2QNJA

Kinase and ubiquitin-associated domains of mark3/par-1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
324
structure length
318
Chain Sequence
GAMGSEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITATYLLLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/microtubule affinity-regulating kinase 3
publication title Conformational instability of the MARK3 UBA domain compromises ubiquitin recognition and promotes interaction with the adjacent kinase domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 318
sequence length 324
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2qnjA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qnjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qnjA01
4E6AA 2I0VA 4QQJA 4C4EA 2PE2A 2PSQA 1VDLA 3OXZA 4FV6A 1HT2E 1V0PA 2HCKA 4J52A 3TNHA 3ZC5A 4UN0C 3RALA 5JZJA 3E64A 3SC1A 2R7BA 2Z8CA 3DGKA 4ZP5A 4O0YA 4C57A 3L8XA 3VN9A 3NNXA 4NW6A 3QUEA 1K9AA 1K2PA 3MS9A 4FICA 2PULA 4KSQA 4OBQA 2B9IA 3KKVA 4G34A 4RC4A 4XH6A 4I3ZA 5FLFA 3CEKA 1JAMA 3R22A 3ZDUA 5KMMA 1DO2A 2RRUA 3K3IA 2EKKA 1VEBA 5JI2E 3NDMA 3FPQA 2ZAZA 4IANA 2XK3A 5DNRA 3IW5A 2X8IA 3GNIB 2JZ0A 1GOLA 4OT5A 3RMFA 4CFVA 4CYIA 5HE1A 3B89A 4UWYA 4P7EA 5CU3A 5KUPA 2PMNX 3LCVB 3MFSA 3TV6A 2YIWA 2YJSA 2JY7A 2ACXA 4FT5A 4FKJA 4QPSA 2C68A 3Q9YA 3M42A 2WFYA 2V0DA 4O0VA 3REPA 2JDOA 4Y72A 3IK3A 4CNHA 5BQ0A 2GQGA 2X7GA 4R71A 4KNBA 2WPAA 1H1PA 4HPTE 4XV3A 4YTIA 1R39A 2XIXA 3PRFA 4TKSA 1R78A 4C62A 3LQ3A 2CLQA 4Z16A 1PYEA 3W8LA 2JBOA 5LXMA 3TNIA 4AS0A 3ETAA 1O6LA 3COKA 3AMAA 3FI3A 5L2TA 4HYIA 1YDRE 2PVMA 3TI1A 2GHMA 4FNWA 3R9OA 2WQNA 1PMUA 4DFYA 1E1XA 3LMGA 3JR1A 5J9LA 2YCRA 5JGDA 4AGWA 3EMGA 5IEVA 3FMHA 2JDSA 4ZLYA 2GSFA 3L9LA 3FUPA 1JLUE 4D2RA 3A7FA 4E4NA 1MRUA 5M07A 3KK9A 3F5GA 3CY3A 1H1RA 4QMVA 4HNFA 2GTMA 2W0JA 4D0WA 4O82A 4DG0E 1CKPA 2G1TA 2YEXA 3PRIA 3COMA 3HA6A 3RGFA 2XH5A 3PFQA 4I92A 3RKBA 4BCKA 3EYGA 5IQIA 4BKYA 2PK9A 4ZZMA 3BLHA 3BELA 3KRXA 4OTPA 4W8EA 5J95A 4BIBA 4CQGA 2UZLA 1FINA 2UUEA 3T9IA 4LG4A 2OW3A 4TNDA 3KB7A 1PMEA 4MYGA 4Z7HA 5EDQA 3QKKA 3W32A 2FUMA 3QA0A 5B2LA 5I9VA 3MVMA 3NNUA 4QP9A 2CJMA 4D2PA 2F7XE 5IQBA 4O0WA 3H0YA 4H1MA 3CPBA 2YM5A 4O1OA 4F2LA 5CZHA 4BDGA 4FSTA 3UC4A 5C1QB 4HJOA 3BHHA 4IM3A 4UEUA 4FV7A 4Y8DA 4KIQA 5CASA 3FKNA 2R64A 4DH1A 1PJKA 4YNOA 3V5PA 4JI9A 2YIXA 3BEAA 4IJPA 4B7TA 1UU8A 3NX8A 3LFDA 3RP9A 4HYSA 1FVRA 2OF4A 2JUJA 3RINA 3D7TB 4ACMA 5B7VA 3CE3A 3QCYA 5CAQA 3FL5A 4OUCA 4GEWA 3HVCA 5FEEA 4W9WA 3D0EA 4L00A 1PW2A 3BQRA 3GU5A 4FZ6A 4AGCA 5DR2A 4E3CA 3D2KA 4D5KA 3OEZA 4F9CA 4MBJA 2W4OA 3KMMA 1A06A 4LGDA 5AP5A 3V5TA 2BZKB 3AC2A 3A7HA 4NSTA 3F7WA 4F63A 4TYHB 2OF2A 4MXZA 3ZFYA 4BDCA 1M17A 1O6YA 3DBCA 2A2AA 3C1XA 3B8RA 3IPHA 4PL5A 3LFEA 3PVBA 4GIIA 4XRJA 3RPOA 3VW8A 3EZVA 3VNTA 4RQVA 3NUUA 4DITA 1SMHA 3QD2B 1SZMA 2WMBA 3DPKA 3MH3A 4L52A 2VWVA 4QMLA 4KBAA 3F2NA 3CJGA 4XG2A 3VS6A 2PY3A 1Q8WA 2XNOA 3C0IA 3T8OA 4BBMA 3HP5A 4I94A 4D9TA 4P5ZA 5JK3A 4NIFB 3UYTA 4EUTA 2OOAA 4G31A 5E8YA 3EFLA 4IX4A 2WNTA 3BU3A 4ARKA 4FT0A 3F88A 4I6QA 2H9VA 3NR9A 2ONLC 5AUVA 4U3YA 4F7SA 4EK6A 4BBEA 4BCFA 5KMOA 3LOKA 2Y4PA 3QHWA 1V0OA 1UKIA 4LGHA 1BUHA 2WQBA 4YJTA 4BL1A 1M2QA 2EXCX 4ACCA 3G9LX 4A9SA 5AV2A 3DTWA 1RDQE 5DN3A 2Y6MA 4ZSJA 4MCVA 3SA0A 2A0CX 3ID6C 2XNPA 1PMVA 3FKOA 3KF7A 3OEFX 5AX9A 4G6OA 3FMNA 3M2WA 3QZHA 4KRDA 4XBUA 4JAIA 3I6UA 3F5PA 1UU7A 2PMLX 3C0GA 5C8MA 3FV8A 3RWQA 4ACGA 1ZMWA 3A8XA 5EYKA 3BYSA 3H9RA 3LZBA 2EB2A 1CTPE 3FI8A 4J97A 3WZUA 3DZQA 3Q60A 4RVMA 2IZUA 3PA5A 4M15A 2V22A 2W4KA 3LJ1A 4EBVA 4F7JA 3AMYA 3NIEA 3RHKA 3Q53A 2UZVA 4EQMA 3AC5A 2Y9QA 2QSFX 3VVHA 3IW7A 5HO7A 3AC3A 3FLNC 4NT4A 1JSVA 4QP7A 1J3HA 5AMNA 5AIRA 2WMAA 2BILB 3E8NA 4O84A 4I5HA 4BYJA 1ZZLA 3FMDA 5BUEA 3NWWA 5AUXA 3W1FA 4FEVA 2JZ1A 5FTOA 4PNIA 2QI8A 4XCUA 2QOQA 3TTIA 4BZOA 5M55A 1A48A 3UZTA 5CAUA 3DBQA 4UZHA 3JPVA 3WZDA 4DFUA 2ETMA 5BVOA 5CX9A 1H08A 2YDKA 5CTPA 4QYEA 1X8BA 3O8TA 4FG7A 2XNEA 4B9DA 1VYZA 2IO6A 4DT9A 4CFFA 4X6QC 4WHZA 4E6QA 4QPMA 1WFCA 5IZFA 2LAVA 2XK8A 1UU3A 1WBOA 4B0GA 3H4JA 4F4PA 4P2KA 4BHZA 5I5ZA 3O2MA 3OCGA 1TTEA 2YCQA 1B39A 2WELA 4IM2A 2UW4A 3QD4A 4LV5A 4MQ2A 4OR5A 2UZOA 2QU6A 1HQYE 3II5A 1W84A 4IM0A 2Z02A 1YW2A 4RJ5A 5D12A 4A7CA 4CZUA 2BUJA 2X7OA 3C4CA 4U40A 4F64A 5G6VA 5JQ5A 4IFCA 3TACA 4F65A 3ZYAA 4B6LA 3RVGA 3DBEA 4DC2A 2J51A 2P2HA 4W4WA 3FLYA 4FC0A 3VBYA 3NLBA 3EL8A 3OW4A 5ETIA 4YBJA 2C47A 4FSUA 5GZ9A 5BUIA 5CAVA 2C6IA 4EH4A 4ZTNA 1L8TA 4U41A 3KXGA 3QTRA 2JNHA 3RPRA 3MMPA 3R28A 4A4LA 4RMZA 5L3AA 4YLKA 3R2YA 2G2HA 4QRCA 5EYMA 3ORMA 1G41A 4Q5EA 3R8PA 3AOXA 1OM1A 4FT3A 4DEEA 4GVAA 5LVNA 4FE2A 4CMUA 2ITWA 2CP8A 4ITJA 3NYOA 3OOGA 4D1ZA 4JX7A 3IDCA 3HRBA 5HNIX 4EQUA 4J71A 4O0SA 5EQEA 2OKRA 2B3TA 4FTJA 4I4FA 3VBQA 2AC3A 4EH5A 1DO0A 1YI6A 4K2RA 3Q6UA 4EOLA 5J7BA 3GCVA 2W99B 4XV9A 2UZEA 3FY2A 3UP2A 3DAKA 3AD6A 4RWJA 2R3OA 1OPLA 3O51A 2PMOX 3MIYA 4LFIA 3R9HA 3VS7A 4IJ9A 3ZTXA 4G3CA 3GEQA 3IONA 3EKNA 5K0KA 5AV0A 3RK7A 3ZLWA 4O7YA 2UZUE 4YO6A 1WBPA 5F94A 3RK5A 3EN9A 2ESMA 1BL6A 4YU2A 1H1QA 2G9XA 2O63A 4USFA 3FMEA 1W83A 3BYOA 2ITOA 4AW5A 2Y7JA 4YO4A 1OITA 2FB8A 4G3OA 1KE9A 4C59A 4KWPA 4RX9A 3SVVA 4EHEA 3QU0A 4ZEGA 3WZEA 3HV4A 4C3RA 2PYWA 4XG6A 5HX6A 2WMVA 3DFAA 3UP7A 2KTYA 1CSNA 3ENMA 3R7EA 3NYXA 2BTRA 3WYYA 5L2IA 4I0SA 1J7UA 3UOLA 2FO0A 3DK3A 3DZOA 3SXSA 4LOQA 2AUHA 1RJBA 1JQHA 2GCDA 4M66A 5BMMA 3ZM9A 4FZDB 3LFFA 2GPHA 4I1ZA 3UOJA 1PXNA 3OVVA 2DNAA 4FT9A 4JXFA 2X6DA 3R1NA 3ZSIA 2OU7A 2XBAA 4D58A 4H3QA 4BTKA 3OC1A 2P33A 2PVRA 3ODYX 3OUKA 4ZJVA 1M2PA 3LM0A 5HE0A 4QNYA 4DBXA 3EFKA 5JSMA 2ZB1A 2C6KA 2W05A 4QMWA 3VHEA 2UW8A 1XH4A 5JN2A 3GBZA 1PY5A 5CYIA 3ZLSA 1PXLA 2WMQA 3QCXA 5EI8A 3SKCA 4E93A 4O86A 4RC3A 2J5EA 1Q5KA 2VGOA 5JRQA 2EXMA 4QTBA 5EOLA 3KREA 4QYFA 3EQIA 3GP0A 3UNJA 1OTRA 5AP0A 3P78A 2Z7QA 4A9TA 2OJJA 2VTNA 2C5NA 4QD6A 4F09A 2BPMA 3KXHA 4S33A 4YMJA 5HBJA 2GS6A 3HL7A 5K5NA 3TWJA 4YJPA 4H1JA 3R7UA 3TXOA 4FR4A 4BIDA 4QMYA 5KNJA 2CWBA 1CKIA 5DWRA 2JC6A 3PA4A 3Q9ZA 3GCSA 4HZRA 1WVWA 3V8WA 2WOUA 2WTVA 2GNGA 3P08A 4E4MA 5IQHA 2XS0A 1JVPP 3QF9A 3CQUA 4W9XA 2ERKA 3RBWA 4JQEA 3SHEA 4AA4A 5TOZA 4FKUA 3EZRA 3AD5A 5K4JA 4Z3VA 3SW7A 5M4IA 1APME 4I22A 2SRCA 4YC8A 2XBJA 3GB2A 1CM8A 1ZOGA 3QWJA 3O96A 4E4LA 3W2CA 3R9RA 2R3JA 3PXYA 3TUDA 1PXJA 4FSMA 1XXHE 2B7AA 3FLSA 4FV5A 4RWLA 5KHXA 4KSPA 5E91A 1XB2B 4WIHA 5HLWA 5FXRA 2QG7A 2J2IB 3GU6A 3S0OA 3CY2A 4BWKA 2CNVA 3LJ2A 1Q24A 4APCA 4EK4A 2VUWA 4USDA 4EWHA 5LWMA 5HICA 2C6MA 4JG8A 4F7LA 3BE9A 3EQBA 3Q2JA 3WF5A 2OO9A 3G2FA 3U4WA 2YLFA 2XIKA 1Q99A 4ZY5A 4AT4A 4Y5QA 4FOBA 5AP3A 4AZFA 3OY1A 2XIZA 3RK9A 1KSWA 4E6DA 4A06A 5TR6A 5IA5A 4RFYA 5BVNA 5CSPA 3S00A 1M52A 3MGYA 4NM3A 3ANQA 3MVHA 4MK0A 2MJ5B 4HW7A 4F08A 4D1SA 4DA5A 3ALNA 4RQKA 4RG0A 2R3RA 2V55A 3AXWA 3NW7A 2VWIA 5I3RA 3BBWA 1H0VA 3NUNA 3H0ZA 4ASDA 5HE3A 5CF5A 2L4EA 4HYHA 3UVQA 3HV3A 3JVSA 2PE1A 4AT5A 5IA4A 2DAGA 4BHNA 4L9IA 3TNQB 4NKSA 5EHYA 3NYVA 4GL9A 5ANDA 2YCFA 3EKKA 5BNJA 3BV2A 2GQSA 2YLEA 4O0XA 2XYNA 2PVNA 5AV1A 3R7GA 2BFXA 2ZTCA 5CVHA 2BALA 4ZTMA 3UDBA 4WBOA 1VEGA 5EOBA 5L8JA 4F9AA 4R78A 3CLYA 5DFPA 3QX4A 1P4FA 3A7JA 1U54A 2W1CA 3EQCA 3MJ2A 2KNVA 4CMTA 2I0EA 3ZCLA 3H10A 2I7QA 4MKCA 1LP4A 5E9EA 3VAPA 2EXEA 2CGUA 4QMNA 3E8DA 3P9JA 3I81A 3QA8A 1XH8A 5DIAA 2B0QA 1OAIA 4ZOGA 5H2UA 4TWPA 3NPCA 4ERKA 4FTMA 3SQQA 2V62A 4NJ3A 4Y85A 3PXRA 2IWIA 4CKJA 3ERKA 3RJCA 1ZYSA 4KIKB 2W96B 5H9BA 3GLGE 4F6WA 3BYMA 2R3IA 3QTUA 2A19B 4HNIA 5EKOA 5I9ZA 2PZPA 3LXLA 5HG8A 4FSRA 1OIRA 2KULA 4BICA 1YXTA 3V5JA 1ZMVA 5LMKC 3EH9A 3HV6A 4B8MA 1M7NA 3DXNA 2MR9A 4ZK5A 3FQSA 3JY9A 2G01A 4C4GA 5CQUA 1KE5A 4M8TA 3H30A 3N4VA 1MN3A 1PKDA 4O1PA 3WOWA 4B99A 2VTPA 2ZV8A 5AUZA 3PIZA 5LVLA 4DYMA 3VUIA 4E4XA 2QONA 2Z60A 2QD9A 1IAHA 3WIGA 3BIZA 5BUJA 2XYUA 4ZTLA 3VQUA 5AEPA 3C5IA 2WD1A 4IB1A 4GK2A 2VD5A 3VRZA 3VUTA 3ZO2A 1KOAA 3CQEA 3MJ1A 1QPEA 5DE2A 3ATSA 4GU9A 3FI2A 5C03A 1H24A 3W2RA 1GIJA 5CF6A 3PVGA 3OCBA 4IC8A 3ZEPA 3MH0A 4PMSA 3KC3A 5GJFA 1H1WA 4QMSA 3IGOA 4PF4A 2HZ0A 1B6CB 3PJ3A 4LL5A 3FZSA 3JXWA 3Q32A 4FKOA 3ZRKA 1HOWA 4F1OA 3F82A 2B9HA 5CQWA 5FRIA 5K3YA 3CD8A 5L6PA 2CHLA 2NRUA 2YM3A 3E3PA 3KXMA 3UNZA 2VX1A 5EI6A 5L6OA 5EM7A 1DAWA 3G0EA 4YZBA 1OKYA 3FI4A 2VWYA 5H8GA 3QQHA 3KF4A 3KXXA 2X7FA 4YJSA 1J1CA 5CVGA 2CCHA 1ZARA 5HQ0A 1W0XC 4RT7A 4FUYA 4FEXA 4BTFA 2G2FA 5AIKA 3DXPA 2IW6A 4I6HA 5IUGA 3P7BA 2ITZA 4TYEA 5AJQA 4BTMA 4EOIA 5ANIA 3D7TA 2HZNA 1LR4A 3OWJA 4CFWA 4EH3A 4EK5A 2O5KA 3V5QA 3W8QA 3PY0A 5CT7A 3ZO4A 3SAYA 2ERZE 2C6DA 2W06A 3LCTA 4FSYA 5AR3A 1ZWSA 4RZWA 2X81A 4EJNA 4GT4A 4GYIA 3QKMA 4Y73A 4HYUA 3LMIA 1GO5A 2JEDA 1WCCA 3QTSA 4EHGA 4JDHA 1NW1A 3ZZEA 5CAPA 1UA2A 3R1QA 3IW4A 4V01A 3KXZA 2R3MA 4R3CA 5CEOA 3TZ9A 4C0TA 4YJQA 3VJOA 4IXPA 3I0OA 4WG4A 4E8AA 4K77A 3E63A 3UIMA 1SNUA 4L3LA 4LGGA 4R7HA 4TPTA 5JRSA 3VS3A 3QLGA 3OXIA 3DQXA 4FIHA 1YI4A 2J0IA 3OG7A 5KZ0A 1C7YA 3RAKA 3TKIA 5L4QA 1OKZA 3Q4TA 3FMJA 3DKFA 4Y5HA 4AACA 4Q9ZA 3DQWA 4UZDA 5CXZA 5M51A 1OL6A 4JIAA 2WHBA 5KCVA 3GC8A 1IA8A 2HW7A 3FXZA 1FVTA 4WKQA 4CD0A 3ROYA 4KABA 3EJ1A 5C01A 3D7ZA 4J96A 4GFGA 4K1BA 3S2PA 4DG2E 2RGPA 3TIYA 3TIZA 5EM5A 1CDKA 3F2RA 3FZRA 3MY5A 4G5JA 2W4JA 5E8XA 2BZIB 2QHMA 4M69A 4FKTA 2QOBA 5ANGA 1VQ1A 4UN2B 2O3PA 3NZ0A 5KHWA 4BC6A 4L01A 3LAUA 4CXAA 4RIWB 1KE6A 4UV0A 3P79A 3HDMA 1R1WA 1SNXA 3QLFA 2OXYA 1V1KA 2O8YA 5IMXA 4PY1A 5CU0A 4FK6A 4JOAA 4QP3A 1ZRZA 1FOTA 2C3IB 4WT6A 4WNKA 3ZU7A 3FAAA 5LVOA 4P5QA 5CSVA 2CGWA 4AE9A 4MWIA 4D4YA 4EL9A 2C4GA 2CKEA 4RGJA 4EI4A 4I6BA 5FWKK 2YM7A 3O50A 4AZVA 3GCPA 4BDAA 5LVMA 1XH6A 3BHTA 4QNAA 5E90A 4AFJA 2WU7A 3CP9A 4CTCA 5M44A 4RIXB 3MIAA 4PRJA 4J7BA 2HZIA 5JFWA 2IVUA 4IBMA 3KEXA 1XBAA 3NCGA 3UC3A 1OVEA 4NW5A 1FVVA 5DT3A 3C4WA 2JFLA 3BGQA 3PPKA 4NH1A 4YZMA 4EYMA 3PSBA 4AOJA 4YUQA 2Y4IB 5J79A 2O65A 3E8EA 4NM7A 4FTOA 2OICA 1PF8A 3WE4A 2R5TA 2ZTDA 4GK4A 3FZOA 5L8KA 2LTUA 4GIHA 4BIEA 4FV9A 3R63A 4BTJA 4WOVA 3FHIA 4ITIA 2A1AB 3ACKA 1U54B 2LVNC 5FTQA 5H8EA 3U4UA 2BRHA 4CFXA 3VF9A 4AF3A 4C4FA 5K5XA 3NVKI 3LXKA 4P90A 4EOJA 2OJGA 3RAIA 2CMWA 4BZDA 5J5SA 4OGRA 5FM3A 2E9VA 2WEVA 4PMMA 2VX0A 4QMPA 3VW6A 4I21A 1WVXA 1Q8UA 3LJ0A 4L53A 1Q41A 2GNIA 1ZXEA 3KRLA 4YZ9A 4BCJA 4DEGA 2YACA 3P5KA 4J1RA 5CXHA 3ROCA 3U6HA 2WTIA 1NVQA 4JT3A 3QQLA 4KKGA 3TV4A 4CT2A 3U54A 1JKLA 3NMUF 1Q62A 2ITPA 5ACKA 2B55A 2JKMA 4FKLA 1GAGA 5KMLA 1OUKA 5AWMA 2OWBA 4BCHA 4FTRA 4D1XA 2XEYA 3F92A 2BHHA 3UO6A 4QTDA 4EH6A 3DB6A 4QMTA 5AM7A 1Q3DA 1U46A 1NA7A 3ZONA 2XK7A 2P55A 4D2TA 3DCVA 4EZ5A 2Q83A 3OW3A 4FV4A 4F1MA 4FIJA 5HIEA 5FDXA 5AUUA 4XV2A 4IX6A 1P2AA 4GKHA 4YHFA 2X6EA 4U80A 5EW9A 3D14A 2FA2A 3JS2A 5HBHA 2H5XA 3F9NA 3G6GA 4ZXTA 4NM5A 1AQ1A 3DY7A 2BWEA 2DHYA 2ZDUA 3HRCA 2QOHA 4ACDA 3B2WA 4O0RA 5DGZA 5E8WA 4XG8A 3LCUA 2PE0A 5DRDA 4EKKA 2JIUA 3K9PA 4FV1A 4CLJA 3CSVA 4EEVA 5JGBA 4AGDA 2OO8X 5M09A 2OXXA 3F69A 5FXQA 2WTKC 4BRXA 3FBVA 2YDIA 4E20A 1QCFA 2PU8A 2BTSA 2PVJA 2BAKA 3GENA 5KMNA 1NY3A 2BZJA 2VWZA 5J8IA 4EH7A 2FVDA 3ZUUA 2CNQA 4FNZA 3L8SA 3FZTA 3QBNA 4KBCA 4IZ7A 4FUXA 3LKMA 2BCJA 2OJFE 4DG3E 3EQHA 4UXQA 4V0GA 4YZDA 2X4ZA 3V6SA 1TQPA 4E73A 2DUVA 2PZYA 5HU3A 1H00A 4ALVA 3AT4A 4H36A 2ITTA 2XKCA 4XEYA 5JFXA 3PIXA 1DS5A 1QZEA 3BHUA 5JQ8A 4C4JA 2CDZA 2YM4A 3LMHA 2ZMCA 4FIGA 4MXCA 5ITAA 2XKDA 3IKAA 3UIUA 4ZZOA 2PPQA 3N4TA 2UZBA 2P4IA 3BBZA 2OIBA 3OD6X 5HO8A 3MY1A 3C4EA 4AZTA 4YJRA 5T68A 3OTUA 4FKRA 4R8QA 4ZS0A 3HMOA 1G4AE 1ATPE 3WYXA 4LMNA 5IMEA 3DAJA 3LFAA 4PQNA 5E1SA 4ZTHA 5KBQA 2F9GA 3QHRA 2PVKA 2XF0A 4HZSA 2CSNA 4JDJA 5TT7A 4XOZA 4NTTA 3E62A 2LGCA 5GIOE 2W5HA 3FHRA 2G2IA 2R3FA 3GCUA 3ORNA 2RG6A 3D9VA 3Q4ZA 1VYWA 3K5UA 4RJ8A 5IF1A 3E46A 2W1EA 3PZHA 4TY1A 2XNBA 3G15A 2Z7LA 4L45A 4F0GA 4JR7A 4UB7A 2JIVA 4M0YA 4UYAA 2DI0A 2EVAA 4YTFA 2OOBA 4MBIA 3WIKA 4PUZA 1B38A 3TDWA 4MVFA 3RCJA 4QOXA 4FIIA 2X9EA 1KWPA 2J90A 2R9SA 3SXRA 4QQTA 3NVMB 2QO9A 3HLLA 1BMKA 5C4KA 2F7ZE 3V6RA 4FGRA 5A3XA 2O0UA 3UO4A 4YPSA 2ZV2A 4UY9A 4EOPA 4AZWA 4XV1A 2PUUA 3ZHPC 5KO1A 5TE0A 1QL6A 4WP2A 5DYJA 4IIRA 4IX3A 1VZOA 4YLJA 2XP2A 4O83A 4M69B 4FL1A 4WNOA 1J1BA 2NO3A 2ZJWA 5GIPE 3KL8A 4RVKA 4ZLOA 3CC6A 4AN9A 1GJOA 1OI9A 1OBGA 4FMQA 4CEGA 3FQEA 4WNPA 5DG5A 3F5XA 5FG8A 5FDPA 5I3OA 4G5PA 5JZNA 2IG7A 3QX2A 1WBSA 4ASEA 1H26A 3CTHA 3ELJA 3EQDA 4NFNA 1FBNA 3FWQA 4FNYA 2W9ZB 4DN5A 3QZFA 3G90X 4HCUA 4RX8A 3FEGA 4F9BA 3TJDA 4FVRA 1JKTA 2BDWA 2O2UA 3HA8A 4NTSA 3SOCA 3EN7A 3VQHA 4RLLA 1I09A 5CU2A 4I0TA 4ZTSA 3LHJA 5GNKA 4DGNA 1GIHA 2G15A 5DH3A 4D4VA 3I6WA 4U6RA 5HTCA 3EWHA 2L4FA 4JBVA 4K9YA 5LCJA 4A4OA 4R3RA 2HZ4A 4PDOA 1UWHA 2BMCA 4PDPA 3NGAA 5IA2A 3ORTA 1IASA 4I0RA 2W1HA 4XNEA 4DTBA 4QTAA 4YNEA 4C61A 1OMWA 2UZWE 3WI6A 2WO6A 5DBXA 3TUCA 4BKJA 2HWPA 3LPBA 1H01A 3P23A 3R2BA 4O22A 3GLHE 4K11A 4GV1A 4YC6A 5KKRB 3MPMA 3I79A 4G6NA 5J9ZA 2QR7A 1Q8ZA 4FTUA 4QMMA 1VEKA 4M12A 4QP2A 1ZYJA 4MXXA 3FPMA 4FVQA 4OLIA 1TQIA 2A27A 2W17A 3UE4A 3UO5A 1OPJA 5ETFA 3K5VA 4O2PA 1H8FA 3VUHA 1LPUA 2ITNA 2R2PA 4QP4A 4QYGA 5HD7A 3TEIA 2DWBA 3IECA 4GG5A 5FEQA 4YZNA 2R3HA 3PUPA 2AYPA 1O6KA 3TNWA 2VTTA 3C5UA 3KN5A 4IVBA 3GFEA 2GNHA 2WQMA 4WNMA 4YJUA 3CS9A 3ORLA 5A14A 5KZIA 4HGEA 1W8CA 4M84A 1YWNA 2IVVA 2CCIA 5BYLA 4O0TA 4TRLA 2EB3A 4IADA 4QT1A 4IAIA 3VJNA 4W4XA 3D5WA 3DT1A 4ZSLA 5AP6A 5F20A 1KUTA 5IDPA 5F1ZA 5IU2A 3ULZA 3VS1A 4L43A 1TQMA 4FEUA 4K6ZA 4A9YA 5M4UA 2PL0A 2WB8A 3QWKA 3S95A 4BCGA 1P3QQ 4FKSA 1YWVA 2JITA 1CKJA 1URCA 3ODZX 1WBTA 4TWNA 2ZM1A 3POZA 1KV1A 1P5EA 3EQGA 1PKGA 4TWOA 4IAZA 4G17A 3UIXA 4OAVB 4DFNA 3KA0A 4ONAA 4UMUA 2C5OA 3H9FA 3DS6A 5AUTA 2OJ9A 1LUFA 3PYYA 3IS5A 5FQDC 1J7IA 4UYNA 4Q5HA 3QKLA 3TZMA 4MD8E 2OH4A 1NXKA 1XBBA 5IDNA 5AV4A 4S34A 4U43A 2JY8A 5IQGA 3HKOA 1WJ7A 3R83A 4MBLA 4KIKA 3QXOA 3R0TA 2I0YA 2XJ0A 1GIIA 4C36A 2VTQA 5AUWA 5HE2A 2I1MA 3P4KA 4RJ3A 4ANLA 4V0GB 2QOIA 2R0UA 2O25A 1AGWA 5HGIA 4O91A 4C34A 4LM5A 4DHFA 2JIIA 4H3PA 2GQRA 4XLVA 4H39A 1T6OA 3FMKA 3OBGA 3QQGA 2BKZA 4JQ8A 3ZRLA 4WG5A 1FMOE 3L1SA 2WQEA 2WTJA 3D15A 3EQFA 2UZTA 3LW0A 4MQ1A 4QP1A 2GS7A 2UZNA 3RWPA 1PXMA 3FMLA 2J9MA 3ZRMA 2KHHA 3NW5A 4F6SA 4JVGA 3DK7A 4GT3A 4LOOA 2IJMA 4O96A 2CPKE 3F3TA 3MWUA 3COHA 3T3UA 3UODA 5HZNA 2H8HA 3UVRA 2DKLA 4RZVA 2H34A 2RFSA 1YXVA 3P86A 1JNKA 4RWKA 3OWPA 4LV8A 5B0XA 4C3PA 3AC4A 4L3JA 1ZYLA 2BRGA 4UWBA 3KVWA 5K9IA 2QNJA 5D1JA 3PVUA 4APPA 3RM7A 3TTJA 3T3VA 4YR8A 3BZ3A 3WZKA 4AX8A 4U45A 4R77A 3NRMA 1WR1B 3OWLA 4YLLA 3BRBA 2P3GX 3NW6A 3I60A 1M14A 3QGWA 4DFLA 3MA6A 3V51A 3QRUA 5CENA 2W1DA 4BI0A 2LVPC 4D9UA 3UOHA 3LCSA 1IXSA 4G9RA 1QPJA 4IFGA 4V05A 3EN4A 3HNGA 4HVDA 4ORKA 4Y95A 4DBGB 3R04A 4X3FA 4G6LA 4E26A 4C2WA 2EJSA 2IPXA 2WMWA 3PY3A 4PP9A 3PE2A 4DGGA 2XJ1A 3RPSA 4X21A 3PLAE 3NAYA 3DOGA 2QODA 2B9JA 4FTLA 3HRFA 2HXLA 2BWBA 3GU8A 3MSSA 4EOKA 4EORA 4FTTA 1PXPA 2VWUA 1WGNA 3AT3A 3OUNB 4E7WA 5BVDA 5E8VA 2I6LA 5J5TA 4WD5A 3IOPA 4EOMA 3LXPA 4QQCA 1HT1E 3QTWA 4A9RA 4ZY6A 4FYNA 3TN8A 5HU9A 5IQAA 4GUEA 5IEYA 5FTGA 4O7NA 2RFDA 1JKKA 4W4YA 5M06A 3HV7A 2C5XA 3I5ZA 4L6QA 2IW9A 3E21A 1OGUA 3RCDA 2ZMDA 1YKRA 4U8ZA 4EOSA 3ITZA 1LEWA 4G3GA 3QZGA 4NK9A 4DGMA 2F49A 4PMPA 5C26A 2VNWA 4YTHA 1QMZA 4WO5A 5CNOA 4DTAA 3TZ8A 4IVCA 2Y4IC 2Y0AA 3CKXA 3QXPA 5ANKA 3F6XA 5F4NA 3ZO3A 5JGAA 1F4IA 2B53A 4O7VA 2GFCA 3W16A 4RVTA 2W5BA 4R6VA 3SRVA 2VZ6A 1OL7A 3MW1A 4C02A 4CZYB 5IQFA 5EDRA 4C7TA 2RL5A 2WMRA 1IFYA 3CR0A 4N6YA 4ALUA 5AAGA 4PDYA 3AT2A 4XP2A 4ZLZA 5EDPA 1ZMUA 3FYKX 4XBRA 5DI1A 4R1VA 3I0QA 3FDNA 4F0FA 2JDTA 4BN1A 1TR8A 1JSUA 5AP1A 1K3AA 2OZOA 5E8TA 3M1SA 4F9WA 3N9XA 2QO7A 3QD0A 4S30A 4J98A 3WARA 5LVPA 3MVJA 4AZSA 2KNZA 5FXSA 5ETAA 2EWAA 1KE8A 2I40A 3ORZA 1IM2A 5C8NA 2ZYBA 3BU5A 3GI3A 3L8VA 2K0BX 2QOLA 5JMSA 5HIDA 4FYOA 2VTAA 4PTCA 5L2WA 5M56A 4AA5A 2QLUA 4RIWA 4C58A 4XHKB 4MD7E 2L2DA 4RC2A 4DLJA 4LRKA 4XG4A 4IB5A 2OZAA 5C9CA 4OTFA 3ZBXA 3VBWA 5IPJA 4FKGA 4IW0A 1F0QA 1Q8TA 3EB0A 3EFJA 2W1GA 5CU4A 5BVWA 4DH8A 3UZRA 1OZ1A 5HX8A 4IAKA 3R7OA 4EH2A 3V04A 3VUGA 1V92A 4ZZNA 4XUFA 4FL2A 5BYZA 2UW0A 4CV8A 4JRVA 4S31A 5DMZA 3IW8A 3F3WA 4H58A 5D41A 3VBVA 3K3JA 3SG9A 5KE0A 3QYZA 4ZAUA 4FNXA 4RIXA 5CNNA 3RPVA 4E5BA 4L42A 2C0IA 3GU7A 3PE1A 4C37A 4IQ6A 1Y8YA 1U59A 1YXUA 5FBNC 2B52A 4YJVA 1S9JA 4RJ6A 1XWSA 4A4XA 3TDVA 2QOKA 3IGGA 3CKWA 2IZSA 3ZM4A 4ENXA 3PP0A 2Z2WA 4RPVA 3IDPA 4KINA 1PXKA 3LFNA 3OCSA 2OJIA 3DLSA 3PJ1A 3WF6A 1HJPA 4O38A 1UU9A 2V7OA 3EN5A 3NNVA 3FJQE 3MTFA 4P4CA 2DAMA 2C1BA 4IACA 4L8MA 2E2BA 5FEDA 4AUAA 3SW4A 2O64A 5CEPA 3W2OA 2WMTA 5AR2A 2V5QA 4N70A 4IWQA 3PZEA 4JR3A 3KQ7A 1YXSA 3BX5A 3PPZA 5CEQA 5A4LA 3IQ7A 5AR7A 2CGVA 4KB8A 4DAWA 5HVJA 2PZRA 4EK8A 4MNEA 2VX3A 1Z57A 2HY0A 3G33A 3CTJA 4DEAA 2LVAA 5EK7A 2R3QA 1Z5MA 2WU6A 3I5NA 3PSCA 4KKEA 5GJDA 2GS2A 5IA0A 2JDRA 3F3ZA 3OFMA 2LVOC 4OTRA 3PJ2A 3CBLA 4JBOA 3R9NA 4EK3A 3P0MA 2RF9A 3PY1A 4L7SA 4DT8A 4B8LA 2RSVA 3RHXA 3VRYA 1OL5A 3Q4CA 4IZAA 4L7FA 4CFNA 4YTCA 2YISA 5EYDA 5M4FA 3RTPA 1Y6AA 4DEBA 5M53A 2FSMX 3MH2A 3QTQA 4X7QA 1R3CA 5D9HA 4NU1A 4PV0A 1EH4A 3PA3A 4OT6A 4BF2A 3QQKA 2X2MA 4ZMEA 2VRXA 3KN6A 2GTNA 3VC4A 4OBPA 4TYJA 3MTLA 4K33A 3QD3A 1MRVA 3GQLA 4J99A 4ZSAA 3BEGA 3IDBA 4TYGA 4FTQA 5J1WA 2RKUA 3L9PA 3FE3A 2NPQA 4X3JA 2Q0NA 3PJ8A 5FP5A 1U4DA 3ZOSA 4RA5A 4TNBA 3A99A 3A7IA 4CZTA 3I4BA 3UGCA 2QQ7A 3R30A 4FV0A 3GVUA 2HK5A 3ORPA 4JQ7A 1R0PA 4M0ZA 3U6JA 4R3PA 1YXXA 4CGAA 4FZAB 2C0TA 3O8PA 5E1EA 2PUPA 4GW8A 2XNGA 4C4HA 2IN6A 4DH7A 4C38A 2OI4X 3FQHA 2K9DA 2HWOA 1XH9A 3MFRA 5IQEA 4X3FB 5HHWA 4FV8A 5JH6A 3MN3A 4O7RA 1UKHA 4DFZE 1G3NA 3HMPA 4AXAA 3A4PA 3ZLYA 2YWVA 2F4JA 4JBPA 3FRHA 3KULA 2YAAA 3AC1A 2HXQA 3T9TA 4DBNA 3OWKA 2WMUA 5KX8A 2ZOQA 3WILA 3PJCA 4DEIA 1BX6A 1H25A 3GT8A 3SV0A 3P7CA 4X6RA 2B9FA 3BWJA 5CF4A 2X0GA 3CQWA 2JAVA 2CKOA 4HGTA 5CANA 2J50A 2UZDA 3FC1X 3ENHA 2HWJA 4BDKA 4XP0A 2YFXA 4M3QA 3HP2A 1ZV1A 4I41A 3FXXA 4XG3A 3E3BX 4OTWA 4GJ3A 1HCKA 4RFZA 3W33A 5JEBA 4C35A 4NYEA 1XKKA 5E4HA 4FKVA 1OKVA 3WF9A 4TL0A 3N4UA 2WGJA 2LBCA 4ZSGA 4YURA 1OECA 4IWOA 4GU6A 1H0WA 3BU6A 4FSQA 5CS6A 4FEWA 2PZIA 2C0OA 4J95A 5GHVA 2W5AA 3QTZA 4EC8A 5LMAA 5HNBA 4JLCA 5LMBA 4I5MA 3QCQA 4EKLA 3U9CA 1OL1A 4BGQA 4FEQA 2Y6OA 1OUYA 2C69A 2VTHA 2E9NA 2QOFA 2Z7RA 1RW8A 3A60A 4RA4A 3NUXA 4QPAA 5CY3A 5CT0A 3SRVB 3NUAA 2RFEA 3PIYA 3Q04A 1UNHA 3DTCA 4WG3A 4FK3A 1HCLA 4BDHA 4GT5A 1GY3A 2C3LA 3TCPA 2VV9A 3NCZA 4ANMA 4EYJA 4YBKA 4BGHA 4RWIA 5I4NA 1MQ4A 4I23A 4QMXA 2VU3A 3VO3A 4ZIMA 3LLAA 3I7BA 3QYWA 2C5YA 3DKCA 4PPAA 4FSWA 4IAFA 4S2ZA 3R02A 1H07A 3Q5IA 5LOHA 4ANOA 4AE6A 5A6OA 3HECA 3D83A 4NZWB 2XA4A 2QKRA 5CSHA 3VUMA 4IDTA 4AW2A 2GMXA 3MA3A 4CG8A 1REKA 4G9CA 3BLQA 3GUBA 3RNYA 4QMZA 4H3BA 5DT4A 1Q4LA 3RAWA 2YZLA 4O7TA 5A4CA 5KMKA 2PVFA 2OZAB 5BPYA 2UW3A 3GFWA 3UPXA 2CN8A 2QG5A 2PVYA 2BRBA 1WZYA 4IB0A 1Q97A 3NNWA 3KCKA 4WA9A 3TNPC 5ANJA 1GZKA 2EUFB 5AR5A 3UBDA 2XK4A 3JUHA 3LLTA 4LRJA 5G1XA 3BYUA 3VBXA 3V5LA 3E7VA 4GSBA 2QLQA 1NV9A 2DYLA 3HUBA 4FIFA 4L3PA 4JJRA 2YABA 4U42A 3R1YA 4XP3A 3W2SA 2X4FA 1RQQA 4DINA 4GH2A 1STCE 1WAKA 2VN9A 3BE2A 3ZUTA 3KY2A 4ZSEA 4C2VA 5C8KA 5CF8A 4LQMA 3ORKA 3ZZWA 2YWPA 1YWRA 2P0CA 4AW0A 3K9OA 1DV0A 3MPTA 4MF0A 4CV9A 5EW3A 5CWZA 3C9WA 4BFMA 4UMQA 5A6NA 2ETKA 4OTIA 3MYGA 2LVQD 2P2IA 2VTRA 2C6OA 4I4EA 5CAOA 3UQFA 4F7NA 3RM6A 4E5WA 3S4QA 2XM9A 2WMSA 1UV5A 5EG3A 3RZFA 2WOTA 2WXVA 4I5CA 2JAMA 5JT2A 4EONA 4U97A 1YHWA 5M08A 3Q2MA 3QALE 4DH3A 3NIZA 2OBJA 5GZ8A 2FSLX 4NCTA 2H96A 3LFBA 4FG9A 1PMNA 2UW6A 4CVAA 3CCNA 2UW5A 5E7RA 4FTAA 5CU6A 4X2GA 4HVHA 4N57A 4YP8A 2NNWB 3R7YA 5I9XA 2BKKA 4MNEB 5DA3A 3DNEA 3ZO1A 1Y6BA 3R01A 3Q3BA 4O2ZA 3Q5ZA 4YC3A 1QPDA 3S1HA 3MV5A 2YIYA 4IB3A 4D4RA 2KNAA 2PTKA 2XNNA 4PL4A 1XJDA 3DJ7A 1P4OA 2XIRA 4MH7A 3PXQA 4IVAA 4M14A 2XRUA 3UG2A 4XX9A 3D94A 3DV3A 3FYJX 4U5JA 3W2QA 4DCAA 4CQEA 4H05A 3W2PA 3EIDA 2ZB0A 4DH5A 4KIOA 5HO6A 3GLIE 3HX4A 4UALA 1SVEA 2BZHB 3EFWA 1IG1A 5E8UA 1ZY4A 4BY9E 3F3VA 4GK3A 4GVJA 5IQDA 4KS7A 2VO6A 3O17A 4GUBA 3BBTB 3HV5A 1T43A 5EM6A 5K4IA 2BRNA 2XKEA 1FGKA 4M7IA 1GNGA 5HESA 2W1FA 4BCPA 2XB7A 3DAEA 3GC0A 4FKPA 1KYIA 3R1SA 3LFQA 4F1TA 4RX5A 3VHKA 2E9UA 3G6HA 1H27A 4IC7A 4GJ2A 1NVRA 2UW9A 1G5SA 4BKZA 3KRRA 4IHPA 3GCQA 4AW1A 3A7GA 1Q61A 4ITHA 3BHYA 3BPRA 2R7IA 3JYAA 2OFVA 1REJA 3HUCA 4IVDA 4QQ5A 1A5TA 5HIBA 5C4LA 5IH6A 3CJFA 4L44A 2JKQA 3ZSHA 3SOAA 1SG9A 3D5XA 5BVKA 1YLAA 3ZFMA 3FRIA 1ZYCA 4UBAA 3W18A 4N6ZA 4RIYB 5KBRA 5LWNA 1OBDA 3NUSA 4O27B 3P7AA 5L2SA 3KULB 4BWPA 2F2CB 5D10A 4EZ7A 4AZEA 2YZAA 5AFVA 4UXLA 3DBFA 2ZVAA 4DLIA 4QTEA 2OGVA 3FKLA 3ALOA 1MRYA 4MEDA 1PYXA 3F2AA 2EKFA 3QQUA 1IEPA 2XK9A 3C50A 4FL3A 1MQBA 2DAEA 4O7SA 2ITUA 4CFMA 4G16A 4EZ3A 2VTLA 2XM8A 4UMTA 3LE6A 5CZIA 4BCMA 2HIWA 4EOQA 3CXWA 4HCVA 2XKFA 3Q9XA 2W1IA 4CMOA 4DEDA 1ZYDA 5HI2A 1BL7A 2JP7A 4MXAA 5AAFA 3VWAA 1ZLTA 2DS1A 4PWNA 3R00A 4FI1A 1W98A 1IA9A 2YM6A 4B4LA 5CEMA 2G3QA 5M57A 4FKQA 4BB4A 4ANQA 4Q9SA 3KU2A 2CN5A 1ERKA 2GNLA 1YDTE 2UVYA 4KIPA 4YZCA 3U51A 2GHLA 2OIQA 3OP5A 1BVSA 4TT7A 4A9UA 5EQPA 4WUNA 5DOSA 3F3UA 3LCKA 3R8LA 2XEZA 3DK6A 2W7XA 2BAJA 3BYVA 4RRVA 4WRGA 1WIVA 3QRIA 5TKDA 4Z55A 4UMRA 4QO9A 2PVHA 4U44A 4N0SA 2QCSA 4FF8A 3ORXA 2C6LA 4L68A 4O0UA 2V7AA 4QTCA 4V04A 2XIYA 3E93A 2Q0BA 4II5A 4CKIA 4U81A 5K0XA 4R1YA 4EHZA 4U3ZA 4AT3A 2X2KA 3KMUA 3PSDA 5CLPA 1T45A 4MXOA 1T46A 1SVGA 1H28A 3BHVA 4F6UA 5A4EA 5ICPA 1BI8A 4IWDA 2QR8A 5AP4A 2ZM3A 3M11A 3KMWA 4IZ5A 3TJCA 3SG8A 3JY0A 1L3RE 3CD3A 5HTBA 4CG9A 5ACBC 1I44A 3MFUA 4MXYA 2B1PA 4K18A 3HAVA 4JDIA 3A2CA 4ZMFA 3BV3A 4FGBA 1DI9A 1J91A 3SXFA 3L9MA 4XOYA 3W10A 5ETCA 3V3VA 1XH7A 1ZZ2A 4U9AA 4Y46A 2BRMA 4MTAA 4C3FA 2VWWA 4E5AX 3FSKA 4GYGA 3G51A 1YVJA 2HELA 5EH0A 4AWIA 3DXQA 2AC5A 5HKMA 5H3QA 4DEHA 4D0XA 4X2NA 5HCZA 5J87A 3R7VA 4M97A 4BCQA 1Q3WA 2JD5A 4PL3A 3B8QA 5AADA 3BLRA 3I1AA 1PXIA 2F2UA 3TG1A 4AA0A 3VUKA 2PUIA 3LFSA 3IW6A 5LARA 4C33A 3R71A 2EU9A 1DAYA 1VR2A 2DAIA 4CRSA 5IH5A 1YOMA 3L8PA 3O71A 3AG9A 1XH5A 3ET7A 3COIA 3BQCA 5TF9A 5L2QA 3BWFA 4OTGA 4KAOA 3R8UA 5KMIA 4XG9A 1NV8A 2UVXA 3AGLA 4HEOA 4YGAA 2JY5A 3VUDA 4D4SA 4AAAA 2IVSA 4QMUA 5HVKA 3UMXA 3A8WA 4QP8A 3ZSGA 4NFMA 3UMWA 4OTDA 4LYNA 3ZS5A 5EHOA 4TZRA 3WE8A 4JNWA 5CEIA 4FT7A 5EFQA 4EHVA 3ULIA 5AA8A 4IEBA 4BZNA 2CGXA 4PTGA 4NL0A 2OXDA 2GNFA 4EOOA 2BDJA 2RG5A 1NT2A 3C51A 5H8BA 5BVEA 1Y8GA 3HEGA 4L46A 1U5RA 3MFTA 4BWXA 2R3GA 3F5UA 5IA3A 5HCYA 1G8AA 1QPCA 1BKXA 1LEZA 4QP6A 3NYNA 4KD1A 5FBOA 5AV3A 3R7IA 3HMMA 4BDEA 3U55A 3EOCA 2PWLA 2YERA 3GC9A 3OS3A 4WUAA 5CEKA 4DTKA 2BROA 3SD0A 5FM2A 2RIOA 3QC9A 3JVRA 4FIEA 4CCBA 5EI2A 3R9DA 2BIKB 5B2KA 2WTCA 5AM6A 3QTIA 4AQCA 2ITVA 3Q52A 3QUPA 4C4IA 4FV2A 3OZ6A 3U8WA 1KOBA 4GS6A 4CSVA 5FGKA 4D2WA 2DENA 4F99A 2NP8A 1ZAOA 3F61A 3V01A 5A4TA 3PWDA 3AQVA 3MB6A 1OIYA 1E9HA 4YHJA 3A61A 4AU8A 1V0BA 2PVLA 3BKBA 3V5WA 1ZOHA 3LFCA 1VEJA 2ONLA 4X2FA 2FGIA 2R3KA 5AR8A 1ZOEA 4RJ7A 1S9IA 2CKPA 4Q2AA 4FV3A 4IE9A 2E9PA 2QOOA 4AG8A 1YDSE 3BCEA 5HCXA 3QRJA 1R0EA 4CKRA 4ID7A 1FPUA 1PHKA 4O21A 2MROB 3R6XA 4YSJA 1MP8A 2ZDTA 4HCTA 4IZYA 4ZTRA 4BDIA 3F66A 2QC6A 2JKKA 4X3FC 3C0HA 1RE8A 3A4OX 5AP2A 5E8ZA 3QQJA 5HG5A 3O0GA 4O7LA 5AAEA 3ZH8A 4TN6A 2JFMA 5I9WA 4X2KA 5DHJA 5IG1A 4XMOA 1G8SA 3DJ6A 3E7OA 3HGKA 2XNMA 3QCSA 1Y57A 2X1NA 1OIUA 3MBLA 3R8VA 1MUOA 2VTJA 3E5AA 5HLPA 4PDSA 4WBBB 3ZMMA 4CFUA 5FUTA 5HLNA 2BVAA 4FSNA 5HBEA 4BR3A 2OG8A 4JAJA 2WIPA 1KE7A 1W82A 4CRLA 2OFUA 4Z9LA 3KGAA 3PG1A 4N4SA 1WBNA 5T3QA 4JL9A 4MD9E 3EHAA 3ZUVA 3ZDIA 2GHGA 4QYYA 3RNIA 2WKMA 4IDVA 4U7ZA 2YJRA 3VS0A 2QHOB 2BAQA 1BLXA 4FVPA 3LCOA 4HVSA 3OBJA 3PXKA 2C3KA 3I7CA 4ZTQA 1A9UA 1O9UA 1YOLA 1Q8YA 4NKAA 1BI7A 2WTWA 4ERWA 4QMQA 5LCKA 2R3NA 3KVXA 5D7AA 2REIA 2HW6A 2YN8A 2OSCA 3TKUA 1YI3A 2W9FB 1AIPC 3KXNA 3PVWA 4FOCA 3A62A 1OL2A 2C1AA 3P1AA 2GFSA 4RFMA 1OB3A 4O6LA 4FKWA 1CMKE 2QHNA 2WMXA 4FBXA 3UQCA 1TKIA 5ANEA 1EFUB 4D55A 4JS8A 4DFXE 3N51A 4FKIA 4M67A 2J0JA 2OIDA 5C27A 4I93A 5L8LA 2X9FA 5IUIA 5DLSA 3T6PA 4ANNA 4XRLA 2FH9A 4GMYA 4TTHB 4O7WA 3LXNA 2C6EA 5DEYA 5CVFA 4FTIA 5AX3A 1FMKA 3TT0A 3VIDA 2HAKA 3KK8A 3FY0A 4BBFA 4D5HA 2DQ7X 3TV7A 4O81A 4FZ7A 5HEZA 2VTMA 1XR1A 3WF8A 2F7EE 3EL7A 4OW8A 3HYHA 2GU8A 3OTVA 4C8BA 4ASZA 4NEUA 4PPCA 2QU5A 2HY81 4EBWA 3C4FA 1SM2A 3U87A 5A4QA 4MHAA 3QL8A 3BGZA 3RI1A 5BMSA 5EQYA 3QZIA 1JOWB 2WTKB 1UNGA 5DFLA 2BIYA 3ORIA 5JFVA 2UW7A 4KS8A 2VTIA 4YHTA 3VF8A 3GOPA 4BVUA 1JR3E 4WRSA 1YHVA 2NRYA 2X8DA 3HMIA 4D28A 2UV2A 3IO7A 2JLDA 5HVYA 3UIBA 2JKOA 4U0IA 2J0LA 3PTGA 2YHVA 4I6FA 3EYHA 2QO2A 3LVPA 3CGFA 3DA6A 3HZTA 3IOKA 4PX6A 4YPDA 4QMOA 4DF3A 4AOIA 1Q02A 4BCNA 5HG7A 3MH1A 1H4LA 3RZBA 4IAYA 2R3PA 4Z7GA 4CYJA 4LOPA 4AOTA 3ANRA 4OBOA 4HVIA 3UOKA 5DT0A 3QQFA 1SVHA 2WTDA 4M13A 3SLSA 4IH8A 5EKNA 3TKHA 5I0BA 3QGYA 4GCJA 4TW9A 5CSWA 1GZ8A 5EHLA 4EQCA 3FC2A 2A4LA 2ZM4A 3CIKA 3MESA 3C4XA 1ND4A 4IX5A 3L9NA 4LUEA 3WF7A 4MNFA 3HMNA 4YJNA 1WBWA 3K2LA 2F57A 2YITA 5ANOA 3AGMA 3KRWA 2WAJA 3MVLA 5DR6A 4BCOA 4GG7A 3BI6A 3DB8A 3C7QA 5DRBA 2FSTX 3NAXA 1E94E 3NUPA 2DAKA 3PLSA 4J8MA 2VAGA 1M2RA 5A54A 2XCHA 4JG7A 4I24A 5FP6A 4DCEA 5HTIA 3G0FA 4XYFA 4D2SA 2YIQA 2C3JA 1WMKA 5IA1A 4NUSA 4YJOA 2BFYA 2XJ2A 4NM0A 4EH9A 3UQGA 2GDOA 5BYYA 2PHKA 4KUJA 4XLIA 4K0YA 2X39A 4E1ZA 2IW8A 3R21A 1XBCA 4IWPA 1JPAA 2WQOA 3MDYA 1M7QA 2XUUA 3VBTA 3ZBFA 5LQFA 1F3MC 1UFZA 5CI7A 2JY6B 4QYHA 4RIOA 5DVRA 4RX7A 5DPVA 4MAOA 5D11A 5B2MA 3IHPA 2PZ5A 3UZPA 3ZC6A 3KFAA 3R8MA 2OLCA 1XQZA 4PNKA 4BDJA 2HENA 2IVTA 1Z9XA 3GXLA 3SX9A 3ZEWA 3AMBA 3FLZA 4MWHA 3MB7A 4BI1A 4J53A 2C5VA 2GNJA 3OMVA 3BGPA 1XO2B 4ANBA 4K8AA 5LJJA 4ZS4A 2FYSA 4WSYA 3PDTA 4R5YA 1FQ1B 3G9NA 4O6EA 4RVLA 5IEXA 5IISA 4R7BA 1DI8A 4CT1A 3HDNA 3OHTA 4W8DA 5AA9A 4JX3A 1PGYA 3DJ5A 4BDBA 3SDJA 3LCDA 5M4CA 3OT3A 1PRYA 4GRBA 4IAAA 2YM8A 4TXCA 4Y83A 2MGWA 3CPCA 5CSXA 4XJ0A 3G5DA 4FZFB 4ASXA 5BVFA 3E92A 1UWJA 3CTQA 4G3DA 3F7ZA 4ZJIA 4E6CA 1OKSA 4UWCA 4UMPA 4CLIA 1PXOA 4RBLA 3ACJA 4JG6A 2J6MA 2XRWA 4TYIA 2W1ZA 4RJ4A 1JBPE 2BHEA 1VG5A 3LIJA 4ALWA 1G3IA 4AN2A 3GC7A 3D4QA 2OK1A 4DGOA 2Y8OA 4MF1A 5E8SA 3OT8A 5T6KA 3HAMA 4HGSA 3THBA 3QTXA 3UPZA 3OCTA 2HYYA 3DNDA 3H3CA 4NWMA 4R5SA 3V8SA 4A07A 2CNUA 4ENYA 1AD5A 3NEWA 1OIQA 3VS4A 2YDJA 5IQCA 3UJGA 1DM2A 3GLFE 5DEWA 4EC9A 1YHSA 4WSQA 4FG8A 4AGUA 3PG3A 4F9YA 3DBDA 4FSZA 5FD2A 5AUYA 3TZ7A 5HORA 4XS2A 3OY3A 3OOMA 1OQYA 1OKWA 1P14A 3OF0A 1BYGA 3NSZA 4G1WA 5TO8A 3ATTA 4D2VA 3LQ5A 1GZNA 2ETRA 2XVDA 2ZV7A 3DDQA 4LMUA 2QURA 4FTNA 2R0IA 2QKWB 3MY0A 4G3FA 3EQPA 4M68A 3FZ1A 3GU4A 1E1VA 1Y91A 2QVSE 4NJDA 4EH8A 3Q4UA 2XZSA 4USEA 1WGLA 4MX9A 4F0IA 4OAUC 4RLKA 4CTBA 3PXFA 3D5UA 2ITXA 3FXWA 3B2TA 3LM5A 3Q9WA 4KKHA 4YSMA 5F95A 3WBLA 4UX9A 1FGIA 3SGCA 1VJYA 4AN3A 3U6IA 2WZJA 2QOCA 2J0KA 5HOAA 3RAHA 3R73A 4ACHA 2B4SB 2J5FA 3OXTA 4BCIA 5E92A 1UNLA 5IUHA 3DU8A 3E87A 4I5PA 4RIYA 4LL0A 3ZXZA 2RFNA 1KV2A 2I0HA 5F9EA 3UNKA 5IH4A 4Q7JA 3H9OA 4HVGA 4BGGA 3UYSA 1JKSA 2VNYA 3FLQA 1CUKA 3QUDA 5JFSA 3Q96A 1URWA 2XCKA 3C13A 4FX3A 4G3EA 3TL8A 3ZXTA 3GGFA 4FODA 5I9YA 3QRTA 2BR1A 3EQRA 4S32A 5GJGA 1YRPA 2Z7SA 3GOKA 3PPJA 4J8NA 5L6WL 1YQJA 2DZLA 2JGZA 2H6DA 3R8ZA 5GZAA 3VS2A 1SYKA 4GKIA 2YAKA 1WVYA 4PTEA 4GFMA 1W7HA 4KA3A 2J7TA 2VO0A 3D2IA 3TM0A 4L67A 2XK6A 5I9UA 3PXZA 1ZY5A 1WBVA 2VO7A 3E88A 2J4ZA 1IR3A 2VWBA 3IG7A 4OTQA 5IKWA 2JDVA 2OH0E 3U9NA 4BI2A 4JBQA 4LRMA 5JKGA 4JDKA 3MI9A 3QC4A 3D5VA 4LI5A 4F70A 4F1IA 3S3IA 1IRKA 3FMMA 4ZY4A 3AD4A 3CGOA 3FL4A 3EN6A 3O7LD 4G2FA 5J7HA 4DFBA 4RSSA 3C4ZA 4EJ7A 3QFVA 5LMKA 2CKQA 3DKGA 4IMYA 3TUBA 1TVOA 2BDFA 5AR4A 5EW8A 2VO3A 3WZJA 5EM8A 4FA2A 4HOKA 3O8UA 3MPAA 2YCSA 4PMTA 3UVPA 5KKRC 4PPBA 2WEIA 4NCTC 4X0MA 5A46A 2CLXA 4PP7A 1IAJA 1OPKA 4TYHA 1R4GA 3PP1A 5DR9A 5J9YA 3PWYA 4JIKA 5HG9A 2PUNA 3Q6WA 4GFOA 2VGPA 2WIHA 4OTHA 2X8EA 3UTOA 1JSTA 1NVSA 4FTCA 3O7LB 3DKOA 3QAME 4LUDA 4DGLC 2ITQA 4KRCA 2X2LA 1JWHA 2YA9A 3UG1A 2ITYA 2VWXA 4ANSA 5A9UA 4KBKA 4DE4A 3FSFA 5HD4A 4X2JA 3FLWA 1XHAA 2UVZA 2E9OA 3OROA 4JRNA 3KCFA 5CI6A 2PMIA 4NIFA 4ZJJA 3VS5A 4W4VA 3O23A 3DDPA 4XG7A 4FTKA 5KMJA 3AC8A 3NS9A 2J0MB 4TWCA 2FSOX 2VTSA 3E8CA 4AP7A 3GQIA 2R4BA 5AP7A 5J1VA 2VTOA 2ZV9A 3VULA 3KRJA 2C6TA 4GEOA 3W55A 2B54A 1UVRA 1F5QA 5HNGA 3DFCB 1U5QA 2XMYA 3ZLXA 3FZPA 2IZRA 4CCUA 5BX0A 2YIRA 1GZOA 5EYCA 4EWQA 2R3LA 4AFEA 4BDFA 4I20A 2JBPA 4HGLA 5D7VA 5CALA 4O7ZA 3QRKA 1WHCA 2IZTA 4R7IA 3DLZA 1YOJA 2C30A 4EUUA 3LQ8A 3NUYA 4HPUE 4BYIA 3V8TA 1H1SA 2HOGA 4BDDA 3POOA 5GINE 4U79A 3K54A 3ZFXA 3RPYA 1J7LA
chains in the Genus database with same CATH superfamily
2I0VA 4QQJA 4C4EA 3OXZA 3Q8GA 4FV6A 1HT2E 3TNHA 2Y20A 2Z8CA 3DGKA 3L8XA 3QUEA 3MS9A 2KZUA 4FICA 4OBQA 2B9IA 4RC4A 4I3ZA 3ZDUA 3C3DA 1JAMA 1VEBA 4IANA 2XK3A 1GOLA 4CFVA 5HE1A 1JR3A 3LCVB 2YJSA 4QPSA 2JDOA 4Y72A 4OVZA 3IK3A 4CNHA 4YTIA 1R78A 1PYEA 3TNIA 3ETAA 5L2TA 1NSFA 4HYIA 2GHMA 2YCRA 4ZLYA 1JLUE 3A7FA 1MRUA 3CY3A 4HNFA 2W0JA 1YUBA 2YEXA 3PRIA 3HA6A 3BXWA 3RGFA 4BKYA 2PK9A 3KRXA 3BELA 1FINA 3T9IA 2OW3A 3QKKA 5B2LA 4QP9A 4D2PA 5IQBA 4H1MA 3UK6A 4O1OA 4F2LA 4IM3A 3FKNA 4JI9A 3BEAA 4B7TA 3LFDA 1FVRA 2OF4A 2JUJA 3CE3A 3HVCA 4W9WA 4AGCA 3D2KA 3B7ZA 4MBJA 2W4OA 3V5TA 3AC2A 2A2AA 3VW8A 3IPHA 4GIIA 4RQVA 5CI7A 3MH3A 3DPKA 2VWVA 4KBAA 1K82A 2PY3A 4D9TA 4NIFB 4G31A 5E8YA 4I6QA 2FOIC 4KLNA 5AUVA 4U3YA 4F7SA 3LOKA 2Y4PA 1UKIA 4LGHA 4BL1A 4A9SA 1RDQE 5DN3A 2Y6MA 4ZSJA 3SA0A 2XNPA 1PMVA 4EZ3A 3QZHA 4KRDA 3I6UA 2PMLX 4ACGA 5EYKA 3LZBA 4J97A 3DZQA 4RVMA 4F7JA 3NIEA 3Q53A 1JSVA 4QP7A 5AIRA 2WMAA 3FMDA 3W1FA 5FTOA 4PNIA 4XCUA 3U5ZA 1V34A 2YDKA 3O8TA 3J7AS 4LY6A 4WHZA 4E6QA 2C5RA 1WFCA 2XK8A 1UU3A 1WBOA 4B0GA 5I5ZA 4BHZA 2UW4A 2UZOA 2F5OA 4LJAA 2BUJA 2X7OA 3C4CA 4F64A 3TACA 2J51A 4W4WA 3OW4A 5GZ9A 2C47A 4L15A 4EH4A 4A4LA 3R28A 5L3AA 4YLKA 3R2YA 4PT5A 2R65A 3ORMA 2I7PA 3B9PA 1G41A 4FT3A 5LVNA 3WHLA 2CP8A 3OOGA 4JX7A 3A42A 2FE8A 2OKRA 2LHGA 3VBQA 1IBLM 1DO0A 4XV9A 3DAKA 2Y0TA 2R3OA 1OPLA 2PMOX 3VS7A 3RK7A 2UZUE 1H1QA 2G9XA 3FMEA 1SXJD 1W83A 4C59A 4G3OA 4O4CA 3SVVA 3QU0A 3HGIA 2PYWA 2WMVA 3DFAA 2KTYA 3R7EA 1PRBA 2BTRA 5L2IA 4I0SA 1J7UA 2FO0A 3DK3A 3SXSA 4FZDB 1SXJB 4FT9A 2X0OA 3ZSIA 4D58A 5FLXS 3OUKA 1M2PA 3LM0A 5HE0A 5JSMA 2WSFF 3GLFB 4O86A 5E6JA 4QYFA 2VTNA 2C5NA 4F09A 3TWJA 3TXOA 3HWSA 2JC6A 3PA4A 4HZRA 4E4MA 2GNGA 1JVPP 3AD5A 4S12A 1CM8A 1L1ZA 3FLSA 1XB2B 4GHAA 4WIHA 5FXRA 4DV1M 2J2IB 3K8ZA 3SYLA 4EK4A 4JG8A 2OO9A 3U4WA 2YLFA 5AP3A 5TR6A 1M52A 3MVHA 4MK0A 3ALNA 3UVQA 2PE1A 4BHNA 3TNQB 4NKSA 1DGHA 5BNJA 3BV2A 4KT0F 5AV1A 2ZTCA 5CVHA 2BALA 3UDBA 4WBOA 3CTWB 1VEGA 5EQTA 3QX4A 1P4FA 2YQZA 4KO8A 4JI7M 3EQCA 3HU2A 2I0EA 4QMNA 4NRVA 3PXRA 1IY2A 3ERKA 3RJCA 2R3IA 4HNIA 5HG8A 4IBKA 4FSRA 1OIRA 2KULA 2APLA 1ZMVA 4B8MA 3JY9A 4C4GA 3WOWA 5LVLA 3VUIA 2QD9A 4LGYA 3WIGA 3BIZA 5BUJA 2XYUA 4ZTLA 3C5IA 2WD1A 2VD5A 1KOAA 5DE2A 5IWAM 3W2RA 3OCBA 3ZEPA 4PMSA 3KC3A 5GJFA 1H1WA 2HZ0A 4LL5A 3FZSA 3Q32A 3ZRKA 1HNWM 2EUCA 5L6PA 3CD8A 3E3PA 5EM7A 2F4VM 3FI4A 2VWYA 3KF4A 3KXXA 5CVGA 1ZARA 2XAMA 5AIKA 4I6HA 3P7BA 2ITZA 4BTMA 5ANIA 3HU1A 1LR4A 4EK5A 3V5QA 5CT7A 3LCTA 4Y73A 3QKMA 3U6QA 2R18A 3QTSA 3IW4A 5CEOA 3VJOA 4E8AA 3UIMA 4TPTA 3VS3A 3QLGA 3OXIA 4FIHA 1YI4A 1OKZA 3Q4TA 4Q9ZA 3DKFA 4Y5HA 4AACA 3GC8A 4JI5M 2W82A 4KABA 5C01A 4K1BA 4GFGA 3TIYA 5EM5A 3GPXA 2W4JA 2L6OA 4M69A 3NZ0A 4UN2B 4BC6A 1KE6A 2O8YA 4JOAA 1FOTA 5LVOA 4AE9A 4D4YA 4EL9A 2C4GA 2CKEA 2YM7A 2WU7A 3CP9A 4PRJA 4J7BA 4JMQA 3KEXA 1XBAA 3NCGA 4NW5A 3LMMA 3C4WA 3PSBA 2O65A 4NM7A 4FTOA 2OICA 1Z5CA 4GIHA 4FV9A 5FTQA 4AF3A 4C4FA 4P90A 3PXGA 2CMWA 2E9VA 2VX0A 3LJ0A 3V76A 4BCJA 1N36M 5CXHA 1NVQA 3U54A 1JKLA 4D80A 1Q62A 1GAGA 4FTRA 4D1XA 3UO6A 3F92A 2BHHA 3ZONA 4D2TA 3DCVA 4F1MA 5HIEA 5FDXA 1OAOC 4GKHA 2X6EA 3D14A 2FA2A 3JS2A 2H5XA 4ZXTA 4NM5A 2ZDUA 3HRCA 4JI2M 2QOHA 1G8PA 4O0RA 2PE0A 4EKKA 2JIUA 3K9PA 4CLJA 3CSVA 2OO8X 2OXXA 4BRXA 1QCFA 2PVJA 2BAKA 1TH3A 4JN6A 2FVDA 2OJFE 4DG3E 3K1JA 4UXQA 4V0GA 1TQPA 1H00A 3L29A 3AT4A 2XKCA 5JFXA 3U6DA 3LMHA 4FIGA 3L27A 4MXCA 2XKDA 3UIUA 2PPQA 3N4TA 2UZBA 2P4IA 3BBZA 2OIBA 3OD6X 5HO8A 4AZTA 3HMOA 3TYKA 5IMEA 3DAJA 1LV7A 4ZTHA 4LF9M 5E26A 3QHRA 4XOZA 4NTTA 2G5GX 2Z7LA 4UYAA 1Z5AA 3WIKA 1B38A 4QOXA 3SXRA 3HLLA 1XMMA 1I94M 4IIRA 1J1BA 3I4VA 2ZJWA 5GIPE 2DXIA 3VKGA 3B74A 4WNPA 3F5XA 5JZNA 4OW0A 4ASEA 3ELJA 4IBCA 4CISA 3G90X 1JKTA 5FTKA 3CF0A 3HA8A 3SOCA 4ZTSA 3LHJA 2J7OA 3TQSA 3I6WA 4U6RA 5KPRA 3HY5A 4JBVA 4R3RA 5IA2A 3ORTA 2W1HA 4XNEA 4YNEA 3WI6A 2HWPA 3P23A 1Q8ZA 3UO5A 3K5VA 1H8FA 1LPUA 4QP4A 5M06A 3PUPA 1O6KA 3C5UA 2GNHA 2WQMA 5A14A 4JXJA 4TRLA 4IADA 4QT1A 3DT1A 4ZSLA 1KUTA 5IDPA 3QWLA 4DDIA 1YWVA 4TWNA 1KV1A 2UXCM 1PKGA 4G17A 2C5OA 3DS6A 1J7IA 4UYNA 3TZMA 5AV4A 2JY8A 1WJ7A 3R83A 4MBLA 1XXHB 4KIKA 4IBJA 4C36A 2XJ0A 3JR1A 5HGIA 2JIIA 1T6OA 3FMKA 3L1SA 2WTJA 1PXMA 3NW5A 1OFIA 4F6SA 4GT3A 5HZNA 4HLQA 4LF6M 4C3PA 3KVWA 4APPA 3T3VA 3BZ3A 1XNRM 3NRMA 1WR1B 3QRUA 5ITTA 4D9UA 3UOHA 4IFGA 2XALA 2ERCA 4V05A 3HNGA 4C2WA 4DGGA 4EOKA 2VWUA 5E8VA 2I6LA 4A9RA 3GLGB 3QTWA 4ZY6A 5FTGA 2RFDA 3HV7A 2C5XA 3E21A 1OGUA 4RF0A 1YKRA 4G3GA 4NK9A 2F49A 5CNOA 4AXDA 4DTAA 3TZ8A 5JGAA 2DHRA 4RVTA 3SRVA 2RL5A 3CR0A 4N6YA 4ZLZA 2V1CA 2JDTA 1JSUA 3WARA 3MVJA 5ITRA 1H6UA 3BU5A 3GI3A 3L8VA 4XHKB 2L2DA 2OZAA 3TMOA 3VBWA 4FKGA 3V04A 1V92A 3KS8A 4JRVA 4S31A 3IW8A 3VBVA 3SG9A 3RPVA 2CUZA 3GU7A 3PE1A 4IQ6A 1U59A 5FBNC 2B52A 4YJVA 4RJ6A 3TDVA 2IZSA 3PP0A 3LFNA 1UU9A 2V7OA 4P4CA 2C1BA 2E2BA 4AUAA 2O64A 5CEPA 2WMTA 2V5QA 1YXSA 3BX5A 5A4LA 2CGVA 4DAWA 1IBKM 2VX3A 3G33A 4F9WA 2LVAA 2R3QA 5IA0A 2GS2A 2JDRA 4OTRA 3R9NA 3HHYA 3VRYA 1OL5A 4YTCA 2YISA 5EYDA 4DEBA 5M53A 1QUTA 2Q2EB 4OBPA 3MTLA 3L9PA 2NPQA 3PJ8A 1U4DA 3A99A 3CF2A 3R30A 2HK5A 4JQ7A 3O8PA 5E1EA 2PUPA 4L4UA 2IN6A 4C38A 1XH9A 4I6LA 4O7RA 1G3NA 2F4JA 3KULA 3U6CA 3WILA 4DEIA 1H25A 3GT8A 3SV0A 4X6RA 2B9FA 2X0GA 4HGTA 2XZUA 4BDKA 2C9OA 2YFXA 4I41A 4OTWA 5EP2A 1HCKA 5JEBA 4NYEA 4IIWA 5IZ7D 4ZSGA 4YURA 4IWOA 4FSQA 3QTZA 5LMAA 3I04M 4JLCA 4FEQA 2G8LA 2C69A 2VTHA 3A60A 5CT0A 2L7HA 3PIYA 4WG3A 1GY3A 2C3LA 4ANMA 3NCZA 4BGHA 3SHGB 2XAOA 3LLAA 2C5YA 4FSWA 4IAFA 1H07A 3Q5IA 2GMXA 1REKA 1V33A 2CN8A 2QG5A 1WZYA 3NNWA 3KCKA 1GZKA 3JUHA 5G1XA 3E7VA 2QLQA 4U42A 4QHSA 4GH2A 3ZUTA 3KY2A 3ZZWA 1YWRA 1OIPA 3U6PA 4OTIA 2Z4RA 1PJIA 2P2IA 2UUAM 2XM9A 2WMSA 1UV5A 2WXVA 4EONA 3MJ5A 1YHWA 5M08A 3QALE 4K0KM 4DH3A 3NIZA 2OBJA 2FSLX 2H96A 1PMNA 2F5PA 5I9XA 3ZO1A 3Q3BA 4YC3A 4D4RA 3C9PA 1XJDA 4M14A 4U5JA 3W2PA 1NNUC 2ZB0A 3GLIE 3EFWA 1ZY4A 3F3VA 4GK3A 5IQDA 3O17A 5EM6A 3BBTB 3HV5A 5K4IA 4AXFA 4BCPA 3GC0A 4GRIA 3LFQA 4IC7A 3KRRA 4LFBM 2L09A 3A7GA 4AAYA 4ITHA 3JYAA 1VDDA 5C4LA 3ZSHA 1SG9A 5BVKA 3GLHB 3NUSA 1OFHA 5D10A 4AZEA 5AFVA 4DLIA 4MEDA 1MRYA 5EXXA 4O4BB 1MQBA 4EOQA 4UMTA 5CZIA 4HCVA 2XKFA 4CMOA 4MXAA 2DS1A 4B4LA 5CEMA 4BB4A 1Q3BA 4ANQA 2CN5A 4YZCA 4KIPA 3OP5A 1BVSA 5DOSA 3R8LA 3LCKA 3DK6A 2BAJA 4QO9A 2QCSA 4FF8A 3ORXA 2C6LA 4LJ5A 4R1YA 3KMUA 1IN8A 1T45A 1T46A 4G4QA 1SVGA 1IY1A 5A4EA 5AP4A 4QDEA 3JY0A 5ACBC 1I44A 4MXYA 3HAVA 4FGBA 3W10A 4C3FA 4E5AX 4GYGA 3G51A 3DXQA 5HKMA 4DEHA 5H3QA 5HCZA 5AADA 3TG1A 3LFSA 1MJGM 1VR2A 2DAIA 4CRSA 2IEWA 3AG9A 3COIA 3BQCA 1R7RA 2AEGA 3BLAA 3SHFA 2JY5A 4AKHA 2CGXA 4NL0A 4G6ZA 1Y8GA 3F5UA 5IA3A 1QPCA 5AV3A 1LEZA 4QP6A 3NYNA 4BDEA 3U55A 5FM2A 2RIOA 5EI2A 3R9DA 2BIKB 5B2KA 4AQCA 4F99A 3U8WA 2DENA 2LNHC 3V01A 3AQVA 1E9HA 2PVLA 3BKBA 3V5WA 1ZOHA 3LFCA 4X2FA 2FGIA 1S9IA 4Q2AA 3C3EA 4AG8A 1YDSE 3BCEA 4CKRA 1FPUA 3R6XA 4YSJA 3F66A 4X3FC 3C0HA 4B7HA 5HG5A 3ZH8A 2JFMA 4I4LA 3QCSA 3MBLA 1MUOA 4PDSA 5EXTA 4FSNA 4BR3A 2WIPA 1KE7A 4CRLA 3KGAA 3PG1A 3ZDIA 2GHGA 3DA1A 4IDVA 2YJRA 2QHOB 3I7CA 4NKAA 4QMQA 5D7AA 2REIA 2YN8A 2W9FB 3SAUA 1OL2A 3TE6A 3M7GA 4O6LA 4FKWA 1CMKE 4FBXA 5ANEA 3N51A 4ANNA 4XRLA 2FH9A 3LXNA 5CVFA 4BBFA 3VIDA 4FZ7A 2F7EE 4MGZE 4ASZA 3U87A 3BGZA 3RI1A 5BMSA 1QVRA 3QZIA 1UNGA 5DFLA 2O01F 3ORIA 2UW7A 4YHTA 3GOPA 1YHVA 3VDUA 2JKOA 3IOKA 5IT9S 4PX6A 2C96A 4QMOA 3VFDA 4ITQA 4LOPA 4AOTA 3UOKA 1SVHA 5I0BA 1IY0A 3SATA 4TW9A 5CSWA 5EHLA 2ZM4A 3CIKA 5JI3E 4IX5A 3WF7A 4YJNA 1WBWA 3AGMA 3FTDA 2WAJA 3MVLA 4GG7A 3PNVA 3C7QA 3NAXA 4J8MA 3G0FA 1TFFA 5IA1A 4NUSA 2XJ2A 4EH9A 4W5WA 2IW8A 3R21A 1XBCA 3MDYA 1M7QA 4RIOA 5DVRA 4MAOA 4MUQA 3ZC6A 3VK7A 3R8MA 4BDJA 2IVTA 3SX9A 3MB7A 2C5VA 3OMVA 4ANBA 4K8AA 2FYSA 1FQ1B 5IEXA 4CHTB 4CT1A 4GKKM 3HDNA 3OHTA 1PJQA 3L25A 4GRBA 4TXCA 4XJ0A 4ASXA 4UMPA 4CLIA 4RBLA 1G3IA 4JI1M 3FYDA 4DGOA 4YHHM 2HYYA 5KPTA 4ENYA 5KQ8A 3VS4A 4AGUA 3DBDA 2DWNA 4XK8F 2LWXA 2KEBA 1P14A 4G1WA 4D2VA 2XVDA 4G3FA 4GC5A 4M68A 4FWDA 3FZ1A 3Q4UA 2XZSA 1WGLA 4RLKA 2ITXA 4KKHA 4UX9A 1VJYA 4AG5A 3U6IA 2OPFA 5HOAA 3RAHA 4ACHA 3J7BA 2J5FA 5BPVA 5IUHA 3DU8A 3UNKA 5IH4A 4Q7JA 3QAUA 2VNYA 4FX3A 4G3EA 3TL8A 3ZXTA 2Z7SA 2X4AA 1YQJA 2JGZA 1WVYA 3D2IA 1ZY5A 2VWBA 2OH0E 4BI2A 4LRMA 4LI5A 2DVWB 3S3IA 3FMMA 4G2FA 5J7HA 5AR4A 3WZJA 4HOKA 5L8RF 4PMTA 3UVPA 5KKRC 1IAJA 4TYHA 3PP1A 2PUNA 3Q6WA 4GFOA 4OTHA 1QAOA 2Y0QA 2ITQA 4KRCA 2X2LA 2ITYA 4ANSA 4KBKA 5HD4A 4X2JA 3OROA 1XHAA 2E9OA 3AKZA 3UZRA 2PMIA 4XG7A 5KMJA 3AC8A 2VTSA 3KRJA 2B54A 2XMYA 3Q8XA 3FZPA 2IZRA 1L2DA 2YIRA 3FKEA 2R3LA 5D7VA 1YOJA 3LQ8A 4HPUE 4BYIA 3V8TA 1H1SA 4BDDA 3ZFXA 2R6FA 2F5QA 4E6AA 2PE2A 4J52A 3RALA 3E64A 3SC1A 4C57A 1IN4A 4FVMA 4XH6A 1DO2A 5JI2E 3NDMA 3IW5A 2R62A 2X8IA 3RMFA 3TV6A 3TL4X 2JY7A 3U6LA 3IG8A 3Q9YA 4O0VA 2V0DA 3REPA 4I5SA 5BQ0A 5ITXA 4KNBA 2WPAA 4XV3A 3PRFA 4TKSA 3W0NA 5LXMA 4AS0A 1O6LA 3AMAA 3TI1A 2WQNA 1PMUA 3LMGA 5J9LA 3EMGA 2GSFA 3L9LA 4E4NA 1H1RA 1IXRC 4O82A 3PFQA 1S3SA 3A98B 3BLHA 4CQGA 4OTPA 1Q39A 4MYGA 3W32A 2FUMA 3NNUA 3THGA 3H0YA 5A2QS 5CZHA 4HJOA 4UEUA 5CASA 2R64A 4DH1A 4YNOA 2DZNB 3RP9A 5B7VA 5CAQA 3QCYA 3FL5A 4E3CA 4LGDA 2OF2A 4MXZA 3ZFYA 1M17A 4PL5A 4GHLA 3B8RA 4XRJA 3NUUA 2WSCF 3QD2B 3CJGA 1Q8WA 2XNOA 4BBMA 3U60A 4I94A 5JK3A 3UYTA 4EUTA 3F88A 3NR9A 2ONLC 4EK6A 1M2QA 3G9LX 4MCVA 3ID6C 4G6OA 4XBUA 4XOYA 4JAIA 1JB0F 3A8XA 3BYSA 3H9RA 3WZUA 2IZUA 4DR4M 3LJ1A 3RHKA 4P17A 3AC5A 2Y9QA 2QSFX 3VVHA 1JR3D 5HO7A 5AMNA 4O7LA 4O84A 4REZA 2BILB 3E8NA 4I5HA 4BYJA 1ZZLA 4FEVA 3NWWA 2QI8A 4BZOA 1A48A 4DR2M 4DFUA 2ETMA 1H08A 5CTPA 1X8BA 2LAVA 3H4JA 1TTEA 2WELA 4LV5A 4OVZB 4IM0A 2Z02A 1YW2A 5G6VA 3ZYAA 3HU3A 3RVGA 2P2HA 3FLYA 3VBYA 1HQCA 4YBJA 3FTEA 4ZTNA 4U41A 3KXGA 3QTRA 2JNHA 4RMZA 5EYMA 2G2HA 4QRCA 4GVAA 4CMUA 3IDCA 2CRUA 2B3TA 2AC3A 4EOLA 3I01M 3GCVA 2UZEA 3FY2A 3MIYA 3R9HA 3ZTXA 4G3CA 3GEQA 3IONA 4YO6A 3EN9A 2ESMA 2M5ZA 2O63A 3BYOA 1W2CA 2ITOA 4AW5A 4YO4A 2FB8A 3AOEC 1CSNA 3NYXA 3UOLA 2C98A 1JQHA 3LFFA 4I1ZA 1PXNA 2X6DA 4QOSA 4H3QA 3OC1A 3EFKA 2W05A 4QMWA 2UW8A 1XH4A 1PY5A 3ZLSA 1PXLA 3ZH9B 3EQIA 3FUWA 2BPMA 3GPPA 4YJPA 3R7UA 5KNJA 3GCSA 1D2NA 2WTVA 3P08A 4W9XA 3CQUA 3SYKA 5K4JA 3SW7A 1APME 4I22A 4DV5M 4YC8A 3W2CA 4KSPA 3U5ZB 2QG7A 4BWKA 3LJ2A 5LWMA 2VUWA 4USDA 5HICA 3G2FA 4AT4A 4FOBA 5BVNA 5CSPA 4NM3A 4HW7A 4DA5A 4D1SA 4RG0A 5IH5A 2V55A 2VWIA 3BBWA 5KQDA 1H0VA 3H0ZA 3NUNA 5IA4A 4L9IA 4GL9A 5ANDA 3EKKA 2J7NA 4O0XA 2BFXA 3MJ2A 4CMTA 4MKCA 4FJVA 3E8DA 3QA8A 1OAIA 4ZOGA 4B7FA 4FTMA 2V62A 4NJ3A 4Y85A 1G8KA 4CKJA 2R44A 5EKOA 5I9ZA 2PZPA 3V5JA 2XEPA 1M7NA 4ZK5A 3FQSA 2G01A 1KE5A 3H30A 3N4VA 4O1PA 4B99A 4DYMA 2VTPA 4E4XA 3PIZA 2QONA 2Z60A 4DUZM 3AFHA 3VQUA 3KSXA 3VRZA 3MJ1A 3ATSA 1H24A 5CF6A 3PVGA 3PJ3A 4FKOA 3F82A 2B9HA 5FRIA 2YM3A 3KXMA 2VX1A 5EI6A 5L6OA 4YJSA 1W0XC 2G2FA 3VKHA 2HL7A 5IUGA 4TYEA 3A45A 1HNXM 2HZNA 3OWJA 4CFWA 4EH3A 3PY0A 2C6DA 1ZWSA 2X81A 4EJNA 2UU9M 4GT4A 3LMIA 4HYUA 1GO5A 2JEDA 4EHGA 3ZZEA 4V01A 4I8OA 4MGHA 1W2FA 4K77A 1SNUA 4R7HA 5JRSA 2J0IA 5L4QA 2DZOB 5M51A 8CATA 2WHBA 1IA8A 4L16A 4WKQA 3AL0C 4J96A 3TIZA 2LXEA 3FZRA 3MY5A 2BZIB 1VQ1A 4L01A 4LJ9A 2CFOA 4RIWB 3HDMA 1SNXA 5IMXA 4PY1A 3ZU7A 5CSVA 4I6BA 4CTCA 4RIXB 1J7KA 1QYRA 5DT3A 3J2PB 4YZMA 4EYMA 2Y4IB 1PF8A 2R5TA 2ZTDA 4GK4A 3FZOA 5L8KA 4BIEA 4BTJA 4WOVA 3FHIA 2A1AB 3U4UA 5K5XA 3VF9A 3LXKA 4EOJA 4BZDA 5J5SA 4I21A 5KMIA 2GNIA 3KRLA 4YZ9A 4J1RA 3U6HA 4KKGA 3QQLA 2X8AA 3KS4A 5ACKA 2B55A 4F78A 4FKLA 1OUKA 5AWMA 2OWBA 4EH6A 5AM7A 5C18A 4FIJA 4XV2A 5EW9A 3DY7A 2BWEA 2DHYA 1G8JA 4XG8A 1YE9A 1SXJC 2PU8A 3GENA 1NY3A 4EH7A 3ZUUA 2CNQA 4AXEA 4IZ7A 3LKMA 4E73A 2PZYA 3PIXA 3BHUA 4C4JA 3KIOC 2O5RA 2ZMCA 1TF0B 4ZZOA 2UUBM 4YJRA 4R8QA 1G4AE 4G4OA 3LFAA 5E1SA 3FYCA 2F9GA 2CSNA 3E62A 2LGCA 3FHRA 2G2IA 5GKNA 2R3FA 5IF1A 3PZHA 2W1EA 4TY1A 4JR7A 2JIVA 4M0YA 3TDWA 4FIIA 2J90A 4FGRA 5A3XA 4JI3M 4EOPA 4UY9A 4XV1A 2PUUA 3W0QA 5KO1A 1QL6A 5DYJA 4IX3A 4M69B 4WNOA 4RVKA 4ZLOA 4CEGA 3FQEA 3HZJA 3QX2A 1H26A 3CTHA 1ORYB 2W9ZB 4FVRA 4RLLA 5GNKA 2Z3XA 2L4FA 3KOYE 4EIWA 2HZ4A 2BMCA 2AQXA 4DR1M 1IASA 2ZM6M 2WO6A 3TUCA 4BKJA 4YC6A 4K11A 5KKRB 3KXEC 3MPMA 3I79A 4G6NA 2QR7A 1W5TA 4M12A 2QPAA 1ZYJA 4MXXA 4OLIA 5ETFA 4O2PA 2R3HA 2AYPA 2VTTA 3KN5A 4YJUA 3ORLA 2VF8A 4HGEA 1YWNA 2EB3A 4BCGA 4W4XA 3D5WA 1TQMA 1P3QQ 3ODZX 1CKJA 1P5EA 2KZSA 4TWOA 4OAVB 4DFNA 4ONAA 4QDVA 5AUTA 3PYYA 4Q5HA 3QKLA 4MD8E 4TUWA 1DGBA 1XBBA 4S34A 5IQGA 3QXOA 2I1MA 4RJ3A 4ANLA 4V0GB 2R0UA 5KPZA 4C34A 4DHFA 3QQGA 2BKZA 2CNVA 3EQFA 2GS7A 3ZRMA 4JVGA 4DDGA 3DK7A 4O96A 1XMLA 2CPKE 3F3TA 3COHA 3UVRA 3P86A 4RWKA 3OWPA 3AC4A 4L3JA 4UWBA 2QNJA 3WZKA 4U45A 2P3GX 3NW6A 3I60A 3QGWA 3BOSA 1QPJA 4HVDA 4ORKA 4Y95A 3R04A 4E26A 2WMWA 4PP9A 3NAYA 4FTLA 3HRFA 5J5TA 3IOPA 1HT1E 3J27B 3HHX