2QNEA

Crystal structure of putative methyltransferase (zp_00558420.1) from desulfitobacterium hafniense y51 at 2.30 a resolution
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
476
structure length
476
Chain Sequence
b'GLLPKYNILTEDQVQKIHENTMKILEEIGIEFEYEPALEVFRREGQKVEGKRVYLTREFVESKLKSAPAEFTLHARNPENNVVIGGDNIVFMPGYGAPFIYELDGSRRKTTLQDYENFAKLAGASKNMHLSGGTMAEPQDIPDGVRHLQMLYSSIKNSDKCFMGSAEGKERAEDSVEIAAILFGGKDVIKEKPVLVSLINSLTPLKYDERMLGALMAYAEAGQAVIIASLVMAGSTGPASLAGTLSLQNAEVLAGISLAQSINPGTPVIYGSTSALSDMRSGSLSIGSPECALFISASAQLARFYGVPSRSGGGLNDSKTVDAQAGYESMMTLMAANLTGVNFVLHTAGILQYFMAMSYEKFIMDDEIAGMLLHYMKGYTFDEDGMAFDVIEKVGPGGHFLTQKHTRKNHKREFYTPTLSDRSAYDTWAKEKLETKQRAHARWQQILANYVPPALDPEIDAKLQAFIAQRGKEVGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
molecule tags Transferase
source organism Desulfitobacterium hafniense
publication title Crystal structure of putative methyltransferase (ZP_00558420.1) from Desulfitobacterium hafniense Y51 at 2.30 A resolution
rcsb
total genus 167
structure length 476
sequence length 476
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.480 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 2qneA01
4YYCA 2QNEA
chains in the Genus database with same CATH superfamily
4JQ1A 3UWYA 3KZPA 3NZRA 3VKKA 2PDKA 1TA3A 3LBOA 4AMAA 1U2YA 5HAOA 4S39A 3G1YA 4R7OA 2G0WA 1QPOA 2V6AA 4N0RA 1KCLA 4PMRA 4A4AA 2WZMA 3F03K 2XWEA 4G9PA 4P8UA 4FLSA 1FWDC 1CTNA 4LYKA 2YCKX 1SMDA 2ZX9A 2VYOA 3RYSA 4W7UA 4JY9A 4O8AA 1K8ZA 4HVXA 1LUCB 1UCWA 3R5EA 4D72A 3PS7A 3EKZA 1HUVA 5FKYA 3GFYA 3IRDA 1XYMA 3WLKX 3LX9A 3G1AA 1D7FA 1XWYA 3MYPA 4URIA 2WMIB 1A5UA 1RH9A 5M2FX 2QUVA 1FRBA 1OGSA 3QYSA 1MXDA 3CQHA 1CXKA 1M7JA 1V02E 5HMSA 4ZOEA 2BY1A 4C91A 1KR1A 2XSAA 1VFTA 3W28A 4KFPA 2VCCA 2WCAA 4V27A 1QNRA 4UR8A 3OO2A 2JKEA 3UGRA 1GVYA 3RLUA 2XIQA 3TYBA 4H9TA 1RUSA 2Z1WA 4D8AA 4JTKA 1LOQA 3KVMA 1OFQA 2XIMA 3OYXA 3F4WA 3WCZA 1G67A 2DQWA 4GQBA 3NAVA 4ZZ9A 1B5TA 2FJKA 3M0VA 3USBA 4QS6A 1V08A 5GQBA 3OG3A 3RCMA 3VIOA 5KSWA 5F4SA 1KWKA 1ISWA 5EL1A 2YA2A 5M17A 3CNYA 3C2VA 3QQWA 1WAWA 4E38A 2PTXA 1UROA 1WUEA 1RQEA 3FCPA 3VM7A 4XZIA 1W3LA 3TTYA 3TN6A 2AMXA 2HZGA 3MB9A 1JZ5A 5A8PA 2QDEA 2D3LA 4PC8A 4YU1A 5CQ1A 1VEMA 4DLMA 3PZUA 1EUAA 3UVAA 1JDEA 4PUWA 4FNTA 1JYNA 3HZ3A 3LCIA 1E6XM 3WDHA 3WLRA 4OT7A 2D20A 2G5WA 3PTMA 2C13A 3ITYA 1J4EA 3HURA 3S5ZA 1CLXA 1PIFA 4KKXA 4GUHA 4EACA 1NP0A 4YLWA 5AFDA 2XZ7A 4QDMA 1TTPA 4AQLA 4X2RA 4PFHA 5C9XA 3PBWA 1F4AA 3IUIA 4MPQA 4WOQA 3IJ9A 3LXAA 3RCNA 5CZKA 3GW3A 3W7LA 1F3EA 2W67A 5C9ZA 3K8LA 2ATSA 1KBKA 5F1VA 4Z2JA 5DN1A 4UTWC 2PI6A 4JTLA 4GI8A 3SFKA 2H9AB 2D22A 1LT7A 4GK8A 1D7KA 2F2HA 1VBUA 5HJYA 2XUCA 1ZB5A 3OIHA 2Y62A 1AL8A 4HT3A 1EA0A 1ZBWA 5IM51 2X0HA 3HN3A 1JG9A 1ZJBA 4AG0A 1US2A 4KCWA 3SUSA 1LQ2A 4QP0A 3NO1A 5D9NA 5RUBA 3H4XA 1TPFA 4YPJA 1N82A 4O54A 4H8HA 3EPNA 4RE3A 3QW4B 3PZ9A 1Q6CA 1XYFA 2X8RA 4N9DA 4I6KA 3RJXA 5M3WA 3LXCA 3C52A 1UKQA 3CZEA 1HXJA 3IIOA 5IXEA 4YTTA 3EB2A 1S1RA 1F76A 3QN3A 2XGIA 1UASA 3ZVHA 4AEOA 1A0CA 1JAKA 3WFZA 1REQB 4LC6A 3TQPA 1XLAA 2WYSA 3GAYA 3DFHA 4QLKA 3V18A 3N13A 4H7CA 3DENA 1GQNA 3BK0A 3NQGA 5REQA 2WB5A 1QPQA 4JCMA 3DERA 1V93A 1UP0A 5HMDA 3AAMA 5CPSA 1EXPA 3PBYA 3UBPC 3KBJA 3M46A 1DIOA 4I3GA 4XZNX 5E93A 4AWUA 1AH0A 2VOTA 1E9IA 2QDGA 4RNJA 1K7XA 3VCRA 1JDCA 3LQLA 3QY8A 2MANA 3B0VC 4AVOA 2QVHA 2C71A 2VHLA 4O1AA 3GRIA 1ZUAX 1E4NA 4D9PA 5K9CA 3GKAA 4ZOBA 4GZIA 1J9YA 2VENA 2YW3A 1C9DA 3MSRA 1UD4A 1RZMA 3GTIA 2NV9A 4TMCA 4GISA 4GXPA 4QISA 2BLEA 1XBXA 3HTWA 1JGIA 4NIRA 1LL4A 1S3TC 4GE8A 3THDA 7PTDA 4A05A 1ODZA 4AZIA 3H24A 3DFPA 3E2SA 3N2MA 4L4MA 1ADDA 3I3BA 2DEPA 4UFIA 3SCTA 4EXBA 4JYFA 1QTWA 3V36A 1LT8A 4XBSA 1VKFA 2JK2A 2QCMA 3CHDA 4HSOA 3V5CA 2JALA 1A3HA 5M03A 3DUGA 2J66A 5EKYA 3KRBA 4QCEA 1HJQA 5CLWA 1BLIA 2J13A 1HKKA 4Y9MA 5FEPA 3AYVA 5I02A 3C6CA 3A9IA 1CXHA 3H7UA 2BBFA 4KFNA 2PCEA 3IIZA 4FO4A 3ITXA 3BSMA 3FY1A 3I10A 4HPJA 4US5D 3AROA 2A6LA 1F9CA 2PGEA 3Q67A 4IPJA 4AFYA 4JXCA 1LOSA 3VFCA 2ZZ3A 4NX0A 1EP2A 5IHRA 1Q65A 4ZO9A 3KDOA 4EF9A 1XYCA 5HWMA 3C86A 1OT1A 3B0YA 2I5IA 3CUZA 3R89A 3SY1A 4B5SA 4M56A 3MJMA 1E72M 1SMAA 1GQKA 4HNLA 1UW9A 4G5DA 1G7UA 1EO5A 3KXQA 1AMYA 2O7QA 4FNQA 5HPCA 3SCWA 1GG1A 1ZHAA 1XISA 1W5NA 1ZP4A 3G1DA 3TTQA 3L4XA 1GOOA 1PE1A 3BGAA 4OV4A 1JIBA 3QV8A 3LI1A 2X09A 2Q8XA 4PRRA 3PWIA 3CQKA 3B0UX 1OFDA 3C2OA 4GIYA 4JEJA 4OJYA 3GU2A 2A5HA 2W62A 1THFD 3EWCA 2XH0A 1KW1A 1Z48A 1OC5A 4ADSA 1UB3A 3CWHA 1XPGA 3ARUA 4PEEA 1SU5A 3CHCA 1QBBA 4HN8A 4GVFA 4WY0F 1J0IA 1LL6A 2PD9A 3HPZA 2VVNA 1J0KA 1W9PA 2CLOA 3KCJA 2XIBA 4K8HA 1U5VA 3KW3A 5EA9A 4H9VA 3SQSA 5LNUA 3W7IA 1KFEA 1PWLA 3G5EA 4IQEA 4Z08A 4Z1CA 2FHFA 3G3DA 5FACA 1XFCA 1H7NA 4EPEC 4OBTA 1BQCA 3BMXA 1AD4A 4WGHA 2EAWA 4UZSA 3EWWA 3G0UA 3CHEA 4ZODA 4AHQA 4K1WA 3LV6A 3C8NA 3KTSA 2HISA 3VKBA 3NPXA 5D2WA 3ITCA 3R43A 2VL4A 5U7SA 2X1SA 4QG8A 3IIPA 3VABA 1GW1A 4LS1A 2Y7FA 5E9AA 2VX5A 5C55A 3NQAA 3TU9A 3B97A 2NX3A 5L9FA 3OIXA 3ARYA 3MI3A 4QQ3A 5EBUA 4H2HA 4O17A 4Z2LA 4EPBC 1RLCL 1E6NA 3FN9A 1AZ1A 1AVAA 4P8WA 3RR1A 3AUOA 1UD2A 3T7VA 3S5OA 4UC5A 2A3AA 1B3ZA 4CEXC 2QJGA 5B7YA 2CLLA 3VZXA 3B04A 1VYRA 1YLVA 5TNVA 5HDRA 2DVUA 4TO8A 2ATMA 1VCGA 3CV6A 3ZJ8A 2PTZA 2W4XA 3I68A 5BOEA 4C6MA 1P5BA 3HFTA 4RCXA 3BSGA 2NZLA 3C5QA 3G1RA 4RK8A 2P3ZA 5AYBA 2Y6ZA 2C1GA 3T0BA 4O16A 6ALDA 4QSFA 1CIUA 4PTWA 4LUSA 2AGKA 2RGLA 3N9SA 1ZSXA 3HF3A 1OM0A 4BS0A 2DSWA 1RBAA 1XH1A 1PX3A 4WX2A 3WLIA 2FPYA 3THAA 2XGBA 2ZVIA 4W9TA 3WH5A 3K5XA 5KETA 3MBFA 4A29A 4ZSTA 3FXGA 2WNNA 3P14A 5HOSA 1Q6GA 2QAPA 4AVFA 3AU6A 1XYLA 4Q4RA 2O4QA 3N11A 2R24A 1EL3A 4JDYA 1EX1A 4WKAA 2C1IA 1EJ7L 5EMKA 3WIJA 1S2AA 3IEBA 3QHMA 3T9PA 4WJXA 1Q8AA 3EPOA 3FGCA 4MYXA 4RXGA 3ZLHA 4Z1BA 2ON3A 3BGJA 4JCLA 2H9AA 3S3GA 4NZJA 4MY8A 2CZDA 1XCXA 1PIIA 3P84A 1HL8A 3H54A 2OSYA 4K8GA 3NL2A 3AI0A 5HMFA 4M1RA 3ARQA 1OSEA 3TSDA 3E49A 1WXZA 4PMXA 5FJRA 3UY7A 2XFWA 3UCQA 2Z0IA 1JUKA 1HZYA 5I0DA 4X63A 2IPWA 4UOQA 2OGYA 2GPTA 3QHNA 3G24A 2F7FA 4C6DA 3R8HA 1KWGA 2EPNA 4MY1A 3DFTA 1VLWA 4C6JA 1XCWA 3T2QA 1BG9A 4L5ZA 1AJZA 2JBMA 3C0JA 1PB0A 1FQ0A 3DN5A 5G5IA 4RE4A 1R3YA 3BLIA 3MUIA 3RXZA 3C0SA 1XS2A 1SSGA 1AQMA 3TQVA 3L2MA 3TUUA 3FYOA 3MBDA 1JCJA 3GR7A 3FEQA 3LMZA 3LGGA 4YTRA 1KM0A 2CZEA 3VIMA 5ABEA 2VRJA 3LRKA 1TRIA 2V9DA 2QF7A 4LAZA 1ISZA 2Q09A 2GGHA 3LDVA 3E0FA 1JF5A 2PGWA 5D9OA 3CB3A 4NNBA 3SCSA 2FPVA 1KNWA 2YXOA 1YDNA 4F9DA 2B7OA 1XC6A 1SW7A 5A6MA 2J25A 3GSMA 2KZHA 1QI4A 3TC6A 4JKLA 1LQAA 4QXIA 4IH3A 4PTVA 3WENA 5AVHA 1FWWA 4GPNA 2NLIA 4HK5A 1P0EA 5CBIA 3C3NA 1W3TA 4O12A 3RN6A 1XW8A 2FFCA 1L0PA 3OA5A 4BF5A 1YX1A 3M0KA 2VR5A 4J40A 4JTIA 4H7ZA 5AHIA 3RM4A 1EP1A 1TZ9A 4RL3A 1C8VA 3GS6A 3EYPA 1XM3A 4RW3A 4C65A 3N2OA 5A2CA 1E6SM 4IGMA 1F6KA 1DQXA 3GC5A 3W84A 2GDQA 3BCFA 1R7AA 5M1TA 4Z2KA 3CQ0A 4IFKB 4UQEA 1QK2A 3VDBA 2WMKA 3NDOA 1DKWA 5FCZA 2ISDA 4ICCX 4M6VA 3GG8A 2GUUA 2CU0A 1XJBA 3QVQA 2CBJA 2UY3A 1HT6A 4UTHA 5JBFA 5FD0A 2BHUA 3DHDA 3TJLA 5AYIA 3BTNA 2J77A 4ORMA 1ECQA 3KTXA 3W6MA 4BK9A 1PKYA 1XH2A 1UWUA 1XLEA 3MUY1 3L5AA 2FMOA 5DMYA 4GYPC 1E6RA 4LH8A 3F2DA 4KGLA 5GPRA 1AJ0A 1TV3A 6XIMA 2WK2A 3I3DA 2KX9A 1IGSA 2D3NA 3T78A 4S23A 1FWJC 3JZUA 1M3UA 3OU8A 5EMLA 4NRRA 1D9EA 1RQHA 1B3YA 5LGXA 1A0EA 2H3BA 1Q8JA 3F5LA 2O9PA 1H60A 3P61A 5I3FA 1I75A 3STFA 3CV1A 1SO4A 3CZLA 1BPLB 2D1ZA 3UJ2A 2VDIA 1BGGA 3GVWA 3WQ6A 1HP5A 3MP3A 2DZTA 4LRTA 1Q66A 4GQRA 1EWDA 2PLCA 1P0DA 2VOMA 4DYKA 1NWTA 4DIAA 1PDYA 2F38A 1L6GA 1FOBA 1JXKA 1Z41A 2C79A 3IIXA 3IUDA 4A3HA 3G18A 3P81A 1GHRA 3WLNA 4B2DA 5JU6A 2FZMA 4NJKA 3UJSA 2E09A 1E15A 3ZMRA 4GFIA 3MCNA 1EBHA 3BL3A 1EFZA 5D8ZA 4GHRA 3SUWA 3A4WA 2BB0A 1MXGA 1TSIA 4CD7A 1C8XA 3NZQA 1TPC1 4ERIA 3LPOA 4S2BA 1WP6A 4DXVA 4XKYA 1F73A 5LA0A 2OMAA 3AMGA 1BVWA 1PWMA 3HV8A 2TPSA 3MV01 4HJWA 3K1DA 3BOFA 4G1NA 3GFZA 2IKGA 4JX4A 7TAAA 1HQTA 2Y8KA 3ZWTA 3KOZA 1KC7A 4AZCB 4GZJA 3PPGA 3TA6A 3CZGA 1I9CB 3PTQA 1JDDA 1MEHA 3MUCA 1YE4A 1DJYA 3GUGA 2NQJA 2F84A 1QXLA 3GAKA 3NPUA 1QUMA 7ENLA 2GUBA 1KXQA 2HTMA 2VRQA 2QEZA 3L4ZA 4NSBA 3ERPA 2R1LA 4WKHA 2Z25A 1W1IE 3UXAA 3DC0A 4REQB 3D3AA 2A7PA 1BKSA 2WJZA 4PB4A 3APGA 4B5XA 4S3KA 1P0KA 3CWNA 2CBVA 4BR1A 3CYJA 3RPMA 4CD8A 4LYPA 4HCDA 4QEHA 4IXHA 1KFCA 3KWSA 3RF9A 1CX9A 3LLDA 3DBPA 1TJPA 3EMZA 5AY7A 2X7VA 1DIDA 3P6LA 4E4FA 2VX7A 3UFYA 5CBBA 3TW9A 1K3UA 3GD6A 3OA3A 3MO7A 4W85A 3WNLA 4QG9A 2ZE3A 3VKAA 1A50A 4XUYA 1AA1B 1VRXA 3PTKA 2IKHA 3VZZA 3RU6A 4E0CA 5EFDA 3NDZA 4A8IA 3GH4A 4GNVA 2CBIA 4KFOA 2Y0FA 2GJNA 3VIFA 4GQ0A 3UNTA 5C71A 1RJPA 1QWGA 4HYVA 1UH3A 2PDLA 4ZFCA 3AIUA 4DF1A 2QJJA 3GG0A 2BV9A 4DWSD 3ZSTA 1TKKA 3NTYA 3TP4A 2WHMA 3CH0A 1VCVA 1PV8A 1SFLA 2AKMA 1EO7A 3WBEA 4QGCA 3OEXA 5KZMA 4N42A 2E40A 1M9HA 1EDGA 3QFWA 5AOUA 1V6UA 4WGXA 3W1MA 1GPWA 1KTBA 4LF2A 1VBGA 1S2CA 1TWIA 3TSBA 3N6QA 5JH2A 4FALA 4QHRA 2DZPA 1TG7A 3NOEA 5FJUA 3EWZA 2WKLA 3G1SA 5AC7A 1Q63A 2DJLA 2WBKA 1XD0A 2OQHA 1AFSA 2RHGA 4GCAA 2DZXA 2Y4SA 2XINA 3GNDA 4J3XA 4CQAA 3S6DA 4J3ZA 6XIAA 1GYNA 1HO1A 2ZVRA 3BG3A 3WBAA 2D2JA 2ANUA 3G0SA 1FHVA 2NXIA 1VYSX 5A3HA 4L9ZA 1U83A 3GTFA 2CEQA 2C1HA 2BXYA 4XD6A 6REQA 5A95A 3QH2A 4MNJA 1KRAC 2PP0A 1LCOA 4I7WA 1PZ0A 3W02A 3TLQA 4V2XA 5J5RA 4AUBA 1UUQA 3HBLA 3CZ8A 1XLHA 1M7XA 3DG6A 3EX6A 3O06A 4UTKA 3XIMA 1J0HA 1GHSA 3N73A 3AJXA 4F4RA 4AYGA 3VNKA 4LUYA 1J2WA 1GGOA 3SR7A 4ATWA 5E0KA 1DE5A 4IX2A 1UC4A 1W3KA 2BOEX 1O60A 2C6QA 1YDYA 1MDLA 2PTDA 4UNIA 3CO4A 1A5CA 1M7OA 3SCVA 1UP3A 1W37A 2GVJA 5C7HA 3H12A 1QW9A 2BSLA 1E3ZA 5AECA 2Q01A 2HMCA 2O55A 1ZY9A 3VD3A 2XZ9A 3R0DA 4HJFA 1QI0A 1JD7A 4G6CA 1K4GA 3EWUA 4J9JA 1K4HA 1FDJA 2XVLA 5BYWA 4IUGA 3VD9A 3FVMA 3WMCA 3QGAC 1AW5A 4G7EB 2EG6A 1IWPA 4LVDA 3EX3A 4JIHA 3GHSA 4JNZA 4AIOA 5CC3A 1M65A 5GJPA 4FF7A 5LIXX 2NV2A 2QDDA 3W7KA 4IQLA 3MJYA 5AC4A 1TCDA 3VINA 3VNDA 4BFAA 1GKPA 1HGWA 3WJXA 1P1XA 2WM0A 1DXEA 2GOUA 2A6NA 4NASA 1ITUA 3UVIA 2OO6A 1TE6A 1C3FA 2JF6A 3D47A 3KDNA 5I06A 2RH9A 2CETA 1IZJA 5CZSA 1OD8A 3EAUA 4IOTA 4F79A 5HUPA 3CZKA 1MSSA 2ZA1A 4NJJA 5REQB 3HMCA 4CN4A 1BWVA 1GQLA 4GX9A 4YTQA 2ICSA 3U0HA 3MUXA 2AQOA 4AZ5A 3WNOA 5HINA 2DT2A 1MZRA 3W01A 1VHNA 5I03A 3N2TA 3TYZA 2J9YA 3H23A 3IANA 1G5AA 2QCGA 2J7GA 4JTFA 1QNVA 1O5QA 5G2WA 2X7WA 2DIKA 1ZJAA 3C8FA 5FEWA 4GO8A 3MVTA 4RDVA 4DJDD 5E9XA 2DP3A 3CMFA 4YMZA 3KEHA 3ICJA 3GYEA 4EE9A 3KHJA 5BRPA 3VDGA 4GO9A 1UBPC 3PP7A 2CHRA 3OYZA 4LNCA 2VZSA 4XKYB 1DWFM 4MNKA 3W27A 4H8NA 1Q6FA 1M68A 1ICQA 1E55A 4RW5A 1GW9A 3NZ1A 4K3ZA 5C54A 3DAQA 4OKDA 3M9YA 2CBUA 3RCYA 2YL8A 1T99A 3FJ4A 4IP5A 4OFCA 1W2VA 4ZB0A 3S9YA 3S1UA 3VOHA 4B9ZA 1LM1A 1V3LA 5JH1A 1OFEA 1YPIA 3B9OA 1H0IA 3M7WA 4NJHA 3VD7A 3WL0A 2RDXA 1EB3A 2FVMA 4IG2A 2WNZA 3E74A 3U3HA 5LXEA 3USZA 4AIBA 1DXIA 5I07A 3W74A 3B8VA 2PUZA 3QXBA 4W93A 3A64A 2QIIA 3C2EA 1DHPA 3FIGA 3FX4A 4FOKA 1DWJM 3RPTA 5CJMA 3I4KA 1O1HA 1RK6A 1PTAA 3IJLA 5KZEA 4LVGA 5F4XA 4WDUA 1XQLA 1EC9A 2NUYA 3EA3A 1D2KA 4C6KA 3XINA 2W0UA 3T07A 4JHZA 2D24A 2O0TA 5LSMA 4OUEA 4JKKA 3T44A 2W61A 4PGLA 1EGZA 3E5PA 1YQ2A 1GVRA 5F2LA 3R94A 1BYAA 2KAUC 4GACA 3FHAA 5EMYA 4LY8A 4RXFA 4CU8A 2XVNA 1OX4A 1H62A 1L6FA 4YL2A 2QZRA 2A1YA 4IGHA 1HFBA 4F2TA 5T8GA 3ALGA 1R2RA 4D2JA 2JKPA 3WY1A 4NYYA 2VEKA 3S4TA 3OW1A 4BHYA 3W73A 4YNGA 2VGFA 3SUTA 2OZ3A 1LBMA 3MSGA 3R79A 4G8TA 3N2BA 3AHVA 2NSOA 3V0SA 3IGXA 1J11A 2DJXA 2G96A 2D69A 3AS1A 1QNPA 2EPLX 1Z32X 2OEMA 3ABRA 2J7HA 4S38A 1H7PA 3GZ3A 3W7CA 4FLOA 4PULA 4QLLA 3RLGA 3CAKA 4L80A 8A3HA 3FSTA 4QDWA 3WFLA 4JQAA 4V33A 2XN0A 4NF7A 2YDRA 5G2HA 5GNZA 4UQAA 3NL3A 1U33A 3OG2A 4P7LA 1SYTA 5C6MA 2TAAA 3UXDA 3W1PA 3EB4A 3C3UA 3IIVA 3W86A 4C5ZA 1Y5WA 2OKOA 3AS0A 4JIRA 3NSMA 4I5RA 4IJCA 1FX6A 2CHOA 4MB3A 3GR4A 2CERA 3SSZA 2ZA2A 2V3DA 2A3BA 2YB1A 4RZBA 4FI4A 1ONEA 2WV8A 3PBUA 4FPSA 4MMWA 3CV2A 2A79A 4GYJA 3UEQA 3WK2A 3VOJA 4HD5A 1E0TA 3T4CA 4WY0A 1H1NA 5FA5A 4JN6A 4FLQA 2BVYA 3ZVIA 2ZFAA 2MUCA 1BXCA 2CZ5A 1JGMA 4LAMA 3AHXA 3DC8A 1UG6A 1E1FA 5LNWA 1A47A 3SJ3A 3V7PA 2G3MA 3UW6A 3OVQA 1L6WA 4ALDA 4UWMA 3TKFA 3UG5A 1E51A 2Y7EA 3GO2A 2YX0A 1A3WA 4F0RA 1JFHA 1WYIA 1YBQA 1B90A 1JDFA 1G94A 3P67A 1XSKA 4HA1A 2VJXA 3T8QA 3MT1A 1J0JA 2NX1A 3DI1A 3KBNA 4LAUA 4Q7BA 1RBOB 5BOOA 4C6OA 2VCBA 4RDWA 5TAOA 4PCPA 1G1YA 5KITA 2P8BA 3NG3A 1JL8A 4JX5A 1SZGA 3UXLA 1KQYA 4W4QA 3LG3A 4A8NA 2AAAA 4HZMA 4Y8FA 1VJSA 3M16A 2B81A 4MUZA 1FKWA 1WZAA 1W9DM 3WEMA 3CASA 8RUCA 1JZ6A 1W3NA 2PWUA 4DUWA 1GONA 2ZUSA 4C6PA 1E4MM 3MPGA 4PCTA 3MQTA 3KBVA 3UT0A 1IV8A 1UWSA 3DHPA 3GZAA 3AIVA 4ZO8A 3PPHA 3W2MA 1XSIA 3NO3A 5LNVA 3PZMA 3I6RA 3GC4A 2X1TA 1JD9A 5AKQA 3ZOAA 1D8WA 1X97A 5BRBA 2PGFA 1NAL1 4ZMGA 3WSUA 2D2GA 1UWTA 1EHAA 4HU3A 4IP4A 4I9MA 3EA1A 3TIMA 4PEKA 1EDTA 1Q7QA 4H04A 2FB2A 4AH7A 1RP9A 3RM9A 2DT0A 2E68A 2G8ZA 2X0YA 1GVQA 5A6JA 1WA3A 1UQYA 4HOWA 3TK7A 1KLZA 3JS3A 3M7SA 1F7BA 2HK0A 3BLKA 3UWEA 1KD0A 4DJFA 1TTIA 4C1NA 3VNYA 1AODA 3SCPA 1UOKA 4E5TA 4PCSA 4LB4A 4DLFA 3TWBA 2ZCGA 2J6XA 4Q6JA 1J18A 1TA3B 3NQEA 1XLIA 3DYPA 4N6FA 5A8NA 2W66A 1SM9A 2XU2A 1W9XA 4JIEA 4BWLA 4ERGA 1PDZA 4MG4A 4DO5A 4WIWA 1UMYA 1PVNA 2NVDA 1B0IA 3PVFA 2VEMA 4E2DA 3CIWA 1UQZA 4AD5A 1QPKA 3THQA 3VCNA 1DWAM 1GOKA 1EIBA 1GVSA 4Q4SA 2YPIA 3V16A 4DQWA 1W1B1 2DH2A 1V77A 1WUFA 4ZB2A 1V3MA 4HA4A 3E0WA 4QRNA 4UOZA 2QV5A 3W2LA 1UD6A 3F4NA 1E6PA 1BRLA 1XGDA 5HJXA 3S2CA 2BGNE 5K7JA 3S1WA 2Y8VA 3GXDA 4O1EA 3UR5A 2WO5A 4AEEA 4UTTA 1P43A 4NZFA 3O07A 5BNKA 2BX7A 2WVVA 3VGEA 3GIQA 1H5VA 3R8RA 4QCFA 3U48A 4EKJA 3KE0A 4YXGA 2A3EA 3OQ8A 1UZDA 1OGGA 2QCEA 4AD0A 3OTRA 3EXSA 1SZEA 4CKQA 1C7SA 3NEHA 1ZBVA 1NOFA 1VIZA 2OWWA 3AS2A 3T6CA 5AZ0A 3CIVA 5I79A 4W5ZA 2XN1A 4X3ZA 5FJOA 3W4RA 3R4IA 4I8DA 4PTXA 1DXFA 4AF0B 4TV5A 3A23A 5K9XA 2RJHA 2QGYA 3OZMA 4NKCA 2Z1XA 3HB9A 1LF1A 3SDOA 1IZKA 3NQBA 1V3JA 3C2YA 3KBSA 1QBAA 2HK1A 1DYSA 3OLIA 1V0LA 3BG9A 3JU2A 3GBDA 3URBA 3LBMA 4AZ7A 3VGFA 3KLKA 3N9KA 2FTPA 5GJMA 4S3EA 2JGQA 1L8PA 2PDIA 1GQIA 4DBSA 2XPKA 2PDBA 2R91A 3U4FA 4TVUA 4C6LA 1BHGA 3GDMA 1JJKA 3EGJA 1JPHA 1FCUA 3W38A 3ORWA 3COTA 1GUVA 2VMFA 3LHUA 4H7VA 4UIOA 2J27A 2PWGA 4MDPA 3VE9A 1ALDA 1HNYA 3VFLA 3BO9A 3VNLA 1JVNA 4LVAA 4DF0A 3SN4A 2WAGA 2E6YA 4B4HA 4O1CA 1A4LA 1XDMA 2ZE0A 2J7DA 3TC3A 4ERAA 3S5SA 4AF0A 4XG1A 1Z69A 1B3WA 3O05A 2Y2WA 1C8YA 1TV7A 2PLJA 4TXEA 3IGHX 3NQDA 1W5OA 4NJIA 3O3RA 5IDIA 5C5YA 4DPPA 1MUMA 3K8KA 4HZ7A 4YWIA 3WEZA 2UZ9A 5BWFA 3HPFA 3QZ6A 3SCRA 4ILSA 3F7JA 3ITVA 4IIHA 2PDUA 5HK4A 5HNUA 3EPMA 2E6AA 1UKPA 1W9VA 4XVDA 4QM1A 1WX0A 2HSAA 1AQ0A 2FZDA 4IG2B 4O28A 2G3JA 3CH9A 3W83A 1JQVA 1LL7A 2DSZA 1NOUA 3DX5A 5T9CE 3SIZA 5LHFA 3SBFA 4GKTA 3BLDA 4GUFA 2DU2A 4OWGA 3OLDA 4GY7A 1HL9A 2X1RA 2PP3A 3WQDA 4DZAA 5HWJA 4MNMA 3LCWA 4EP8C 3S0CA 1CXFA 4KW2A 2WLZA 1RJRA 4JOMA 1SO5A 1L9WA 3R11A 1A5NC 4PRTA 1KV8A 4IT1A 1G6CA 4TQTA 3LSBA 2CXEA 3W81A 3ZR6A 4Q7NA 4NXSA 2ZX8A 1IEQA 4FXRA 5A6LA 3V0UA 3ZSSA 1G01A 4CNOA 4DJDC 1OYAA 5JBDA 3WH7A 2GK1B 3IK2A 1KFKA 1PCWA 1ZBKA 2YDAA 4IXXA 3UETA 3B4UA 3SZ8A 3W2NA 2VVSA 4JNYA 2Q71A 4O8RA 1RD6A 3W72A 4BF9A 1V3HA 3VILA 1V0MA 4RPPA 3SCNA 2AQWA 2VRKA 5K9DA 2ZA3A 5H8UA 1NVMA 3WN6A 3LY0A 1UWIA 3ALFA 3VNJA 4FP1A 1LROA 3N3MA 4L1WA 3WF0A 1A5BA 4EAMA 3PAOA 3W1AA 2QJIA 2DW7A 2VFHA 2R8WA 2OQLA 1JFXA 2ONEA 5HR7A 3UWUA 1QU4A 2DIEA 4PUEA 1SPQA 3VOCA 1QI2A 2EXOA 1JCXA 3VGHA 1P6BA 2W27A 2H90A 5FAJA 3GVQA 3PC0A 1J01A 2WQPA 1X8FA 4Y9NA 1OIFA 3E9AA 1H41A 4PN2A 4J5NA 3TC7A 3C61A 1XGZA 4UFHA 5L6UA 1W1VA 1J2BA 2YDSA 5ABFB 1UC5A 1OY0A 5E5CA 4XZLX 3OOQA 3P5ZA 3TYUA 1XX1A 1FCQA 3RGTA 3T0AA 4S3GA 3H2MA 4R27A 2A4AA 3KBWA 4CQ9A 2WQDA 4NAEB 3KWXA 3FEMA 4UOJA 1EYEA 3QQ0A 4YTUA 3G1FA 3GXMA 1MQQA 1V7YA 3EEZA 1UP2A 2W9MA 3SRKA 3MKCA 1RSCA 4N4QA 4H19A 3MMUA 3HG5A 1W5QA 3APYA 3VDHA 1TQXA 1CGTA 2O7SA 3RUBL 1VEOA 5G2IA 1K6AA 2BASA 4Q4QA 4IMCA 1YNPA 3LOTA 4MAVA 3ITLA 2HS8A 4G7EA 4HYRA 1YXYA 1ZAHA 3GXPA 4GC4A 3ELFA 2PD5A 4MWAE 1OIMA 4H9XA 4QIUA 3KCLA 2XJ7A 3QC3A 4HU4A 4YVPA 1RCXB 2YCIX 4EPDC 7A3HA 4ECLA 4I9AA 3HG2A 3M41A 3GM8A 1ONXA 5DXXA 1EC7A 3E2RA 2ODOA 1R85A 3UWQA 1EGMA 1L2QA 3O0KA 4O10A 5TIMA 4MB5A 5EGRA 4XZMX 3N6HA 1DTUA 2EO7A 5KZDA 1OCBA 3EKGA 3B9EA 1Q2RA 1TJRA 4MKVA 1BXNA 1S38A 3IVSA 1ZNNA 2CLHA 1ZQ5A 2ZIDA 4NJGA 3WNNA 1VFUA 2ZDSA 3C2RA 3W29A 2WSRA 3NVTA 4WDWA 4LYQA 3VDCA 5F2GA 3D6NA 2XHYA 2ZZ5A 3OQEA 4C6BA 1WZLA 1CLVA 4QJ3B 1FTXA 3B03A 2CCRA 4GVHA 2OPJA 3LZ5A 3B0PA 4GVIA 5FJIA 4IP7A 3URQA 2ZOXA 4JIPA 3H7RA 4LNYA 4ZGYA 2VC6A 4F66A 1OC7A 3NR0A 3SRFA 1PKNA 1GWJA 3P93A 1FFQA 1IR1A 3GDTA 4UFMA 1JYWA 3C0LA 3VIGA 3CTTA 4PUKA 4B5VA 1C7TA 2OO0A 1IEVA 3CZJA 2ZTKA 4JTDA 1NQ6A 4ZE5A 3DGRA 4LQ1A 5CLTA 5CXPA 5DRCA 1O12A 4GYFA 4YYCA 2NVAA 3GHTA 2ASHA 3KHDA 1QHZA 1ZGDA 1KRCC 2TMDA 2EEXA 4ZTYA 1DVJA 3K4WA 1RVKA 4HK7A 3VNIA 2JFEX 5E70A 4OGZA 3JR2A 1QNQA 2YLLA 3DCPA 1UD5A 2XVGA 1VBHA 4LUIA 4O1BA 5D2YA 2QMJA 1IIGA 4QSHA 3OB8A 1UA7A 2HE8A 3POCA 4U4MA 3RM8A 3WH9A 3O7UA 3NZPA 1RCOB 1M04A 1NDYA 3S47A 2R82A 5JVLA 1M6JA 1A5MC 4KWSA 4DM2A 2YW4A 4EIVA 2DFAA 2QDHA 2XH2A 4DO4A 3PY2A 2OEKA 4OBSA 4EWND 4PCFA 1Z7AA 1T8XA 3SECA 1UUMA 3GU1A 1NF0A 4NZ3A 3CL8A 1DV7A 2R1MA 3GUWA 4NX5A 4P7NA 2V3GA 1I4NA 1C93A 3BOLA 1W3HA 2YCJA 3AXHA 3BAKA 5HANA 2A21A 3VGGA 4JICA 1XBZA 3EX2A 1PTGA 4DX3A 4AAJA 4D6GA 1S5NA 1JCTA 3TXVA 3LSCA 1YPFA 1WV2A 1L6SA 1X98A 3RRAA 2C8NA 1EWEA 3APTA 2XVPA 3QZAA 2HCVA 2X16A 2ZTJA 3QV7A 4NILA 3WYZA 4XD5A 1C8QA 2DT1A 3WQCA 1JPMA 1W2PA 5CG7A 3QBUA 4UQCA 3ITOA 4KEUA 3VX0A 1KFWA 1YE6A 4WJEA 5KZ6A 2O56A 2OLHA 1VBJA 4NL1A 3AXKA 3MSDA 1A53A 3U2EA 4OV9A 3DHFA 8XIMA 1T7LA 3LTYA 4EK7A 1QJWA 1RA5A 2IW0A 4L7ZA 2ZZ7A 1TWDA 4GJJA 3VO0A 3B8TA 2DORA 2V2CA 3STGA 3SGGA 2YCLB 2V5JA 4L1XA 9XIAA 4PMQA 1EJXC 2OT1A 5FJTA 3V5OA 3LS9A 4M51A 1KTCA 1FHDA 1U5HA 1CB2A 2OZ0A 1FWFC 5D4YA 3CHFA 5F7UA 1K6WA 3KRUA 3W75A 3L12A 2F61A 2J8FA 1VBRA 3G1VA 3GIPA 1ODUA 2V68A 3B05A 3MS8A 3OHMB 2EPHA 3IJ8A 1EJTC 1PIGA 1TCMA 3ONCA 4WSHA 3K8MA 1FWBC 1R87A 4GJIA 4XZBA 5HUOA 4IMEA 4RE2A 4X9SA 3VUSA 4GQQA 3BANA 1E40A 4WCJA 1XRFA 4GNJA 3PTDA 1OINA 1J6PA 1W9UA 4A8LA 2HVOA 3AWNA 4GJ1A 3ARSA 1VIWA 3QPZA 5EFFA 1SJBA 3BLOA 4DJEC 4BEUA 2C0AA 2Y63A 3AU2A 4DUOA 3VIHA 1XIFA 5HA7A 3OZPA 1TVLA 2YBVA 4Y9PA 2OSXA 2A2IA 4ZENA 4PODA 4M3PA 3VXGA 4RV8A 2QPUA 3NQFA 4GI4A 3CL7A 1POKA 2J6VA 4M82A 3AJ7A 4NG3A 5ABHA 1UKOA 5HNNA 3THUA 5CC5A 2VZVA 2WNQA 2OTDA 4MSSA 4EXQA 3M0ZA 4WOZA 3WNPA 1V03A 3VTRA 4KETA 4QE4A 3SFWA 1QRQA 3S2MA 3DECA 2YYUA 1AJ2A 3NURA 1EQPA 3UPMA 3MP5A 2IMRA 3LLXA 5AHLA 2HPIA 4KERA 2WMIA 4R33A 1MI3A 1OYBA 3VOIA 5TD4A 4AZBA 3DFNA 4AEFA 3W24A 5E0CA 1E0XA 4ZOAA 4M29A 2Y5EA 5LYRA 4JFTA 4WKFA 1J6OA 4YWSA 1LRNA 1T40A 4FA3A 3QLDA 2VT0A 4Y7EA 3RDKA 3BZJA 2G3IA 3VC6A 4XAPA 2YL5A 4MFEA 5DEZA 4LS0A 3WUGA 3TROA 4H8UA 1XICA 4W88A 3WDPP 1CZ1A 4AU0A 3SJNA 1DWHM 1XIDA 3GQYA 4ZFMA 2QCDB 1YADA 4X60A 4Q22A 1Q85A 5CGTA 1XR2A 1TV2A 3B8DA 2P76A 1TWSA 4GZEA 2IPJA 5CSUA 4KRZA 2BOFX 1YW1A 3PG9A 1Z6KA 4RE0A 3QY7A 3UF9A 5FF3A 5LHEA 2GGIA 3PJXA 3II1A 2PEVA 1V6WA 3GYCA 5CPOA 4BI6A 3AYTA 2HJPA 4GGBA 3O15A 4A3UA 1BWLA 3RIKA 3W53A 4GGHA 4CD4A 4Q6XA 3K2GA 2OODA 2BS9A 3BDKA 4PZVA 4RDZA 3M5VA 2QW5A 3A13A 3T05A 4L9YA 4BQ3A 3WNMA 3WUBA 1W3JA 2BMBA 1OFRA 3DU0A 4W7VA 1HKVA 3PZGA 2A3HA 1OX4B 4AMCA 3CUHA 3TCEA 3ENLA 2OJPA 3QR3A 4GOAA 1KGXA 2ALDA 3WL1A 3W85A 2POTA 4UTMA 4LCRA 3BAJA 3SQLA 1X1ZA 4CQ8A 1HW6A 3GIYA 4PMNA 4QE1A 3JW7A 3W22A 5IHSA 1F3XA 4DM1A 1FWEC 3VMOA 3WQFA 4LB3A 3WF3A 1FDZA 2CLFA 2VR4A 3GTHA 3VGDA 1UH4A 2O4MA 3N4EA 1B4EA 3VKJA 4IHCA 2OGJA 4MZ1A 2WSPA 3FOKA 3AALA 1EJRC 3BAYA 4H83A 1G4TA 1LUCA 4G2DA 4ZQOA 4W87A 3W7PA 1ZALA 2XSXA 3PK7A 3RX2A 1JZ8A 3UWZA 2Z1BA 1F3TA 2ZWZA 4IIGA 5BXPA 4MLRA 4K36A 1IQ8A 2RGMA 4G56A 3PB2A 2TODA 4JNMA 2YL6A 3ANUA 3PZQA 5B7ZA 1I2OA 3NL5A 6PTDA 2FZNA 2PGRA 3ZJ6A 2V63A 2YYTA 3E0VA 3L2IA 1PCKA 1TUFA 1TIWA 3VNMA 1I0BA 4GBUA 5A8QA 2J62A 1JZ4A 1DWGM 4HOZA 1PTDA 1VP5A 3EA2A 3LU2A 2V69A 5SWUA 1FWIC 1E4IA 3FHQA 3EKLA 3G1HA 3IGSA 1H7XA 1ELSA 2QHAA 1B3OA 1QT1A 4LCSA 4D6JA 5HBFA 1T8QA 2E9LA 2PDPA 4HSNA 2INZA 3MY9A 3UZXA 5F2MA 2ZXDA 4NVTA 3ZT5A 4IIEA 1IWBA 3L4YA 3BW4A 4XZWA 3RMJA 1H11A 2HXUA 2WCGA 5D04C 3OHIA 1AW1A 1S5WA 3XISA 1US0A 1W54A 1RY0A 1GCYA 1EZWA 1H09A 1VH7A 1W8SA 3A6OA 4C6FA 4C90A 2JE8A 5DLCA 5AB3A 2EKCA 2GYIA 2G4JA 4Z2HA 1KO0A 5BXTA 2GL5A 2QXWA 3F1QA 3M1ZA 3B3DA 1TJ0A 1JZ2A 1Z8AA 1G4EA 3FSUA 3QLLA 1UR2A 2I5GA 4Y96A 3SY5A 2NQZA 4X9YA 5CC6A 3CQJA 1XV8A 2FTYA 4DJEA 1RJQA 3TN5A 4I5UA 2Q3RA 4MDOA 2R1NA 3ITGA 3QKEA 5G1MA 3PNUA 1UMLA 4DJDA 1ADSA 3K4DA 4NZ4A 1V0KA 1WNOA 2EBNA 4LEQA 4O1FA 3UD6A 3PJUA 4PMDA 3GBEA 2INEA 2BHZA 2H8XA 5I5RA 3LERA 3SEPA 3PAJA 1U1JA 4X0VA 1YHTA 4DNMA 3O63A 1EJUC 3TMQA 1GEHA 3R0KA 3GHUA 4PUDA 2FGBA 4D1JA 2V3FA 1KR0A 3ZJ7A 4J3SA 3A4JA 3M5YA 1UKTA 4P7QA 4RUBA 3TCSA 1B31A 5IBXA 4ZQCA 4AWTA 3TONA 3K4AA 2W3ZA 3ZR4A 3ARPA 5JIPA 1Y5VA 2ZX5A 5F2IA 3VIKA 3M5ZA 3E38A 1VPQA 4DAIA 2P10A 4DYJA 1BVZA 2PMQA 2CKRA 1KM3A 3ZVHB 5FOOA 4BQ5A 4LFYA 1B30A 1NFPA 4J2MA 4JBRA 4ACYA 3DFOA 1XHGA 3WELA 2PF8A 5DCDA 3VC5A 2CHNA 1R9ZA 3AS3A 1W9BM 4MGGA 2ZZ2A 2FJUB 5ABGA 2HVMA 2OWXA 1CXIA 4DO7A 4H9MA 4J1OA 4A3RA 4E8GA 4GMEA 3BSHA 1S2VA 1ESWA 1ZZMA 1BEUA 3PPFA 3AIQA 4A2SA 3UZJA 4Y6GA 3TYDA 3ATZA 4DJFC 5LXXA 1OZQA 1NM9A 1OX6A 4B15A 3WD0A 3MTWA 1EPVA 3MI6A 1AZ2A 2I9UA 4H9UA 3PF3A 4KEVA 7CGTA 1E0VA 2QS8A 2PTYA 3URNA 3PG8A 3CUGA 1ME8A 3KOFA 1TWZA 3CC1A 2V82A 3FA4A 4DXXA 2WANA 2E0PA 2PRHA 3AWOA 3LGDA 1FWRA 4MYAA 1DEDA 3NPWA 5JUVA 1JPKA 1BG4A 2GJXA 1XKYA 3OJGA 4LYRA 2ZUTA 4HK6A 1KBLA 4ML9A 2VFGA 1TV5A 5BZAA 2G4FA 3NQVA 4KIEA 3S1VA 1PL9A 1K9FA 4HNCA 3LENA 2E28A 3IVUA 4MZYA 4NT0A 4HMCA 1M41A 3B06A 3PZIA 3GU9A 4CU6A 4GVGA 3VPLA 4LGXA 3PFMA 5BW6A 3ECQA 4MNLA 1RHCA 2VDGA 1XIMA 3GG1A 5KEZA 2O9OA 2NT0A 4FOUA 2PURA 4Q4KA 1JCLA 3T8LA 4UQBA 1ONRA 5XINA 2PP1A 2YFNA 3TTEA 3TA9A 5TQLA 4CEUC 1JQXA 4XQ6A 1OK4A 4ADTA 4Q32A 1WDQA 1ISXA 3QW3A 4PR4A 1I6NA 1P1MA 5ABFA 2HBXA 5I2UA 3PUGA 3T2OA 1WXYA 1XIBA 2EPMX 2PDFA 1TFVA 5AYYA 2QPSA 2V38A 4AY1A 4DBDA 3RX4A 1GVFA 1OK6A 1LTDA 4J28A 5GJNA 3PUOA 4JX6A 5EB8A 2YFOA 4DBUA 3URAA 1QASA 3WUFA 2F6KA 3W26A 4MOZA 3ZQ9A 5A6BD 4O19A 1BGAA 4LT9A 2X0SA 3SQMA 3FGCB 3W7QA 2AKZA 3RO8A 4BEQA 1GG0A 1XLFA 3FAWA 2E77A 5U4NA 2H8ZA 4O0QA 5I7GA 3I3EA 3P2VA 2DZWA 4RLIA 3TDFA 3BAXA 1QPNA 1IT0A 5JIWA 2PBGA 1SQ7A 3LHTA 3VD5A 5FF2A 3H2EA 1VC4A 3T0DA 2XN2A 2PRMA 3TQ0A 2P8CA 4P8XA 4Z1DA 3RR4A 4NI3A 3OVGA 3BLFA 3OODA 4GYKA 2Y85A 1B9BA 2JIWA 2OR2A 3S6OA 1ZCOA 2WLYA 1O1ZA 1QVBA 3GTNA 2AQVA 1P48A 2OOFA 1CYGA 1G69A 2FDSA 4DNHA 4I7VA 2VD8A 2UY5A 3U57A 3N04A 3LBCA 4KCUA 1R6WA 2WHKA 5DF0A 2C18A 3NUKA 1LP6A 4WHBA 2VGBA 2I9EA 3EOEA 5DY2A 1Q4NX 4XV0A 1W8GA 3T0TA 2GGEA 1E9ZB 1ECEA 1KV5A 2CLMA 4GZ7A 2WKJA 4WSKA 1PS9A 4S1FA 3HQ1A 1VFSA 4I90A 1UYQA 1R3WA 1JYVA 4US5A 2VTFA 2J79A 3UJFA 1DQUA 4IPNB 4IFOA 4Z0SA 4QJ4B 4JHMA 4ORIA 3N29A 1TYGA 1UJPA 3AMDA 4WK9A 2NWRA 2B7NA 3SCQA 3DIPA 5KINA 4LW7A 1NF7A 4ICNA 2W5FA 1TV4A 3K1GA 5IBXC 3N25A 4UR7A 2ISSA 1VPXA 1XBYA 4DY1A 4EWJA 3H2NA 2OOGA 1VHCA 2VXNA 2X40A 3KRZA 4XIAA 3RPDA 5IRPA 3WBYA 1RBLA 2W92A 3N17A 1JNDA 4AX6A 4GCXA 5EBAA 3KL0A 3U6WA 3SM0A 1U1UA 2ZUUA 1E6ZA 1H1YA 4F40A 2PDJA 2YCLA 5A6SA 1XD1A 1YEYA 2JEQA 3BV4A 4LY4A 4TVDA 5BU9A 4XAZA 1GOMA 1GVOA 4KRUA 2VGGA 4IJBA 3VE7A 2H6RA 1KM4A 3GVGA 2BDQA 3KVKA 1ITQA 3BJSA 3P82A 1DPMA 3HGRA 2ACUA 4B2DD 2EPKX 2TRSA 4CCCA 3PZTA 5HQLA 2PWEA 3ES8A 4DBWA 1UR0A 2QAFA 3RX3A 4PUMA 2HQAA 3P62A 4HKPA 1TMLA 1AG1O 3ARWA 3WJSA 1XIJA 1OZMA 3WJYA 1TJ2A 2I57A 4QBXA 3W76A 1XSJA 3ARTA 3U2ZA 4E6MA 1MFUA 3O0FA 4V1XA 1LZOA 3QMTA 5I78A 2BVTA 4OIFA 2X42A 3QYQA 4GWEA 4H9YA 2G95A 2P3EA 1FP9A 5EMJA 8XIAA 1IIHA 1SW0A 2Y70A 1K7EA 2B0MA 1UR8A 1AL7A 1TJ1A 1F6YA 4CD5A 3BPWA 1D8CA 2O9RA 1GEQA 4LJ3A 1W91A 1X6LA 4JTSA 5D05A 2QCNA 3UG4A 2I16A 1VPYA 3HIJA 1Y0EA 2C15A 4B5WA 1DBTA 2DGAA 1C90A 3O6AA 2YLAA 1PPIA 4NXKA 3FAXA 3ATYA 1V4YA 4E4UA 2BWGA 1EJSC 4YVXA 1RPKA 2QLYA 3BAWA 4KWWA 4FXJA 1T6MA 4UTWA 4AD3A 1G4SA 4GA8A 2Z1KA 2PODA 3O6DA 5DCEA 3DKLA 5CAHA 4BF7A 3W7JA 2NV1A 3MUAA 1NOWA 1FA2A 1KCXA 1VLIA 3CB8A 1K8XA 4A3YA 1NP2A 4M6UA 4JTCA 2VQUA 1GJUA 3WD2A 4DF2A 2G3FA 2B31A 2J7BA 4R7JA 2OLSA 4AISA 1JF6A 3CPRA 4LCQA 3VIJA 4Z17A 2ABAA 5EMMA 4IFKA 1MUCA 4UTIA 1EHNA 4XSMA 5DBTA 1W0MA 4XWUA 2F2KA 2QKFA 5JBEA 4XAYA 4NZ5A 2ZXAA 4B3LA 1FWHC 4JQ2A 2HPMA 1GJWA 1W31A 1KCZA 1IT8A 3LHWA 2DV0A 3MHGA 3U5YA 4CCZA 1E1CB 3E6EA 2J4GA 2B7QA 1QI5A 2WHLA 3BCDA 4LV4A 2P50A 2QCFA 2VC5A 2A3CA 1OBAA 5EY5A 2NLYA 2WZIA 1DJNA 2Q8LA 1XG4A 4UZUA 3JZEA 2OZ8A 1B3XA 4WY0B 3MU7A 1H2JA 4Q4PA 4AHPA 4KESA 4KBXA 2IQ0A 2XM2A 4W8AA 4YVVA 4NHVA 2VWTA 3V1PA 4HPGA 2Y8UA 1OWQA 2OB3A 4AC7C 2FH6A 1QNOA 1R38A 1YKWA 1NH6A 1XRVA 2CLPA 4C1KA 2V0TA 3WDQA 2VD9A 1RV8A 1V5XA 1PZ1A 4IUOA 3UZ5A 1OCJA 4ML4A 1EOMA 3LCXA 1CNVA 1ZCCA 3IK4A 1GYLA 3UYCA 1RA0A 4E8CA 2NQ9A 3S9IA 3LV5A 5E6YA 4E3VA 2ALRA 3P7YA 3UPWA 2OZTA 4WUIA 1JZ3A 3TQKA 3UU0A 1HG3A 1TVPA 2QCHA 2DDXA 5I23A 1BVNP 4IISA 4I9JA 3UA4A 3SO7A 4DB7A 1C29A 3AOFA 1QHOA 3E96A 3NL6A 2SFPA 3LGEA 4EX4A 4AX7A 1R9YA 4A3QA 1A4MA 5I3JA 4FX7A 3LTSA 4C6IA 4ES4A 6TIMA 4JTJA 4TIMA 4JHOA 2ZC8A 4HOXA 1V0NA 1FWTA 3CHVA 1NFGA 3MHUA 1UR3M 1KXTA 2PCQA 1BFNA 3BOXA 3FJLA 3LM3A 3PJTA 1XIGA 1UOZA 2FQIA 2OWCA 3NIYA 1QOQA 1XKJA 1J93A 1R7OA 1YRRA 4RNIA 2GJRA 3PN8A 3R2GA 1X8CA 5D2VA 4XK2A 3S46A 4DEFA 3VOGA 4BI5A 3HFYA 2GQ3A 4K6AA 1R2SA 2F9RA 4UUIA 1EJWC 3G77A 2VZUA 2FZ9A 4I8YA 1K03A 3LRMA 2G37A 4HZ6A 2QYGA 4NRSA 4AD4A 2OU4A 5DMNA 1Q7ZA 1V7AA 5T9BG 3LI0A 4XO6A 4CVWA 4U33A 1Y7VA 4GIRA 4IIFA 2VNCA 5KTLA 4N6EA 4IGSA 2YCEA 3H6OA 1AMKA 4UTFA 2DZBA 5CSYA 4KWOA 3KZSA 2BTMA 2DY3A 4QQUA 3QY6A 2F6UA 4A2RA 2BVWA 5DMMA 2GJXB 2X2GA 3Q94A 3UZWA 1SSDA 3ZXWA 4ZQMA 1L8NA 1UZ1A 2CITA 3EZ4A 4ATDA 3UY8A 5FIPA 2Z27A 2P5NA 2OKTA 4ACZA 5DRIA 2HV5A 4Y9OA 2FB3A 1FWCC 2W6RA 1JDAA 1OJXA 1H7OA 1CGYA 1O94A 3CM4A 4JTEA 3DI0A 2XGZA 4PSRA 2J9XA 1O6IA 2GSHA 2VFEA 1RK5A 4MF4A 4ZR8A 3W07A 1FFRA 1GOXA 1N8WA 1X7IA 5HXMA 1UR1A 4GI6A 3WQPA 2GVLA 3PSVA 1T96A 5CGMA 3A4XA 2A7NA 1U30A 4Q8PA 3ZWSA 4HYWA 3QFEA 1LG1A 4UTUA 5DX7A 4S3JA 3WLLA 2BY0A 2YJQA 3T08A 2XM1A 1YBQB 5LGZA 1HGYA 3DEQA 2WNWA 3QOKA 4PFMA 3VIPA 1V6VA 3L7RA 4XB3A 3O6CA 2WMJA 3GC2A 1SO3A 3NSNA 2VDHA 1LRQA 4FSAA 3BWWA 3QPEA 5LIUX 3I65A 1ONWA 5D9MA 1LWJA 2W91A 4PYSA 3KRSA 4X0NA 1FCBA 1X6UA 2E1WA 1PXGA 4OVXA 1XC4A 3CUIA 2E5DA 5DFAA 2EQDA 4J2PA 5K4ZA 5LKYA 1XP3A 1WB0A 4FS9A 1WDPA 4EAYA 5CGQA 3GXNA 4QNWA 2VM8A 3SW6A 4F0SA 2G97A 4UXDA 4H41A 2E7FA 4DUVA 1AH3A 1S2UA 2DUAA 3U7BA 1K1DA 4UCFA 3R7MA 1WKFA 4CN1A 3AXIA 1WDWA 1DP0A 3LPPA 1AW2A 3LM7A 2I56A 3RNDA 1W5PA 1BTCA 1XYBA 5CSRA 4KCTA 1E4LA 7REQA 3ZIZA 3N18A 1I1XA 3B8UA 3UWVA 4AZ6A 4XZ9A 3F5JA 3LZ3A 4MJZA 4HMEA 1S3HA 2IXVA 2BGQA 2DVTA 2WSKA 5CG0A 1NDZA 3SADA 3JRKA 2JKAA 4Q8UA 4LAOA 4HMDA 1FHLA 3NQCA 2JGYA 3OPSA 1RP8A 4WR3A 4S2CA 4L64A 4DI9A 1E5JA 8TIMA 1QOXA 3BXWA 3R12A 2V67A 1PHQA 1LLOA 2YBTA 2FGLA 3U9IA 1OF8A 2QR6A 2WJFA 4PUUA 4D1IA 3FDKA 4K37A 7TIMA 3QSTA 3GNRA 1E3XA 4HHLA 1XG3A 4QS5A 2X1UA 1R3RA 3SI9A 5E09A 3PZVA 1H0GA 1Q6EA 1CGUA 3GTXA 4FIRA 3HGOA 4Y90A 3ITTA 3A3XA 1HJUA 2GGJA 1WDRA 3NFUA 5AVNA 4KWVA 4TX9A 1IEXA 3NM3A 4B3ZA 3QM3A 1G4PA 4AY8A 2C14A 5C9UA 2VWSA 3GDKA 3T0CA 4JEQA 3LPGA 1SFTA 1W5MA 4L4LA 3DOPA 2YXGA 4NZ1A 1J5TA 3MDWA 2IQTA 4KF1A 3W37A 1SZFA 3F4CA 2EJ1A 4JZ5A 1N8FA 5HNRA 3N4AA 4LOCA 3CO8A 4DBEA 1EF3A 3DGBA 3NYZA 1GZJA 3EX4A 4R34A 2CYGA 2CLKA 4Q8VA 4O18A 2Q6ZA 4KPLA 4BKNA 2VEGA 4LUJA 4JYEA 4W84A 1V8EA 1N55A 2FZ8A 2VQTA 3B0XA 1F07A 9XIMA 2GVEA 3BMVA 3DG3A 2BG5A 3NVDA 1POJA 3D46A 3RITA 5IOBA 4NP7A 1ICPA 1BRLB 5FSDC 3LQGA 4IMDA 3MWCA 5DQPA 3NSXA 2V5BA 1UIPA 1JAEA 4ZTXA 4NUWA 1XH0A 4RX0A 1I1WA 2BY3A 3QJAA 1J79A 1X39A 3AUJA 3PSWA 3FKRA 1M7PA 5CBJA 3UG3A 4GG9A 2V8ZA 1XBVA 4JD4A 3GVVA 5G4EA 1NTHA 1D3GA 3O9NA 1MRAA 3H55A 2J8TA 4EPKA 1BF2A 3N14A 3UR8A 1ITCA 2QCLA 3BGGA 4KRTA 1AQHA 3L23A 3CLMA 4CNUA 1QDSA 4F2UA 3W88A 4UQ9A 3S1XA 1KLYA 2IQDA 1RY8A 3W1RA 1BYDA 1WKDA 4GIEA 4K68A 4ZO6A 3VA8A 1KCKA 3CJPA 5CEWA 1IYXA 3CAWA 4HU0A 4HNNA 4KCVA 1KM5A 1PEZA 1V6TA 1S5MA 2ABBA 3QTGA 2V2HA 4I7UA 3UERA 1UH2A 2CWXA 4JFWA 1VJIA 5H1WA 4CGTA 1DJIA 4PTNA 1GNXA 5AC5A 2ZWYA 1QO5A 4E2OA 2AL2B 3WFAA 4U2ZA 4UCGA 2OCZA 4JKMA 5A6KA 1TPDA 3L4VA 4MIMA 2PLKA 1CCWB 4UFKA 4X22A 4IMFA 2I14A 3W7OA 2GWGA 3GXIA 5MKGB 5A2BA 3W2JA 2XIOA 5I3IA 4CNTA 4GBDA 1QW7A 4V1YA 4AC1X 2ZKMX 5H8MA 3QSRA 3FNDA 1E1EA 1NSJA 2PDXA 1ZLPA 1MW1A 3VZYA 3ZLGA 4LC8A 3RAOA 4U2YA 4WSJA 3HU7A 1U22A 3I6EA 3SN0A 1KBBA 2E9MA 3SCOA 1PBGA 3PJWA 3IJQA 5E1QA 1TELA 2QVNA 2YDQA 3WDJA 1GTEA 3LN3A 1IR2A 3WLQA 2V2DA 3P60A 4IIBA 4ZSUA 3DG7A 2VELA 4OE7A 5TBOA 3T40A 1R30A 4UTTC 3VD4A 4HIBA 2NX9A 5K2ZA 1KM1A 1ZS2A 4CU7A 3M47A 1GVIA 3QC0A 3TMLA 3QKZA 4LBRA 3M44A 4M19A 3N6JA 1VYPX 1JI2A 4M7TA 1LWIA 2VGIA 1TE1A 4OUIA 2ZXQA 1OEPA 3HPSA 4J3TA 1LLZA 3WD3A 2DZVA 4XTDA 2QULA 2AGTA 1LOLA 3VIIA 1OB0A 4BY3A 1EOKA 3WLJA 1WO2A 1UPPA 1XQKA 2XH4A 4NAFB 2GQAA 1A5LC 1A5OC 5K4XA 1SFJA 4L65A 2W79A 5JXQA 4JFVA 1QO2A 4TR9A 4IWWA 2C0HA 4IL0A 3NQ6A 4L1GA 1CGVA 2F6XA 2DUXA 1XLBA 3T42A 4WDXA 4PRWA 4JTQA 4GNKB 1EC8A 3CXOA 2Y7GA 4MJMA 3EDDA 3AQUA 1GOQA 4JFSA 4JQ3A 3OVPA 2ZUWA 1HVQA 2ZUVA 1VR6A 1R8LA 3V3WA 5AHMA 2QUTA 3LCFA 1FVPA 3LCGA 4H8VA 2BHYA 3W1NA 2ACRA 4FOJA 4KMQA 1EQCA 4AY7A 3S42A 3MC5A 2GVYA 1FBAA 3E3HA 3W23A 4KH2A 3QTPA 4ZQPA 1GQJA 4UNKA 1XLGA 2OELA 4D6DA 3KCOA 2RFGA 4XD4A 5CJ5A 4NAEA 3M0LA 2R9RA 4ATLA 3WLPA 3B9DA 1EJVC 3L66A 1H7WA 4CD6A 4J3VA 3LEPA 4JAWA 3EDKA 3SRDA 2GFTA 2OSWA 4AWEA 3GXFA 1QAPA 1YPXA 2WPBA 1JI1A 4O50A 1RVGA 1K9DA 1OC6A 1R47A 4CQCA 1X96A 4P5UA 1D3CA 3B9AA 1TPWA 1TTJA 4UMAA 1VAHA 1XI3A 3PZOA 4AZCA 1LDCA 2WKGA 2BGSA 4LAKA 1YXCA 3P80A 4DJFD 4V15A 3WKZA 1VB9A 5BMWA 3BH4A 2C3ZA 5EPDA 3HA1A 3RJYA 4ZE4A 3HM7A 2EGZA 1AUSL 2Y5JA 4X61A 1P0NA 1TWWA 4CCEA 9RUBA 1FCVA 3L2LA 3R58A 3WQ4A 4L4PA 1TR9A 3GB6A 2XYLA 1SFSA 1VRDA 1OFOA 1KQZA 4NAFA 3UGVA 2R94A 3LD5A 1DJQA 4XISA 3M0IA 1HO4A 3DYMA 1UHVA 4Q8TA 2WW5A 5A8OA 4A6GA 5DO8A 2OT0A 3TX9A 1GOIA 4H3DA 4PCNA 3EDFA 4F2BA 3S83A 1F61A 1KKOA 3WEOA 3TOPA 2WVVB 1YDOA 1WQ5A 2QCDA 4JTUA 4IM4A 1MMFA 2WMFA 2J7FA 3UR7A 3L21A 1MO0A 3W87A 1K8YA 2ZRXA 4GC3A 3NOYA 3QMSA 2QQ6A 5EYWA 3IPWA 4U3AA 4YHGA 3UZYA 3M07A 3GDBA 4ACZB 4LXFA 3N2XA 3S2NA 3CUJA 2Y89A 2OQYA 1EYWA 4HTYA 4Y9AA 1G0CA 1ICSA 3M0JA 3KX6A 1XLJA 3G6MA 4GLEA 4LUTB 4I9TA 1MEIA 3ABZA 3CUFA 4W89A 1MW3A 3GWQA 4BZYA 4ROQA 4O15A 1QFEA 1W56A 1WXJA 2CC0A 2B7PA 4FNUA 1XLCA 2H3DA 3P8JA 1HJWA 4W86A 1EA9C 3W0KA 3PHAA 4RZ4A 3E1F1 2I5QA 3U4AA 1FKXA 3DDMA 1O66A 3GKFA 3LLFA 1ZRQA 2YIHA 3L4WA 1KFBA 2HVNA 2Z29A 1EUNA 5I3HA 5MKGA 5LZLA 3FK4A 1X6NA 4AD2A 3PBGA 3RO6A 3WJWA 4HZ8A 4POCA 1BKHA 1Q3NA 5A5WA 4PB5A 1JUBA 4IJRA 4YHEA 4CNNA 3I7SA 3W7GA 4W8BA 2A0NA 4AIUA 1ZENA 3N3TA 3SY8A 2PPGA 3RLHA 1EP3A 4PBFA 4O0KA 3WD4A 4B5UA 1FHUA 4UTLA 1Y8BA 3QGVA 3LXBA 1R0MA 3I6TA 3ID7A 4MWAA 3BLLA 1NDWA 3WQGA 3G3MA 2QUUA 1S5TA 1OG0A 2J24A 1PO9A 3U2CA 4F0MA 1BTMA 1BF6A 4MWAD 2HDJA 3ABSA 2ZUNA 3ARRA 4PMZA 2VURA 1A3XA 5CSSA 1MWOA 3ZS4A 1MUWA 3TNBA 3TOYA 4EANA 1NY1A 3QMRA 1MQPA 2FVLA 3R8GA 2POZA 4IPPA 3MZ2A 3AIBA 2Y24A 3EDJA 3SGUA 2DH3A 1NDVA 1NQKA 1EGVA 3H53A 3K13A 4F9JA 2XVKA 3CK5A 4QNEA 3SCUA 3S9ZA 4DZIA 2CPUA 4D71A 1VS1A 2WM1A 4OTKA 1OX5A 5M5DA 4Q8OA 4FK9A 2OX4A 4AB4A 3LHYA 3R13A 4MB1A 1X7FA 3QOMA 3TYCA 3AHZA 3G8EA 2CESA 3KVLA 3ZFHA 2DVXA 2WWCA 3OGVA 3AISA 2GQ8A 3MCOA 3ME3A 4KT2A 4QAIA 3LTPA 2BY2A 3RG6A 4HBKA 1OFAA 3H26A 1W1YA 5BOFA 2HBVA 4WXYA 2PC4A 1GZ1A 4Q3MA 2Z6IA 3RILA 4BI7A 5FL0A 4JTTA 3W2KA 3WQ8A 4HCHA 1J10A 3S2LA 4MKSA 3GVRA 4XX6A 2P0OA 3QV6A 4K7VA 1AQFA 2HWGA 1T41A 3IJ6A 1WKYA 2Z00A 3BC9A 4XKMA 5G1YA 2DIJA 1GK8A 3AXMA 2UY2A 5D2TA 3B40A 3AMKA 4ZQRA 3CS2A 2PB1A 1KGWA 2VKZG 5HR6A 4DVOA 1PKMA 3BVJA 3L68A 1PX8A 4AHOA 5J5DA 2G3NA 1VENA 5CZJA 4TMBA 2EF9A 4DRSA 3D0CA 4P8VA 4PBEA 2ZC1A 3O2LA 5FEZA 2BVDA 5D02A 4M5PA 4TU1A 3LYEA 3QV9A 3TAKA 1UBSA 4ZL1A 3KP0A 3NEVA 2RUSA 2ISWA 4MWAC 3Q58A 4YCOA 3CWOX 5FJPA 1ME9A 1HIZA 1LYXA 4IICA 4PB3A 1PJ9A 4UMCA 1VZWA 5DANA 1JCNA 3TJ4A 2XIJA 3TNOA 1H50A 4D6FA 4UFJA 2DSUA 4UFLA 3MUZ1 4GFSA 2HXTA 1JUEA 5FL1A 5LIYX 2QMKA 1NWUA 5CCZA 4CQDA 4JTGA 2IPGA 4IPLA 5G4WA 4B9YA 2VX4A 4MVAA 4LUSB 1J8VA 3NQ7A 2QPXA 2UBPC 1XYAA 4N2YA 1UD8A 2PLMA 4TTUA 2GGGA 1A80A 7REQB 1G7VA 5AN7A 3VMPA 2VEFA 2Y88A 3CIXA 2VP8A 1NWRA 3QEZA 3S5NA 1W1PA 2HE5A 2X05A 1PZ2A 3WLTA 4C6CA 1Z3NA 4R9XA 1RLDA 3V75A 5CH9A 5A2AA 2DQXA 3VOFA 2E6DA 3CPUA 4IF2A 1LWHA 1Q7MA 3N19B 2NSXA 2C19A 4XTIA 3UPBA 1XL9A 1OCQA 3UJEA 3MMTA 2CLIA 4JGDA 1UJQA 2J88A 3PZNA 5C7VA 3EOOA 1XXXA 1CPUA 1MFVA 4QDPA 3WH8A 4QJ1A 1HJVA 4LEFA 5HQMA 3ABOA 3MMWA 1TX2A 1LORA 3QRHA 2IPFA 4LALA 2GJLA 3BICA 5B80A 3OP2A 1WPCA 1E70M 2D23A 4W8LA 4DN1A 1CGWA 4R7WA 3CV7A 3CYVA 4K39A 1MNSA 2HNEA 3WLHA 3GXTA 4B90A 2C16A 1V79A 3H21A 1YDVA 5C9WA 2NXHA 2RDTA 5CAKA 3MP4A 1CBGA 4GH3A 3VUPA 4RR4A 2PBOA 4AD1A 1M1BA 2X1IA 3TE9A 2REQB 3A12A 2Z2UA 3OLEA 4MADA 3W7DA 2E9BA 3AMCA 3LNPA 1Q6RA 6A3HA 2ZRZA 3A24A 2P1FA 2YOCA 4MY9A 1XDLA 2YA0A 4Z2GA 3TJXA 3Q37A 3QHOA 2TSYA 3EWYA 3BARA 1BYBA 3G22A 1W17A 3A22A 1H49A 1MVYA 1HTIA 1UUOA 4FXFA 2PDNA 1XLMA 2GZXA 3CLWA 4R5EA 1T5AA 4IZGA 4HGXA 2ZBTA 1Q6QA 3GW0A 1B2YA 1OABA 4YYFA 1CDGA 3W6LA 3WO8A 4PMUA 3ARZA 3EWDA 1MXSA 4PTDA 3PFRA 1XF0A 5ECUA 1R86A 2RJGA 3EWBX 1F8MA 4K8EA 4FNRA 4CQBA 3W1QA 4D6IA 1XFBA 4O14A 5D37A 2DPEA 4WXZA 1E0UA 3EB3A 2VX6A 3FDGA 5K3VA 1GTHA 4RNHA 4XIMA 2WC7A 3IVTA 5A6AA 3LB0A 2VI0A 4PMVA 3AICA 5CZTA 3UNDA 4ADUA 3W1LA 3TH6A 2R6OA 2HNHA 1XYZA 1Q6DA 1REQA 2HS6A 3GH7A 3A5VA 1GKRA 3JVAA 3S6TA 4QE5A 1JR1A 4XO7A 1XIHA 3HJZA 4M8UA 1F05A 6CGTA 4WRHA 3THCA 3W7MA 1MDRA 1R2TA 5DT5A 4QITA 3VYLA 1SR0A 3VVGA 3E12A 1HKMA 3TR9A 1OYCA 3EEGA 2VFDA 1EF2A 2V5DA 1B54A 3BCJA 3VK5A 3EOUA 1ZTVA 3HV9A 2V5LA 1GJPA 6ENLA 2D0GA 2ZRWA 2AMGA 5AHNA 4M81A 5CC7A 3R25A 1BD0A 4ZCWA 3TW7A 2D0FA 1UWRA 4MAZA 4QLJA 5LNSA 2E5CA 4QJ5B 4NQ1A 3FA5A 3PB0A 5MHBA 4Q8QA 3IGUA 2HROA 3M0YA 1Q6OA 2E4TA 2OYKA 3G6LA 3POHA 3W7RA 4DXKA 3NYDA 1HP4A 3T81A 2DSKA 2NUWA 4U5IA 3KS6A 3S1GA 3B8IA 5A8GA 5BXSA 3UQNA 1FWNA 3ISIX 1K70A 2WHJA 4C6NA 3KTCA 2GSEA 2IKJA 2BOGX 3EXTA 3LPFA 3NCOA 3UXKA 1ENUA 3W1UA 2GK1A 1DJGA 3OBKA 3TW6A 1M03A 3KOWA 3LNMA 5T26A 4UBPC 4JN8A 2INFA 5D8WA 1XCFA 5ECVA 3UCCA 3OZYA 2WVSA 1TRDA 5I3DA 1A5KC 3BZGA 2Z1SA 4DAFA 3KS5A 3SIMA 4AZHA 2A7RA 2ZYFA 1E6QM 3CPGA 4DJED 3GNOA 4TTGA 2F8QA 4S3AA 3PULA 2YR1A 3EX1A 3W2UA 4KWUA 1UKSA 5BWAA 1CXEA 2PSNA 1TR1A 1LG2A 1ZJIA 5F4WA 3S2JA 4UB9A 4TUFA 5H91A 4OOZA 4XUGA 4QX4A 3SAZA 4HB7A 5XIAA 4CN6A 4Z2IA 4J7RA 4KS0A 3M6DA 6TAAA 1OF6A 3FKKA 2ADAA 3ANYA 4M80A 5BXRA 3AZSA 3AIEA 4KIRA 2BFGA 4P7OA 3FVDA 4ZB5A 1TO3A 3V5FA 1KBIA 1DJHA 2JF7A 3WZ0E 1GYMA 1Q13A 3BLEA 4AIEA 3O6YX 4ZEPA 1WOAA 5CKSA 3GY1A 2YBUA 4FR1A 3T2PA 4U31A 2E25A 2HRWA 1FWGC 2R14A 1F8IA 4J3WA 4IGNA 3LMYA 1HX0A 1IEWA 4OOUA 1SUXA 3CEPA 3UG8A 4AW7A 3SURA 2GWNA 1FDYA 3WH6A 4DZ5A 3UA3A 4DWSB 2WCSA 3U5UA 2OVLA 3CU2A 1UWAA 1JPIA 5D38A 2QJNA 3BAIA 3W25A 2QGHA 3WLMA 4HTBA 3DFQA 1TV8A 1PX4A 3ARVA 5LA2A 3AXXA 4I6VA 5H6HA 4L6HA 1KM6A 3AFBA 3SB0A 3GDLA 3E2VA 2VZOA 3MMDA 3V4BA 3WDRA 2FTWA 3GK0A 4Z0JA 3RU8X 2VFIA 3MKKA 1B9ZA 4G1KA 1M01A 1W3IA 4LVBA 1VQTA 3DBNA 4JS3A 1E56A 2YL9A 1VD6A 4A22A 4ROPA 4UR9A 4WF7A 5DELA 2BP1A 4QAWA 1CW2A 1SR9A 1F5ZA 4GKLA 5A1AA 3N12A 3ANVA 2CKSA 4Y2WA 1WBHA 1TIMA 3LCLA 1IWAA 3H4WA 5FEXA 4OBRA 1VFMA 3I7QA 5KMYA 3AHTA 1DE6A 4JL1A 1S39A 3VCCA 5DBUA 3IWPA 1H61A 1XIEA 3KAOA 2PC8A 4HNVA 4FHAA 2JEPA 1IE7C 3M6YA 1IXNA 3FJ6A 1ME7A 2BZNA 2PWFA 3R1ZA 2QJMA 3NA8A 3H8AA 2V81A 3C2FA 1X1OA 1VFHA 4IQJA 3GR8A 1UIOA 3QQ1A 3EDEA 4P2VA 3FW6A 1EBGA 4XSLA 1KBJA 2ZADA 2XIIA 1OT2A 3V35A 4HHHA 3O1NA 2DT3A 1EIXA 1CENA 1WDSA 2VEPA 3QR1A 5BRQA 3STCA 1ZPTA 1DORA 4MM1A 4MJ4A 4M6PA 1DIKA 4CVUA 1ZFJA 5HQEA 1ZAIA 1PHWA 3UWWA 4S3BA 3DFYA 5HNTA 1KA9F 1LJYA 1HVXA 3EMCA 1RD5A 1QPRA 1I8JA 4BA0A 2EG7A 3BE7A 2FHBA 4QG6A 1P4CA 2C7FA 3IACA 4RDYA 4HN4A 3TTSA 1O4UA 3UYIA 2JIEA 3BMWA 1Y5XA 4MPKA 3ZT6A 1N2VA 2CXGA 3L0KA 1ZJHA 2E67A 2GJPA 2GQ9A 4FB7A 3R10A 1CLKA 4K2SA 1R5YA 4HNTA 2XDFA 1A5SA 4GXWA 4RJEA 3IRSA 1H5YA 1VFOA 4BQ2A 1NJJA 1PYFA 1QW8A 2Z7GA 4LVFA 4NU7A 4YTSA 1VFLA 2J75A 3M64A 2ZRVA 1O5KA 4LU0A 3O16A 3LCHA 3GDRA 3GE7A 4O4VA 2BXVA 1HKWA 1FH7A 3L5LA 4WZHA 3H70A 2X41A 4WD0A 4IQDA 1EDQA 4Q8MA 4LV9A 3KOXA 1IGWA 5HMEA 2GVGA 3NWRA 4BJHA 4A21A 5T91A 2PZ0A 3NZGA 3F4DA 3SN1A 1SZNA 1CWYA 3TV8A 3MV11 4JIIX 5GNYA 1P6CA 1Z42A 2AL2A 3QF0A 1K9TA 3WQVA 5D2XA 4ZBCA 2V5CA 4Q7IA 3P74A 4EF8A 4BWLC 1EXBA 3HG4A 1C92A 4CUCA 4O57A 3PR2A 3IARA 4C1NB 4INFA 3KVJA 1Z44A 1I2RA 1HL2A 3LK6A 1TB3A 3NQ2A 3INPA 4E2VA 4FR6A 3BW2A 1JPDX 1DL3A 1I45A 1TQJA 3H2CA 1WKEA 4OU1A 2XH7A 3EMQA 4NNAA 5AC8A 1DIEA 3C0QA 2ZZ6A 4JIQA 1SW3A 1EKOA 3HGJA 5HPOA 4EXAA 1JRBA 1GKQA 3A47A 3UR2A 2GLKA 4KGJA 3WQEA 3CQIA 1KRBC 3MWAA 3E0LA 2YZRA 1K02A 2QUNA 1RQBA 1MZHA 3KM8A 5E6ZA 1XINA 3DKJA 2YGYA 5CZ0A 3J7HA 5D9PA 3TXZA 2G41A 4O53A 1KXHA 2W63A 4O4WA 1R3VA 2X30A 1EH9A 1MNZA 1F3WA 4QROA 4AWSA 1MRQA 3RFAA 3W7NA 4REQA 4RZ5A 3WF2A 4Z1YA 1TPEA 3L0GA 3L4UA 4O1DA 5FF7A 5CPLA 3SUVA 3WD1A 1P0BA 3N4FA 1XRSA 3F5KA 4DZHA 3CEUA 6REQB 3OVRA 3W3OA 3M4HA 4IMAA 3A3HA 1I2QA 1DHKA 4XZHA 3AIRA 4Z1AA 3G2GA 2VO5A 4JN7A 4LTSA 5IFPA 4L56A 3VAVA 3W7HA 5C8BB 1TMHA 1VJZA 3NO5A 1P6WA 2ISVA 1VEPA 1SVDA 3TYEA 4JTRA 1IZCA 1RCQA 4L61A 5A6TC 3W71A 1Q2SA 2Y5SA 4D6CA 4RKAA 2IKIA 4FX6M 4LANA 4GUGA 4L6OA 5XIMA 1KFJA 1JCYA 2WZHA 2I1OA 2UY4A 2BODX 2PDHA 3N1AA 4HHMA 4W5UA 3HPXA 1FXQA 4IIDA 4PE8A 4H00A 3WX7A 3MHFA 3P0WA 3RRXA 2ZQ0A 1IXPA 3HO8A 1K9EA 4WQ6A 3MA8A 4HSHA 1XLKA 3VDAA 1MYRA 3MCMA 4DWDA 3CAVA 3L5MA 3B4YA 4J3UA 3WQ5A 2P53A 3L4TA 5G1TA 3NJ3A 3O8AA 3WF4A 2PRLA 4E3TA 2BNJA 1K8CA 3WBWA 3UJRA 1X1NA 1S5VA 3IJDA 3VGBA 3BQ5A 3H7VA 3DHUA 2EJAA 2UV8G 4KEZA 1HN1A 4N7QA 3WK1A 1O68A 1J0ZA 4HA0A 2YZ5A 3DXIA 5I09A 2PWVA 1I60A 3V1HA 3FJNA 5H2ZA 3RLVA 4E4PA 3SRHA 2J7CA 4FF5A 1Q5MA 4H1ZA 1BAGA 4N9BA 2I7GA 5AYXA 2PDWA 2J9ZA 3H2FA 4LUTA 4FLRA 1SJAA 4C7GA 4F0LA 4RV3A 4ZQNA 1DJXA 3K30A 4HHPA 5HATA 2PF0A 3D3FA 4RNFA 4D8ZA 1OADA 4GQGA 2PA6A 3LHZA 3DZ1A 3FYPA 2WVTA 1VF8A 4BCEA 2ZUMA 1J12A 1ZP3A 4B91A 3MI2A 4R88A 3IJIA 3MANA 1DJZA 5CPMA 4DYEA 3GNNA 1JNEA 4C7FA 2CZFA 5I00A 1BQGA 1QR7A 2PFHA 4TX6A 2MNRA 2QUMA 1FH9A 2PDGA 3GH5A 1TPUA 3R0UA 4KQNA 1BSLA 2PDMA 1CB7B 3N2CA 2HEJA 1FY6A 4S3CA 1WCGA 4MLJA 5A6BA 2ACQA 1HKJA 5HJLA 3WLOA 2WXDM 2D73A 2REQA 3EOLA 1E9LA 2D2HA 3PUEA 1LQ0A 1UR4A 4GD0A 3G1XA 3GNXA 3ABXA 1H7RA 1IEIA 2A85A 2YXXA 4CCDA 2ZICA 1AD1A 2I17A 4N4PA 1IXQA 2QJHA 1LRTA 1IHIA 4MHBA 2ZRYA 2A3LA 3PWGA 1HJXA 1SZRA 2VFFA 1D3HA 4US6A 1C9WA 3W1XA 4M7SA 2C91A 4S3DA 4MKNA 5I77A 4LBSA 4C7DA 3EXRA 4N02A 2PDCA 4MTVA 1OGBA 3IV3A 1GORA 2CIPA 4Q8WA 3FLUA 4R9OA 3GG7A 1DWIM 1JULA 1SJCA 4JQ4A 4JR5A 1N7KA 1TX0A 4EVZA 3QR0A 4JFUA 5I6SA 5C0QA 5LIKX 4FNPA 1QI3A 4MJ2A 1RALA 3RMEA 1SO6A 3L65A 3CTLA 4GUJA 3STEA 1Q6LA 2IXUA 1V51A 4RZ6A 2P88A 2NQ5A 1PUDA 4ICMA 3S8HA 2Z26A 1QOPA 1EEXA 2OXNA 2XFRA 4XBKA 2NXGA 3RK8A 3HGSA 4RPQA 3UESA 4GIAA 2NUXA 3FV9A 3VU2A 1YMYA 3ABQA 4F0HA 2PZNA 4WJ8A 3WF1A 3TN4A 4IL2A 1BYCA 4QFUA 3PPCA 1U5JA 4WLCA 3H4GA 4MUPA 4Z42C 3A3WA 3CMGA 3E0IA 2UWFA 3LHVA 1R3TA 2YA1A 3NXLA 4H6QA 1Z89A 2NT1A 4E2BA 2WJDA 4AYSA 9CGTA 4FX8A 1YYAA 4O0ZA 4Q4OA 4FAMA 4GINA 7ODCA 2ZXBA 4FZIA 3ZT7A 1TMQA 3W00A 4HA3A 5FI8A 1Y65A 3M43A 3KLLA 4DHGA 4OQVA 2Z4GA 1B57A 2DZUA 4HMNA 2Q3OA 3IV8A 2V30A 4EOUA 2TYSA 3AIWA 4JDBA 2DUZA 1K77A 3IAQA 3TN3A 4QEEA 1NEYA 5C2CA 2QF8A 2D0HA 1XUZA 1MEWA 3Q65A 3Q4DA 1F2JA 4AZGA 3TWAA 3REQA 1JCMP 5CJNA 2XISA 1ZBCA 2PDQA 3BLPX 4H6RA 1HJSA 8CGTA 1PSCA 4XBJA 2EG8A 3WMSA 3CUXA 3BJTA 2PS2A 5TF0A 2FDMA 1SGJA 4R53A 4HPNA 3NM1A 1E9YB 4F48A 1A49A 1GPFA 1QCWA 1EPXA 3PBMA 5DT7A 2WSYA 3CGTA 2QT3A 4PBGA 1ADOA 5CPTA 3JUGA 3U8GA 4Q8NA 4O11A 3M0XA 4JY8A 1WZKA 2G50A 1UZ4A 1B3VA 1VCFA 2E6FA 4PA8A 4Y8EA 3F2BA 1WAUA 3TFXA 3U7VA 4M0XA 5I3KA 4LS2A 3W82A 3NGFA 4NI8A 2OG9A 4FEZA 3AHYA 3GNPA 5A8MA 2E1DA 1PAMA 3U2OA 5IFTA 1P7TB 2PAJA 1YTDA 5ABTA 1XLLA 5HWNA 1P7TA 3PANA 1DOSA 3WG6A 2XFFA 1FH8A 3AYSA 3UCDA 4C1LA 4PMOA 1US3A 3QPYA 2WZTA 3GX9A 2NW0A 3HMJG 1H51A 3LRLA 3SSJA 5FF0A 1C91A 3TAOA 2RKXA 1XPYA 1O95A 4DO6A 5DMLA 4H6KA 1V6XA 4GH1A 5A69A 3NGJA 4U10A 2ZX6A 4GY0A 2XFYA 1ZAJA 5LNRA 3AZTA 3I7RA 4BQ4A 1X38A 4K7YA 3BJFA 4MZ8A 4DELA 1YTKA 3P3BA 2GDUA 1TREA 3B9NA 4HPHA 4J27A 5F1UA 3MO4A 3VMNA 2Y7DA 5CPNA 4QTGA 4S3FA 4B5TA 1OG6A 4GI9A 1GT8A 3BUVA 4ENLA 3TYAA 3TTOA 2ISFA 4D8LA 1ZU8A 3B8SA 3ARXA 1E0WA 3K46A 2J74A 4O13A 1A5AA 3C56A 1UA3A 4LSBA 4HPXA 3TEVA 3A5FA 4V28A 4C60A 4CNPA 4JPGA 3WJZA 3MW7A 3HPAA 1GVEA 3OLGA 3TLLA 5GNXA 2PDYA 3KFTA 3WBXA 5D32A 3H2AA 3KL3A 3IAPA 4NYUA 1QWKA 2FYMA 1G9HA 1PYMA 3NPVA 3WLSA 1IF2A 3OGRA 3FS2A 1H63A 1O7AA 1R46A 2Z28A 4U5KA 1XUUA 3SGZA 1NU5A 4B4FA 4UMBA 2GSJA 1YIXA 1GOWA 1M5WA 1B1YA 1H3GA 3BURA 3HQNA 3CL6A 3HG3A 5EMUA 5CPQA 7XIMA 5D33A 2WC4A 3CAQA 5C2GA 2J78A 3WDIA 3Q45A 3KUMA 4X2PA 2VR2A 1TVNA 4H6EA 1YXDA 1FP8A 2GUYA 1L6YA 3WMLA 4IPIA 1MW0A 1UR9A 2FGZA 4ZO7A 4B92A 1ML1A 2ZDRA 3E5BA 2Y61A 2ZZ1A 4J35A 3W7EA 2FVKA 4ZXOA 1I2NA 2AOSA 4DWSA 4GXMA 1J5SA 2EPOA 2FH8A 1HF6A 4ZOCA 3TZNA 5MF5A 2EHHA 5DXYA 1PZ3A 5GVJA 4ONVA 5AC6A 3ZM8A 3FXYA 5C9RA 3T4WA 3VKCA 4IMGA 4XVEA 2CFFA 4AVNA 3MKVA 4Q33A 4PTMA 3DESA 3HQPA 1B4KA 2GDVA 2QIWA 5BMXA 4J4KA 4LX4A 3IUHA 1R3QA 4LRSA 3EOSA 3ZJKA 4LF1A 1S2WA 4YJ5A 3T55A 3QZEA 1R9XA 1E5NA 1WDDA 1I0DA 4XAFA 4QR6A 1KTNA 2FIQA 3CMJA 1K7FA 1QHPA 4HCLA 3TSMA 3I4EA 3C4UA 1ISYA 3DH7A 1SJDA 1S46A 2Z2AA 1WZMA 4GX8A 1OD0A 1NELA 2RAGA 1PKLA 3PUDA 4D6EA 4MFDA 4UQDA 3A4AA 3AMLA 1TTQA 4W7WA 2WVUA 3VKDA 4PL1A 1FUYA 1UWQA 5JMUA 4TVCA 5JQ9A 4YCPA 3M5XA 4IX0A 5LA1A 1FWAC 3T1GA 3RHGA 3PM6A 1M53A 3N34A 2YKKA 4TV6A 4XD3A 1OHLA 4MB4A 2PWDA 2WMGA 1OFBA 1BSIA 2C