2QNJA

Kinase and ubiquitin-associated domains of mark3/par-1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
324
structure length
318
Chain Sequence
GAMGSEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITATYLLLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational instability of the MARK3 UBA domain compromises ubiquitin recognition and promotes interaction with the adjacent kinase domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords MAP/microtubule affinity-regulating kinase 3
total genus 97
structure length 318
sequence length 324
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2qnjA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qnjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qnjA01
5LMKC 2JD5A 2OIDA 4GG7A 2F7EE 1UU8A 4NCTC 2V22A 3E7OA 3ETAA 1M2RA 4M66A 5ANJA 5EYMA 5FP5A 5CAPA 1PW2A 4O38A 4GEOA 4FVRA 4O96A 3OOMA 4UV0A 3DFCB 4ARKA 3F5UA 3EFJA 5I3OA 4AZTA 3BYUA 4W4XA 4JR3A 2PUUA 3NW7A 4FIHA 4EBVA 3NUSA 1A48A 2GS6A 3T9IA 2CCIA 2F7XE 4GK3A 5B0XA 1M7QA 4L00A 5EOBA 5FEEA 2H9VA 3QTQA 4IIRA 3VUHA 4BTMA 4E5AX 4EOQA 2OH0E 4EWQA 2JKKA 3C4XA 4FL1A 4MNEB 4ZMFA 4QD6A 4EZ3A 4TRLA 4G3CA 5I9YA 2WKMA 2X2MA 5C8NA 2A27A 3GNIB 2PVFA 4CQEA 4J1RA 3KFAA 4ASZA 3ANQA 4ZIMA 4P90A 4IZAA 4CFWA 4O81A 4BWKA 1DI8A 4IB1A 4EORA 3OUKA 2F7ZE 4QPAA 3DQWA 4IWPA 2X39A 4ZK5A 3VBVA 3GCQA 1Q8UA 4IWQA 2MJ5B 1C7YA 2ZTCA 1GAGA 3RKBA 1YHVA 3P7AA 5TE0A 4JNWA 5CEOA 5HBEA 4BGGA 1UNHA 4AA5A 4A4LA 4H1JA 5AUVA 2X8EA 3W2OA 4DFLA 3PWYA 4R7IA 4YURA 2UW8A 1FPUA 1H28A 2BFXA 4MXYA 3N4VA 3RALA 5BVFA 4FVPA 5FWKK 4NFMA 3ZTXA 3CS9A 3DBFA 3L1SA 4H36A 1E9HA 4BHNA 1YXTA 2YM5A 1ZOEA 1V1KA 3R83A 4YZDA 1X8BA 4WOVA 3GOPA 4QQCA 3S00A 3M11A 4H39A 2ONLC 3ZRLA 2YWPA 2Q0NA 4GT3A 3RVGA 3PIYA 3L8XA 2FO0A 4IANA 3UNKA 4HJOA 2C6KA 5EYCA 3VF8A 4EH2A 5IEXA 4HVHA 1YI6A 3COMA 4BDEA 2X8IA 3UOJA 4B6LA 4MXXA 3NWWA 2W7XA 2FSTX 5KO1A 2G01A 2VWUA 4I41A 4UMPA 1HJPA 3D2IA 5I9VA 5KKRB 2WMAA 4QOXA 2PZRA 1YXSA 4RA4A 4XBUA 4FG8A 3UBDA 5KZIA 3SQQA 4ALUA 2IZTA 3BYOA 1H08A 4FNXA 3W32A 2RIOA 4HEOA 2CLQA 3JS2A 5JH6A 4G6LA 1FOTA 4WUAA 2OZAB 3B8QA 4H3PA 4B4LA 3D14A 4KINA 2E9UA 3QRIA 4UXLA 3MPTA 2A4LA 3OW4A 3ZONA 3GQIA 4DA5A 4ASXA 2CGVA 3KMMA 1JVPP 4FBXA 5CU6A 3F5XA 5EW3A 4FSRA 3A4OX 3PRFA 1KV1A 2C3LA 2W9ZB 1VEGA 5CX9A 2E2BA 1WBWA 4NK9A 4FV6A 5GJDA 2FB8A 2J0MB 4W4YA 5HIEA 4F1TA 1YW2A 1RJBA 3C4ZA 4JAIA 5LCKA 3R9DA 3HV6A 3DBCA 3RPYA 3UODA 4DTKA 4PDYA 4CFNA 5AUXA 4GVJA 4G31A 5CSVA 3NCZA 2YJRA 2HY81 3AC2A 3ACKA 3EQHA 5EDPA 2B9HA 4BDBA 4BDAA 4G3OA 2PVHA 3AD5A 4U80A 5KMLA 2ITXA 4IXPA 1H1RA 4D2VA 4F70A 2OF4A 3VNTA 5CEKA 5A4LA 2G2HA 4NJ3A 4S2ZA 4FKIA 5HBHA 1FGIA 4MNFA 4TNDA 3PVWA 1WCCA 3HMMA 2WMBA 3COHA 3KULB 4XYFA 5HX8A 4FZDB 4K0YA 5FEQA 5H9BA 5IEVA 5IPJA 5IQHA 3MGYA 2CN5A 3NUXA 1PXPA 4LL0A 2ZAZA 4I5HA 2OFUA 4DFNA 1R4GA 3LAUA 3UZRA 1OZ1A 5DT3A 5HO6A 3Q04A 4GT4A 1YXXA 4C35A 2HXQA 4HNFA 3R00A 4XG7A 3O0GA 4EUTA 2IZRA 4IM2A 4F65A 2C6OA 3EFLA 4WBOA 2IVTA 2J0KA 1PXIA 4D2PA 3ANRA 4N4SA 1GJOA 3MVJA 2YIQA 4RJ8A 3I79A 1XH4A 2VWIA 3P23A 5DHJA 4AP7A 4DEIA 3FXWA 3AC1A 3V5WA 3OHTA 2I0YA 3QXOA 5AP0A 1GIHA 1FMKA 2DENA 5EI8A 2AUHA 4EH5A 5I9UA 2PPQA 1UNGA 3VIDA 4FEWA 5H8GA 4LV8A 2O3PA 3R1NA 5AUTA 3K9PA 3DKCA 1Q5KA 4KKEA 4ZTLA 3C0GA 4O7ZA 1H1PA 4OAVB 3HUBA 1BX6A 2PVMA 5L2QA 4C58A 4GH2A 4AA4A 5LWMA 5IG1A 2QC6A 3ATSA 5HESA 3NUNA 4M3QA 2Y4IC 4FSWA 5HIBA 3I6UA 4S34A 3K54A 3QKMA 3UG2A 2LVPC 3IHPA 3QL8A 5GNKA 1IEPA 5E8SA 1ZOGA 3ODZX 2LGCA 2WNTA 3FEGA 4QP6A 2PK9A 4ITIA 4QYEA 4BZNA 4EH4A 3FXXA 3F3VA 3QUDA 4N0SA 3U9CA 3OZ6A 5FM2A 3N4UA 3ZU7A 3QZFA 4ANBA 2OOAA 4YJNA 5CXZA 5DR2A 3O7LD 3IW4A 4BTJA 4H1MA 3HP2A 4GUBA 1JKLA 5EQPA 3TN8A 2CNUA 4C4IA 5AAEA 3E3PA 4XCUA 3ZXZA 1ATPE 3D5VA 3DPKA 5J9YA 3OWJA 4XV1A 3FZRA 2BVAA 2BDJA 3LM0A 5CNOA 3WZDA 2PVRA 3VS1A 3WF8A 4IFGA 4DGLC 3C5IA 5IUHA 3Q5ZA 4F2LA 3MA6A 5HVJA 1H0WA 4PL4A 3FXZA 4FSQA 1U46A 1K2PA 1G4AE 3EB0A 4DTBA 4LOQA 1VYZA 4AZVA 3L9LA 4QMPA 2VTQA 1P4FA 4IW0A 2LVAA 1J1BA 2BDFA 4GFGA 3UE4A 4I5CA 2YLFA 4LQMA 3RHXA 1IASA 5E8WA 4CKIA 5EHLA 3ORKA 4NT4A 4YPDA 2ITTA 5AMNA 4C4EA 2NO3A 4QMXA 1CSNA 2JDRA 3MY0A 4UEUA 5JQ5A 3FLSA 3QLFA 4RFYA 4DEAA 4DINA 5IA4A 3QZGA 4L43A 3Q9YA 4GSBA 5BUIA 4KSPA 5CZHA 5AR3A 4JDKA 5CASA 5IISA 3W2QA 2IJMA 4FSMA 4D4VA 3L9NA 2HZNA 2W5BA 2EJSA 2YA9A 4WO5A 4V05A 3W10A 3NPCA 2BRBA 3IPHA 4IFCA 3GLHE 5DR6A 4AOJA 5M56A 3DKGA 1XQZA 1Y8GA 5F20A 1YXVA 3HRCA 5L6PA 2OSCA 2IW8A 5CS6A 4CTCA 4TYHA 3R8PA 3W18A 2PZPA 3GLFE 4D28A 4QP8A 4QMQA 2Z7QA 4JL9A 4QTCA 1YXUA 3QBNA 3QRKA 2FGIA 1YWRA 1OL6A 4XOYA 2OZOA 4ZTQA 1IG1A 4M8TA 4EQCA 2VWZA 2J7TA 3BX5A 1JLUE 4PPCA 2BMCA 3V5QA 3U6HA 3AC4A 3DGKA 2W0JA 4CT1A 3ZSHA 1JSTA 4NKAA 4UXQA 4O6EA 3OWPA 1DM2A 2KNZA 5CT0A 2XYUA 2JIVA 4H3BA 3UNJA 4OBQA 4D4YA 4LGGA 2NPQA 3GC0A 2LVOC 1DS5A 3QD3A 4YJVA 4HNIA 3EQDA 4KIKB 4V01A 1OITA 5I9XA 4RBLA 4YJSA 5TKDA 1YDSE 2X6DA 3QALE 5ETAA 3VW6A 1YWNA 5A9UA 5AUZA 2IO6A 4IAYA 1LEWA 4K6ZA 4F7NA 2Y4IB 2C3IB 3SAYA 3KEXA 4AT5A 3BZ3A 3PE1A 5IUGA 4RRVA 3KVWA 1H1WA 3R22A 1URWA 2YCSA 3C5UA 3IW8A 2YAKA 4KKGA 4YC3A 3FLWA 4OLIA 3H30A 4ZSJA 4YUQA 5CAVA 1SG9A 4EQUA 1BLXA 1URCA 2QQ7A 4I4EA 4ZTNA 3TACA 4L46A 5E8ZA 3BHHA 4I6HA 2WAJA 2P55A 2XNPA 3P08A 3PXQA 1GNGA 4OGRA 3IECA 1DV0A 1VQ1A 2Z7LA 4XJ0A 4CFXA 1IAJA 3E5AA 4BWXA 1H27A 3E64A 1YDRE 3CY2A 5C4LA 1OQYA 3KN5A 2VTLA 2JLDA 2XNOA 4QP7A 5DRBA 1PHKA 2VO7A 5BPYA 1NVSA 3QWKA 2JITA 4G2FA 3LFNA 5BX0A 4U43A 4IWOA 4EJ7A 2XZSA 3IOKA 5CU2A 1JR3E 4BR3A 3FZOA 2XIXA 3BPRA 3ORZA 4LRMA 4XBRA 4JOAA 3OTUA 4ENXA 4UMUA 4ZS0A 1J3HA 4AN9A 5LMKA 4DG2E 5HCYA 3PIXA 2GMXA 3R8UA 2XK6A 4DEDA 5KMKA 5LQFA 5LXMA 5CSWA 3PY3A 3HLLA 5IDNA 5IA0A 4LM5A 1YKRA 3UIXA 1P14A 5EM8A 5T3QA 4EOJA 1J7IA 4Q2AA 4RX9A 5CWZA 2QURA 2W1DA 3NRMA 4X3FB 3KRWA 2HW7A 3IG7A 3G5DA 3R02A 1UU3A 3WILA 1RDQE 4WUNA 3V8SA 3AGMA 5M06A 3D0EA 3HMIA 3EZRA 2C1AA 3NDMA 4ZSAA 4O1OA 1Q8WA 2JIUA 2YCRA 3A60A 4G3EA 4P5QA 4EK3A 3OY1A 3OOGA 4IAFA 4JVGA 3MW1A 4UYAA 5CQWA 1XB2B 5BVEA 1TQIA 3H0ZA 4G1WA 4X6RA 3KU2A 4ZY6A 4DYMA 5AAGA 4A4XA 5AIRA 3O8PA 5IQGA 4EYJA 1FQ1B 2WIHA 3HL7A 2W1FA 1O6KA 1Q41A 4E20A 4CGAA 5AUYA 2C30A 1OKSA 1JBPE 2IN6A 1FINA 2K9DA 5C9CA 3TIZA 3WOWA 1ZY5A 2PVNA 3NIEA 5D12A 3EL8A 5I3RA 2V0DA 2WU6A 4UZHA 3R7UA 3VBTA 4J98A 3PRIA 3KQ7A 2OJIA 4L3PA 4ORKA 4MH7A 4LOOA 1T6OA 1JPAA 3F3WA 3P86A 4WP2A 3AT3A 2BIKB 3CQWA 3NLBA 4L67A 3TI1A 5L8KA 4AAAA 3R21A 1S9JA 4EL9A 2IPXA 5JT2A 3OC1A 2I6LA 2R3NA 4P2KA 4RPVA 4CVAA 5JMSA 5CEQA 5HOAA 5A14A 3FPQA 3QC9A 3UOKA 5LARA 4CD0A 5AADA 4F6UA 3F3UA 3LCVB 3R9OA 3FBVA 2VTMA 3DB8A 3RNIA 5J7HA 4X2KA 5LCJA 4QMSA 2UV2A 4GT5A 5FUTA 1YI3A 2W17A 1T45A 2X0GA 2UZWE 5JGBA 2C6IA 3VS7A 4AQCA 3IW7A 3UO6A 3ZO4A 4G6NA 4OT6A 4OTFA 5TOZA 4B0GA 3PJ3A 4I4FA 4AE6A 4EH6A 3GLGE 5EQYA 4MXCA 2ZM3A 1OKZA 4FV1A 4A4OA 4F6WA 2GNGA 4RLKA 4ACMA 4JR7A 3SOCA 4LUEA 4AACA 4NJDA 3TNPC 4C0TA 3CTJA 3B2TA 4YLLA 2MROB 3GUBA 4I92A 3KC3A 2UVZA 4NM7A 4JBVA 4Q9SA 4J8MA 4X3FA 2VX1A 2PUNA 3IGGA 5HLWA 2QR8A 1PJKA 1M14A 4FKVA 4BDHA 3B89A 5M4CA 4C3RA 4LYNA 5EG3A 4JXFA 4NM3A 1ZMVA 2I0HA 3EN7A 4EOKA 2B55A 2B4SB 5CAUA 5DOSA 4K8AA 4C38A 4DH3A 5KMMA 3MN3A 2CNVA 4QMUA 5HZNA 3K3IA 4JQEA 3BCEA 3DJ7A 3P7BA 4K77A 4FK3A 4X2GA 4JQ7A 2W1EA 5E8YA 2OBJA 4C33A 5J5SA 5LMAA 1VZOA 4I5PA 3Q4ZA 4FV3A 1G8AA 1PXJA 2C6MA 5AP1A 4HOKA 3KF7A 3DXPA 3NSZA 4I94A 4J8NA 4CEGA 3W16A 3QCYA 3SXSA 4N6ZA 2BALA 1Q8YA 1XBBA 4Y95A 1VYWA 2JAVA 4BIDA 2NP8A 4FK6A 3QLGA 3P9JA 4J52A 4UMRA 4YJOA 4M15A 2C6TA 3TKUA 4EBWA 4BCHA 4N70A 5LVOA 5CQUA 2UZEA 4B9DA 5J79A 3D9VA 5DFPA 4BGHA 4QMNA 3C13A 2GNHA 4HGLA 3BGZA 2IW9A 1E1VA 3SC1A 2A19B 5FQDC 2BILB 3BLHA 3CJFA 4FKGA 3A7HA 2CHLA 3LOKA 1YI4A 2CGWA 3UPXA 3CTQA 4BDCA 3TNQB 4RJ7A 4JBPA 4E6CA 4YTFA 4ONAA 4ANQA 4PNKA 1TVOA 4TT7A 4MBIA 5AAFA 3DKOA 4Z7HA 2UVXA 3UG1A 3A7FA 5JFXA 3UOLA 4HCUA 3CQUA 4FR4A 3FL5A 4RIYA 5L2WA 2VGPA 1JSVA 2R0UA 3FSKA 3E8CA 4RIWA 3VRZA 2ZDTA 3UOHA 3EN6A 2QR7A 3QC4A 4IVCA 4RFZA 4FIEA 4R78A 3WBLA 2DKLA 5KHWA 1OI9A 5L2TA 3ZUUA 2YLEA 4O6LA 5FD2A 3TJCA 4EYMA 4GKHA 4AN2A 1OIQA 2Y8OA 4RSSA 4DTAA 2GDOA 2O8YA 4HPUE 5EM7A 2LBCA 2OH4A 2VWBA 3OCBA 5HX6A 2W4JA 4D9TA 1WHCA 5AV2A 2YISA 3EWHA 3FZ1A 3GT8A 4I0SA 4ALWA 4FOCA 3KREA 2YAAA 4F1IA 2VO3A 3ZLSA 2ZM4A 4YSMA 5C1QB 3V5PA 5CAOA 3A7IA 4CSVA 1W7HA 2E9NA 3AC3A 4PX6A 5HE1A 1U4DA 1OIUA 5DH3A 4BCGA 2FUMA 4L68A 2Z02A 4RC3A 2WZJA 3ZOSA 4EI4A 2VTSA 2RSVA 2CKOA 2PULA 3WZKA 2JUJA 3OEZA 5E90A 3A2CA 3K9OA 4AE9A 4U6RA 3AMAA 1W8CA 4YU2A 4JI9A 2OFVA 3LMHA 4MNEA 5A46A 2J50A 4Y8DA 2F2UA 4U3ZA 3ZRMA 2UZNA 4XG4A 4Y83A 4C37A 3R2YA 1H01A 4HCVA 1KYIA 3QCSA 5IQCA 3LJ2A 4PTCA 2LVQD 3KRJA 5C8MA 5K5XA 3F69A 2PZIA 2XKEA 2WMQA 1VG5A 4FTJA 4WSYA 4ANSA 3ID6C 4D0WA 4J7BA 4KAOA 3D15A 4HVSA 5C01A 3Q5IA 5KHXA 5M09A 1IRKA 1KE5A 1V0OA 3G0FA 1OKVA 1JSUA 2XS0A 2R64A 3MB7A 1EFUB 1BMKA 3R9HA 2XBJA 1ZYSA 3ZUTA 3E46A 1NVQA 4UWYA 3PVGA 4U45A 5ANDA 2PWLA 5F95A 4GMYA 4KWPA 4D1XA 5IQFA 4V0GB 3BHTA 1XH6A 3MVHA 4FZFB 2J6MA 4YSJA 3JY9A 5KMJA 4LGDA 3V5TA 4WNPA 4YZMA 5A4EA 1OL2A 4WA9A 3ALOA 1G3NA 2RG5A 3F6XA 3GCSA 1Q8ZA 4G17A 3LFBA 4GEWA 3EQPA 4PP9A 2PL0A 5I9ZA 5CI7A 5E7RA 2PE1A 2BKZA 4MXZA 4DFUA 5K4JA 3C4CA 4WNMA 5HI2A 5CY3A 3ZCLA 5DIAA 1H25A 2UW9A 4BDFA 3SX9A 3OBGA 2R5TA 1QPDA 3MVLA 4X2JA 1J7LA 2O63A 4XLIA 1P3QQ 1DAWA 2V7OA 3HDMA 3UQGA 3ZMMA 4FTTA 5K0KA 2XKDA 4F63A 4FSNA 3U9NA 4ACHA 3PA3A 1XWSA 3BIZA 3NUPA 4D4RA 3MYGA 4ZSEA 1H26A 5HTIA 3QF9A 2GQGA 2UZVA 4X2NA 4FI1A 2O64A 3BQRA 1ZWSA 3EH9A 4IM0A 5FXQA 2V62A 4A9UA 3E8EA 3GC8A 4HYSA 5E1SA 3A7GA 5JFWA 2OI4X 3LCKA 2J51A 3KL8A 4IHPA 4ENYA 4QP2A 2B0QA 3E62A 1M52A 4DCEA 3E3BX 4PL3A 5L3AA 5CZIA 1JKTA 4TYGA 3IGOA 5L8JA 4BB4A 4EKLA 4FV8A 2R3QA 4XRLA 3VUMA 3U55A 3A99A 5ANIA 3P78A 1Z5MA 2QOCA 2B1PA 2XCKA 5EW9A 1PF8A 4HYIA 4A9SA 1YDTE 3DZOA 4QYFA 4R1VA 5HHWA 3S3IA 1SNUA 3WF6A 1R39A 4ANLA 4BI2A 2GPHA 5M4UA 1IFYA 4JX3A 5EHOA 3QCQA 1YHSA 4CCBA 4CLIA 4LG4A 5JGAA 2PMOX 4GVAA 4EWHA 3MWUA 2W5HA 3HV3A 1U54B 2B7AA 3CKWA 4QP4A 1AIPC 5IH6A 3RCJA 3T9TA 5E92A 5EYDA 3D5UA 3QD4A 4U44A 3THBA 2VAGA 3QRJA 3EZVA 5HBJA 3ZBFA 4YTIA 4EZ7A 3LPBA 3MJ2A 3O7LB 4LGHA 1FVRA 1Q8TA 2F4JA 3FZPA 2XVDA 4XG8A 3NAYA 3QYZA 4IAAA 5E8XA 4I6BA 3FDNA 4AN3A 3F2AA 4GCJA 1HT2E 1BL7A 3BLRA 3O23A 3BBZA 2W4KA 3EQBA 3KK9A 3MFSA 4JG6A 1DO2A 4R3PA 4FEXA 4QMMA 3CGFA 4OW8A 3UTOA 2Y6MA 5HE2A 4EK5A 3DBDA 5GZAA 3GQLA 4RZVA 2G3QA 3PZHA 1WR1B 2SRCA 3IONA 3AGLA 5DBXA 5LJJA 2WQEA 3R8ZA 1XO2B 3TV6A 4GV1A 3NYOA 2ITOA 4QTAA 4RVLA 2Y4PA 4HPTE 4CZTA 2J0JA 3R7EA 4G3FA 4RT7A 4TKSA 5FG8A 5KUPA 2DAKA 1Y8YA 1YWVA 2ZVAA 3M2WA 3MY5A 5J7BA 2DZLA 2JKOA 4HGSA 5M07A 3LKMA 1BYGA 3DJ6A 1GIIA 1K3AA 4O0WA 3A62A 4J95A 1Z57A 2NRYA 4JG8A 3HV7A 1JKSA 2WXVA 3FSFA 3NCGA 4PV0A 5CU3A 5DEWA 3MMPA 1CDKA 5M44A 4J99A 4MAOA 5KE0A 3TV4A 2WELA 4ANOA 4N57A 4C59A 2PY3A 2BIYA 2YN8A 3O71A 3VBYA 4CZYB 4GKIA 5FLFA 3C1XA 2C0IA 2C3JA 3BEAA 1YRPA 2VTHA 3NYNA 3ZEWA 4AZEA 4M0ZA 2O0UA 1YQJA 4GU9A 2L4FA 3R28A 3Q6WA 4QP1A 3UIMA 3RGFA 2P33A 3LFEA 4WD5A 2QG7A 5C4KA 2WO6A 3M42A 1OBDA 4O84A 3EMGA 2HZ0A 4NWMA 4OUCA 4ZSLA 4ZJIA 4O83A 1FBNA 5CSHA 4FTMA 1OL5A 4L7SA 3O96A 3W2RA 2G2FA 1UU7A 2Z7RA 3BE2A 4X3JA 3NEWA 4X21A 4RQVA 5A3XA 2YFXA 5L8LA 1YOLA 3RZBA 3R1SA 3OD6X 3SXRA 2PZ5A 4KUJA 4XG9A 4IDVA 4E7WA 3QD0A 1GZ8A 4M97A 1YOJA 3ZSIA 2WQMA 4BDDA 1KOBA 4KRDA 4Y85A 4AX8A 1PMEA 4BCPA 3OCGA 4CFFA 2Q0BA 1H24A 2O25A 4ZZOA 1KUTA 3V51A 4RFMA 3HKOA 5EOLA 2WTKB 4O27B 2JGZA 2E9PA 4O0XA 4YHFA 4D5KA 5AV4A 2BWBA 2C5XA 3DTCA 2X4ZA 3CIKA 4TL0A 3ULIA 1IAHA 2OXYA 4PDOA 4JIAA 3R9RA 4ANMA 3LLTA 5M55A 4MXAA 4QTDA 3L8SA 4YO4A 4EK6A 1PYXA 5C26A 4FOBA 3DQXA 4R1YA 4W9XA 3GU5A 1XJDA 4ZJJA 3RJCA 3TDWA 3RBWA 4D2SA 5BNJA 4W9WA 4O0UA 4WHZA 4E4MA 3PLAE 2YM7A 4O91A 3F7WA 4WBBB 4A9YA 4G5JA 1Q3DA 2H34A 3UZPA 2YJSA 5BQ0A 1Q97A 4MWHA 3PXKA 2QVSE 4CMTA 2PMLX 5HQ0A 3G51A 4Y72A 4XH6A 3CXWA 4OTDA 1F0QA 3D5WA 1VDLA 1XKKA 4E6QA 2BTSA 2UW0A 4XG6A 1BL6A 3NNWA 3HUCA 5D10A 1H0VA 4XG3A 3A8XA 4O0SA 4C2VA 2C5YA 3GCPA 1LUFA 1Q99A 1IXSA 3UYTA 3VS4A 3VUKA 5FXRA 4DLIA 4E5WA 4C57A 5HG7A 2WPAA 3GBZA 4O21A 3WIKA 3C7QA 2P3GX 4D5HA 5EDQA 5J9ZA 2BHEA 2KTYA 2YCFA 2QKRA 2I0VA 4M12A 3RWQA 3C4WA 4AS0A 5EQEA 4FICA 5K4IA 2FVDA 4I3ZA 3TUDA 4FV5A 5ITAA 2OU7A 4F09A 4CTBA 5HTCA 4ZZNA 2GQSA 1F3MC 4EC8A 3Q60A 2KHHA 4WIHA 3DT1A 3D83A 1PYEA 3NGAA 3SXFA 2PMIA 4BRXA 1MRUA 4FT5A 2Z8CA 1PY5A 1YHWA 3QRUA 5HO7A 4DFYA 5HCZA 2RFSA 3A4PA 3HYHA 4MBJA 5ICPA 4R5SA 2JY5A 3RINA 3D4QA 2HZ4A 2DYLA 3VUIA 3T3UA 5CTPA 2L2DA 4RIXA 4BDKA 4UN0C 3QTXA 2HY0A 3WZUA 5L6OA 3SRVB 3A7JA 4GL9A 4MD7E 3FRIA 1BUHA 3FI4A 2HELA 3ZBXA 4F08A 2VTIA 5EHYA 4R5YA 3TXOA 3ZS5A 5A4CA 2ETRA 4KA3A 3LLAA 3GU6A 4YLJA 4L6QA 2GS7A 4YHTA 3V8TA 2MR9A 1DAYA 2IG7A 2WTJA 2ITWA 3FHIA 4HGTA 5AWMA 3GOKA 3RAWA 3VQHA 3W2PA 1QCFA 5JFSA 5LWNA 4MKCA 4XV2A 4PPBA 2W1HA 3U4WA 4YNEA 5BUEA 1AGWA 2YM4A 4K1BA 4DH1A 4S32A 5L4QA 3FQSA 2JC6A 3I60A 2XA4A 4YC8A 5FTQA 4UY9A 4BCOA 5HTBA 5BVOA 5DNRA 2NRUA 4RGJA 3QHWA 4RVTA 3ZEPA 2J4ZA 2WHBA 4XOZA 4TYIA 3PXFA 2UZBA 5AV3A 4GW8A 2OWBA 3V01A 4E1ZA 1WBOA 3Q3BA 4QNYA 2QOLA 4RJ3A 4AZWA 5B2LA 4FKSA 2HWPA 3WF9A 3QX2A 2DNAA 2OF2A 3QUEA 4QO9A 3RI1A 3UYSA 5IQAA 4RVMA 3WZEA 2YDJA 5TF9A 5LMBA 3CY3A 2WMRA 1IA8A 2ETMA 2XJ2A 4RX8A 2XJ1A 3EIDA 2FSLX 3E8DA 4MF0A 4FSUA 5CALA 4BYIA 1OPLA 1H1QA 2XIRA 4O86A 3PSBA 5DPVA 3ZSGA 2YEXA 3BWFA 5CF8A 2XK7A 2JAMA 4AW1A 3MY1A 4DF3A 3C4EA 3BHVA 2EXEA 4D55A 4IC7A 3REPA 3DU8A 4ITJA 4YMJA 3GI3A 4PWNA 4F0GA 1XBAA 3QTWA 4U3YA 3EN9A 4F6SA 3BV2A 2W06A 3HVCA 4FTCA 4K18A 1G3IA 4CT2A 2ONLA 3F2NA 2EKFA 3C50A 4M0YA 5M4IA 2GFCA 4PDPA 1YLAA 5AP3A 4M69B 4YBKA 3LZBA 1Q3WA 1ZYCA 4TNBA 3EQFA 5HG8A 3PJCA 4L3LA 5CAQA 3ZLWA 2PE0A 4OTWA 4BKJA 4FE2A 3UIUA 2PSQA 4FT7A 4DGOA 3V8WA 2X8DA 4ACGA 1NV9A 2JKQA 3R6XA 4D1SA 4FX3A 3U4UA 1I44A 4NM5A 2JFMA 4E93A 2CGUA 2PUIA 2BDWA 5CF6A 5IA2A 3F88A 4KB8A 1XBCA 2YABA 1UWHA 4UN2B 2F2CB 5CVGA 3TCPA 3TZMA 3VW8A 1WZYA 2XP2A 4J53A 4EOIA 4ZAUA 4FKTA 4IAKA 2Y0AA 4NEUA 5BVWA 4NTTA 3U6IA 1UKIA 3BHUA 2HYYA 3EQIA 2JIIA 2WMUA 2R3FA 4E73A 2X9FA 3IDBA 1OKWA 4NKSA 3RMFA 2YITA 2PVKA 2GTNA 3F92A 4I0TA 4K11A 1KWPA 1PXLA 3CBLA 4JDHA 3U6JA 4M7IA 2YACA 2CPKE 2BRGA 4C7TA 2VTRA 3QTIA 4IB3A 5EI2A 3MESA 4YPSA 1TTEA 2RF9A 3V6SA 1OIYA 3QQUA 3R01A 4EHGA 2QOHA 5CANA 2DUVA 4WG5A 5HCXA 3BBWA 1R78A 2VN9A 2V7AA 3CD8A 3KXXA 2EU9A 1BI7A 4M14A 1OIRA 1ZXEA 4RC4A 4AG8A 4AOIA 3D7ZA 4AT4A 3PG3A 3H4JA 3PVBA 4FSYA 2C6EA 4PMPA 5F1ZA 2A2AA 3SHEA 5GIOE 3LCTA 2XEYA 4O7YA 5BYZA 3IOPA 4ID7A 5KBQA 1TQPA 1W0XC 4QMWA 5EDRA 4C4FA 4C8BA 4TWPA 4L42A 4IX6A 1PMNA 4GG5A 4O22A 1A9UA 4NIFB 2ZJWA 5ACBC 2QI8A 5JRSA 3WF7A 4BCKA 1OPKA 4XS2A 2JKMA 3LXKA 3NNXA 3MSSA 4GK2A 1BVSA 4TZRA 4AWIA 4C3PA 2GNLA 4RG0A 3MB6A 4AFJA 3ZO2A 2FSOX 1KE7A 1Y57A 5A6NA 2OICA 5HU3A 2R3IA 2VTAA 3G0EA 3WE4A 4BCFA 3PXZA 3PJ8A 3LMGA 4F0IA 3JVRA 2BZHB 4M84A 5DEYA 3LXPA 1PKGA 3DDQA 5FP6A 3VQUA 3WE8A 2YZLA 1PXMA 5M08A 4APCA 2W4OA 2X7FA 4EH7A 3NUAA 3H10A 2WOUA 3VRYA 3R71A 5DR9A 3OCSA 4KBKA 4DBXA 1QPCA 2WTKC 2HAKA 4F64A 1ZYLA 5TT7A 2XKFA 3K5VA 3FMHA 4FKWA 3ORTA 4DGMA 2OJGA 4ZTMA 4BTFA 2YZAA 1NA7A 3QU0A 2GS2A 4IH8A 4NYEA 1VJYA 3KXMA 3TEIA 4FIJA 3PY0A 4UMTA 2WD1A 3KY2A 3VO3A 5J9LA 1IR3A 5AX3A 2GU8A 4GIHA 5HLPA 2WMSA 3G2FA 3G90X 5LVMA 2G2IA 4IMYA 3DOGA 4O7SA 1JKKA 3D7TB 4USFA 1APME 2BAQA 3RHKA 5J5TA 1WGLA 2BWEA 2YIYA 1XH7A 3QXPA 5L2IA 3VBWA 4U0IA 1FGKA 4RIYB 4BCQA 2RFEA 4BBFA 1NY3A 3FWQA 4BGQA 1NVRA 3H3CA 4DFXE 3CTHA 5CSXA 4BF2A 2ESMA 4X2FA 5CENA 4BTKA 5A4QA 1WFCA 3Q96A 2A0CX 2REIA 5M4FA 1M7NA 3Q9XA 4I6QA 2GNJA 3NIZA 3BKBA 4O7LA 1O6YA 3G9LX 3LFAA 4OTRA 1VEBA 3PIZA 4DG3E 2C3KA 4O2PA 2JZ0A 2IVUA 4HCTA 2EB2A 5IA1A 5F94A 4CYJA 3UVRA 4ASEA 1KE6A 2R9SA 4FGBA 5J87A 4FKRA 1H00A 2WTWA 3IK3A 1PMVA 1Q61A 5H2UA 4G34A 2JBOA 1A06A 1S9IA 3SGCA 4P4CA 3AMYA 3L8PA 4HGEA 2RKUA 4BHZA 2EB3A 3VHKA 4MHAA 2WQOA 2B54A 1GZOA 5JGDA 3VUGA 3O17A 3I1AA 3PTGA 4BCNA 2FYSA 3B8RA 4J96A 4IVDA 1PGYA 4U5JA 3ATTA 4L7FA 1UU9A 3C4FA 4I23A 2QONA 1RW8A 4M67A 5DE2A 4HZSA 3LM5A 3RPOA 2E9VA 3A61A 2H5XA 3L9PA 2PZYA 1P5EA 5IQBA 3LXNA 5AUUA 3O8UA 4OBOA 4QQJA 3SV0A 5HD7A 4N6YA 3VS3A 3PJ1A 4YHJA 4FTQA 4PNIA 3RCDA 3BRBA 3KKVA 2VWVA 1M17A 5KZ0A 3UNZA 4O1PA 3RTPA 2X1NA 2LVNC 4FIFA 2JNHA 4EHVA 2QOIA 2R4BA 4C4JA 2ZV8A 4IACA 2HIWA 4C4GA 2R2PA 5AFVA 2BKKA 4FNWA 1OM1A 5HIDA 4NSTA 4Y46A 4AF3A 4LUDA 3ZM4A 2R7IA 5EKOA 3DK3A 3ORXA 5AUWA 1E1XA 1PXKA 2HWOA 3FKLA 1G5SA 3ACJA 4MK0A 5B2MA 1ERKA 4FTOA 2P4IA 1U5RA 4CRLA 1PXOA 3LE6A 2ZV7A 3QQLA 4Z16A 3O51A 2DAIA 4DEBA 3TIYA 3BYMA 4B8LA 1OPJA 3B2WA 4XNEA 4BCJA 5DLSA 4CMOA 4PUZA 4RQKA 2UZLA 3V5JA 1ZARA 3JR1A 2H96A 5J95A 1VR2A 3VBXA 2UW3A 5IH5A 2DI0A 5FBOA 3CC6A 5AM7A 3JUHA 3R04A 3DAEA 2OJJA 4PTGA 4MBLA 4HW7A 1PMUA 2P2HA 4YC6A 3IW6A 4E26A 1SM2A 4EONA 2X7GA 4PMSA 3KULA 3AD6A 3P1AA 2Q83A 3BU3A 2GNFA 3BGQA 3V6RA 3OEFX 4DHFA 3OS3A 4V0GA 2C6LA 1MRYA 3QD2B 1WJ7A 1MRVA 3IW5A 5C03A 3RAKA 2BCJA 1MQBA 4L53A 4TPTA 4FYNA 1STCE 4JBQA 3DDPA 5ANOA 3D5XA 3SVVA 1ZZ2A 3EYHA 1B39A 4R6VA 4RJ5A 2J2IB 3PP0A 4EHEA 3PE2A 2QOOA 4FIGA 4U8ZA 4WKQA 2EUFB 2HK5A 3LMIA 2XB7A 3E7VA 1MP8A 3UP2A 1PRYA 2PTKA 3ALNA 3PPJA 4IE9A 4YZNA 3GP0A 2BUJA 2BFYA 3FMEA 3DTWA 1FMOE 4MYGA 3R8MA 3PUPA 3FI8A 4ZTSA 3OXZA 5BYYA 2UZTA 1KE9A 2G1TA 3KMUA 5IEYA 3ZFXA 4F1MA 2E9OA 2JDTA 4MX9A 4C36A 3II5A 5FEDA 1MQ4A 2OK1A 3R7IA 5D11A 3BV3A 1R0EA 1CM8A 3KRLA 3O8TA 1W82A 2B52A 4FT9A 4H3QA 1JNKA 1GIJA 3DB6A 4D2RA 2OIQA 2QOKA 3ULZA 5IZFA 4FZ6A 4NFNA 4DCAA 3I81A 3JPVA 4BBEA 5BVDA 5HVYA 1OBGA 5CLPA 5FM3A 5KBRA 3MFRA 3UMWA 3RAHA 4G3DA 4FTLA 2XEZA 4KKHA 4NIFA 2ZMDA 5KMIA 3UC4A 3G15A 4YJRA 3WARA 2AC5A 2C5VA 4PL5A 1XH9A 4QMLA 3W2CA 3F9NA 3HECA 2YERA 3NS9A 4DG0E 2PYWA 3SW7A 3L9MA 3OY3A 2JZ1A 1RQQA 3QTUA 2ITVA 4EEVA 3ENHA 3UZTA 2CCHA 2X9EA 4GUEA 5DN3A 3SD0A 4D9UA 3ITZA 4UX9A 4ACCA 2W1GA 3PG1A 3MH2A 2IWIA 4YLKA 3HDNA 3HAVA 5ANKA 2R3KA 2QD9A 3SG8A 2ITNA 4O0TA 2WMVA 2RFNA 4BI1A 2WEVA 3POOA 4MQ1A 3KCFA 3Q2MA 4EOLA 3MH3A 4DC2A 2F57A 4NW5A 3U8WA 4EUUA 3MA3A 3W55A 2X2LA 5BYLA 2BAKA 2YIWA 1UKHA 5JZNA 3PZEA 4QNAA 2PVYA 2J5EA 2CJMA 3DCVA 3NNVA 4IVAA 2I0EA 3FV8A 4GS6A 4AFEA 3VN9A 2XF0A 4MWIA 1IA9A 5FBNC 3SLSA 2CSNA 4FTKA 1DI9A 2WMWA 4AGDA 1HCLA 3ZZWA 4K9YA 4OT5A 5B7VA 4W8EA 2HCKA 2Y9QA 2WMXA 1JWHA 5M57A 4AXAA 4MQ2A 4WG4A 4Z9LA 5AV0A 2ITYA 1ZOHA 1QMZA 2ITZA 4YZ9A 3UJGA 3ZFMA 4HYHA 1F5QA 3KRXA 4I93A 2VO0A 5CEIA 4CZUA 4BIEA 3GLIE 3BBTB 3MIAA 3GENA 2DAMA 4C34A 3QQKA 4RX5A 2BR1A 4BI0A 5FRIA 5EM5A 5LVPA 3F3ZA 4FKQA 3QRTA 1KE8A 4ZP5A 3D7TA 3GGFA 3WZJA 4FV0A 4TYHB 4C2WA 4EH3A 5HLNA 4YR8A 3GU7A 3F5PA 5AR8A 1LR4A 4CXAA 4KBCA 5JFVA 2VX0A 4JQ8A 2QNJA 5DFLA 1Q62A 5J8IA 3PY1A 2KNAA 4FSTA 5A54A 4OTIA 3DBEA 4O7RA 4C62A 3TL8A 2W1CA 3DFAA 4FUYA 4JG7A 4CFVA 3NYXA 4BYJA 5I9WA 3S1HA 4FIIA 2R3PA 2XCHA 3NR9A 3LXLA 4FKPA 5E8VA 2UW6A 2X2KA 5AR2A 3H9RA 3F66A 2QHOB 2XKCA 4D2TA 1T46A 2W1ZA 4QRCA 5HVKA 3SDJA 3FRHA 2P0CA 3NW6A 3DY7A 2EKKA 4KS7A 3CSVA 2F9GA 3RAIA 2C4GA 4FL2A 4FTUA 4IVBA 3DLSA 4JDIA 2JDVA 3HA6A 4R3CA 4USDA 5CI6A 5FGKA 5GJFA 2WQNA 4DT9A 5CU0A 4WG3A 2ZYBA 3T8OA 3E87A 3VULA 2JDSA 2C0TA 3QHRA 4DEEA 4G9CA 3F61A 4FTAA 3V04A 4OR5A 1H1SA 2ZM1A 1CKIA 1LP4A 5IQDA 2DAGA 4KSQA 4RJ6A 3LFSA 5HG5A 3Q4UA 5JKGA 2OKRA 4ZEGA 2Y7JA 1KOAA 3FLNC 3KGAA 3SA0A 5JQ8A 4M68A 4A7CA 4WRSA 4I6FA 5DMZA 2RRUA 2BPMA 4KRCA 4IADA 4FNYA 1ZMWA 5IH4A 5AR5A 4E5BA 1ZY4A 1V0BA 2R3GA 2DQ7X 4TY1A 3AD4A 2W1IA 3PJ2A 3I7CA 4U97A 4V04A 2JY6B 4XMOA 3BEGA 3FMNA 3H9FA 1SZMA 4BZOA 4CRSA 3EQGA 1UA2A 1HCKA 4TXCA 3DXNA 4U41A 3QQHA 3MS9A 4XEYA 5FXSA 4KIOA 3QCXA 3GB2A 5HU9A 3TNWA 3AQVA 1OB3A 3DK7A 5K0XA 3BU6A 5E91A 2YDIA 4QQTA 2ERZE 4XP3A 3N4TA 1HQYE 1Q24A 3T6PA 3R0TA 4S30A 2XIZA 4TWNA 3VS2A 3Q4TA 2VD5A 3ZZEA 3AT2A 3CJGA 3G33A 5GJGA 3HP5A 4AZFA 5I4NA 4R71A 1Y6AA 1R1WA 4FZ7A 3DNEA 3RM6A 3LCOA 3TUCA 5HNBA 4ZLYA 2J9MA 2VTTA 3I0QA 4PMTA 4BICA 3COIA 4EOPA 2UW5A 3POZA 1CKJA 2XJ0A 3E21A 3Q6UA 2QU6A 3LQ5A 1J1CA 2UZUE 1OAIA 4RIXB 1WBVA 4S31A 5C8KA 1QPEA 4O7VA 4BY9E 4X7QA 4R3RA 3SRVA 4I0RA 3FYKX 3ZUVA 5KCVA 4Y5QA 4UMQA 1I09A 2QO2A 4F9YA 3FHRA 4YGAA 4ZLZA 5AA8A 5G1XA 2B53A 3BYVA 1TQMA 4B99A 2QG5A 4QYGA 3SKCA 1REKA 4D1ZA 4FEVA 1TKIA 3G6GA 4TYJA 2OIBA 5IF1A 1QPJA 3F7ZA 4HYUA 3FC1X 4X6QC 1OL1A 3TG1A 3MTLA 4O0RA 5ANEA 5B2KA 2CLXA 3UDBA 3ZLXA 3RPRA 5CF4A 4R77A 3MBLA 5HE0A 3FE3A 4I20A 2WEIA 4X3FC 3KXHA 4MF1A 4BCIA 3BLQA 3QFVA 1JAMA 4XV3A 3FZSA 4MD9E 5A6OA 3E88A 4B7TA 3F3TA 4UBAA 4ZZMA 5ANGA 5L6WL 3OT3A 4E4NA 4EK8A 3U54A 5EYKA 2O5KA 2RFDA 2XK8A 3QKKA 5EFQA 4RWLA 3UPZA 3TKHA 2PE2A 4QTEA 1VEJA 1B38A 3AG9A 2YHVA 2J0LA 3R63A 2W96B 1XHAA 4ERKA 1OECA 3I0OA 4UB7A 4GYGA 4JBOA 3OMVA 4I1ZA 4U9AA 5AV1A 4HVIA 3RPVA 1REJA 5DA3A 4GK4A 4H05A 2YIXA 4ZOGA 2QOFA 3D2KA 2ACXA 4W4WA 5AM6A 2HXLA 3HV4A 3RK5A 4KIQA 3PVUA 3S2PA 2L4EA 4DLJA 4F4PA 2VGOA 2OO9A 2BROA 3FUPA 2JFLA 4BDIA 1Q4LA 3ORMA 2LTUA 1TR8A 3V3VA 5IA3A 5J1WA 3FQHA 4YJQA 3T3VA 3QQJA 3NMUF 2XNGA 3AC5A 2BRNA 4QQ5A 4F99A 3PDTA 2R3JA 3LFDA 1WBPA 1OL7A 3HMPA 5CNNA 3WYXA 3E93A 1A5TA 5IQIA 4L45A 4DEHA 1MUOA 3ELJA 3LFFA 3C51A 3LVPA 2QKWB 4FF8A 2A1AB 4PPAA 4R8QA 5KNJA 3IDCA 3PSCA 1F4IA 4ZMEA 3OP5A 5DWRA 4CG9A 3NNUA 1Q02A 3OVVA 4JRNA 4BIBA 3PYYA 5E8TA 5GZ8A 4RWKA 4FGRA 4MEDA 4MD8E 4MTAA 4B8MA 3S0OA 4RWIA 4TN6A 2VTJA 2PMNX 3I6WA 4DN5A 4E8AA 3LHJA 2QHMA 4KIPA 3I4BA 3LCSA 4FVQA 2PU8A 4KBAA 4C61A 3FKNA 4F1OA 5M51A 3QA0A 3FMDA 3CGOA 4ACDA 1NW1A 3CCNA 3IDPA 1JOWB 4FTIA 5EM6A 1SVHA 2R3LA 3VS5A 5FTOA 4X0MA 4FT3A 4O7WA 3VHEA 5GIPE 4DITA 5T68A 3OXTA 2XNBA 5FTGA 2FSMX 4BC6A 4LMNA 4FSZA 4E6AA 3TZ7A 3CEKA 5DRDA 3QGYA 3QTSA 5AP2A 4TWCA 4FV9A 4IJPA 5JK3A 5AX9A 5JRQA 2OXXA 4CYIA 1W98A 4P5ZA 4LMUA 4YZBA 4BVUA 4C4HA 3ZRKA 2ZMCA 3P4KA 2OJ9A 2FA2A 3FMKA 4A07A 2ZB1A 5FDPA 3OBJA 4M13A 4QMTA 4FKOA 3NUUA 3S95A 2B9JA 3W8QA 4EOMA 2F49A 1XXHE 3TTIA 2QSFX 3BI6A 3DZQA 4OAUC 3FZTA 2HOGA 2KULA 1M2PA 4FV2A 3RP9A 3C0HA 4JT3A 1UVRA 4XP2A 4CNHA 3AOXA 2WOTA 2J90A 3TTJA 3QYWA 3VC4A 3ZYAA 1RE8A 2R3OA 4JX7A 5EK7A 2H6DA 5G6VA 3KB7A 2GHMA 3DK6A 3OT8A 5DT0A 4QPMA 1FVVA 2IZSA 2AC3A 2JY7A 4L9IA 2XNEA 4G16A 5AR4A 3HMOA 3P0MA 4QTBA 2XK3A 4LL5A 1AD5A 3KA0A 4D58A 1V0PA 2C68A 3GC9A 4U7ZA 4DE4A 4U42A 3AXWA 3QZIA 4EC9A 3LIJA 3VS6A 1H4LA 1K9AA 4RX7A 4ANNA 4QPSA 3L8VA 3R7GA 3W8LA 4IWDA 3UMXA 2HW6A 3TNHA 4CV8A 3MI9A 2J0IA 3MPMA 3IQ7A 3NX8A 3RK7A 2R0IA 4GJ2A 4DAWA 1IM2A 2QU5A 3N9XA 4FODA 4G6OA 5D7AA 5EH0A 4APPA 4EH9A 2WFYA 2WGJA 4L3JA 4R7HA 2CWBA 4YJTA 3NVMB 1ZRZA 2EXCX 4ZTRA 3FLQA 3A8WA 3I7BA 3QWJA 2JBPA 4JRVA 2CN8A 4QP9A 5D1JA 5HE3A 4F7SA 1J7UA 4FNZA 4FTNA 3FMLA 3MFTA 2QLQA 4KS8A 5EW8A 2QOBA 4ZY4A 4R7BA 3Q9ZA 4CLJA 4JAJA 4ZS4A 5GHVA 3SW4A 3U51A 4QMYA 3Q9WA 5DI1A 4AGWA 3UVQA 4AW2A 3FMMA 3DLZA 4FG7A 4FEUA 4CKRA 3ORIA 2EVAA 4ZSGA 5IMXA 3OTVA 1ZYDA 2CKPA 4GRBA 4ZTHA 3OWLA 3W1FA 2VU3A 3CPCA 3JYAA 3C0IA 3PPKA 3WF5A 4L52A 4NW6A 4TW9A 3E8NA 1GY3A 3TZ9A 2RGPA 4EK4A 4A9RA 1H8FA 2ITPA 1Y91A 2XK4A 1WBTA 3CE3A 3GVUA 3OG7A 4HZRA 3ORLA 5AP4A 4XLVA 4I5MA 4YTHA 2KNVA 4TTHB 3AT4A 3QKLA 4M69A 3DKFA 3ZDUA 3FI2A 3KVXA 1GO5A 3KCKA 3ZO3A 1ZYJA 3QUPA 1PKDA 4NZWB 4A9TA 4CCUA 2BZIB 1OUKA 3QX4A 5DG5A 2NNWB 3R2BA 4IBMA 3MFUA 1WGNA 4AA0A 5JSMA 1OVEA 2C47A 3EQCA 2W99B 3VBQA 3FLZA 4DFBA 3R8LA 2YIRA 4OTGA 2R3RA 3ENMA 2JDOA 4FKLA 4F9BA 3IO7A 2G9XA 2XNNA 3I5NA 4DH7A 2I1MA 3PP1A 3F82A 5JI2E 3VUTA 2EXMA 2QLUA 2VWYA 2ERKA 3OWKA 5ETIA 2XMYA 5H3QA 3KF4A 3LFQA 5HNGA 3FI3A 3K3JA 2GTMA 4C02A 4BDJA 1OUYA 2X6EA 4QYHA 4RA5A 4AU8A 5DT4A 5CEPA 4RC2A 3R73A 3Q32A 3TT0A 4DBNA 2B9FA 5K5NA 4PF4A 3Q2JA 4U79A 1WVXA 3HZTA 3R9NA 3CD3A 3GFWA 2V55A 3QAME 1R3CA 3LCDA 4FG9A 2VTNA 4EZ5A 4E6DA 1SMHA 2ETKA 2PVJA 4E3CA 3G6HA 3ROYA 4JDJA 4AUAA 1ND4A 4YZCA 1ZLTA 3NW5A 1B6CB 5IA5A 3HV5A 3ZO1A 3DJ5A 4FTRA 2Y6OA 3EQRA 4EQMA 3Q4CA 5K3YA 2PHKA 5H8BA 4BZDA 4D0XA 3QQFA 4CG8A 4LFIA 4ERWA 2BAJA 2QCSA 4O7TA 1HOWA 3P5KA 2ZTDA 2YM8A 4MCVA 4BBMA 2O2UA 3MVMA 3UQFA 3KRRA 2K0BX 3MDYA 5H8EA 4IX5A 2VX3A 3IKAA 2WQBA 4YNOA 2VWWA 4LOPA 2WIPA 5AEPA 3RZFA 5E8UA 3FY2A 4AGCA 5CF5A 3EOCA 2XIKA 5K9IA 3G9NA 4DEGA 2VRXA 4LI5A 1H07A 4P7EA 3E63A 3RM7A 4EKKA 2J5FA 2XRUA 4QMOA 4TYEA 4NUSA 2IZUA 2W05A 4FA2A 2I40A 3JY0A 3QQGA 4NCTA 2WTIA 3KXZA 3ORPA 1NV8A 5AP6A 4C3FA 3BQCA 1CKPA 1CTPE 3K5UA 4XV9A 2X4FA 4IQ6A 3DAJA 4BCMA 3RWPA 2OO8X 4AW0A 5CU4A 2VNWA 4NM0A 3PSDA 1SYKA 4BDGA 4GIIA 2WTDA 4D2WA 1PXNA 3MIYA 2HZIA 3DXQA 3NAXA 4NH1A 4BWPA 3N51A 3FPMA 3EFKA 3GCUA 4YBJA 2XBAA 3R30A 1UWJA 4RJ4A 5DYJA 5IDPA 4G9RA 4IZ7A 4L01A 3GXLA 4MVFA 4JS8A 1KSWA 3KK8A 4IB0A 3VWAA 2XIYA 4IDTA 5BVKA 3GFEA 3FKOA 5I0BA 5IQEA 5KKRC 2O65A 4WT6A 2XK9A 3E92A 1O6LA 2GFSA 3RPSA 5CSPA 3VJOA 4OTPA 5AJQA 3NVKI 2CKEA 3IS5A 2W9FB 4KABA 2DWBA 4Y73A 2JY8A 5TO8A 2UZDA 5D7VA 2IW6A 4PP7A 4Z7GA 2VTPA 4XX9A 4FV4A 4EJNA 2YM3A 1R0PA 4IZ5A 3BWJA 4YJUA 4YO6A 4AOTA 2GSFA 4ZLOA 3F2RA 3FLYA 3ZM9A 3KN6A 5ETCA 4PY1A 2QO7A 3K2LA 3NZ0A 4FL3A 4XG2A 3NYVA 4RWJA 5AIKA 5FDXA 2G15A 4I24A 2XUUA 1HT1E 3H0YA 3RK9A 5BVNA 2PUPA 4FKUA 1LEZA 3LW0A 5A4TA 3VUDA 2C5OA 4PQNA 3TJDA 3ODYX 5CVFA 5AR7A 4KIKA 3TM0A 4K2RA 2CNQA 4RZWA 2ITUA 5ETFA 1XR1A 1NXKA 1UFZA 3GU8A 4GU6A 4EOOA 1XH5A 1WAKA 5D41A 3GU4A 2QHNA 5J1VA 2DAEA 5LOHA 3PA5A 1G8SA 2OJFE 3CKXA 4UWCA 3EKKA 5HEZA 4GJ3A 3WYYA 2HWJA 5AA9A 2CDZA 2EWAA 4AT3A 5C27A 3R7OA 3OF0A 4D4SA 4F7LA 3EN5A 1O9UA 2DHYA 1VEKA 3MV5A 4GYIA 4KD1A 2W5AA 4EHZA 4Y5HA 4OTHA 4NL0A 5LVLA 3PFQA 3UO5A 2XRWA 3UQCA 2QODA 4DT8A 3ZLYA 1GZKA 5E9EA 3TDVA 3SOAA 4G5PA 2GCDA 2YCQA 3PA4A 3R1YA 3Q53A 3VVHA 3R7VA 2VZ6A 3CPBA 3HRBA 4KNBA 2CMWA 4QYYA 1OKYA 3OW3A 5M53A 2CP8A 4YJPA 2IVVA 4LRKA 2C0OA 1Y6BA 3DA6A 4FMQA 4JJRA 4ASDA 4LV5A 3OROA 3U87A 3AMBA 3FAAA 4FKJA 4AZSA 5DGZA 4Z3VA 3R1QA 2Z2WA 3EN4A 5ACKA 1BI8A 3CQEA 3MPAA 4PDSA 5D9HA 3TNIA 4EOSA 3VAPA 2VTOA 2ZOQA 3TUBA 3DS6A 4FYOA 4EH8A 4OTQA 3BYSA 3EL7A 5KMNA 1P2AA 3S4QA 2DS1A 4CV9A 1U59A 5KX8A 4F9CA 3P7CA 4U40A 3HNGA 2C5NA 4O0VA 4RVKA 4G3GA 4QT1A 5GZ9A 4Q5EA 2OLCA 2QO9A 5JN2A 1WVWA 1GOLA 4DH8A 4Q9ZA 4CKJA 5TR6A 4QP3A 4FZAB 2VNYA 3GEQA 5CXHA 4RMZA 4YP8A 4DBGB 4UZDA 1Z9XA 2OOBA 2BRMA 4O0YA 1OGUA 2P2IA 3UC3A 4J71A 2MGWA 3WI6A 2XH5A 4ALVA 4Q7JA 3COKA 3CR0A 1YVJA 3BELA 3EYGA 4W4VA 1OMWA 2BRHA 1DO0A 4IX4A 1T43A 3PPZA 2BZKB 4BL1A 3TZ8A 3MJ1A 5F9EA 3SG9A 3BU5A 3ZXTA 1P4OA 5EKNA 3NUYA 5HKMA 4E4XA 5HICA 4IAZA 3WIGA 5L2SA 2Z60A 4UYNA 4DGNA 3ZH8A 3FJQE 2BZJA 1M2QA 5HO8A 2C6DA 2OXDA 2WMTA 3VF9A 3W2SA 5T6KA 4CMUA 1AQ1A 3KMWA 4IJ9A 3RNYA 4U81A 3HAMA 3CP9A 4F7JA 2WTCA 4PTEA 2UUEA 4WRGA 4YTCA 4UWBA 2UW7A 4F9WA 3TKIA 4XP0A 1U5QA 4PRJA 3ZC5A 3FY0A 4CFUA 1KV2A 2H8HA 5CT7A 3H9OA 3FL4A 5CEMA 3ZC6A 3MH1A 4GFOA 2QOQA 2BTRA 3HA8A 5KMOA 3OUNB 3ET7A 1ZZLA 3PXYA 3MTFA 1CUKA 4BKZA 3CLYA 2ZDUA 5IUIA 4CFMA 1UNLA 4QMVA 3F5GA 4AW5A 2VO6A 3HX4A 2CGXA 3QTZA 3OCTA 1J91A 4TWOA 2OZAA 1MN3A 1V92A 3VS0A 4JLCA 2V5QA 3TWJA 1QZEA 5BUJA 2JP7A 4WSQA 2I7QA 3MH0A 2BHHA 3GCVA 2C69A 3FMJA 4FC0A 4MXOA 4DH5A 3JVSA 3HRFA 2ZV9A 3EKNA 4IM3A 1FVTA 2FH9A 3QGWA 3BGPA 4IZYA 3ZHPC 5BMMA 4DFZE 4E4LA 4HVDA 2OGVA 5DVRA 1SVGA 1UV5A 1QL6A 3QZHA 1OTRA 2YDKA 3ROCA 3EJ1A 3FQEA 3DV3A 3BHYA 1WVYA 5CYIA 2RL5A 3HMNA 3O2MA 4A06A 2GQRA 1ZAOA 4IAIA 3AC8A 1WBNA 3D94A 2R3HA 3M1SA 4H58A 4L44A 4O2ZA 4XUFA 5HGIA 3R8VA 4ITHA 4NTSA 3ORNA 2IVSA 3LQ8A 4UALA 3UIBA 3EHAA 4LRJA 1ZMUA 4J97A 5CVHA 4PMMA 3VJNA 1JQHA 5IMEA 5EI6A 3PWDA 2ZV2A 1G41A 5E1EA 5I5ZA 5F4NA 4I22A 4II5A 2UW4A 4ZY5A 4USEA 4RLLA 3W33A 5AP5A 4DGGA 5GINE 2XM9A 5HG9A 1LPUA 4NU1A 4IEBA 1GZNA 4AGUA 3EFWA 3HEGA 1SNXA 4O7NA 3TV7A 3LFCA 3FYJX 4FUXA 4IC8A 2YM6A 2VV9A 2LAVA 2R7BA 1XH8A 2XM8A 4BN1A 3ZDIA 1WBSA 5E4HA 2CKQA 3DAKA 5AP7A 2C1BA 3LJ0A 4WNOA 2WU7A 2B9IA 2GHGA 2OG8A 3ERKA 2JEDA 3V5LA 1WIVA 4F9AA 2R3MA 3Q52A 1BKXA 2ITQA 3GC7A 3JXWA 4IX3A 3QA8A 4S33A 2B3TA 2RG6A 3OXIA 4ZXTA 4JIKA 4RIWB 2WTVA 3UGCA 3HGKA 4FEQA 4FV7A 2GHLA 4FT0A 2YWVA 2X7OA 4GFMA 4F0FA 3O50A 1CMKE 2HENA 2OW3A 3UO4A 3UVPA 3DNDA 3DBQA 4ZJVA 1SVEA 3QTRA 1EH4A 3I5ZA 2Z7SA 1U54A 5BMSA 1W84A 1W83A 2XYNA 3C9WA 4XHKB 5HNIX 4BFMA 4Z55A 3LCUA 2VUWA 2X81A 5HD4A 4WNKA 4BKYA 5IU2A 4QMZA 3R7YA 1NT2A 4RIOA 2WB8A 4K33A 4OBPA 3KXGA 3KXNA 1L3RE 2PVLA 3ZFYA 2UZOA 3PXRA 5IKWA 4I21A 1ZV1A 2UVYA 4IB5A 4CQGA 5LVNA 3OFMA 2GNIA 3LJ1A 3PLSA 4XRJA 2XNMA 3UP7A 4L8MA 1E94E 1YOMA 5HORA 3BE9A 1L8TA 5JEBA 4W8DA 4HVGA 3LQ3A 3FC2A 3P79A 2VWXA 4Q5HA 1WMKA 4O82A 2ZB0A 5JZJA 2AYPA
chains in the Genus database with same CATH superfamily
5LMKC 2JD5A 2OIDA 4GG7A 2F7EE 4LCBA 1UU8A 1ZAEA 4NCTC 2V22A 3E7OA 3PFYA 3ETAA 1M2RA 4M66A 5ANJA 5EYMA 5FP5A 5CAPA 1PW2A 3KOXE 4GEOA 4FVRA 4O38A 3OOMA 4O96A 2Z8YM 3DFCB 3F5UA 3EFJA 4UV0A 5I3OA 4ARKA 3BYUA 4W4XA 4AZTA 4JR3A 2PUUA 4AXFA 3NW7A 4FIHA 4EBVA 3NUSA 1A48A 1JB0F 2GS6A 3T9IA 2CCIA 2F7XE 4GK3A 5B0XA 1M7QA 4L00A 5EOBA 5FEEA 2H9VA 3QTQA 4IIRA 3VUHA 4BTMA 4E5AX 4EOQA 2OH0E 2DWLA 4EWQA 2JKKA 3C4XA 4FL1A 4MNEB 4ZMFA 4QD6A 3B9PA 4EZ3A 4TRLA 4G3CA 5I9YA 2WKMA 2X2MA 2DWZB 5C8NA 2A27A 3GNIB 2PVFA 4CQEA 4J1RA 3KFAA 4ASZA 3ANQA 4ZIMA 4P90A 4IZAA 3I01M 4CFWA 4O81A 4BWKA 1DI8A 4IB1A 3A45A 4EORA 3OUKA 2F7ZE 4QPAA 3DQWA 4IWPA 2X39A 3NFGB 4ZK5A 4B3TM 1R7RA 3GCQA 1Q8UA 3VBVA 4IWQA 2MJ5B 4QNMA 1C7YA 2ZTCA 1GAGA 4LF9M 3RKBA 1YHVA 3FTDA 3P7AA 4JNWA 5TE0A 5CEOA 5HBEA 4BGGA 1UNHA 4AA5A 1QUSA 4A4LA 4H1JA 5AUVA 2X8EA 3W2OA 4DFLA 3W0NA 5IQHA 3PWYA 4R7IA 2YFQA 4YURA 2UW8A 1FPUA 1H28A 2BFXA 4MXYA 3N4VA 3RALA 5BVFA 4FVPA 5FWKK 4NFMA 4O4BB 3ZTXA 3CS9A 3DBFA 3L1SA 4AQKA 4H36A 1E9HA 4BHNA 1HNWM 1YXTA 1ZOEA 1V1KA 2YM5A 4YZDA 1X8BA 4WOVA 3R83A 3GOPA 4QQCA 3S00A 3GPXA 3M11A 4H39A 2ONLC 3KS4A 2YWPA 2UUCM 2Q0NA 4GT3A 3RVGA 3ZRLA 3TE6A 3PIYA 3L8XA 2FO0A 4IANA 3UNKA 1IN8A 2C6KA 4HJOA 5EYCA 3VF8A 4EH2A 3SYLA 2Y0TA 5IEXA 2X0OA 4HVHA 1YI6A 3COMA 4BDEA 2X8IA 3TDVA 3UOJA 4B6LA 4MXXA 3UDTA 3NWWA 2W7XA 2FSTX 5KO1A 2G01A 2VWUA 4I41A 4UMPA 1HJPA 3D2IA 5I9VA 5KKRB 2WMAA 3AOEC 4QOXA 2PZRA 1YXSA 3HU3A 4RA4A 4XBUA 4FG8A 1OFIA 3UBDA 5KZIA 3SQQA 4ALUA 2IZTA 3BYOA 1H08A 4FNXA 3W32A 5FTNA 4HEOA 2CLQA 2RIOA 3JS2A 5JH6A 4G6LA 1FOTA 4WUAA 2OZAB 3B8QA 4H3PA 4B4LA 3D14A 4KINA 2E9UA 3QRIA 4UXLA 2I7PA 3MPTA 2A4LA 3OW4A 2EO2A 3ZONA 3GQIA 4DA5A 4ASXA 1UM8A 4MB7A 1JVPP 2CGVA 3KMMA 3F5XA 4FBXA 5CU6A 5EW3A 4FSRA 3A4OX 3PRFA 4AXCA 1KV1A 2C3LA 2W9ZB 1VEGA 5CX9A 2E2BA 1WBWA 4NK9A 4FV6A 5GJDA 2FB8A 2J0MB 4W4YA 5HIEA 4F1TA 1YW2A 1RJBA 3C4ZA 1YUBA 4JAIA 5EP3A 3HV6A 3DBCA 5LCKA 3R9DA 3RPYA 3UODA 3U6MA 5AUXA 4GVJA 4JI7M 4G31A 5CSVA 4CFNA 3NCZA 3GRRA 2YJRA 2HY81 3AC2A 3ACKA 3EQHA 5EDPA 2B9HA 4BDBA 4BDAA 4G3OA 2PVHA 3AD5A 3GQ3A 4U80A 5KMLA 2ITXA 4IXPA 1H1RA 4D2VA 4F70A 2OF4A 3VNTA 5CEKA 5A4LA 2G2HA 4NJ3A 3KDSE 4FKIA 4S2ZA 1C1KA 1FGIA 4MNFA 3PVWA 4TNDA 5HBHA 1WCCA 3I04M 3HMMA 2WMBA 3COHA 3KULB 4XYFA 3GQ4A 3GQ5A 2JA2A 4FZDB 4GKKM 4K0YA 5FEQA 5H9BA 1T3TA 3MGYA 2CN5A 3NUXA 1PXPA 4LL0A 1ZQ9A 2ZAZA 2ZFYA 4I5HA 2OFUA 4DFNA 1R4GA 3LAUA 3UZRA 1OZ1A 5DT3A 5HO6A 3Q04A 4GT4A 1YXXA 4C35A 2HXQA 4HNFA 3R00A 4XG7A 3O0GA 4EUTA 2IZRA 4IM2A 4DTKA 2C6OA 3EFLA 4WBOA 4F65A 2IVTA 1OIPA 1E9SA 1PXIA 2J0KA 3ANRA 4D2PA 4N4SA 1GJOA 3MVJA 2YIQA 4RJ8A 4XK8F 3I79A 1XH4A 1IN6A 2ZM6M 2VWIA 3P23A 5DHJA 4OX9M 4AP7A 4MGIE 3AC1A 3FXWA 3T38A 2I0YA 3OHTA 3QXOA 5AP0A 3V5WA 4FD2A 3O5AA 2KW0A 1GIHA 1FMKA 2DENA 5EI8A 2AUHA 4EH5A 5I9UA 4AKGA 2PPQA 1UNGA 3VIDA 4FEWA 5H8GA 4LV8A 7CATA 2O3PA 3R1NA 3HHYA 1JR3A 3K9PA 2UUBM 5AUTA 3DKCA 1R2YA 1Q5KA 4KKEA 4ZTLA 4XBOA 3C0GA 2AEGA 4O7ZA 4PDGA 1H1PA 4OAVB 3HUBA 1BX6A 2PVMA 5L2QA 4C58A 4GH2A 3U61B 4AA4A 5LWMA 5IG1A 2QC6A 3ATSA 5HESA 3NUNA 4M3QA 2Y4IC 3LVVA 4FSWA 5HIBA 3I6UA 4S34A 3W0RA 3K54A 3QKMA 5IUGA 3UG2A 2LVPC 3IHPA 3QL8A 5GNKA 1IEPA 4LFAM 1ZOGA 3ODZX 2LGCA 2WNTA 5E8SA 3WF5A 4QP6A 3FEGA 2PK9A 3UDSA 4ITIA 4QYEA 4BZNA 4EH4A 3FXXA 3F3VA 3QUDA 4N0SA 3U9CA 3OZ6A 5FM2A 3DOAA 3ZU7A 3QZFA 4ANBA 2OOAA 4YJNA 3N4UA 3HHZA 1DGHA 5CXZA 5DR2A 3O7LD 5LMUM 3VVHA 3IW4A 4BTJA 4H1MA 3HP2A 4GUBA 1JKLA 5EQPA 3TN8A 2CNUA 4C4IA 5AAEA 2VQEM 5ITXA 3E3PA 2F4VM 4XCUA 3ZXZA 1ATPE 3D5VA 3DPKA 5J9YA 3OWJA 4XV1A 2BJWA 2BVAA 3FZRA 2BDJA 3LM0A 5CNOA 3WZDA 2PVRA 3VS1A 3WF8A 4IFGA 4DGLC 3C5IA 5IUHA 3Q5ZA 4F2LA 5ITYA 3MA6A 5HVJA 1H0WA 4PL4A 3FXZA 4FSQA 1U46A 1K2PA 1G4AE 3EB0A 4DTBA 4LOQA 1VYZA 4AZVA 3L9LA 4QMPA 2VTQA 1P4FA 4IW0A 5IPJA 2LVAA 1J1BA 2BDFA 4GFGA 3UE4A 4I5CA 2YLFA 5EQTA 4LQMA 1IASA 5E8WA 3RHXA 4C0TA 3AOEA 5EHLA 4CKIA 3ORKA 4NT4A 4YPDA 3ZO3A 1DGFA 2ITTA 5AMNA 4C4EA 2NO3A 4QMXA 1CSNA 2JDRA 3MY0A 4UEUA 5JQ5A 3FLSA 3QLFA 4RFYA 4B3MM 4DEAA 4DINA 5IA4A 2Q2EB 3QZGA 4L43A 4DT8A 3Q9YA 4GSBA 5BUIA 4KSPA 5CZHA 5AR3A 4JDKA 5CASA 5IISA 3W2QA 2IJMA 4FSMA 4L16A 3L9NA 4D4VA 2ZANA 2HZNA 4DV3M 2W5BA 2EJSA 2YA9A 4WO5A 4V05A 2ERCA 3NPCA 2BRBA 3FYCA 3IPHA 3GLHE 4IFCA 5DR6A 3W10A 2O5RA 3W0LB 4AOJA 1G8KA 3DKGA 3SYKA 1XQZA 5FTKA 1Y8GA 5F20A 1YXVA 3HRCA 5L6PA 2OSCA 2IW8A 5CS6A 2IEWA 4CTCA 4TYHA 4FVMA 3R8PA 2PZPA 3GLFE 3W18A 4QP8A 4D28A 3GLHA 4QMQA 2Z7QA 4JL9A 4HLQA 4QTCA 1YXUA 3QBNA 3QRKA 2FGIA 1IQPA 1YWRA 1OL6A 4XOYA 2OZOA 5AP4A 1IG1A 4ZTQA 4M8TA 4EQCA 4DR5M 3GPPA 2J7TA 2VWZA 1JLUE 3BX5A 4QHSA 1LTMA 4PPCA 2BMCA 3V5QA 3U6HA 3AC4A 3DGKA 2W0JA 4CT1A 3ZSHA 1JSTA 3L27A 4NKAA 4UXQA 3THGA 4O6EA 3OWPA 1DM2A 2KNZA 5CT0A 3GPYA 2JIVA 2XYUA 4H3BA 3UNJA 4JI5M 4OBQA 4D4YA 4LGGA 2NPQA 1SXJD 3GC0A 3AKJA 2LVOC 1DS5A 3QD3A 4YJVA 3HHWA 4HNIA 3EQDA 4KIKB 4DV7M 4V01A 2N35A 1OITA 5I9XA 4RBLA 4YJSA 5TKDA 2QBYB 1YDSE 2X6DA 3QALE 5ETAA 1YWNA 3VW6A 4GHLA 5A9UA 5AUZA 2IO6A 4IAYA 1LEWA 4K6ZA 3W68A 2Y4IB 2C3IB 3SAYA 3KEXA 4AT5A 3BZ3A 3PE1A 4F7NA 4JI6M 4RRVA 4GIPA 3KVWA 3K1JA 1H1WA 3R22A 1URWA 2YCSA 3C5UA 5BV3A 3IW8A 2YAKA 4KKGA 4YC3A 3FLWA 4OLIA 3H30A 4D80A 4ZSJA 4YUQA 5CAVA 1SG9A 4EQUA 1BLXA 1URCA 1S3SA 2QQ7A 4I4EA 4ZTNA 3TACA 4L46A 5E8ZA 3BHHA 4I6HA 2WAJA 2P55A 2XNPA 3BXWA 3P08A 1GNGA 3PXQA 3IECA 1DV0A 1VQ1A 2Z7LA 4OGRA 4XJ0A 4CFXA 1IAJA 2LHCA 3AOGA 3E5AA 1H27A 3E64A 1YDRE 3CY2A 4BWXA 2Z3XA 1OQYA 3KN5A 2C5RA 2JLDA 2VTLA 4P16A 2XNOA 1PHKA 2VO7A 3KP1E 1NVSA 4QP7A 5DRBA 3NWLA 4DR4M 3QWKA 2JITA 2CHGA 4G2FA 3LFNA 5BX0A 4U43A 4IWOA 4EJ7A 2XZSA 3IOKA 5CU2A 1JR3E 2L09A 4BR3A 3FZOA 4FRFA 2XIXA 3BPRA 3ORZA 4LRMA 4XBRA 4JOAA 3K92A 3OTUA 4R8QA 4ENXA 4ZS0A 4UMUA 3AKKA 1J3HA 4AN9A 5LMKA 4DG2E 3U6DA 2JXNA 5HCYA 3PIXA 2GMXA 3R8UA 2XK6A 4DEDA 3D8BA 5KMKA 5LQFA 5CSWA 3PY3A 5LXMA 3HLLA 5IDNA 4AW4A 5IA0A 4LM5A 4EIWA 1YKRA 3UIXA 1P14A 4OVZB 5EM8A 5T3QA 4EOJA 1J7IA 3SHFA 1TDHA 2DWNA 4Q2AA 4RX9A 4O4FA 5CWZA 2QURA 2W1DA 3NRMA 4X3FB 3KRWA 1QAOA 2HW7A 3IG7A 3G5DA 3R02A 1UU3A 3WILA 1RDQE 4WUNA 3V8SA 3AGMA 5M06A 3D0EA 3HMIA 3EZRA 2C1AA 3NDMA 4ZSAA 4O1OA 1Q8WA 2JIUA 2YCRA 4GC5A 3A60A 2FE8A 4G3EA 3OY1A 4P5QA 4EK3A 4M0WA 3OOGA 3U60A 4IAFA 4JVGA 3MW1A 4UYAA 5CQWA 1XB2B 5BVEA 1TQIA 3UZUA 4X62M 3H0ZA 3KU2A 1J09A 4G1WA 4X6RA 4ZY6A 4DYMA 4A4XA 4PDIA 5AIRA 3O8PA 4QDEA 5IQGA 4EYJA 3T1YM 3HY5A 1FQ1B 2WIHA 3HL7A 2W1FA 1O6KA 1Q41A 3M7GA 4E20A 4LRSA 4CGAA 5AUYA 2C30A 1OKSA 1JBPE 2IN6A 1FINA 2K9DA 5C9CA 3TIZA 3WOWA 2R46A 1ZY5A 2PVNA 3NIEA 3EL8A 5D12A 5I3RA 1IBMM 3U61A 2V0DA 1D2NA 1ORYB 2FFJA 2WU6A 3I4YA 4UZHA 3R7UA 3VBTA 4J98A 3PRIA 4NXNM 3KQ7A 2OJIA 4L3PA 2C9CA 4MH7A 1VLRA 4LOOA 4ORKA 1T6OA 2BNKA 1JPAA 3F3WA 3P86A 4WP2A 3AT3A 3SMPA 2BIKB 3CQWA 2XLJA 3NLBA 4L67A 3TI1A 5L8KA 4AAAA 3R21A 1S9JA 4EL9A 2IPXA 4MGYE 3FKEA 5JT2A 1OJLA 4IBJA 3Q8GA 3OC1A 2I6LA 2R3NA 4P2KA 4RPVA 4CVAA 5JMSA 5CEQA 5HOAA 5A14A 3FPQA 3QC9A 3UOKA 5LARA 4CD0A 5AADA 1GVNA 3F3UA 3LCVB 4F6UA 1IN4A 3FBVA 4GKJM 3R9OA 2VTMA 3DB8A 3RNIA 3MHVC 4X2KA 5J7HA 4QMSA 2UV2A 4GT5A 5LCJA 5FUTA 1YI3A 2W17A 1T45A 3AV0A 2X0GA 2UZWE 5JGBA 2C6IA 2I7NA 4JI4M 5DYIA 3VS7A 4AQCA 3IW7A 3UO6A 3ZO4A 4G6NA 4OT6A 4OTFA 5TOZA 4B0GA 3PJ3A 4I4FA 4AE6A 4EH6A 3GLGE 5EQYA 1D0MA 4MXCA 1OKZA 2ZM3A 4FV1A 4A4OA 4F6WA 2GNGA 4RLKA 4ACMA 4JR7A 3TWKA 4LUEA 3SOCA 4NJDA 3TNPC 4AACA 3CTJA 3B2TA 4YLLA 2MROB 3GUBA 4I92A 3KC3A 3CF2A 2UVZA 4NM7A 4JBVA 4Q9SA 4J8MA 4X3FA 2VX1A 2PUNA 3IGGA 5HLWA 2QR8A 1PJKA 4KLNA 1M14A 4FKVA 4BDHA 3B89A 5M4CA 4C3RA 4LYNA 5EG3A 4JXFA 4NM3A 1ZMVA 2I0HA 3EN7A 4EOKA 2B55A 2B4SB 5CAUA 5DOSA 4K8AA 4C38A 4DH3A 3A46A 3MN3A 5KMMA 2CNVA 4QMUA 5HZNA 3K3IA 4JQEA 3BCEA 3DJ7A 3P7BA 4K77A 3AKLA 3SAUA 4FK3A 3A42A 3C58A 4JQ7A 2W1EA 4X2GA 2X0PA 2OBJA 5E8YA 4C33A 5LMAA 1VZOA 4I5PA 3Q4ZA 4FV3A 5J5SA 1PXJA 1G8AA 1D0KA 2C6MA 5AP1A 4HOKA 3KF7A 3DXPA 3NSZA 3HJ8A 4I94A 4J8NA 4CEGA 3W16A 3QCYA 3J81S 3SXSA 4L6V6 4N6ZA 2BALA 1Q8YA 1XBBA 4Y95A 2RKOA 1VYWA 2JAVA 4BIDA 2D7HA 2KA6B 3LQRA 2NP8A 4IBBA 3P9JA 3QLGA 4FK6A 4J52A 4UMRA 4YJOA 4M15A 3RGSA 2C6TA 3TKUA 4EBWA 2UXDM 4BCHA 4N70A 5LVOA 5CQUA 2UZEA 4B9DA 5J79A 3D9VA 5DFPA 4BGHA 4DHJA 4QMNA 3C13A 2GNHA 4HGLA 3BGZA 2IW9A 1E1VA 1TF0B 3SC1A 2A19B 5FQDC 4QOSA 2BILB 3BLHA 3CJFA 4FKGA 3A7HA 2CHLA 3LOKA 1YI4A 2CGWA 3UPXA 3CTQA 4BDCA 2VQFM 3TNQB 4RJ7A 4JBPA 1DGBA 4DV0M 4E6CA 4ONAA 4YTFA 4LV7A 4ANQA 4PNKA 1TVOA 4X65M 4TT7A 4MBIA 3RE8A 5AAFA 3DKOA 4Z7HA 2UVXA 3UG1A 3A7FA 5JFXA 3UOLA 4HCUA 3CQUA 4FR4A 4FWGA 3FL5A 4RIYA 5L2WA 2VGPA 1JSVA 2R0UA 3FSKA 2FS1A 3E8CA 4RIWA 3J80S 3VRZA 2ZDTA 3UOHA 3EN6A 2QR7A 3C3EA 3QC4A 4IVCA 4FIEA 4RFZA 4R78A 3W0OA 3WBLA 2DKLA 5KHWA 1OI9A 5L2TA 5JRQA 3ZUUA 2YLEA 4O6LA 5FD2A 3TJCA 3EIHA 4EYMA 4AN2A 1OIQA 2Y8OA 4RSSA 4GKHA 3GLGB 4DTAA 3IG8A 2GDOA 5J7BA 2O8YA 1PJQA 4HPUE 2LBCA 5EM7A 3LQQA 2OH4A 2VWBA 3OCBA 5HX6A 2W4JA 4D9TA 1MU5A 1WHCA 3R9XB 3D8LA 5AV2A 2YISA 3EWHA 3FZ1A 3GT8A 4I0SA 4ALWA 4FOCA 3KREA 2YAAA 5ITRA 4F1IA 5ITXE 2VO3A 3ZLSA 2ZM4A 4YSMA 2R44A 3V5PA 5C1QB 5CAOA 3A7IA 4CSVA 1W7HA 2E9NA 3AC3A 4PX6A 5HE1A 4FW9A 1OIUA 1U4DA 5DH3A 4BCGA 3U6EA 2QBYA 4LF8M 1W5TA 3FUWA 2CV1A 2FUMA 4L68A 4RC3A 2E5LM 1DGGA 2WZJA 2G5GX 3ZOSA 2Z02A 4EI4A 2VTSA 2RSVA 2CKOA 2PULA 3WZKA 2JUJA 3OEZA 5E90A 3K9OA 2DXIA 3A2CA 3HHXA 4U6RA 4AE9A 3AMAA 1W8CA 4YU2A 4JI9A 2OFVA 3LMHA 4MNEA 5A46A 2J50A 4Y8DA 2F2UA 4U3ZA 3ZRMA 2UZNA 4XG4A 4Y83A 4C37A 3R2YA 1H01A 3FUXA 1VDDA 1KYIA 3QCSA 4HCVA 5IQCA 3LJ2A 4PTCA 2LVQD 3KRJA 5C8MA 5K5XA 3F69A 2PZIA 2XKEA 2WMQA 1VG5A 3QAUA 4FTJA 4WSYA 4ANSA 3ID6C 4D0WA 4J7BA 4KAOA 3D15A 4HVSA 5C01A 3Q5IA 5KHXA 5M09A 1IRKA 2XARA 1KE5A 2F5PA 1V0OA 1OKVA 1JSUA 3G0FA 2XS0A 2R64A 3MB7A 1EFUB 1BMKA 3R9HA 2XBJA 1ZYSA 3AJIB 3E46A 5KQ8A 1NVQA 4UWYA 3ZUTA 3PVGA 4U45A 5ANDA 2PWLA 2R45A 5F95A 4B3SM 2CV2A 4GMYA 1HNZM 4KWPA 3IG5A 4D1XA 5IQFA 4V0GB 3BHTA 1XH6A 3MVHA 4FZFB 4ZPXA 1N75A 2J6MA 4YSJA 3JY9A 5KMJA 4LGDA 3V5TA 5E6JA 4WNPA 4YZMA 5A4EA 1OL2A 4WA9A 3ALOA 1G3NA 2RG5A 3F6XA 3GCSA 1Q8ZA 3HJSA 3LFBA 4GEWA 3EQPA 4G17A 2PL0A 1QANA 4PP9A 5CI7A 5E7RA 4DV5M 2PE1A 5I9ZA 2BKZA 4MXZA 5J9ZA 4DFUA 5K4JA 3C4CA 4WNMA 5HI2A 5CY3A 1SXJC 5DIAA 1H25A 2UW9A 3ZCLA 3SX9A 3OBGA 2R5TA 1QPDA 3MVLA 4X2JA 1J7LA 2O63A 4XLIA 1NNJA 1P3QQ 1DAWA 2V7OA 3HDMA 3UQGA 3ZMMA 2J7NA 4FTTA 3KOZE 5K0KA 2XKDA 4F63A 4FSNA 4YHHM 3U9NA 4ACHA 3PA3A 3HWSA 1XWSA 3BIZA 3NUPA 3RFWA 3MYGA 4D4RA 2VDBB 1H26A 4ZSEA 5HTIA 3QF9A 2CHVA 5E26A 2NQ8C 2GQGA 2UZVA 1X37A 1N78A 4X2NA 4FI1A 2O64A 3BQRA 1ZWSA 3EH9A 4IM0A 5FXQA 2V62A 4A9UA 3E8EA 3GC8A 4HYSA 5E1SA 3A7GA 5JFWA 2OI4X 3LCKA 2J51A 3KL8A 4IHPA 4ENYA 4QP2A 2B0QA 3E62A 1M52A 4DCEA 2C98A 5IREB 3E3BX 4PL3A 1JKTA 4TYGA 3IGOA 5CZIA 5L8JA 4BB4A 4EKLA 4FV8A 2R3QA 4XRLA 3VUMA 3U55A 1HQCA 3A99A 5ANIA 3P78A 1Z5MA 2QOCA 2B1PA 4D82A 2XCKA 5EW9A 1PF8A 4HYIA 4A9SA 3CF0A 1YDTE 3DZOA 4QYFA 4R1VA 5HHWA 3S3IA 3J7BA 1SNUA 1R39A 3WF6A 4ANLA 2GPHA 5M4UA 1IFYA 4JX3A 4DGMA 5EHOA 3QCQA 1YHSA 4CCBA 4CLIA 4LG4A 5JGAA 2PMOX 4GVAA 4EWHA 3MWUA 2M60A 2W5HA 1K82A 1U54B 3HV3A 2B7AA 3CKWA 4JI3M 4QP4A 1AIPC 5IH6A 5KNJA 3RCJA 3T9TA 2C9OA 5E92A 5EYDA 3D5UA 3QD4A 4U44A 3THBA 2Z4SA 2VAGA 3QRJA 3EZVA 5HBJA 3ZBFA 4YTIA 4EZ7A 3LPBA 3MJ2A 3O7LB 4LGHA 1FVRA 2D7GA 1Q8TA 2F4JA 2XVDA 3FZPA 4XG8A 1IN5A 3NAYA 3QYZA 4IAAA 5E8XA 4I6BA 3FDNA 4AN3A 3F2AA 4GCJA 1HT2E 1BL7A 3BLRA 3LMMA 3BBZA 2W4KA 3EQBA 3KK9A 3MFSA 3O23A 1DO2A 3KOWE 4R3PA 4FEXA 4QMMA 3CGFA 4OW8A 3UTOA 2Y6MA 3V76A 5HE2A 4EK5A 1GLNA 3DBDA 5GZAA 3GQLA 4RZVA 2G3QA 4G4RA 3PZHA 1WR1B 2SRCA 3IONA 3AGLA 5DBXA 4OW0A 2X4AA 4LG2A 2WQEA 1XO2B 3R8ZA 3TV6A 4GV1A 2J5YA 2ITOA 3NYOA 4QTAA 4RVLA 2Y4PA 2KEBA 4HPTE 4CZTA 4KO8A 2J0JA 3R7EA 4G3FA 3GRUA 4RT7A 4TKSA 5FG8A 3HKPA 5KUPA 3PNYA 3KIOC 2DAKA 3FTFA 1Y8YA 1YWVA 1R2ZA 2ZVAA 3M2WA 3MY5A 2DZLA 2JKOA 3VS2A 4HGSA 5M07A 3LKMA 1BYGA 3DJ6A 1GIIA 1K3AA 4O0WA 4QEBA 3A62A 4J95A 1Z57A 2NRYA 4JG8A 3HV7A 1JKSA 2WXVA 3FSFA 3NCGA 4PV0A 3U6PA 5CU3A 3MMPA 1CDKA 5M44A 4J99A 4MAOA 5KE0A 3TV4A 2WELA 4ANOA 4N57A 4C59A 2PY3A 2BIYA 2YN8A 3O71A 3VBYA 4CZYB 4GKIA 2HL7A 5FLFA 5L3AA 3C1XA 1Z6TA 2C0IA 2C3JA 3BEAA 1YRPA 2VTHA 3NYNA 3ZEWA 4AZEA 2R62A 3HX3A 2O0UA 4M0ZA 1YQJA 4GU9A 2L4FA 3R28A 4LY6A 3Q6WA 4DDGA 4QP1A 3UIMA 3RGFA 2P33A 3LFEA 4WD5A 2QG7A 5C4KA 2WO6A 3M42A 1OBDA 4O84A 3EMGA 2HZ0A 4NWMA 4OUCA 4ZSLA 4ZJIA 4O83A 1FBNA 5CSHA 2R18A 2XSZD 4M69A 2HKJA 4FTMA 4Z6YA 1OL5A 4L7SA 3O96A 3EIEA 3W2RA 3ZDUA 2G2FA 1UU7A 2Z7RA 3BE2A 4X3JA 3NEWA 4X21A 4RQVA 5A3XA 2YFXA 5L8LA 2Y0QA 1YOLA 3RZBA 3R1SA 3OD6X 3SXRA 2PZ5A 4GC9A 4KUJA 4XG9A 4IDVA 4E7WA 2FH0A 2K47A 1N77A 3QD0A 4LFCM 1GZ8A 3PFIA 1YOJA 4M97A 3ZSIA 2WQMA 4BDDA 2QCUA 1KOBA 4KRDA 4Y85A 1PMEA 4AX8A 3OCGA 4BCPA 2Q0BA 1H24A 2O25A 4ZZOA 1KUTA 3V51A