 4GUJA 3D5HA 4O4WA 2HNEA 2Z1SA 1GOIA 3STPA 1IGSA 2CBIA 3MUZ1 5CAKA 4PR4A 5A8QA 3M5XA 4TIMA 3ONBA 2GVEA 2ZA3A 5J8LA 3HMJG 5HJLA 3KZSA 1UD3A 4REQA 2YL5A 4J2MA 3H53A 1DWFM 3SSJA 4GBDA 3ARZA 4GLEA 1JG9A 1GK8A 3N17A 2CHNA 4ZQRA 3NNTA 3ABOA 2ZVIA 1ZCCA 3PNUA 7CGTA 1A0DA 1XFBA 2OEMA 4O1EA 1RLCL 1A47A 4YU1A 4HNOA 2VURA 3VFLA 1V6TA 3EX2A 4PH6A 5AVHA 1EX1A 2WKJA 4BI7A 4TR9A 3HG2A 2WK2A 1KC7A 4DNMA 1BXBA 4ZQOA 3V16A 2BXYA 2EF9A 4Z42C 4LVDA 1LUCA 4U2YA 3M0JA 4E6MA 3PK7A 2R14A 4R9OA 2X0SA 1L6WA 4YYCA 3H2MA 4H83A 1W56A 5I3HA 2E4TA 4M8UA 2GDUA 1N8IA 3BAKA 4GZIA 7A3HA 3UG8A 1ITQA 2GFTA 2H9AA 1HX0A 3SI9A 3G77A 4UIOA 3ZWSA 2BS9A 2H90A 4XD3A 5FF2A 2VZTA 4IT1A 4Y8FA 3EWDA 1PYFA 1FWWA 2PDPA 3NUKA 1AFSA 3AZRA 1GHSA 7PTDA 4GA8A 1D7KA 3LPPA 3TJLA 1M65A 1WA3A 3EMCA 1VEMA 4YTSA 1DJWA 1EF2A 4EF8A 2QCDB 2QNEA 4CCZA 3CQKA 2FMOA 4ZB5A 4IIFA 4XAFA 1AQ0A 1DOSA 2IS7A 1QW9A 4GCAA 3EX3A 4E3VA 1A5KC 1EEXA 4PGLA 1L6GA 2GWNA 2BXVA 3IIVA 1VQTA 5HQLA 1W31A 1HKVA 7REQB 3L5MA 3QPYA 3A3HA 3L4VA 1Q13A 1SJCA 2NUWA 4XAPA 2IUZA 1RQEA 1AJ0A 4FNSA 2OKOA 1UR2A 3H7VA 1PDYA 2DSKA 3E2VA 3NVTA 3H23A 2QHAA 3N6JA 5MKGA 4IFKA 2GK1B 4NILA 3N18A 3S47A 1IF2A 4FLRA 5J5RA 2RKXA 1H4PA 1S1RA 1VCGA 3LBMA 2BGNE 3LY0A 1OFQA 2E40A 3M43A 4LT9A 1H7WA 4X2RA 4EAYA 4ZTYA 1PKYA 2C1HA 1XYCA 3IEBA 4CU7A 3KBVA 1LWIA 1LROA 3EWWA 1JXKA 2OX4A 1FBAA 3T6CA 1TTPA 2BVWA 2HE5A 4C6LA 1DIKA 2GWGA 1XLCA 1CGTA 3SN0A 2I5QA 3C2YA 2LLEA 5M17A 2YL9A 3OGVA 1R3TA 4C5YA 3M4HA 3R6IA 2GJLA 1L0PA 3DN5A 1PDZA 1CIUA 1LORA 3L4XA 4A3YA 3LCIA 3WH5A 1BG4A 5CH9A 4KWWA 1CBGA 1SFJA 1VR6A 1TPH1 4JYDA 4PUUA 4UTMA 3RRXA 4PA8A 3IRSA 4C6QA 2YPIA 5CLTA 5AHFA 3WQGA 1RPKA 3OBEA 4RW5A 3DG3A 2BOEX 1FHLA 4GQGA 1OM0A 3NCOA 3SJNA 3QTPA 2I17A 3UZZA 5C9RA 3AIVA 5HR6A 2UWFA 5CBBA 4H00A 4MWAA 4LUSB 3V4BA 3B9OA 2ZUMA 3KRSA 2FH6A 1KW1A 2PWVA 3BO9A 1YTKA 1O68A 3AZTA 3XISA 1B3ZA 4UFHA 3GNXA 4Q8MA 1JZ4A 1TV3A 3LQLA 3AYTA 3SY5A 1MUMA 3V5CA 2G95A 4Q8VA 3EDDA 5HA7A 3O07A 4O17A 3BARA 2YA0A 4YCPA 2XN0A 4H9XA 3DERA 2XZ7A 2GUBA 2EJ1A 5AOUA 2PCEA 1YADA 3QFWA 4MFEA 1FWTA 1PKLA 3SQSA 1WDWA 2NSXA 2FTYA 1QNSA 3FA3A 4UTTC 4B5WA 3GC4A 4CUCA 4ZXOA 4AY7A 2DZUA 4HSNA 3AWNA 2GOKA 3DKLA 3LLFA 4PMUA 3M0ZA 4M19A 2J47A 1A49A 2W27A 2KZHA 3LV6A 3BV4A 4W8BA 1ZHAA 3WJWA 3PFRA 3O16A 3IK2A 5LKYA 1S39A 1PTDA 4MGGA 3W3OA 4GC3A 3VM5A 2Q3OA 4HSOA 4U28A 1GPFA 3F5KA 3VDGA 5D05A 1UZDA 4RZ4A 1EQCA 4BJHA 4V15A 3EB2A 1Q66A 3TFCA 3PWIA 4Y96A 3AS2A 2DIKA 1W1B1 3VUPA 4UXDA 4LCSA 1KBIA 3GQYA 3OQ8A 5HDRA 2X1IA 4Q8UA 3QV8A 1Q6FA 5A6AA 2C15A 3GC5A 4P8XA 4Q7NA 3DFOA 5LGZA 2Z4GA 1GONA 2PAJA 4AZHA 4JOMA 3LCFA 1XPYA 5A1AA 1KRAC 3D6NA 4MY1A 3HO8A 1TQJA 2FH8A 3M0MA 2FZBA 3S1WA 4JY9A 4R3UA 3W38A 4MUPA 3KX6A 3VXGA 1WO2A 4LX4A 4KEVA 3LRLA 5K4ZA 5CPMA 3I10A 1TZ7A 5K9XA 3BAXA 3LD5A 4J3VA 2Y0FA 1XGZA 3STCA 5AC5A 2AL1A 1VLWA 3OLIA 4IX0A 4AZCA 2XISA 3TEVA 1TTQA 3TN4A 3RU6A 1Q63A 1IWAA 4FO4A 1CLVA 1MDRA 2X1UA 1EOKA 2Q01A 5JBDA 1WDRA 2Y7EA 3IGXA 4JKMA 3C0LA 2PDMA 4POCA 1EJRC 3EX1A 4R33A 2X40A 4KKXA 5AYXA 3IJ8A 1C8YA 1XX1A 3L68A 4JICA 3P62A 2W67A 4TUFA 4URIA 1JPHA 1KGUA 1WE5A 3BLIA 3DENA 1XICA 4GX9A 3M44A 1XINA 3W7PA 3ZR5A 4JPGA 5BMWA 3DZ1A 1JI1A 3GS6A 5J5DA 4A35A 4DXXA 1HKWA 4GY7A 1ICSA 5DCEA 1N7KA 4J5NA 1KQYA 1KR1A 2P8CA 1I4NA 3FA4A 4NVTA 2FMNA 2PTYA 1CXIA 2W79A 5G2WA 1ONWA 4H9VA 4GQBA 1NDVA 5C2XA 5A2AA 1A3XA 2NQJA 4L4MA 2QW5A 4MWAD 3SJ3A 2C3ZA 4WD0A 1OINA 3TYZA 3DXIA 1TG7A 1JXJA 5G2HA 2VVSA 2DW6A 3GXMA 3DCPA 1KTNA 1E6RA 1H7RA 1YTEA 3R2GA 3FYPA 3GE7A 4US5A 3TVAA 3QLLA 1JCNA 2E5CA 5DT5A 2BWGA 2IQTA 2V2DA 5D2YA 2RJGA 5KTLA 3W2UA 5FF0A 2XN1A 3GHUA 3FX4A 1HJVA 3BMXA 2NVCA 4LUTA 4Q4MA 4S3EA 1FWCC 4WK9A 5I2UA 1SW3A 1E5JA 2GUUA 2QUNA 3PAJA 3UXAA 5I06A 3GX9A 4JY8A 1DJHA 3LMZA 4D6IA 4MVAA 1O95A 4HMEA 1EOMA 3FEQA 3FOKA 3WYZA 4X3ZA 5T91A 3IJ7A 2J88A 3W2JA 3VIKA 1THFD 3ZO9A 2F6UA 3SQMA 1HKKA 1XRVA 4XVEA 1M41A 4IWWA 3NZQA 5CSSA 1FP8A 3BMWA 5HUOA 5K4XA 3ZLFA 1S3TC 1S2WA 4EXBA 5EA9A 4W84A 4IGNA 4GXWA 2Z24A 3ZS4A 4O1FA 3FEMA 5LNVA 4WIWA 3DHUA 2WANA 4DM2A 1OK4A 3SO7A 1SW0A 2RGLA 4Z1BA 1UC5A 4J3UA 2GJRA 3S2NA 3I6RA 2XIBA 2QZRA 3CASA 5E0KA 2PTWA 4Q8PA 1XF0A 2DV0A 3LK6A 1SZFA 1SSGA 3AIBA 1TPC1 1O5RA 2QJIA 4JX6A 4PUJA 4QISA 4ZO8A 3HIJA 3WNKA 2ZTKA 1BGAA 1LTDA 4NNAA 4JNYA 1SM9A 2ADAA 3KOXA 1XLKA 4HT3A 1JUKA 1WYIA 3ARTA 3CHDA 3WNMA 4O0KA 4KCUA 4QQ3A 5CBIA 3OHMB 3TZFA 1A0EA 3M0LA 4UTLA 3VYLA 3GW3A 3T81A 4DYJA 4MJ4A 1C8VA 2YBTA 3RR4A 1RQHA 1S5TA 4MAVA 2ZYFA 4TX8A 1WZMA 1NOWA 1AJZA 1Y0EA 4V33A 3P0WA 1NVMA 3W23A 1DJQA 3CPUA 1M01A 4ZXLA 3KCLA 4JHZA 1EEPA 1GVRA 2CLPA 1JDCA 2W5FA 1YXYA 1J93A 3H2NA 1ZBKA 1Q6LA 1ZS2A 3SCOA 5TIMA 2XM2A 1Z6KA 3H4XA 1K8YA 2HE8A 5FJOA 1C8QA 3ZJ8A 1P48A 3KHJA 3SFKA 1V5XA 4LQ1A 3UWYA 1PZ1A 3CPRA 5D37A 4CQAA 3B8TA 3SCPA 4HN8A 3NPVA 3G24A 3QH2A 1QK0A 3S6OA 2ZZ6A 4I8YA 3M0HA 4NAEA 1X8FA 1OGBA 3LCHA 2OX1A 5KINA 1A53A 3URAA 4KRZA 3GBEA 2HPMA 3U8GA 1QW7A 5AHIA 3W07A 2WHKA 9RUBA 1GZGA 3N3MA 4R53A 3CT7A 1OC7A 4MHBA 4LJ3A 1XLAA 5TF0A 4GOAA 5A3HA 5REQB 2WNWA 5ENLA 2P0OA 1Y65A 1LQAA 3LQGA 2C71A 3W2MA 3MMDA 1BWKA 4UTTA 1DJGA 3AU6A 1NJJA 4LBUA 2VNCA 5AHLA 3E0IA 4EE9A 1O5QA 1M7JA 1OC6A 4US5D 3F4VA 4FNUA 4ENLA 3FXGA 2X7WA 1BEUA 1DWAM 2RDWA 1FKXA 1W8SA 4GYJA 4X60A 2NUYA 4PL1A 2YXXA 2WZEA 4DZIA 1XIMA 4I5XA 3NZPA 1H61A 4Y6GA 2G4JA 2XN2A 1UUMA 3M5YA 1V6UA 3GYEA 4HHMA 5FAGA 5A8OA 1IXNA 1W37A 5T26A 4M6VA 1GJWA 3ZR4A 1TZZA 4G2DA 3H70A 2ZXAA 3U2ZA 2DDXA 3U7BA 2P53A 3GZAA 5U7SA 3A12A 1I1WA 1IE7C 3BLKA 4LOCA 3VGFA 2X41A 1NOUA 5CSUA 1ZQ5A 3PBGA 3JR2A 4REQB 3PC0A 4O10A 5BROA 2I5IA 2J8FA 3OB8A 1LT7A 3VX1A 2NQHA 3VIFA 4RNIA 3GNRA 3GXDA 2A21A 2G4FA 3IUHA 3M41A 5DCBA 4ONVA 5DQPA 2FQIA 2HDJA 3N12A 2F7FA 4DF2A 3PULA 3AUOA 4D8LA 5CPNA 2CLLA 3O8AA 3GYCA 4YWIA 3G2GA 4LU0A 3RJYA 4G7FA 5JMUA 4K1GA 1LUCB 4LUYA 5A8PA 3OYXA 2PMQA 4Q32A 1TMQA 2AQOA 3MI6A 4HPGA 4CCEA 1DORA 1IR1A 1ZAIA 3ZLGA 2OSYA 4BR1A 4F0RA 3VE9A 1H7PA 2EPOA 3LS9A 2H9AB 4OQVA 2W91A 5LNUA 3BSMA 2XSAA 2AQVA 3A4AA 2ZDRA 4ZR8A 3UZ5A 4LTSA 4UC5A 1E70M 1AH4A 2P76A 1QUMA 5HINA 1EIXA 5HR7A 5LA1A 1DJYA 5A8MA 3L5LA 3C8NA 1OYCA 4BZYA 4K3ZA 4O1CA 3NQGA 3GSMA 4PC8A 4GY1A 5EPDA 2E1WA 3GFZA 3QPZA 4Y90A 1P1MA 3EWXA 2I9UA 3N2MA 3CM4A 3K8MA 1EF3A 2PDFA 4GGBA 1OJXA 4DO7A 4F66A 2A7RA 3ID7A 3S6TA 1NSJA 3EA3A 1K9TA 5I24A 3IVUA 3HPXA 2PFHA 3AHTA 3LNMA 3ZT7A 1VBUA 3QQWA 3NXLA 2UBPC 4AW7A 5MKGB 3NPXA 2QJMA 4RXFA 4IFKB 2DSVA 3RF9A 4R7OA 4FP1A 1JZ2A 3KP0A 1U1HA 3LCXA 4ZOAA 3W2KA 4JTUA 3WENA 1V02E 3TWBA 4IMEA 1U5HA 3N2CA 3MCMA 1Q3NA 1EJSC 4MB5A 3S1UA 5BOFA 3BAWA 4RZ6A 4A3UA 2PRMA 1C7TA 3NSXA 2OOGA 1WDSA 4UFJA 4O0ZA 2H3BA 3GKAA 2HK0A 3KW3A 1P43A 3BLOA 1RCQA 1LG2A 3SIMA 4HQVA 1PIFA 3KFTA 2ACQA 3GK0A 3DFQA 3KL5A 1HKIA 2ZQ0A 3SN1A 3EKLA 4LB3A 4HU8A 4JFWA 4QJ3B 4PULA 2FPTA 5DT7A 1P4CA 2XVNA 3IIXA 1C8XA 4GI4A 1J96A 1X6NA 2DT0A 2WNQA 2WZIA 3W7IA 2CNCA 1XIFA 4OTKA 3CIVA 4UQAA 3GXTA 3VNKA 4J2PA 4WDWA 4HYRA 2PODA 5BZAA 1U5VA 3W29A 1V77A 1EWEA 3W7JA 3V0UA 1MEIA 3TA9A 3EDEA 3TDFA 5C7VA 4C90A 4RNJA 3W85A 3UESA 3VKKA 2ZZ1A 4G9PA 4MWAB 2F9RA 3F4WA 1H41A 4YTQA 4OV9A 2PDGA 1VEPA 3OVQA 3APGA 2QGHA 4OFCA 5D9NA 3T78A 2G5WA 1T0OA 4KCVA 4QAIA 2OWWA 4LWWA 1W3LA 3ITCA 2Z29A 3FAXA 4L5ZA 8A3HA 3VC5A 4H8HA 4AC1X 3NURA 2C7FA 2JKAA 1P0NA 3Q2DA 4K39A 3O63A 3VILA 4HNLA 5G4HC 2Y62A 3SB0A 3JZUA 2FHBA 1RUSA 4DJDC 4FF5A 5D2WA 2W9MA 4HTYA 3CV1A 4B5XA 3DFTA 2VX6A 2FGZA 1FCVA 1HFBA 5BWAA 1SPQA 2BHYA 1BYCA 1Y5WA 4M1BA 2Y61A 4AVFA 1CYGA 1GVSA 1G67A 3TV8A 2PGRA 3G1DA 1JIBA 3W7KA 2VMFA 2DVXA 2DORA 5E93A 3WD4A 1QASA 1JYNA 1J0HA 3W7LA 4KESA 3E2RA 5HMDA 4KGJA 4QX4A 1XYAA 3C2OA 2IMRA 4DWDA 4JQ4A 3VIIA 3WK1A 1DV7A 2PDXA 3ARVA 3R8GA 3HOJA 4HTBA 4OIFA 4ZOCA 3OLGA 3BE7A 2INFA 4GBUA 1FHDA 4FB7A 4D1JA 1SO4A 3TTSA 1YDNA 4YIWA 3VDCA 2Z7GA 1F3TA 4ZODA 2V9DA 1SGJA 4JTIA 4QEHA 2B0MA 3G5EA 1WOBA 2ISWA 3WX7A 3W01A 2V2HA 4M0XA 1HF6A 4UR7A 1IXOA 1NQ6A 1EXBA 3S1XA 1E3XA 3W1AA 3UA4A 4JYEA 5JQ9A 1QHZA 2GJNA 2WMJA 3E9AA 3WF0A 4H6EA 4YS1A 2ZRUA 1BTMA 3WL0A 4DI9A 1KFWA 5GPRA 1LLWA 2ISVA 1RBAA 3M0KA 3BLFA 3KS5A 4AD0A 1I2RA 2PUZA 4M7SA 4MPQA 3F4CA 5AHNA 3DKJA 4L61A 1GG0A 1UZHA 3CEUA 3OBKA 2WM0A 1E6PA 4N4QA 1PKNA 5DFAA 1IEVA 4C6PA 1OGGA 4OOUA 3RU8X 1PVNA 4MZ8A 1ISZA 4OBRA 5FJIA 4AZCB 1QO2A 3IVSA 3ARWA 1K8ZA 5EB8A 3F5LA 2DVUA 1VHCA 3QR1A 3W2NA 3MUY1 4IJCA 2GJXA 2PWFA 1VJIA 1Z32X 2P5NA 3CUIA 4MYXA 4H6QA 3KLKA 3NQVA 3Q45A 1UWRA 3GBDA 1R87A 5JIWA 3QM3A 3GHRA 4LC6A 2UZ9A 1C91A 2CZFA 1IT8A 4RPQA 3VKBA 1S5VA 2V5CA 2XJ7A 3BGAA 1F73A 1LL6A 3QVQA 3PZ9A 2D69A 5AHEA 4AISA 3KRUA 4IIDA 4LNCA 2W0UA 1XQKA 2EPMX 1XC4A 3VUSA 3L7RA 1H1NA 3O6AA 5HWMA 4AU0A 1DQWA 3W82A 4AMCA 4ZA0A 2HROA 4XKMA 2ZX9A 1WP6A 1VFTA 4MM1A 4MKVA 1NF7A 1KGXA 3O7UA 3VIGA 1XM3A 1LQ0A 1RJRA 4RLIA 2NX3A 4XAGA 4QEEA 1XCWA 4FNRA 5A6KA 1R3RA 2RDXA 4Q22A 3Q4DA 4AD3A 3SR7A 4P2VA 5F1VA 1K70A 2QCGA 3TC6A 3E5BA 2ZVRA 1O1ZA 1U33A 1XGEA 1VIZA 3S5SA 1KFLA 5F7UA 1TWIA 3QMRA 3INPA 1K4GA 4ZE4A 1K6AA 2DH2A 3HG5A 1E3ZA 5BCAA 1KFJA 3R10A 5JIPA 3PHAA 4LUTB 2IPFA 3H2OA 3SN4A 3BVJA 2RJHA 4QLJA 1X39A 4H41A 1B3OA 1XIDA 3GTHA 3SUWA 1VFFA 3AS0A 4MOZA 1S2CA 3AYRA 3M5ZA 3AJ7A 4JN8A 2RAGA 2X2GA 3U48A 1HL2A 2O9OA 2ZFAA 4HA0A 4RKAA 5HPCA 1MEWA 3TH6A 4P7LA 1YDYA 4L1XA 4V1XA 8XIAA 1JPKA 4LEFA 2QV4A 1XS2A 4L4OA 3GDLA 4L9XA 4M6UA 3R0UA 1BHGA 1TFVA 1Q8AA 3VU2A 4IFRA 1FH8A 1KM1A 1FXQA 3WLKX 5I07A 4AXNA 1GQNA 1WQ5A 1OADA 3A4JA 4QSFA 3C0QA 1EZ2A 3W22A 3L67A 1V51A 4A21A 3MSRA 4JTRA 3TP4A 3CBWA 1E71M 2Y7FA 4OVXA 1V6YA 4A22A 3LBCA 5LSMA 5H1WA 4QM1A 1U22A 1QNPA 2Z00A 1QTWA 2YLLA 1W9PA 1LOLA 3FS2A 3VOJA 4Q7BA 2PDWA 3EOUA 4RUBA 3V1HA 1K7FA 1Z42A 1H1ZA 3WF4A 1E43A 3IAPA 2QGYA 3QQ1A 3QC3A 2PGWA 2Q8LA 1E6ZA 2XPKA 4DJFA 3WDJA 3AQUA 1QWGA 1UP0A 4MLJA 4UBPC 1RSCA 2PGEA 3U2OA 4AYSA 2C91A 3WIJA 3VZZA 3WLJA 3QN3A 3L12A 5B7ZA 2O0TA 4MJ2A 2QVNA 3NGJA 1J6PA 1GWJA 3LV5A 3MQTA 3W7QA 3VMOA 4Q4PA 2WXDM 1E9ZB 1UBPC 3TE9A 4DYKA 1OHLA 4K7VA 3FHQA 1KV8A 3W37A 3NWRA 3C0SA 3V3WA 3PPFA 1DPMA 1OFPA 4ASTA 1EA9C 4IPJA 1UIOA 2V67A 3U2CA 5CCZA 2ZRVA 5CZKA 4DZ5A 3VKJA 2VR5A 4FOKA 3LHZA 3PF3A 4IGSA 4NAEB 2ASHA 3GG0A 2XU2A 1GNXA 1MUWA 3N6QA 3NM1A 1GTEA 3G1SA 4ES4A 3CB8A 3A47A 3PAOA 1R7OA 4FX8A 4W8AA 1KBBA 2W3ZA 1DXFA 1KCLA 3UWZA 3B4UA 1J4EA 4XZBA 3KDOA 4JTKA 4XD6A 4PB3A 1AH3A 4IOTA 4QE4A 3W1NA 4DJEC 4XZNX 5EMJA 4IMFA 4DUOA 4NXSA 1TJ2A 3F4NA 1R0MA 2UY5A 2VZOA 3DECA 2HBVA 5EMMA 1JYXA 4R34A 3F2BA 1Q4NX 3H8AA 2OVLA 2XIIA 1HJQA 1NU5A 1JF5A 4S23A 3UZJA 3SCWA 4O1DA 5CC6A 1RALA 4XD5A 3GU1A 4IL2A 1S2VA 3GHTA 3WNPA 4BS0A 1W5PA 5A95A 4DM1A 2FYMA 3NQCA 1K1DA 1KM3A 2OZTA 3D3FA 2PE4A 4DWSC 5EMLA 4K2SA 4PUDA 2WMGA 1GQJA 2O55A 5A6JA 2HS6A 2BY3A 4MY9A 2CBJA 3BLDA 4Z0JA 1ZJBA 1C90A 2IPJA 3KXQA 3P5ZA 3MO7A 2XVGA 2CU0A 4AF0A 3KBWA 2NZLA 4GVFA 1F6YA 3OG3A 1SO3A 2HBXA 3UPBA 5H8MA 1F3EA 1DJXA 3G1FA 3GR4A 5G1MA 5FL0A 3OG2A 3CIXA 2DZWA 3IUIA 3Q94A 3R7MA 1J0YA 1CX9A 1P7TA 2R91A 4DB7A 7TIMA 3DC0A 2CWNA 3EX6A 2E6DA 1FWGC 4ORMA 4H9TA 1OVDA 2ZX6A 3TN5A 3B0PA 2GSEA 3S2LA 5HBFA 3R8HA 3W70A 5DMMA 3MJYA 5AYYA 4IL0A 1V3KA 3DU0A 4B3LA 3WDPP 4K6AA 1VYRA 3LRMA 1ISYA 4AEOA 4IGHA 3G8EA 2E77A 3LOTA 3WLIA 2CLKA 2HXTA 1XHGA 3AICA 3FJLA 1XUZA 2J74A 4JFSA 3OIHA 3EKZA 3CUHA 4G56A 4S3FA 5CPQA 3LCGA 4DJFD 5C9ZA 3TR2A 4KBXA 5CZ0A 3UVAA 2A3HA 3NOEA 3H2AA 1TPB1 1SJAA 2O9TA 1B90A 2NUXA 2Y6ZA 4QQUA 3TK7A 1F7BA 2I5GA 5CGQA 3UWUA 2ISSA 4OE7A 2YCLA 2IXUA 1ITXA 5DCDA 1IEIA 4DIAA 3E1F1 1WAWA 2CERA 1E0TA 5HWJA 4O11A 3EMZA 2PP1A 1FWAC 1OT2A 3SCVA 4IP5A 2X7VA 1QI2A 6XIAA 1PS9A 2WMKA 3O6DA 3TTOA 2Z25A 3QGKC 5LIYX 4M5PA 3B9EA 2BASA 3CUFA 4C7DA 2WJFA 1J12A 1UD6A 4PTNA 1VENA 5H6HA 5LIKX 4EP8C 3E6EA 2CLFA 2OJPA 1LJYA 2CC0A 2BBFA 3LXAA 4AMAA 1MEHA 1PAMA 1OX4A 4CQ8A 3HQ1A 2XH7A 1ZU8A 5IFPA 3ZVHA 1KLZA 3U2EA 4DNHA 4H19A 2FLIA 1FHUA 3STGA 4YHEA 4I5UA 1ZZMA 3BH4A 2BHZA 2NW0A 4CD8A 3GDRA 4K7YA 3WQDA 3VGEA 1JZ6A 4UR9A 4AZ5A 3IIPA 1KM5A 3XINA 3GD6A 3AIRA 5KETA 4HU3A 5D2XA 3SIZA 3AHYA 4ML4A 1KKOA 3GY1A 3TSMA 2XIQA 2ICSA 4KEMA 4WZHA 3CPGA 3GXFA 1V02A 3UJ2A 3H22A 4I9TA 2WHLA 1FCQA 2QDGA 2QULA 5IBXA 1O5KA 1XI3A 3CV2A 1QMLA 1DKWA 4GH3A 3H54A 4I7VA 1ZJAA 2GQAA 2DSZA 3IJIA 2PD5A 5F2IA 1CXLA 2WLZA 3IJ6A 1TKKA 3CV7A 3R5EA 3SM0A 4HOZA 1HXJA 1JFXA 2BG5A 3SY1A 1L2UA 3C4UA 4E2OA 2AQWA 1V0MA 3MDUA 1M03A 2TSYA 1NP2A 3B0YA 1C93A 1JPMA 2ZZ5A 4HBKA 4FIQA 4CCDA 4IIHA 1JVNA 3QFEA 3WLSA 3C8FA 4WOZA 3LPGA 1KD0A 2DZAA 2AAAA 1R2RA 4JIHA 2OYMA 3BQ6A 4LY8A 4IHCA 2GVJA 2QT3A 4OBTA 3UZXA 1D3HA 4C6MA 5GNYA 3K4WA 3T2PA 5FSEC 4D8ZA 2ZBTA 1JCMP 2WZTA 3LA4A 4OWGA 1Z3NA 2DUAA 1UH2A 1X38A 3N15A 1UWSA 1QNRA 2GVYA 3TU9A 6REQA 1KCKA 5G1YA 4AFYA 3L4WA 1A50A 3O1NA 3MMUA 1P5BA 3QW3A 1W5MA 4JX5A 4IF2A 1XLLA 4AIEA 1H11A 2VFIA 2WJDA 2Y2WA 3W24A 4B91A 1LG1A 1QOPA 3K30A 4ZZ9A 2IKHA 2JGQA 1ODZA 1TUFA 4EPBC 4CCCA 3TLQA 2C0AA 1G4TA 1EC8A 3WQWA 3VCRA 4UMCA 4IPNB 4CD6A 1HGWA 2DT1A 3PTMA 4M6PA 3M7WA 4GXPA 5M1TA 5CKSA 3RX2A 1J0JA 2OU4A 3G3MA 2R8WA 3R13A 1TPDA 1NARA 1VFLA 5AFDA 3VDAA 4AZIA 4GX8A 2A7NA 2QF8A 3E49A 1TJPA 3E0VA 6ENLA 4NAFA 1UJPA 3CU2A 2DT2A 2X0YA 4DAIA 3N2TA 1V08A 1ZGDA 4NNCA 3VCNA 3HGRA 3EWCA 3RPMA 4CNNA 2PDNA 1JYVA 2HJPA 3A5VA 4I7WA 1R3VA 3QQ0A 2ZC1A 1CW2A 3AFBA 4B3ZA 5CJNA 5FJPA 3R58A 4JCLA 4CU8A 3REQA 1VHNA 2PRHA 1Y5XA 4D72A 3FYOA 3IUDA 3MWCA 4UOJA 1R9XA 7ODCA 4S3BA 1Q85A 2IPGA 3SCTA 2PLKA 3W7OA 1EJUC 4C6FA 2BMBA 1G69A 4L9ZA 3LGEA 4OZOA 3MSDA 4NKCA 4RPPA 2VOTA 2UV8G 3M5VA 3H24A 3WQ8A 3N04A 1EP1A 1CXKA 1XGDA 2YKKA 3KVJA 1YPIA 4V2XA 4JGDA 4JS3A 2JF7A 5I5RA 4XZ9A 1ZAHA 2GJXB 4G7EA 4UNIA 4A2RA 3URQA 3FJ6A 2HK1A 2YDAA 2P88A 2QR6A 2PP3A 4LVBA 4UQCA 5AC4A 1JYWA 2HVNA 3CZEA 2ZUNA 4P7NA 1GOOA 3BZGA 4Z2KA 2DEPA 2J66A 3NOYA 2AOSA 3UQNA 2BY0A 3JRKA 3WLHA 5I09A 3POCA 1A4MA 1R86A 3GUWA 3GWQA 3TTQA 1A5LC 5CAHA 3OPSA 1WUFA 1IEQA 3VNJA 2FTPA 4W9TA 3TMLA 3URNA 3M0YA 3QBUA 5C0QA 5LHEA 1GQKA 2HV5A 5IHRA 1R3QA 4ZQMA 1KA9F 3C2FA 4CLMA 1WKYA 5CG0A 3MUXA 1UWUA 1KWKA 3DI1A 1PZ0A 2ISDA 1RA5A 4DAFA 3DYPA 3QHMA 2X09A 4UTWC 3GUGA 3H2EA 4B5NA 1G9HA 4Q3MA 3TJ4A 1UP3A 3U57A 3ARYA 2J77A 2INEA 2Y4SA 3FN9A 3AXMA 1F6PA 2FGLA 3QKZA 3MU7A 4PB4A 5TBOA 4GQRA 1XLMA 5DRIA 1QCWA 4US6A 1NDZA 2YBVA 3V0TA 4S3KA 4AY1A 2BP1A 1XLEA 3ABQA 2L5HA 2NSOA 1V93A 2OMAA 1FWIC 1WNOA 5C5YA 1OABA 4F40A 1PWLA 2ZA2A 3NDYA 5FF3A 4U5IA 4WY0F 4CNPA 3WCZA 1DJZA 3AO0A 2G96A 3L0NA 1K77A 2WC3A 1JI2A 3NL3A 1W0MA 4TVDA 2HVMA 2IW0A 4S3JA 5LYRA 1B31A 2DIEA 3NQBA 1XH1A 3PWGA 2OYLA 5D8WA 4RK8A 3ITTA 1Q2RA 4I7UA 4YXGA 3TONA 1B9BA 1TWSA 4LC8A 3L0GA 5CJ5A 2VZVA 4AQLA 4LW7A 1W54A 3VNLA 2I57A 5EU9A 5K3VA 2IKIA 3CAVA 3NFUA 2IQ0A 4XBKA 3CZGA 3GVWA 2YCJA 4GYPA 1EBHA 2VGBA 3V35A 3H26A 1PB0A 1NIUA 5FJUA 2OLAA 1RR2A 2AKMA 4ILSA 2VFFA 3ATYA 4ZVJA 2XYLA 1FWHC 1RH9A 2V8ZA 1D8WA 5H2ZA 4O52A 2DIJA 3VOFA 4J3XA 1S3HA 3ME3A 4TV6A 4DXKA 3QJAA 4DO5A 4X2PA 5A6MA 4I90A 1XFCA 4HCLA 4IG2A 1UUOA 4M29A 2R1PA 2YBUA 4OV4A 1DHKA 4S1FA 1T8QA 2OZ3A 1C92A 4GIEA 2OQLA 3LTSA 3V36A 1ZBWA 1P0EA 1TRDA 1O4UA 3P8IA 1RY0A 4RZ5A 3VIPA 3W7CA 3MP3A 4N4PA 3SCUA 3L4UA 1U30A 2I1OA 1TE6A 2ZZ4A 5HWNA 3V18A 1KRBC 1E1EA 3UXDA 3SBFA 2Z28A 5AC7A 3B0UX 5D30A 2MNRA 5D38A 4Q8OA 5EMYA 2HMCA 4HU4A 4YJ5A 3JVAA 1OYBA 1KO0A 1TO3A 3BCDA 4NHVA 1WZKA 3IGUA 2YOCA 4V27A 3B06A 4YPJA 1KCZA 2OGJA 3VD7A 2IXVA 4LBRA 2IKGA 4JKKA 4NZCA 4M6QA 4JFTA 1EGZA 3R8RA 1PWMA 3A9BA 3DFHA 3T42A 4NJHA 1KXTA 4S3CA 3C5QA 3AYVA 1A5UA 4NUWA 1F9CA 1GYLA 3BLEA 3V0SA 3TQVA 4J4KA 2AMXA 3OEXA 4Q4QA 3GKFA 3T4WA 4GIRA 4EANA 4RNFA 3IV3A 3PB2A 1LCOA 2BNJA 2ISFA 4BWLC 2PDUA 2OPJA 1JDDA 3DHPA 2Y5SA 1A5SA 2QVHA 4H8NA 3WH8A 3QV6A 4ZL1A 6PTDA 3AMCA 4O1AA 3HG4A 3THUA 1H49A 1DWIM 3ABZA 4AD4A 4JAWA 2ZDSA 1HJWA 4QCFA 4YN5A 4L1WA 4NT0A 1FRBA 2CHOA 1OGSA 1O94A 1YRRA 1ZAJA 1E55A 1XIHA 3N19B 3S1GA 1JZ7A 3RHGA 3VOGA 2DZVA 1Q6QA 4LVGA 1OD0A 4FXRA 2X05A 3WSUA 2R1MA 3ZT6A 1CT5A 1JR1A 2KAUC 2DUXA 2Y7GA 3AROA 4CVUA 4JNMA 4O12A 1IIGA 1CLXA 2OT1A 2QLYA 3C3UA 3WUBA 2XVPA 4AF0B 4P8VA 3OZPA 1MI3A 4QAWA 3S9YA 2ANUA 1UD8A 5E1QA 1GYNA 4X9SA 1YYAA 3T7VA 2DH3A 1P7TB 3OA5A 5BXPA 2V5JA 1TE1A 4RE3A 3GRIA 1VF8A 2D0HA 1R30A 4IPPA 1BPLB 5CPSA 3I7SA 4X22A 1G7VA 4IQJA 1ZSXA 4OOZA 3V7PA 3MZ2A 1NFGA 1Q5MA 4W7WA 4HZ8A 4H6RA 5E70A 1NFPA 3KTCA 4GVGA 3LB0A 1KBKA 5FEXA 1KXVA 4P7QA 5L9FA 4ATDA 3MV11 1HNYA 4JTDA 3DUGA 3TNBA 2XH0A 1YE4A 1KXQA 2XTKA 3W7NA 2V63A 3WUGA 4MG4A 2X16A 3URBA 1K8XA 4IICA 3MV01 4EPKA 2R94A 3M9YA 3ABRA 1WDDA 1EDTA 1GVOA 2WMFA 3C0JA 2WM1A 1H5VA 1KQZA 3FY1A 2Q3RA 1XIBA 4PCFA 4WGHA 1YNQA 3EEGA 3ZMRA 4Q8TA 2Z2UA 4H7ZA 4M51A 3C56A 4HPHA 3G0SA 2A6LA 3PZUA 2VEPA 1KM4A 2FZMA 2GGIA 2YCLB 3HFTA 3HJEA 3S4TA 2XSXA 4E4FA 2CHRA 3O6CA 3R12A 1M1BA 2H3DA 4ZOBA 5BXRA 5I3FA 3HB9A 4JDBA 4J27A 1J11A 1G1YA 1AD1A 5ABTA 4N7QA 1UKPA 3N3TA 2VVNA 2VD8A 4O53A 3EOLA 1C3FA 2BHUA 4F2BA 1PJ9A 5AZ1A 1JNEA 1OX4B 1ECQA 1MFUA 2GOUA 4Q8QA 3W26A 4GHRA 2BDQA 4UTWA 3ZVHB 2WHMA 3HU7A 2ZUTA 5GQBA 4B16A 1V3IA 3NQFA 3PUEA 4CQ9A 3NYZA 3OA3A 5DLCA 1MUCA 4ADSA 4DX3A 3NIYA 2VEKA 3CUJA 1JCYA 3N11A 3KBJA 3ATZA 3EXRA 2IKJA 4JCMA 2FPVA 5AHMA 4TOQA 1OIMA 4M82A 4H7CA 3GXPA 5A8GA 4L6HA 2PS2A 1UWQA 5H91A 1PX3A 1NDWA 2GQ3A 1TV4A 2YW4A 3KL0A 1AQFA 3AUJA 1B3VA 3N6HA 3TTYA 3NJ3A 4FR1A 1FHVA 3PZIA 1TMLA 4JEQA 2D24A 1HO1A 1E4MM 4UFIA 3T8LA 1PZ2A 1GW9A 1WKEA 1GTHA 4X9YA 3FLUA 3WG6A 1W3JA 1WXYA 4R27A 3KDNA 4IQEA 2I16A 2D73A 1Y7VA 3WF1A 5FOOA 3EOEA 3DEQA 1QT1A 3KOYA 3NQAA 4ZSUA 1YPFA 4W86A 4DEFA 5BXSA 1Q45A 2POZA 3R11A 1L6SA 1B4EA 2PBGA 3FGCA 1C9DA 1YLVA 5LHFA 3L4YA 1BTCA 2VRJA 1Q8JA 5I3IA 1MFVA 3GLCA 3Q67A 2TODA 2VGFA 4GYFA 4C6DA 2Q09A 3SGUA 2ZICA 1OD8A 3WUEA 5LNSA 1W5OA 1UKQA 5HNTA 4LAMA 3S5NA 3M6YA 4IQLA 4JQ2A 2P8BA 2RFGA 4UZUA 1QU4A 3N4AA 2V5DA 4L6OA 2QCNA 3WBYA 1WAUA 4JHOA 3QTGA 1UG6A 3QR0A 3SCSA 3GTFA 3I68A 4JFVA 2H8ZA 1FKWA 3R89A 2VZSA 2XWDA 1VZWA 1FFQA 4ACZA 3HA1A 3DG6A 3QW4B 3HG3A 5CEWA 2PU0A 1L6YA 3O0KA 3IJDA 1VP5A 4F0SA 6REQB 1HP4A 2E1DA 3PZNA 2YX0A 5FJJA 1A5BA 4OT7A 2REQA 3GNOA 2Y5JA 1UA3A 1M68A 4IFOA 2P10A 2XGIA 3LYEA 4HNNA 2J78A 3UR2A 1SZGA 2OYKA 1XRSA 4DF1A 3UJFA 3O9NA 2J7FA 1GUVA 3B3DA 1O7AA 3UBPC 1LL7A 1TV7A 3FYYA 1UW9A 4C7FA 3N9SA 5D04C 4M3PA 1PL9A 4LALA 4R88A 3PTDA 4TX9A 4PODA 3NO5A 2WAGA 4QLLA 1HQTA 1BYDA 1XLGA 2WB5A 5AYZA 4AX6A 2WJEA 4W7UA 1QPQA 3A9IA 5C54A 2EGZA 2QIIA 4PTVA 4RCXA 5A2BA 1EGVA 4XZHA 1TPEA 1ZPTA 3JU2A 5FJRA 3GXNA 4NAFB 2VELA 1J0IA 1GYMA 3PVFA 3P81A 3P14A 1V6XA 3DIPA 1E9YB 1MQQA 2CLEA 2DSUA 3N34A 4AZGA 4GY0A 1FH9A 4UQBA 4HNVA 1XDJA 2VWTA 1XIEA 2NV2A 5B7YA 1T41A 1N55A 4IUGA 4WRHA 2G8ZA 4AHQA 2Y8KA 4PMXA 4U5KA 2ZX7A 5AC8A 2W61A 3REQB 5K2ZA 2OCZA 4HA4A 3UU0A 3CV6A 1REQA 2QYGA 4ZFCA 2WCAA 3NSMA 3P61A 5AYIA 3DFPA 4ZO9A 3E3HA 4XZMX 3VK5A 4MKNA 4XISA 1TJ0A 1N8FA 2ZX8A 1I2OA 2XH2A 3D0CA 2OSWA 4Q33A 3KTSA 3H55A 1D7FA 3UERA 4AEEA 2DU2A 3VKAA 4A3RA 1A3HA 3PJTA 1AQHA 1JRBA 4A3HA 3VKDA 2NWRA 5EMUA 1A80A 3E12A 4G7EB 1M7XA 4KH2A 4F2UA 1SR0A 2ZRZA 3MKVA 3BJFA 1W2VA 1G7UA 4RR4A 2Z1WA 5GJNA 3AXXA 3H7RA 3TIMA 4YNGA 3HJZA 1YXDA 1VPXA 3WO8A 1XDLA 1OCBA 3ZSTA 1V79A 3R94A 2G0WA 3R79A 4J7RA 1VLIA 2CLIA 4FLOA 4PMZA 2G3JA 1WKFA 3GIPA 2DZXA 1CXEA 4V28A 1OBAA 4HNCA 2V3DA 4DBUA 2P1FA 1PKMA 1LBLA 2V3FA 2VJXA 3NZ1A 3NYDA 4QNWA 1A3WA 2E6YA 3MCOA 2G41A 2CWXA 2ZRWA 5HQMA 4INFA 2Z27A 4ML9A 4D1IA 4HYVA 1XP3A 4YTTA 3CHEA 4Z2JA 1WCGA 2OO0A 4BA0A 2BV9A 2ODOA 3UPMA 3A23A 1R3WA 4GI8A 3UR7A 2PU1A 5C7HA 2FIQA 3G1RA 1QK2A 3HQOA 3IJ9A 1EJXC 5BYWA 1RP8A 2B31A 5CSRA 2CBUA 3MDWA 3LUTA 3SW6A 5IHSA 2A3LA 5RUBA 3CTTA 2XZ9A 5F2LA 2QAFA 4C6NA 3QGAC 2SFPA 5DELA 5F1UA 2EG8A 1ADDA 2ESCA 3BG9A 3RPDA 1XV8A 4ADUA 5EFFA 5D4YA 2Y5EA 1SMDA 1D3CA 3R0KA 4O15A 4UFMA 1X7IA 3BAIA 1G94A 3GM8A 1BXNA 2A2IA 3SGGA 3W7EA 1J0ZA 3MWAA 1A0CA 1HKMA 3VI2A 3WL1A 4UTJA 3B4YA 3T2QA 2JEQA 1PX4A 4GMEA 4QS5A 4YMZA 4ZB2A 5MHBA 1XIGA 2CLHA 4F0HA 3LTPA 2CXEA 3QSRA 4DBEA 3G6LA 4JD4A 1P1XA 2Y7DA 3WJZA 3RYSA 4PMNA 4BQ2A 1EWDA 3DYMA 3EPOA 1MW3A 2PA6A 4HVXA 2VEMA 3C86A 4ERAA 3KBNA 3U0HA 1LF1A 4FX6M 2Z1XA 4H2HA 1XLDA 3W7GA 2BFGA 1SR9A 1KV5A 6CGTA 3L5AA 3IARA 4QDMA 4QHRA 4WJEA 1CXFA 2DT3A 1YXCA 4WLCA 5G4WA 4IG2B 1U1JA 4YVPA 2VEFA 4ZB0A 3RFAA 3MCNA 1W1TA 3TROA 1WV2A 3A21A 1ZRQA 1T96A 3NGFA 1POJA 4UUIA 2OXNA 5F4SA 2EPHA 1IIHA 1SFLA 2OG9A 5CZJA 3WFLA 3BURA 4WF7A 1J10A 1HN1A 5D09A 4XO7A 1JAEA 4PMVA 1LT8A 3G8RA 2E6AA 2QCDA 1X1ZA 3GR7A 3NVDA 2E09A 2O56A 3P6LA 4P61A 3FHAA 2CLMA 5BRPA 1XH0A 5FEPA 3CUZA 2J7DA 1H63A 4A3QA 3RAOA 2I7GA 1M3UA 2ZCGA 3ECQA 1EUNA 4FEZA 4GUFA 2X1TA 1LLZA 5HUPA 4NYUA 2R24A 3RXZA 2PWHA 4HA1A 3VIMA 4L9YA 3H2CA 1EC9A 1TX0A 3TYCA 1XCFA 3T40A 1GEQA 1IV8A 3UZYA 5BU6A 2VKZG 4GG9A 1HT6A 3FIGA 3WQOA 1NDYA 2HVOA 3LGDA 1E0VA 4A8NA 3NQ2A 1MW0A 3GTIA 1OB0A 3PN8A 1ONXA 3C2VA 4TV5A 5D2VA 1EPXA 1B2YA 1GT8A 2EPLX 4CD5A 4F9JA 1GQIA 3DFNA 4JDYA 4F48A 3LI0A 3CQIA 1H51A 2VDIA 3GDKA 4MZYA 1V3MA 3OHIA 4PSRA 1FWSA 1T6MA 2VUNA 2PLMA 4Y9OA 3NDZA 2GSHA 2WQPA 4H4IA 1IR2A 1NOFA 1IT0A 3UWWA 2JGYA 3FK4A 3SCQA 3II1A 3KHDA 2D1ZA 1DYSA 5DMNA 1XG3A 2J9XA 3VA8A 2WSPA 3RR1A 4FNTA 4PUMA 3PPGA 4C6OA 3FVMA 1CGVA 2ZWZA 4HMCA 3VGGA 4FNQA 3TWAA 4LCRA 3M46A 3QKEA 3K46A 4Z0SA 3AXHA 5D8ZA 4EIVA 2OR2A 1W1PA 3DX5A 2DVTA 2QCHA 4UFLA 2YCKX 1H0GA 3EOSA 1Q6DA 2VRQA 1BAGA 1W9UA 4W87A 4JN7A 4CVWA 1XYMA 1VPQA 3AISA 3VIHA 3VM7A 3PUDA 1DHPA 1GKPA 1BVNP 3ZZ1A 2PP0A 1H09A 2F38A 1BKHA 5DF0A 4QP0A 1VC4A 4LPCA 3EWYA 4NZFA 3GNDA 5FF4A 1V7AA 2BSLA 4I8DA 4D2JA 5E09A 4UTHA 4E2VA 1S2TA 1X98A 3EPNA 4CQCA 4GISA 1OT1A 8XIMA 5CGTA 4JTEA 1MZHA 1IXQA 3PPCA 1ZALA 2QUTA 2VTFA 2HWGA 4IX2A 2H8XA 4BK9A 2VC6A 1GOKA 2VHLA 4KFNA 4PTMA 4PRTA 3W4RA 1YQ2A 4J28A 3E0WA 1DJNA 3O2LA 5IXEA 3PM6A 4JHMA 5LIUX 3EWUA 2CW6A 2YB1A 5AN7A 4PL2A 4GABA 2XGZA 1Z69A 4HJFA 2OZ8A 1WXZA 1FWJC 4DBDA 3A22A 5HMFA 1E6QM 1FWDC 5XINA 3DHFA 2XVKA 2Z26A 4JTFA 2QPSA 3V1PA 4HOWA 4K8GA 1UMLA 3WLPA 3APYA 1ISXA 1NQKA 2YJQA 3IIOA 1WX0A 4H8UA 1ICPA 3WZ0E 3W1PA 4B5VA 1FXPA 2BXZA 3T44A 1XISA 3MYPA 2E9LA 4QDPA 3GC2A 1I60A 1PXGA 2JF6A 4LYKA 4NZ5A 3ZJ6A 4GNJA 4TU1A 1KFKA 6XIMA 4LVAA 5CPTA 1EJ7L 1P6WA 1YIXA 5DXXA 4PN2A 1LWJA 1ECEA 2PB1A 1LQ2A 3GHSA 4NASA 3FKRA 2YDSA 5E5CA 1D8CA 3LHVA 2GVLA 3PG9A 4DUVA 1UR3M 3RO6A 5I78A 2DZTA 2V3GA 2WO5A 3B97A 4BCEA 4LYRA 3THAA 1DQXA 1O66A 1CEOA 4HNUA 4H01A 1JD9A 2XGBA 3GTXA 3TSDA 1IWBA 3CS2A 3EZ4A 2V5BA 1ZP3A 3GIYA 3LHYA 2NT0A 4CQBA 3P3BA 2OFJA 3MUAA 1YDVA 1AZ1A 2V30A 1CB2A 4L6DA 2A5HA 5E0FA 1UD5A 4X63A 3CUXA 5FF7A 3PS7A 1ZP4A 1DQUA 2OWXA 1H2JA 4WOQA 2CETA 3BOFA 4MPKA 5I0DA 2F61A 3IIZA 3IV8A 3A4WA 4QS6A 2Q8XA 3W9ZA 3ZFHA 3I3BA 3BXWA 1UPPA 2DUZA 1W3HA 3IWPA 4C6KA 4AZ6A 4EAMA 1KCXA 4X0NA 4FSAA 1VS1A 4Q4RA 3GB6A 1V0LA 2HEJA 4RDVA 3RCNA 1PIGA 3H2FA 3QLDA 3CL8A 3WLTA 1UASA 3YPIA 5FEWA 2QJJA 3L23A 4NJGA 1XIJA 4IUOA 1HJXA 2GQ9A 4UR8A 5J04A 3OYZA 1LLOA 1KXHA 2R1KA 3K8KA 3P0XA 4XUYA 1XC6A 3VNIA 2ATSA 3F7JA 1N82A 3BPWA 4UTUA 3IGSA 3WNOA 3UXIA 4HJWA 3ABXA 3BOXA 3UZWA 4WR3A 3VO0A 1VFUA 2FZNA 1EC7A 4K37A 4MZ1A 4G6CA 3ARXA 3S1VA 5HK4A 2ABBA 4EX4A 3GAKA 4F8XA 1ZB5A 1EIBA 4WDTA 2XFFA 1ZCOA 2QJHA 3B8WA 4GGHA 3W74A 4NQ1A 5HATA 4U3CA 3RM9A 3FKKA 2J7GA 4PE8A 2D2HA 1S5NA 5I3KA 5IRPA 1GOQA 4QNEA 5CG7A 3PUGA 4M24A 2QCEA 1QI3A 4AB4A 1PE1A 1EGMA 4DF0A 2X42A 3KOWA 4B5SA 1HL8A 1HTIA 2E9MA 3JW7A 4KEZA 1F8IA 4UWMA 2O9RA 2ZRXA 3W86A 3WLLA 3E38A 3WN6A 4ACZB 4IPLA 1GVIA 1GEHA 5HNRA 2PURA 4J40A 4PCTA 4E0CA 1ME9A 3U4FA 3TOYA 3APTA 1N2VA 1GVFA 1VJZA 3EB4A 3FXYA 3XIMA 1R5YA 2FTWA 2ZX5A 4Y9NA 2EPNA 3KEHA 4HK5A 2REQB 1JZ5A 1RCXB 4F0MA 2WZMA 3VMPA 4H9YA 1ADOA 1S38A 3B04A 4NZ4A 1E9LA 4KERA 4WKFA 2E5DA 3W72A 5HOSA 1A5MC 3NEVA 1RQBA 4GI6A 2VCCA 4MSSA 1SQ7A 4DZAA 3N73A 4XZLX 1RK6A 4HNTA 3S8HA 1AA1B 2JBMA 4D6CA 3ZXWA 3HQPA 4J9JA 3WNLA 3H4GA 3WEZA 4GJ1A 3GDTA 1WB0A 4Z2IA 4XIAA 2J75A 2OQHA 2BY1A 3VZXA 4IIEA 3RUBL 3RIKA 1SMAA 1QW8A 3PZVA 1D9EA 5KZ6A 2E7FA 4QJ5B 3R0DA 3TJXA 2DQXA 1QATA 2H6RA 2A79A 1U5JA 1RPXA 4YVXA 1JEZA 1TA3A 4IPIA 4Q6JA 2F6XA 1V3HA 1BKSA 1REQB 1QPOA 1VCFA 3ANVA 3SUUA 3TSBA 4AH7A 4Q7IA 1G4PA 1SFTA 2A4AA 3T0AA 4PBFA 1H1YA 3CQ0A 5DY2A 4XBJA 1OG0A 4M7TA 1VFSA 2VXNA 4JQAA 1FWNA 3TJIA 1OX6A 8CGTA 3MYOA 3T55A 3WLRA 2AGKA 5DBTA 4B2DA 1EDGA 4HMNA 2W66A 2Y24A 1OF6A 1IWPA 2WZHA 1PTAA 3CLWA 4HCDA 3UXKA 3M47A 4HKPA 2J9ZA 3MHUA 3ITYA 4U31A 2AMGA 5C6MA 2CITA 4IZGA 2Z6IA 4HIBA 4D6EA 3SQLA 3BAJA 5LA0A 3TYAA 4XB3A 1TTIA 1XIIA 1G01A 3RX4A 1EYWA 5CSYA 3MS8A 4C6IA 3CNYA 2IPWA 5IM51 3EA2A 1G6CA 1W17A 3CT2A 4B90A 2PDHA 3AXIA 3ORWA 3FAWA 5K7JA 1E15A 1XL9A 4BF9A 1E51A 1W3KA 3QV9A 4R9XA 4PFHA 3OVGA 4GUGA 2ALRA 2BOGX 4H04A 4JEJA 2W92A 3T4CA 4JIPA 3IAQA 4F9DA 4QR6A 3LZ5A 3BSHA 1MXDA 1DJIA 4HK6A 3BDKA 4AUBA 9XIMA 1V8EA 2QCLA 3KWXA 3N29A 5LZLA 3MSYA 4MY8A 3EAUA 3KVMA 3PJXA 5F2MA 2YZRA 1V4YA 2B7NA 4CD7A 3LNPA 2PI6A 3FA5A 3G3DA 4C65A 4ECLA 3W1MA 1SJBA 2R1NA 3LTYA 4PSPA 2QKFA 3WKZA 5TAOA 1F61A 2GUYA 1FUYA 1ZJIA 3GNPA 5FD0A 2ZWYA 2YR1A 3QSTA 1OQFA 3UVIA 4O14A 4Z08A 2WCSA 4O19A 1AH0A 3TMQA 4AG0A 3GG7A 5HMSA 1XSKA 2XIOA 3UJSA 3T9PA 4E2DA 3ITGA 4U2ZA 3TW9A 1JAKA 1DEDA 3TAOA 2Q02A 3K4DA 5AKQA 2C8NA 1MQPA 1AW1A 1KTCA 3GVRA 1CTNA 3P74A 4LYQA 1W1YA 3CMGA 4WDUA 1CGXA 1GVQA 4AX7A 5EY5A 3B8UA 2XWEA 1DIDA 2GGHA 4LANA 4Y8EA 5BMXA 1FOBA 4TO8A 3TLLA 1ITCA 3RPTA 3EKGA 3SRFA 3CLMA 2D23A 3H6OA 3A3WA 1TWZA 2O92A 1O60A 1OEPA 4PTXA 4N6EA 4D6FA 3AHVA 4P5UA 4HB7A 2OLSA 3SY8A 4Y7EA 3UCCA 4N9EA 4GPNA 1ONRA 4R7WA 2YXOA 1UWTA 3LG3A 4N0RA 3Q58A 1KR0A 3U3HA 2F6KA 3ABSA 1IZCA 2VRKA 2INZA 2E6FA 3BANA 1TIWA 4ZENA 1X1NA 3G0XA 1H5YA 1ISVA 1SZEA 4NY2A 1MNSA 2HISA 4CN1A 3R25A 1HW6A 2DPEA 3HPSA 2OWCA 3GZ3A 1BD0A 4EOUA 1UROA 2PWDA 2R6OA 3MHGA 3CHVA 3S2JA 2NQ9A 5E0CA 3RK8A 3A13A 1QXLA 3TW6A 2OGYA 4UQDA 4F2TA 1SZNA 5AB3A 1T7LA 4DZHA 3WQEA 2VD9A 3RLUA 2JK2A 3QY6A 4UZSA 1E72M 1EO7A 2YFNA 4B2DD 6A3HA 4J3WA 1EO5A 1OSEA 1TV2A 4NSBA 4C7GA 4J35A 4UB9A 5F4XA 4B9YA 1EKOA 2PWEA 3DFYA 2V81A 1S2UA 1OZQA 4QJ1A 3W73A 3K4AA 3TN3A 1H62A 1DVJA 4OKDA 3S0CA 3CK5A 5M03A 1XYBA 2YLAA 3VC6A 4Z1DA 3N14A 3H7UA 1ITUA 1K02A 3D3AA 3ALFA 2WQDA 4IMCA 3I6TA 4LUIA 3THQA 4CEXC 2P3ZA 4MMWA 2G3NA 4ZE5A 1TTJA 3CZLA 1R85A 3QF0A 4O8RA 1UCWA 4A4AA 1RP9A 3PTKA 4GACA 3TYBA 2VX4A 4XSLA 4PYSA 3KVKA 4JIEA 2ZADA 3P82A 1Q6RA 4JTLA 4I6VA 3UY7A 1F3WA 1D2KA 1M5WA 3B0VC 3Q37A 4O0QA 2CIPA 1KBJA 3VGHA 2NLIA 3CMJA 4S38A 4KWSA 3ISIX 3M0VA 3USBA 4L4PA 1YBQA 1J8VA 3C61A 1CGYA 1YPXA 2WW5A 3EDKA 3EXTA 3DOPA 4S39A 4XK2A 2AL2A 3C2EA 1L8PA 3AJXA 1P0KA 1LYXA 3FSUA 2X1RA 3G22A 2BTMA 4PB5A 1H7XA 2ZE0A 1E1CA 2J27A 2TYSA 3PBYA 4EF9A 2VC7A 4GZJA 4JZ5A 2A3BA 4KIRA 3TCSA 3E0LA 4FR6A 1MMFA 2EKCA 4M80A 4D71A 4OJYA 4YL2A 3NL6A 3UWQA 1BWLA 4LS1A 8RUCA 3W83A 1PBGA 2EG7A 1XKYA 2B7OA 2NXIA 5DMLA 2GVGA 4NJIA 3GNNA 4IIBA 2G3IA 2G3MA 4H6KA 1EP3A 3MY9A 2PSNA 3PUOA 3AIWA 3KCJA 2OELA 5T8GA 3A6OA 5A8NA 5FSDC 2QUUA 4H7VA 5I03A 4DBWA 1OFEA 4NI8A 1YHTA 4QG8A 2YW3A 5DY3A 2GSJA 2QPXA 5TNVA 3MJMA 2PC4A 5A6TC 3CMFA 4KCTA 4GXMA 1W6TA 3CB3A 3RN6A 1WBHA 3GH5A 4RJEA 3MUIA 4PRRA 2DFAA 1V3JA 3VGDA 1QNVA 2CZEA 2OQYA 3T8QA 4GI9A 1Z41A 2YFOA 3OLDA 1G0CA 2P3EA 4UOQA 2QEZA 1ELSA 3LGGA 5EGRA 3F03K 3ZOAA 3N1AA 3W1QA 1P6CA 2YL6A 3IRDA 1W1ZA 4LYPA 4PFMA 2E9BA 1TV5A 1PZ3A 4IJRA 3WY1A 1QPNA 4UCFA 2VWSA 3PR2A 5PTDA 1NWRA 3IACA 2VP8A 1LRTA 3WK2A 4GNVA 3FNDA 1B3WA 5XIMA 3G18A 1ML1A 1UR1A 3CQHA 3BG3A 1JF6A 1AUSL 2WMHA 4CKQA 1FWFC 3SURA 2VO5A 3WQVA 1GOWA 5F2GA 1R47A 1F05A 3PSVA 2Z7KA 3QZAA 2YB4A 2FZ8A 1OCJA 3SGZA 1X96A 3NO3A 3WQ5A 4Y2WA 2J7CA 4C6EA 3CHCA 1MVYA 2CESA 3G0UA 3OTRA 2ABAA 3TKFA 1Z48A 3COTA 4W85A 4RV8A 4HD5A 1PUDA 1TCMA 3H12A 3QGVA 2Y1HA 3TZNA 1OCQA 3TUUA 1FQ0A 4XO6A 5FEZA 1KLYA 2NXHA 4HK7A 5BXTA 5GJMA 3VMNA 2BX7A 3QXBA 2Q8ZA 3RNDA 3M64A 4E8DA 3ITXA 2ACUA 5T9CE 3BGJA 4MADA 2PEVA 2PTDA 1UMYA 3CAWA 1DP0A 3NL5A 3RJXA 1JDEA 4LXFA 2FVMA 3T1GA 3LHTA 2JALA 2DJXA 2FB3A 3B9AA 3BTNA 3U5YA 3T07A 4ICNA 2OKTA 3PSWA 2YA1A 4GE8A 5DEZA 1QOXA 1TQXA 3W00A 3VNYA 2JE8A 1FDZA 1UKSA 1C9WA 1EJVC 4XZWA 3LLXA 4AWUA 4NRRA 1NY1A 5T9BG 2F2HA 2TMDA 4QCEA 4ICMA 1JPIA 4Z2GA 5KZMA 2VDGA 1W3TA 1YNPA 1OC5A 1R46A 3MP4A 3R4IA 2R82A 3VIOA 3VX0A 3GG1A 4B4FA 3L2MA 2NVDA 3RCYA 2BVTA 4LY4A 4OU1A 3UT0A 1UR0A 4DJDA 3BW2A 1E73M 4QG6A 3CO4A 2YA2A 1TRIA 4I9JA 4H9ZA 3UW6A 3A3XA 1K9EA 5M3WA 1J79A 3BICA 1E0WA 5EBAA 3VPLA 1DBTA 3QOKA 3VCCA 3PWAA 5IOBA 1GPWA 2QXWA 3B9NA 3MZNA 1DXIA 4DUWA 1FX6A 2VEIA 3G1VA 5DXYA 2NWSA 1EDQA 2WWCA 3C3NA 4LGXA 1JDFA 3ARRA 4LRSA 3B8SA 1D3GA 4J3SA 4JTAA 1FDYA 4DUXA 1JZ3A 2VUYA 5LNWA 1EP2A 3KUMA 3W7MA 1B0IA 4XKYA 4S2CA 2VR4A 4B5TA 2WPGA 4K8EA 3DESA 4I9MA 2WMIA 4JQ1A 2PC8A 3NR0A 4XAZA 3UJEA 5MF5A 3BCFA 3VTRA 4F4RA 1TVPA 4MLRA 3S2MA 1XSIA 4O13A 4Q6XA 1DIEA 3HN3A 3UG3A 2I56A 2X8RA 4FXSA 3PJUA 4W5ZA 3ZR6A 3UEQA 3V75A 4GC4A 3VDHA 3VVGA 2C0HA 1K9FA 1EYEA 4M81A 4OGZA 4ADTA 3CIWA 1EPVA 2Z1VA 3CL6A 5FI8A 3QYQA 1GJUA 1XBZA 3LX9A 1BYBA 1IZJA 1F3XA 4FPSA 3WEMA 4WVXA 3UG4A 2PDJA 1OIFA 2VQUA 3LI1A 1R9YA 3OZMA 1XLIA 1AD4A 4ZQCA 3DI0A 3VD3A 5CJMA 1MW1A 4IH3A 4RDZA 5C2GA 2Y88A 3GVVA 4WKAA 4FHAA 3W1LA 4LFYA 3GFXA 3MC5A 4RL3A 2NV1A 4E4UA 4K8HA 1SO6A 4NI3A 4EK7A 1EHNA 3UY8A 2ZIDA 1AW2A 1AMYA 2DZBA 1JL8A 1IQ8A 3TQPA 4C5ZA 4WY0A 2XFYA 4WSKA 1DL3A 4FA3A 5JVLA 3PZQA 4LAOA 1V6WA 4MFDA 3W6YA 3SRKA 2ZZ3A 2WKGA 3KAOA 2PDYA 5DN1A 1R9ZA 4ROQA 1BRLA 4XD4A 1EH9A 3NL2A 1B3XA 2V38A 1TYGA 1EA0A 3FJNA 1XRFA 3KLLA 3AMDA 4PEEA 2PRLA 3B9DA 1HJSA 4GYKA 2HRWA 1TA3B 5ECUA 4NNBA 4YTUA 4AZBA 4G1KA 5E9AA 3PB0A 1UJQA 4IM4A 2A1YA 4IJBA 2VFDA 1NM9A 4QXIA 2W62A 3T0DA 2A3EA 3HURA 1E9IA 5ABHA 3QMTA 3ARSA 3RRAA 1RVGA 1TPFA 4O18A 1XLBA 3KOZA 1RXOB 5BWFA 4RX0A 2D3NA 2HQAA 3NG3A 1E1FA 3DBPA 2NVAA 2HTMA 6TIMA 3M7SA 3SADA 1SUXA 1QO5A 4FK9A 5G1TA 2W6RA 4GO9A 4LF1A 3LHWA 3QV7A 3JUGA 4NG3A 5LNRA 3UETA 2PDQA 2WVVA 1E6SM 3M0XA 3E5PA 3N9RA 4D6GA 4GO8A 4DJDD 3B0XA 3M07A 4ZTXA 5E6ZA 4ERGA 2OODA 4L80A 1V03A 2GJPA 3VDBA 3WMLA 3W81A 3UPWA 3PBWA 1W9BM 1B4KA 4N9BA 2FZ9A 3WD0A 1A5AA 2CKRA 1F2JA 3HZ3A 1NELA 3PP7A 2XUCA 1W1VA 2QAPA 3AU2A 1MXSA 1I45A 4G8TA 5HJXA 2J24A 4NJJA 4GCXA 1UR8A 4LCQA 1NF0A 3VGBA 3B03A 1YX1A 4AD2A 1NP0A 2A85A 1UB3A 1YTDA 2WBKA 5FCZA 2Q6ZA 5AYBA 2D22A 3LBOA 4BKNA 1EJWC 3AOFA 4A05A 3CL7A 3I4KA 3CWNA 2BOFX 3UF9A 1GKQA 3MI3A 3BJTA 1ESWA 3LN3A 4PUNA 2VEGA 4ZSTA 2QV5A 3M16A 2Z1KA 1QBAA 4QSHA 3AI0A 1BVWA 3CTLA 1K7EA 1J5SA 5C70A 4BF7A 3RLHA 2HXUA 4M1RA 1KRMA 2YYTA 3NDOA 4YWSA 2B81A 3C2RA 3T0TA 3HV8A 2POTA 3AMLA 4GVIA 5CPOA 1SFSA 3PZOA 2WCGA 3NQ7A 3ZLHA 5KMYA 2HS8A 2WHJA 3ZQ9A 3NXFA 2FHCA 2VM8A 3ARUA 3LHUA 3UNTA 4K1WA 4JTJA 3G6MA 2ZUUA 1MNZA 1XH2A 1AMKA 5CBJA 4BEQA 1QRQA 2RDUA 1Q6GA 1GORA 4WX2A 4GZEA 4QROA 5A6LA 1PPIA 3R43A 4PMRA 2EG6A 2ZUWA 4C6JA 5M2FX 2EAWA 3LRKA 1I0DA 4HYWA 1LZOA 1PHWA 1BF2A 1M7PA 3ARQA 4FZIA 5KZDA 3MMWA 1BSIA 1RV8A 4YLWA 5CQ1A 3NQMA 4EXAA 3PANA 1T8XA 3WH9A 1DE5A 1VBRA 4KRUA 4WGXA 4AWTA 4TX6A 2A0NA 4BQ5A 3AHZA 2QF7A 2JKEA 4MB1A 1GW1A 3ITVA 5HULA 3GTNA 5EYWA 3W87A 2E0PA 3LERA 1XD0A 2D2OA 3AXKA 1EJTC 3WDHA 1R2SA 4MF4A 2GYIA 4HZMA 5IDIA 3RO8A 7XIMA 1XBVA 3L66A 2DW7A 3N9KA 4Z1CA 3A64A 1XCXA 3AALA 1HO4A 4R7JA 4JYFA 5D2TA 4S3GA 1G5AA 1F4AA 2XHYA 1VRXA 3S5ZA 4KS0A 3UP8A 5EFDA 1Q2SA 3MA8A 3UCDA 4G5DA 4CNSA 3JS3A 2A3AA 5BRBA 2PDCA 3VAVA 2B7QA 3EOOA 4N42A 4C91A 1MSSA 3PY2A 1F8MA 3QPEA 1QI4A 1AW5A 2VFEA 2XIJA 4DJEA 2V6AA 4UTFA 1EHAA 4GQ0A 3PZMA 2E3ZA 1QI0A 3MT1A 3UA3A 3CGTA 2YZ5A 1K7XA 3DBNA 1HGYA 4OECA 1BF6A 1XRTA 9CGTA 3QY8A 1K3UA 1AJ2A 4PMOA 2J4GA 1UOZA 2BGSA 5EMKA 3TAKA 1AVAA 3NSNA 4IGMA 4JL2A 4LRTA 4PMDA 4XVDA 1E0XA 4C6CA 1FVPA 1NEYA 2V69A 2RHGA 1XLJA 4TTUA 5HNNA 4DWSA 2XH4A 4CD4A 1A5OC 3DYOA 2X30A 4TVUA 2WV8A 1DWHM 1H3GA 4E5TA 2VYOA 1R7AA 1H7NA 3DFSA 5FL1A 2VX7A 1YBQB 4XAYA 4D6DA 2O4QA 4KWOA 5LGXA 5JXQA 5LIXX 1XD1A 1UP2A 2ZTJA 3PBUA 2AL2B 3LENA 1FP9A 2ACSA 5DMYA 1ME8A 1F4HA 1FTXA 3FSTA 2J9YA 3MKCA 1AQMA 1GCYA 3I4EA 3WFZA 3WJYA 3HV9A 2FHFA 2WC4A 4LAZA 1E1CB 1VFHA 1LRQA 3ELFA 3I3EA 1UD4A 4QDWA 4D6JA 4I6KA 1ISWA 3QZ6A 5ABFA 1HG3A 2XG9A 4DJFC 3ZYZA 5BW6A 1X6UA 3QRHA 2Z1BA 3MP5A 2PDKA 3NAVA 4ZO7A 4HMDA 3HBLA 2GLKA 1T40A 4HGXA 1HVXA 1VD6A 1UR9A 3CUGA 1BFNA 2ZXBA 3TX9A 3WFAA 1QHOA 1UQZA 4H8VA 3B05A 1CLKA 2ZOXA 1JNDA 4FXFA 3ANUA 3SRHA 3W7RA 3MBDA 2FGBA 3LU2A 3CAQA 4MNMA 3LXBA 5BOOA 3WLNA 2C19A 5C9XA 1RK5A 4QRNA 1CCWB 1UKTA 4BHYA 6TAAA 4QJ4B 4GH1A 4AEFA 3TNOA 4H1ZA 7TAAA 3DHDA 4KPLA 2P50A 3SFWA 5HJYA 1US3A 3BG5A 4L56A 4BI6A 4B5UA 4K68A 3HGJA 5CPLA 2PDIA 1VBHA 5CC3A 2VENA 3I7QA 4FI4A 4KFOA 2OB3A 1JDAA 3NA8A 2BLEA 3EWZA 2CZDA 1BQGA 1DTUA 1I2PA 2QMJA 1PO9A 2ALDA 4DY1A 5FKYA 3TTEA 4XTDA 4JL1A 3B40A 1WDQA 3ANYA 4PEKA 1CDGA 3VINA 2PBOA 3RLVA 2VQTA 3OGSA 3DGRA 3GH7A 2VX5A 3QC0A 3OODA 2Q71A 2YXGA 4F0LA 4MJZA 3WJSA 1MWOA 1JGMA 3OW1A 4W7VA 4LBSA 1S5MA 1NWSA 4JTSA 3KP1A 4GK8A 1YMYA 1GVYA 4RXGA 1W5NA 2YDRA 1XUUA 5B80A 4DJED 5A6BA 1ZNNA 3W1RA 1DXEA 4WUIA 1LDCA 4LB4A 3SRDA 4GINA 2CKSA 3ZSSA 5XIAA 1J18A 1I8JA 1FY6A 5A2CA 4ZCWA 1H7OA 4W8LA 3WDRA 3PBMA 4PMJA 1GZJA 1TR9A 4AD5A 2JFEX 1TPVA 1K6WA 1MYRA 1LOQA 2ATMA 3DGBA 2OSXA 1RJQA 4AAJA 1VRDA 2DSWA 4TTGA 2YL8A 2JIWA 1E0UA 3CZKA 1RAKA 3OO2A 4LAKA 3FCPA 2QMKA 3U5UA 3BGGA 4L4LA 1VIWA 4WSJA 2X2YA 2QJGA 3D46A 4AY8A 4DYEA 3I3DA 2VFHA 3THDA 1ZL1A 5CZSA 3ENLA 4KQNA 3CHFA 3O05A 4HSHA 3SEPA 4DWSD 4L64A 3RM8A 4B15A 3HQNA 3V5OA 4KWUA 4DVOA 5D32A 4AXKA 4WXYA 3RDKA 3CAKA 4TQTA 1RD6A 2PCQA 5KITA 3KOFA 1VCVA 3A5FA 4O4VA 3EPMA 3I6EA 2QPUA 3G1AA 4RE4A 3LSBA 3S9ZA 2CCRA 3S6DA 4AIOA 4GKTA 3EGJA 2G3FA 1TX2A 3KWSA 4GVHA 1QWKA 5AVNA 1KFBA 3E96A 4IISA 4GRSA 1JCLA 2ZXDA 5GNZA 3PTQA 2E68A 1OYAA 4WHBA 3WLMA 4DQWA 3F2DA 3STEA 4BY3A 4KF1A 1SO5A 2ACRA 5D33A 3WMSA 4KW2A 1W1IE 1VFOA 4OHQA 2GGJA 3W27A 1PCKA 1O12A 3LSCA 1BQCA 3GFYA 4IP7A 4JR5A 5I77A 4AIBA 4XG1A 2GGGA 3P60A 4M56A 1I2QA 5I79A 3BMVA 3W76A 1MO0A 1V6VA 3VNZA 5DANA 1F07A 1VGAA 2OT0A 3SUTA 3USZA 1GVEA 3EB3A 2WOQA 3SDOA 2TRSA 2NT1A 1MRAA 1GGOA 3QR3A 4NZJA 4XKYB 1EQPA 1TREA 3LMYA 3S9IA 1DWJM 4DELA 3KS6A 4U3AA 2WMIB 2FFCA 4BEUA 4JKLA 5C71A 1F74A 3LM7A 8TIMA 2ZZ7A 4C60A 3T0CA 2PWUA 5AC6A 5AECA 3KM8A 2V5KA 4G1NA 5HQEA 1ZBVA 2RDTA 1JCTA 1OCNA 2CZVA 3EA1A 3MUCA 3W2LA 3TA6A 4CGTA 4F0KA 3A4XA 4HP5A 4EACA 2C79A 2CBVA 3N2BA 1IT7A 2Y63A 2BVYA 4FMVA 1UQYA 3VZYA 1GOMA 4C1KA 5A6SA 4E8CA 2V2CA 4LVFA 3TYDA 4FNPA 2C6QA 4S2BA 5AZ0A 4NX5A 4O8AA 2WVSA 1XPGA 5CGMA 4GIYA 4AHPA 4MAZA 1UHVA 3WELA 1A5NC 1U2YA 4Y9PA 4ZEPA 3PBVA 1MW2A 2A6NA 5DRCA 3I7RA 2PF0A 2CZ5A 2V5LA 3TXZA 2VGIA 3UD6A 3UWEA 3P93A 3UYIA 2FVLA 3B8DA 5IBXC 2UY4A 5A6BD 1S2AA 4W88A 1HIZA 1BYAA 2QIWA 1J0KA 1RBOB 1HJUA 4WY0B 5ECVA 2XM1A 2QQ6A 3GO2A 5E9XA 4Z17A 5TQLA 1XQLA 4ICCX 3E02A 4MNKA 4N9DA 1I75A 1UBSA 3CZJA 1O1HA 1RD5A 4XUGA 4O28A 1MRQA 2HZGA 3HPAA 5HMEA 1Q6OA 1PHQA 2I14A 1NWUA 1BRLB 3QYSA 5I3DA 4QITA 1ZBCA 2WLYA 2VZUA 3PJWA 1KKRA 2UY3A 4DO4A 4R5EA 4NF7A 1IXPA 5LIWX 1H60A 5I7GA 3PG8A 4JXCA 3TW7A 1V0KA 3ERPA 1JRCA 3W7HA 1W91A 4QE5A 2VCAA 3BW4A 1L8NA 1IYXA 4FF7A 1ZFJA 3N4FA 3BK0A 3DG7A 4JBRA 3W6LA 4NL1A 5G2IA 3S5OA 1UH3A 3TFXA 3GU2A 3OIXA 4WCJA 3W1XA 4EKJA 5KEZA 3NQ6A 1PX8A 5U4NA 2RUSA 1YW1A 1ODUA 2YCIX 4PCPA 3N2XA 4P7OA 5F4WA 1ADSA 1CECA 5HXMA 1WBJA 4EWND 1R3YA 2D3LA 1P6BA 3THCA 4EVZA 1W9DM 3PZTA 5HNUA 4WSHA 2V82A 5G5IA 3FDKA 4MJMA 5I00A 1WOAA 2EBNA 3BLPX 3WQ6A 2CXGA 1NWTA 1Q6EA 1B3YA 3ZJKA 4U33A 2E25A 4C1NA 3IVTA 2EKGA 4IXXA 3PFMA 3UXLA 2P0IA 4LAUA 1XG4A 3P8JA 2WVVB 1YKWA 1W9XA 3K13A 4GQQA 3WF2A 4OBSA 1JQXA 4FXJA 1WZLA 1R2TA 3GIQA 1FFRA 1I1XA 1YE6A 3S5YA 3ZT5A 3UCQA 4K38A 1XBYA 5D9MA 4U10A 4JTHA 1WKDA 4MTVA 1Z8AA 3ITOA 1US2A 2PLCA 4LSBA 4W93A 1KM6A 1NFBA 4LNYA 1IEXA 1R3SA 3AIEA 1SYTA 3OGRA 4CN6A 4NP7A 5D9PA 3F1QA 4IMDA 1JUBA 4MNLA 1UH4A 3W71A 4ZGYA 1A4LA 4UQ9A 2YYUA 3FDGA 1CENA 2PDLA 1VJSA 2DZPA 3T05A 4W89A 1E4IA 4XTIA 2J7HA 4A8IA 1L2QA 2B4GA 2JKPA 2J25A 3NO1A 1SZRA 3K1GA 5E6YA 3WLOA 2PZNA 3G1YA 3UYCA 3SUSA 1QHPA 1UPMB 1PSCA 1ALDA 2GGEA 1UOKA 3BWWA 3IS4A 5FACA 4BQ3A 1JGIA 4TVCA 5A5WA 3RMJA 4XZIA 4D6HA 2VI0A 3CC1A 4GFIA 2O4MA 2J62A 1E6XM 4PUEA 3CWHA 2V0TA 4B4HA 1XYLA 5CC5A 3BZJA 4DLMA 1UA7A 2JIEA 1QBBA 4A8RA 1E6NA 4IIGA 5FIPA 2C18A 2QJNA 3I65A 2XVLA 1UWAA 2X0HA 1ZLPA 1Y5VA 2DQWA 4IQDA 4S3AA 2HNHA 2FJKA 1E5NA 3IANA 1B30A 2D0GA 3UJRA 1VYSX 1TJ1A 4AHOA 2CEQA 4NX0A 5GVJA 2J8GA 2Y8VA 2Y85A 2D20A 4CU6A 5H8UA 5BOEA 4A8LA 4WDXA 3LPOA 3AS3A 4H9UA 1RVKA 4N9CA 5C2CA 3U4AA 2DP3A 3AIQA 2J13A 2OEJA 4KGLA 3KE0A 4FOJA 3WLQA 3VABA 1Q65A 5CZTA 2FPYA 3TC7A 2HSAA 4IMAA 4LUJA 4N6FA 1EB3A 3G1XA 3IJLA 3N4EA 1PIIA 1V3LA 3VNMA 2NQLA 3S2CA 4ATWA 2VR2A 1LP6A 3EDFA 1M04A 3WQ4A 5I23A 4BF5A 1OFBA 2GQ8A 3WUFA 4QFUA 4P7RA 4TMCA 4NXKA 1XYFA 2BODX 2GL5A 4HHPA 4RZBA 4Q8WA 3GG8A 3ZIZA 3NTYA 1W2PA 4W5UA 2PTXA 1GOXA 3NQEA 2CYGA 3OLEA 1C29A 2W63A 3WQFA 1LL4A 1AZ2A 1T5AA 2NQZA 3ITLA 1K8CA 3BSGA 3RX3A 1TELA 4C6BA 2WSRA 1EBGA 2YSWA 1RZMA 4PCNA 4H2CA 3MTWA 4I9AA 4JNZA 4YCOA 4Q4KA 3L9CA 1M6JA 4BWLA 5D9OA 1EZWA 2HCVA 3SECA 1VFMA 1O6IA 2TPSA 1N8WA 5IFTA 1A5CA 1ZJHA 2HPIA 4HHHA 3MB9A 2R1LA 4CNTA 2ONEA 1BXCA 1Y8BA 5DO8A 3TN6A 4J3TA 3OU8A 4A29A 1FCBA 1YEYA 2WKLA 5BU9A 2ZE3A 4XV0A 3GDBA 4W4QA 2PDBA 3BV7A 3DC8A 3LZ3A 1SJDA 1CGWA 2XFRA 3HTWA 1VYPX 1VB9A 2X1SA 1KBLA 4XWUA 3AC0A 1GZ1A 2PTZA 4DWSB 1NAL1 4JIIX 3POHA 3KBSA 3VFCA 4PTDA 1VKFA 1TUXA 3HMCA 1FA2A 2WPBA 4AD1A 3T2OA 3QMSA 3RITA 3O0FA 4A2SA 4HZ6A 2YGYA 4MNJA 4UMBA 4DXVA 4GYPC 2Z0IA 1L6FA 3RLGA 1V0NA 4GUHA 1JD7A 4UQEA 4HHLA 4UNKA 1QNOA 1IEWA 1E56A 4KMQA 1B1YA 1BLIA 3HM7A 4RE2A 4O54A 5M5DA 2J6VA 2MANA 3ZJ7A 3SAZA 1CZ1A 2EJAA 1J2BA 2CPUA 3J7HA 4ERIA 4KEUA 3PZGA 2GPTA 3KBMA 4FS9A 5ABFB 3HF3A 4GJJA 4YVVA 3UWVA 5C9WA 2QCCA 4QLKA 2AKZA 2VGGA 5GNXA 4L65A 3KTXA 4QIUA 4BFAA 2E67A 1BSLA 3W02A 2J8TA 3EX4A 1OFRA 3AS1A 4D8AA 1AL7A 2J7EA 1RBLA 3LDVA 3E74A 3W1UA 1K9DA 1TB3A 4N2YA 1PTGA 4HPNA 1TWDA 3GDMA 1TMHA 2NLYA 1TVNA 3HPFA 4CNOA 3HGSA 2QUVA 1Z7AA 3W0KA 3TYEA 3GW0A 4LH8A 2R9RA 5KZEA 3LCLA 1NH6A 4RE0A 4ZMGA 1ZTVA 4AVNA 3LXCA 3TQ0A 2ZZ2A 1X7FA 3NQDA 2MUCA 2XDFA 2Z2BA 3VKCA 4UCGA 2OEKA 4LS2A 3E2QA 1PEZA 3TCEA 3LCWA 3LLDA 4FOUA 2ZRYA 3PPHA 3TYUA 4B92A 4F79A 1LRNA 3ZWTA 5JBEA 2KX9A 4RW3A 2FDSA 2Y70A 1W9VA 4UNLA 4PBEA 4IP4A 1XKJA 5H8PA 1OX5A 1B9ZA 1R38A 1EL3A 2Y8UA 4NYYA 2DZSA 3MKKA 3MVTA 1OF8A 3LPFA 3JZEA 2OLHA 3AAMA 1JULA 4O57A 4PZVA 1CI1A 3OQEA 1BWVA 3NQ8A 1LBMA 3STFA 3WBEA 3P7YA 4F3HA 4AWSA 5LXEA 1OY0A 3EMQA 2D2GA 7ENLA 5CLWA 5DX7A 2XINA 4PRWA 1MXGA 1BVZA 3TOPA 1AODA 2F8QA 3GVGA 4GZ7A 2QDEA 3WD2A 6ALDA 3BQ5A 1CGUA 3CJPA 2WSQA 3NPUA 2YDQA 1OFDA 1XR2A 1CWYA 1UZ1A 2C16A 3VD9A 4MDPA 3KRBA 3WEOA 1UIPA 2ZKMX 4EWJA 3M6DA 4GFSA 2FZDA 2BVDA 4I3GA 4IXHA 3CH0A 1YDOA 3S46A 2Z6JA 3O6YX 4P8UA 2EEXA 2WSKA 3F4DA 1JZ8A 4KT2A 3SCNA 1C7SA 4JTQA 1MZRA 1VEOA 4HA3A 5I6SA 4ZBCA 4EPEC 5I02A 1EXPA 4XX6A 5FJTA 3OZOA 3VE7A 4E38A 2NX9A 3E2SA 3RG6A 2PGFA 1GHRA 3WH7A 3W1TA 4O16A 1XW8A 5IDZA 2J7BA 3WQPA 2ZC8A 2FKPA 3RMEA 1RHCA 1MDLA 2YIHA 1W3IA 3OP2A 2QS8A 3EYPA 2E5BA 3E0FA 4HU0A 5EBUA 3W25A 3DAQA 2ZUSA 4ZFMA 2WYSA 2WC7A 2O9PA 4MYAA 4XSMA 1M7OA 3ES8A 4X61A 1Q7QA 3V5FA 7REQA 4JX4A 2Y89A 3BAYA 3CYJA 3ARPA 2WVTA 1RA0A 2WWDA 3AYSA 4HZ7A 4K36A 2QDHA 3N25A 2FFIA 3TQKA 3UR5A 2D2JA 4MUZA 4MIMA 4JTTA 4WJXA 5CXPA 4AVOA 4UOZA 1GJPA 3AHXA 5C8BB 4JIQA 3KL3A 1OFOA 2GK1A 1PV8A 3RGTA 4N02A 1SU5A 5JH2A 4JN6A 1Z9AA 4Z2HA 1X6LA 4JQ3A 3EWBX 2WNNA 2PWGA 3MW7A 1R6WA 5EKYA 4WEVX 2V68A 1OG6A 2JEPA 1ZUAX 2PF8A 4GD0A 3W84A 1UWIA 4CNUA 4HOXA 2EO7A 1AG1O 4MB4A 4GKLA 3H21A 1FWBC 3ALGA 4EPDC 1TV8A 5DBUA 2PZ0A 5LA2A 4KETA 1OK6A 3S83A 2VC9A 1B57A 3VNDA 1K4HA 3MVIA 3LEPA 5JUVA 2ON3A 3L2IA 4AC7C 1UKOA 4ZO6A 1OFAA 4QGCA 3IJQA 4MWAE 4JTGA 1HKJA 1XWYA 1QOQA 3N13A 2QCFA 1BGGA 2WJZA 1HL9A 3QHNA 1Z44A 2JQXA 4KWVA 1WDPA 3ICJA 1DIOA 1M53A 1V7YA 5FA5A 3ONCA 1UUQA 2AGTA 3T08A 1K03A 2NQ5A 1US0A 2GDQA 3P84A 3VOCA 2NV9A 5I3GA 3L4ZA 1M9HA 1QPRA 4NZ1A 2WSYA 1Q7MA 1CPUA 4LUSA 1TIMA 3WDIA 3RM4A 3P5YA 4V1YA 4KCWA 4WJ8A 3QZEA 3UGVA 3K1DA 3ZM8A 3KCOA 3BC9A 3TC3A 2G97A 1QI5A 3WD3A 1Q7ZA 1FWEC 2O7QA 1I6NA 1FDJA 2FB2A 3O3RA 1J5TA 1GQLA 4CN4A 1UD2A 1JCXA 1QJWA 3CQJA 3CYVA 4MB3A 5BNKA 2WNZA 4Q4OA 3WK0A 4HPXA 4ROPA 1J9YA 1IHIA 2VL4A 2E8YA 4ZOEA 2RGMA 2ZUVA 3AMGA 1BG9A 1I0BA 1S5WA 3QY7A 4FALA 2A7PA 3G1HA 3OJGA 1RCOB 2QCMA 4GJIA 3GXIA 3WH6A 1KTBA 1WXJA 4DRSA 4PMYA 1X1OA 1TZ9A 1KWGA 1XJBA 4B9ZA 4O50A 5AY7A 3CEPA 1KFEA 4P8WA 3FJ4A 2C1IA 1F5ZA 1J01A 3OVPA 4S3DA 4ORIA 3F2CA<