2QNJA

Kinase and ubiquitin-associated domains of mark3/par-1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
324
structure length
318
Chain Sequence
GAMGSEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITATYLLLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational instability of the MARK3 UBA domain compromises ubiquitin recognition and promotes interaction with the adjacent kinase domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords MAP/microtubule affinity-regulating kinase 3
total genus 97
structure length 318
sequence length 324
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2qnjA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qnjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qnjA01
3GOKA 3NIEA 2UV2A 5EHYA 2EJSA 4OTHA 3QRUA 4RRVA 3ZEWA 1P5EA 4J99A 3L9NA 5M55A 3HUBA 5CEIA 1PXMA 1KUTA 3QZFA 2F7EE 2YLFA 4E4MA 1XO2B 1JKKA 2G1TA 3IW5A 4S31A 4JDIA 4WG3A 1J7UA 3ALNA 5HE1A 2PPQA 1WZYA 3LFAA 2QO7A 4RX7A 5IKWA 2OZOA 2B0QA 4O6LA 4F6WA 3TDVA 4QP3A 2QOFA 4U5JA 4BCMA 5CZHA 2FSOX 4TNDA 1Q99A 4RIXB 2PL0A 2Y0AA 2PWLA 4YJUA 3SXRA 4FZAB 5J7BA 4FV8A 3F5XA 4WNKA 4EOIA 2VWWA 4ZMFA 4XP0A 4L01A 4WNOA 2CCIA 4GT5A 4KIOA 5HLPA 5CWZA 5HEZA 2KNZA 1SVGA 3QYWA 4FZFB 4AWIA 3IKAA 3LQ3A 3KY2A 4TTHB 3KRXA 1G8AA 4L3LA 1Z5MA 3KK9A 4UEUA 5CU2A 4M66A 4WSYA 5E8SA 1NY3A 2OIQA 4JVGA 4KKHA 3P5KA 4ZAUA 2VGPA 3UBDA 1Q8WA 3Q4UA 4GG5A 4FYOA 3IDCA 4W8DA 3NNVA 4P4CA 4BI0A 3CQUA 4IM2A 4UV0A 1OB3A 2C6TA 1PXJA 4JIKA 2CKPA 3HX4A 4U45A 4ANBA 2WMAA 1ATPE 5L8KA 1IAHA 2UW9A 4AZWA 4E6CA 3D9VA 5CU3A 1MQBA 1JLUE 5H8GA 3ZZEA 5A14A 1O9UA 4X7QA 3OXZA 2WQEA 3R21A 5B2KA 3VNTA 4M84A 3WZKA 4FEXA 4ZSEA 3EIDA 3DJ6A 1IEPA 2QOOA 2WU7A 1S9JA 1J7LA 5EHLA 4RFMA 4C8BA 3QTQA 4EUTA 2X7OA 1CDKA 3GGFA 4U6RA 5FM2A 3CE3A 4L43A 2OOAA 4CXAA 3ANRA 3PDTA 5IQGA 5HIBA 2P2IA 3DPKA 1P4OA 3UTOA 4TRLA 3CSVA 4EJ7A 3F5PA 3RM6A 5AUTA 3QAME 4QMWA 2QO9A 4TWOA 3ZHPC 4BKYA 5AP1A 2BAKA 2W9ZB 3R8LA 2IW9A 1AIPC 2CWBA 1DO0A 3NX8A 4KD1A 4UMTA 1XH9A 4BF2A 2R3QA 3O7LB 4FNZA 5LMKA 2W1FA 2WGJA 3E3PA 5BVWA 1PMEA 4IIRA 5BPYA 4L53A 5ANEA 2OZAA 4YHFA 2YM7A 3BV2A 3OXTA 3VS5A 3PA4A 4NU1A 4XG7A 3KXHA 2JBOA 3QX4A 2UZBA 5CNNA 5ANOA 4XV2A 1G4AE 1URCA 3KEXA 1GIJA 3R83A 4R3CA 4QMUA 5H9BA 4RPVA 3V51A 3JVSA 1NW1A 1MUOA 3UJGA 1IAJA 4EH4A 2V5QA 1P3QQ 4PPAA 5E8YA 2WNTA 1Q61A 2FSTX 4C4HA 1WIVA 5JKGA 1QPJA 4J8NA 2XIKA 2FSLX 3WE4A 4P5ZA 4YHJA 4JS8A 5AR8A 4TWCA 2VO3A 5JK3A 3WARA 2ETMA 4D4SA 3FI8A 5EKNA 3C0HA 3DB8A 2R0UA 2HZNA 4FIJA 4MKCA 3VN9A 5JZJA 3MGYA 4L9IA 5CAQA 1F5QA 1FPUA 3DNEA 3LPBA 1MQ4A 4NKSA 4CCUA 5K5NA 4ZTHA 5ANJA 3SQQA 3VUKA 5J9YA 3DLZA 1VYWA 4HNIA 5KBQA 5AV0A 5M08A 4RVKA 3C0GA 4F9WA 1FVVA 4MK0A 3GLGE 4DT8A 2NPQA 2QKWB 1DO2A 4BKZA 4ZOGA 3P1AA 2YERA 3FPQA 4L8MA 2JNHA 4N6ZA 4QMNA 4KUJA 3OG7A 5KBRA 4PWNA 1UNGA 1U54B 4I5MA 3VBTA 4R78A 3BGQA 4CSVA 5HQ0A 4GFOA 5HU9A 2H6DA 2UVXA 5LVLA 4IAYA 1B6CB 3MI9A 4FTRA 4U44A 1J1CA 4QTBA 2C6KA 2ITZA 4BDHA 1H1PA 4FSUA 3VHKA 3PE1A 1GIHA 4QQJA 3GCQA 5HIDA 2CSNA 4FG9A 3FZPA 4JDJA 4Q2AA 4ZMEA 1SZMA 4KB8A 2O2UA 2XJ2A 4I3ZA 3V3VA 4BR3A 3FQSA 4FT0A 4HGEA 2Z7SA 1B38A 4OT5A 4G6LA 3V8WA 3I7CA 5AIKA 1IA8A 3FXWA 4PL5A 3FHRA 3DKGA 3KU2A 2HY0A 2NNWB 4GRBA 4H3QA 3VS3A 5E9EA 1KE8A 5EM8A 3ZH8A 2BFYA 2EXMA 3BBTB 5FXRA 5AA8A 3SA0A 3HAVA 3EFLA 2ACXA 2GSFA 4YMJA 2PVJA 4IFGA 5A54A 3ZXTA 4I0SA 3C13A 2LGCA 2HZ0A 3ORXA 3DZOA 4LG4A 2ERKA 4E6DA 1SNXA 4CTBA 2C4GA 3JPVA 1Y8YA 3O8UA 2JAMA 3Q3BA 4MBLA 1O6LA 4A9YA 4YLLA 3UVRA 3W2OA 4DBXA 1WMKA 4CG8A 4ASZA 4UN2B 3FKLA 4FC0A 4FNYA 1PKDA 2IVTA 3HV5A 4FTAA 5A46A 5AAGA 4E6AA 2O5KA 4XV3A 4FOCA 3PVBA 4MXOA 3WIGA 5I5ZA 1BKXA 3FSKA 4CFXA 5IA3A 1SYKA 3NW7A 4IB3A 3F61A 4OBQA 1H25A 3DB6A 4RVTA 4ANNA 3Q53A 4A9RA 2WQMA 2KNVA 5TO8A 2W1EA 2VWYA 4ERWA 1SMHA 3KF7A 4K2RA 4QQ5A 3R9OA 2FGIA 4F99A 1NVRA 2DAGA 2VX0A 4EWQA 4DH5A 2SRCA 3SC1A 2PZYA 1DI8A 1KV2A 5IG1A 3E92A 1Q8TA 5TT7A 5LVNA 1IXSA 1UWHA 1EH4A 2NO3A 2YIYA 4IFCA 2XB7A 5CS6A 4CD0A 4KIKA 3BWFA 3TNWA 2GS6A 3AC4A 3C4XA 3FZ1A 2QR7A 3MVLA 4I22A 4AE6A 2PK9A 1WCCA 4D9UA 5HX6A 4FKTA 2IZSA 3LXNA 4F65A 5E8XA 3RPYA 3FLNC 1PMVA 3GOPA 4WT6A 3PSDA 1UFZA 2WXVA 4F4PA 4QYHA 3NR9A 5F9EA 2ERZE 4R1YA 2FO0A 1UA2A 2HAKA 3C51A 4UBAA 2WTVA 3AC3A 2BIKB 4OTGA 1XWSA 3FAAA 1T43A 3S4QA 4ENYA 4NW6A 3RHKA 4UWYA 1GIIA 3NLBA 5GJDA 3D14A 4UZHA 2A19B 3VS4A 3QWKA 3AD4A 3IS5A 5LVOA 3FLQA 4IEBA 2X2KA 2JFMA 5E92A 4DINA 2QOHA 3U6JA 4D0XA 2L4EA 2DS1A 3GU7A 3SG9A 2R3PA 4AG8A 5CSPA 3RWQA 4HYSA 5A4QA 2GQRA 5AUWA 3ZRLA 1STCE 2V55A 2C68A 3NCGA 3OD6X 5F94A 5GJGA 3ZO4A 4TN6A 4A06A 2RF9A 3CY2A 3DAEA 3WIKA 2C5VA 3TEIA 5K0KA 2X8DA 3GEQA 3DBQA 4I23A 2C1AA 5FEEA 4L45A 4ZTMA 5CXZA 3LAUA 1V1KA 1IR3A 4ZSJA 3RALA 2OIBA 1OIYA 2C69A 4U7ZA 4BGQA 3DBDA 5K4IA 1C7YA 4G6NA 5I9WA 2JC6A 3WF8A 4O0TA 3BLRA 2F7XE 3GCUA 4FKWA 1GZOA 3PP0A 1XH4A 2UVYA 2JZ1A 4FT9A 2C0OA 1APME 2QVSE 2X2LA 4HVDA 4K8AA 2R3MA 3MFRA 5ETIA 4PNKA 2WMSA 2VTAA 4PTCA 3MFUA 3Q60A 4XJ0A 5KZIA 3MH3A 2QKRA 3HGKA 3P7CA 5KNJA 1UWJA 5J87A 3QTWA 4L44A 1DAWA 2VTOA 4G31A 3E8CA 4C57A 2CNUA 5IQFA 3R2BA 4E20A 2GDOA 1FGIA 4CCBA 2VTNA 3FYJX 3QRJA 4FKGA 5JZNA 2A2AA 3FMMA 5FG8A 3TJDA 2QQ7A 4J7BA 5E7RA 5DNRA 4DA5A 5EI2A 4GUBA 4LGHA 3W55A 5AR3A 4I5CA 5I3OA 3NDMA 5HO8A 3V04A 2DAIA 3R7GA 4PDYA 3PJ3A 2V0DA 4MBJA 3CJFA 4GIIA 3QKKA 1WVXA 4H36A 1YI4A 2HY81 4IAZA 4XNEA 2HWPA 5IH5A 4XG4A 3KN6A 3O8TA 3OWKA 4V01A 4PV0A 5L6WL 4ANQA 3FEGA 4GG7A 2EB3A 3HZTA 3QQJA 4TYHB 5CNOA 3JY9A 1Q3DA 3UQGA 5C1QB 4PUZA 4JG7A 3DQXA 5D1JA 5DRDA 3DKFA 4NCTC 1Y6BA 4CFNA 5BVEA 3NYVA 4YHTA 3UG1A 4E7WA 4W4WA 5J9ZA 4X3FA 5HCYA 4ITIA 1B39A 4QYGA 3TN8A 3MB6A 3T9IA 1ERKA 4QMLA 4XMOA 3G90X 2IVSA 3RAKA 4LM5A 4IWDA 5E8TA 5HTCA 5AV4A 1YOMA 5AX3A 3ZO1A 1W8CA 5BNJA 1RDQE 2C5OA 2GS7A 3H9RA 3QA8A 1XXHE 2W4JA 3EWHA 4BN1A 2UW8A 3BU3A 4EZ7A 4EKLA 3COHA 4GEWA 5EQPA 4FG8A 4FKQA 4R3RA 4Z9LA 2Y6OA 4GUEA 3DS6A 4DEBA 3CPBA 5M09A 1XBBA 3DY7A 3IW8A 3QXPA 2WEVA 1GAGA 3R01A 4S32A 1P14A 2Y4IB 1DV0A 3U4UA 2JDSA 3UE4A 4A9UA 3QU0A 3VUHA 5HNIX 3OUNB 4L68A 3ROCA 4DGMA 4HPUE 2HZ4A 4F7NA 3ELJA 4EI4A 2UW3A 3ZDIA 3TV4A 4C7TA 4DH7A 2W99B 4JX7A 4KBKA 4FIFA 4FIGA 2JIIA 4LUDA 4Y5QA 5BYZA 3FZTA 3WILA 4IWOA 2JITA 3SRVA 3Q5IA 4NIFA 3RINA 4GKIA 4HEOA 1JSVA 2OO8X 3LFQA 3LMIA 5D12A 3O23A 3T9TA 4EK4A 4EWHA 5JSMA 3OVVA 2XNMA 2ETRA 4XV1A 3VBVA 4FL2A 2C3LA 4HJOA 1OGUA 3SLSA 4QMMA 3V8TA 1LP4A 4RWJA 4MF0A 4ZTNA 4HZRA 2J51A 1XH7A 5CAOA 2O25A 4DFUA 3PIYA 5LJJA 1OIQA 4W9XA 4AU8A 4AF3A 3R73A 5IUHA 4JDHA 5BVOA 2YIWA 2RRUA 1ZY4A 4F9BA 3DKOA 2W96B 2JAVA 4GFGA 4GH2A 4I4EA 4UMRA 2ZM4A 3PZEA 2UW4A 3HRBA 5AP5A 1YHVA 2QU5A 2I6LA 5DFLA 4B6LA 2PZIA 2C3KA 3EN9A 2AUHA 3KN5A 2BWBA 3NUUA 1J3HA 3QX2A 4JIAA 3S00A 4F1OA 3PPZA 5IISA 4QMXA 3VS6A 2XKDA 4RIWA 3LCSA 3CTHA 4KABA 2XMYA 2XKFA 4YPDA 3CPCA 4QMQA 3HL7A 3ZO2A 1X8BA 4O7NA 3BE2A 3AD6A 4BC6A 2UW7A 3QD4A 4IACA 4XYFA 4FT5A 4RZWA 3RWPA 4OUCA 3TTIA 1NV8A 3MESA 3GFWA 3Q9WA 4KS8A 4ASEA 4NKAA 5K3YA 3QC9A 1HJPA 3D83A 5I9YA 4F9YA 3ZLYA 2IO6A 3D5UA 3R1YA 2O65A 2I0YA 3UODA 4B4LA 3QCYA 5FTGA 2GNHA 3GQLA 3QALE 4FKPA 4WSQA 3R8ZA 3W2SA 4O7ZA 2IWIA 3PE2A 4MVFA 5EOLA 5HLWA 4WRSA 3BGPA 3MS9A 5DYJA 2QOQA 3QQGA 1TQPA 2B3TA 2BIYA 2XK3A 5L8JA 4CMOA 3ID6C 3N4UA 2Z60A 4NL0A 5IDPA 2J0IA 2OJIA 2BRGA 3L1SA 3W10A 5HCXA 4M69B 4RJ7A 3T3UA 1OL1A 3FKOA 3OCSA 4MTAA 4QTEA 1FVRA 2ZTDA 2WTDA 4U80A 3RCJA 4FL1A 3NEWA 3BEAA 1QPCA 4RJ8A 4CZTA 2PE0A 4N70A 2MR9A 5KKRC 3SW7A 2REIA 3MVJA 1E1XA 4LQMA 4I93A 3TNIA 4DCEA 2F2CB 4CNHA 5HIEA 1JR3E 4CFUA 2Z7RA 4DEIA 3TNPC 5LWMA 5EM6A 5L2SA 2W1GA 4F6UA 5HORA 2FSMX 3PA3A 2A1AB 2GNFA 3CP9A 4FKRA 4DG2E 4IWPA 5AP6A 4YTFA 2GNLA 2QO2A 4GVJA 1Y57A 5IDNA 3QHRA 1W82A 2BUJA 2J7TA 3E7OA 4P5QA 2WZJA 4L67A 4QO9A 2BTSA 2JKQA 2PZ5A 3FBVA 5AP2A 1YHWA 3JUHA 5DRBA 3WBLA 2ZM1A 5JGAA 4G3CA 3HMPA 4DFZE 3DA6A 2PVYA 3PY1A 3VAPA 5LMBA 3FY2A 3WZEA 5GZ9A 3FHIA 4PTGA 3D7TB 2YWVA 5LCJA 4O2ZA 4FUXA 1A9UA 4K18A 3NZ0A 2PVNA 4M8TA 4YC3A 5FBNC 1Q3WA 2OIDA 4K11A 4BCIA 3DAKA 5DN3A 5EM7A 5JGDA 4X0MA 2PMLX 3TZ9A 2BILB 4BDGA 3E88A 4AW5A 3DXNA 3R1SA 4N0SA 3NNXA 4D9TA 4R71A 2MGWA 3RZBA 3G9LX 1WR1B 4GEOA 3DJ7A 3UZRA 4YNOA 1CKIA 2BROA 3PXKA 2VWBA 3F2NA 4G6OA 4J53A 3BYVA 3F82A 3MWUA 5I0BA 3LFSA 4FL3A 1OMWA 3K54A 5AP4A 4A4XA 4O7LA 2OI4X 3VUGA 3I0OA 4CV9A 2W1CA 1WVWA 3VS0A 3ZO3A 1W7HA 3LCTA 3OOGA 4JG8A 4ACCA 3UP7A 3ZTXA 2YM6A 4DLJA 4FT7A 3GFEA 3U87A 3V5QA 4EORA 3ZM9A 4H05A 4ZY4A 1JVPP 2ZMDA 1WBWA 3DNDA 1M52A 3I1AA 1VQ1A 3TKUA 2CGVA 4L42A 4ZS0A 3DTCA 4O91A 1BI8A 4KRDA 2R3GA 4FTUA 3O2MA 2B1PA 1KWPA 2F9GA 4FZ7A 4WNMA 3UG2A 4ONAA 2PMNX 2R3FA 2YN8A 4LOQA 4CZUA 4M0ZA 4JLCA 4OTQA 4LYNA 4ZEGA 3O96A 3NRMA 5C26A 3VF9A 2XIYA 3DK6A 4ZY6A 3A7JA 4R7IA 4AA5A 4U3YA 4X2JA 3F92A 3QCSA 4QD6A 4BHNA 4WRGA 4DEDA 3C4WA 1RJBA 5E4HA 3IDBA 3R02A 2ITWA 4TNBA 4MBIA 4E5AX 1E1VA 3LIJA 5EQEA 4C58A 3BIZA 1LEZA 3K9OA 2QG5A 1KSWA 2XKCA 4RLKA 4AZFA 2XNBA 2GFSA 2VO0A 1UNLA 2GHGA 4M12A 3L8PA 4Q5EA 3EQRA 3R9DA 2YDIA 4YJRA 1WBPA 4FSNA 4G1WA 4DEGA 3BHUA 4DLIA 2JUJA 2YM3A 4QMPA 3CTQA 4JBQA 2EXEA 1H1WA 2OZAB 3H0ZA 4I6BA 1U59A 2XK7A 2ZMCA 3M11A 3AGLA 4GJ2A 4RJ4A 5HLNA 5HBHA 5ITAA 5CSXA 4O38A 3KFAA 5CANA 3DBCA 1EFUB 5E1EA 3QL8A 4XG6A 4G34A 2VN9A 4AZSA 1AQ1A 3ORTA 4GK4A 4K9YA 4UYNA 3ALOA 4V05A 3TJCA 3ZRMA 1JSUA 3PJ8A 4Z16A 4D1SA 3N4VA 4ZZMA 4C34A 4QNYA 3VUTA 4QQTA 2Y4PA 4BB4A 4YSMA 1NA7A 3Q32A 4GYIA 4L00A 4WP2A 4MXCA 5BUIA 1H0WA 2YCFA 2A27A 4FEQA 4OR5A 2X8EA 1YW2A 4UMPA 2X6DA 3C1XA 3FZOA 4I20A 4LOPA 4X21A 4ACHA 5FQDC 2YAKA 3P0MA 2Y6MA 1XBAA 1ZOEA 4S30A 5HI2A 3V5PA 2E9VA 3OW4A 1ZXEA 2WMVA 4I6QA 4JXFA 4FOBA 5HOAA 2UVZA 3UNJA 2ZVAA 4OTIA 3RJCA 4RFYA 4RWKA 2KNAA 1YWVA 2JP7A 3QF9A 2X39A 4GJ3A 5F95A 3F7WA 4D2SA 4ENXA 3ITZA 3KVWA 4YLKA 3Q9ZA 4Q5HA 4FICA 4A9TA 3LQ5A 4O0VA 4EQMA 3CJGA 3ORIA 4D5HA 1PMUA 3Q6WA 5C8MA 1OVEA 3ZYAA 5LVMA 2XH5A 1YXSA 2DI0A 4QP8A 4K1BA 3LM5A 3VS2A 5A3XA 3IOKA 5AAFA 5CEOA 5M53A 5BQ0A 4EOMA 4KWPA 5G6VA 5HG8A 2FH9A 2HWOA 5L6OA 3PTGA 3KULB 3AD5A 4Z7HA 3E46A 1XJDA 2LAVA 3PXRA 2VGOA 5AUYA 3S95A 4AX8A 1Q5KA 1OZ1A 1H24A 1PRYA 1PMNA 4HYHA 4QMSA 1K3AA 1PHKA 3W16A 4CTCA 2RFEA 4KKEA 4CT1A 2EXCX 4WG5A 2EWAA 1TVOA 3FL4A 4NT4A 1O6YA 3PXFA 5AADA 4E5BA 4RQVA 1JWHA 4TWPA 2XK6A 4XOYA 5FWKK 4GU6A 3T3VA 5CAUA 3EN5A 2VTJA 3QBNA 3EL8A 5ANKA 3W2QA 3DU8A 2BWEA 5CEKA 4M14A 1VJYA 5KMMA 4QP4A 3VS1A 3W2CA 2IVVA 1XBCA 1QPEA 2GHMA 2JIVA 3ZFXA 1JAMA 4I92A 1AGWA 4NK9A 2I1MA 3V6SA 5C27A 5C4KA 2R7BA 3AC2A 2PVHA 4FTMA 1H27A 1NVSA 3HVCA 1ZYSA 3DFCB 3LJ2A 3OUKA 3G51A 4PNIA 4BDIA 1YWRA 3QTXA 3IGGA 3PUPA 2JDVA 1YDTE 4Q9SA 4ANOA 2YM5A 3HKOA 3FC2A 3LMGA 3II5A 3OBJA 1A5TA 4FV9A 3LQ8A 4MH7A 3FMNA 5E1SA 4JAIA 3VJOA 1YXXA 4HYIA 5D7VA 4OGRA 3NUNA 4UMQA 5BYYA 4K6ZA 1Q02A 1YXTA 4GIHA 3RAHA 4WBOA 1L3RE 5D10A 3VBXA 3TM0A 3FSFA 1CM8A 4O0YA 5F20A 4DH1A 4F0FA 2OFVA 4H1MA 4EONA 3ZS5A 4NM3A 3W8LA 1R3CA 3AG9A 5DR6A 5AR4A 1SVHA 2G9XA 3SRVB 1H00A 2EU9A 3BE9A 4BL1A 5M4IA 4NYEA 1XHAA 2R3JA 2W5HA 2ZAZA 3EL7A 3OCTA 3PWYA 3I60A 5K4JA 2X7FA 3BHYA 3A7IA 3KRRA 2QHNA 2H34A 3BEGA 2C47A 4D1XA 3LFEA 4L3PA 3QCXA 1WHCA 1RW8A 4R1VA 5CY3A 1H28A 2XNGA 3F7ZA 3ZOSA 2X0GA 3R7YA 4AACA 5EYKA 3GU6A 1OAIA 4D1ZA 5BVNA 3P78A 5CSWA 3EKNA 2ITQA 2QU6A 4FTCA 4W8EA 4WUAA 4QNAA 4R77A 3Q4ZA 4OTPA 5AEPA 1ND4A 4CVAA 3G33A 4L52A 4XS2A 3PJ1A 3L8XA 2C30A 4QT1A 4YTHA 4J95A 3BHVA 3CEKA 5F4NA 3MMPA 4R7HA 4CG9A 2WIPA 1T45A 2CMWA 3N9XA 4IHPA 4MXAA 2XZSA 4R7BA 4F1TA 5BUEA 3BCEA 5IEVA 2PU8A 3QA0A 2ZV9A 1HT2E 4C4IA 2BTRA 5T68A 4E1ZA 3BLQA 4YJVA 2CPKE 4J98A 3VS7A 2YCRA 2WMTA 3O17A 2WFYA 3P4KA 5I4NA 1BL7A 4MX9A 5F1ZA 2ZV8A 4ZSAA 4KIKB 4MQ2A 5J95A 4FV1A 1PYXA 2UZNA 3O7LD 3ZONA 2C3JA 4TYHA 1BLXA 3VBYA 4ITJA 2W4KA 3M42A 3QQLA 2UZTA 3OP5A 3NUAA 3HMNA 4PMTA 1Q8UA 2RGPA 3HV4A 5HD7A 3H3CA 4ZLOA 4RX5A 4LRMA 3V5JA 2IZUA 3OROA 2QR8A 2BHHA 3P86A 4BBMA 4YO4A 5DH3A 5AM7A 2C3IB 3WYYA 3GLIE 4DFYA 4F0GA 5BX0A 4DGNA 4I5HA 3NGAA 1KE7A 1ZLTA 2X4FA 4Y46A 4OLIA 1U46A 3TUCA 4LMUA 1M2PA 5LMKC 2G2HA 3DDQA 3F2AA 3SKCA 4UALA 5BMSA 5KMKA 1KYIA 4FG7A 3M2WA 1ZARA 3KXNA 2EVAA 5G1XA 4OTFA 3H9OA 3QXOA 3WF7A 4O7WA 3GENA 2WU6A 3Q2JA 3WZDA 1FVTA 5TOZA 5DT3A 1WBSA 2WKMA 3HDMA 3KL8A 5FEQA 4BDKA 3WYXA 4JX3A 3A2CA 4M67A 1PXNA 5DWRA 3SOAA 2DENA 2XS0A 3QUPA 4L46A 2GFCA 4MD9E 3PPJA 4RWIA 3IW7A 4U41A 4U9AA 4EH2A 3U6IA 1KOBA 4LL0A 4BCPA 1WBOA 3ZC6A 1JKLA 4MYGA 3TZ8A 5D9HA 5E91A 2W4OA 5CLPA 4GSBA 2GNJA 4FEVA 3F6XA 4IB0A 5CVHA 3KA0A 4BDJA 3UYTA 3ATTA 3I7BA 4PPCA 5J5SA 1JNKA 4BWKA 3ZC5A 1H8FA 4CFMA 3O8PA 4AZTA 4X3FB 2VX1A 4F0IA 4BDBA 4IB5A 5ACKA 3WZUA 2B9FA 4IAAA 4UXQA 2R3RA 2P3GX 3KMUA 4P7EA 3Q04A 5HVYA 2YZAA 3D5WA 3MA6A 4YC8A 4RWLA 5IQCA 4BYJA 4E4LA 3TT0A 3H0YA 3P7AA 2XRUA 1PXPA 4OTRA 5CEMA 3ET7A 2JY5A 4RC3A 1OL6A 3RCDA 3OWPA 4GVAA 3HYHA 4RJ6A 4HCUA 4C33A 3DGKA 4HZSA 2W7XA 4JI9A 4X2FA 5E8UA 5IPJA 5ETFA 3RI1A 3I4BA 1WBNA 3R63A 4WKQA 5EOBA 1OPJA 2GQGA 1ZYJA 4UWCA 1PXKA 4DG0E 4MNEA 3JXWA 1ZWSA 3E8DA 2ZDUA 5KMLA 2G3QA 3TWJA 3R1QA 1IM2A 4YZ9A 3NNUA 4IC8A 4IM0A 4B99A 3AOXA 5KHXA 2BKKA 4AOIA 4ZZNA 4MD8E 5E90A 3JY0A 3Q96A 1YI3A 4IVAA 4WNPA 3UVPA 4ACDA 1LPUA 2XKEA 2FB8A 3MBLA 4ALUA 3AGMA 3HMMA 5DR9A 1P4FA 5EDQA 4K33A 2QOCA 4AUAA 1Z57A 3TV7A 1REJA 3CGOA 5I9XA 2O8YA 4JBPA 3AMAA 2QC6A 3UIBA 4MCVA 5FEDA 3B2WA 4WUNA 3QTSA 4CEGA 2X4ZA 4D2PA 4MNFA 5HVJA 3QKLA 1UKHA 5JMSA 3FMEA 4FKUA 4JT3A 4F7LA 2XCKA 3ETAA 5H3QA 2JKKA 5J8IA 2IW8A 4CKRA 4EHEA 4OBOA 1W84A 4ZTRA 2YIQA 4ASDA 3TUBA 2G2FA 1DM2A 2P2HA 4G9CA 1YVJA 4ZTQA 3HUCA 3KXXA 1MP8A 3EQFA 4XLVA 1A48A 4C02A 1MRUA 2OJGA 4DBGB 4GYGA 5JGBA 3GVUA 4G3FA 3AC8A 3T6PA 2WQNA 4CLIA 4A4LA 3HRCA 4O7YA 2QD9A 3ZSGA 2EUFB 5ETCA 4BCGA 2VWXA 2ITUA 3MY0A 3CS9A 3NUPA 2YAAA 4KIQA 4PDPA 4UWBA 4D5KA 4EBWA 5IU2A 4EHGA 3KREA 1OL5A 5GJFA 3TXOA 3WF6A 3TUDA 5K0XA 5CQUA 3AC5A 1OKWA 4LRJA 4XG9A 3CXWA 2WMWA 1W98A 3PIZA 1GOLA 4QP1A 4QTAA 2ITNA 5AP0A 5LXMA 4B0GA 4FNWA 3K5UA 4RSSA 4FR4A 3OZ6A 2OO9A 5CT0A 4AN2A 4EC8A 3R8MA 5CF5A 1XQZA 2WMUA 2ZB0A 3NNWA 3JR1A 2QCSA 2XK8A 3HMIA 4LOOA 3JS2A 5IF1A 3ODYX 3ZSIA 3ERKA 3FYKX 2LVPC 2C0IA 1CSNA 4E73A 4F08A 4O81A 3O0GA 4E26A 1M17A 5BVKA 2C1BA 5D7AA 1I44A 4FNXA 4HVHA 2VWIA 2R3KA 1NVQA 4FZ6A 3U4WA 5CU0A 3FQEA 3I0QA 4DCAA 4F1IA 4AZVA 1UV5A 4EHZA 3OY3A 4YPSA 2KULA 4R3PA 2WQOA 2XK4A 4JG6A 4TXCA 1IASA 1NV9A 3AC1A 4EYJA 3ULZA 3ZBFA 3MSSA 3F3TA 2QOKA 3TCPA 3OCBA 5FUTA 3H10A 4XHKB 2GQSA 4USDA 4ZS4A 3QUEA 3PRFA 3KVXA 5ETAA 2YDJA 4ACGA 3G15A 4WG4A 3FMJA 4BI2A 2WD1A 3DV3A 3ZXZA 3ROYA 4M68A 1DS5A 1Q24A 3AMBA 2PVMA 3EZVA 4K77A 5HD4A 4Z55A 3QTIA 3HV6A 5IQBA 4JDKA 4O27B 4UYAA 1XB2B 5L6PA 1GZKA 4IAFA 4W9WA 4HVSA 4XRJA 2PVFA 3OW3A 4X2KA 2HYYA 2IZTA 5IZFA 4QPAA 4LMNA 2BDFA 4BTJA 4U42A 3GCPA 3CIKA 3RKBA 4G5PA 5AP3A 4EYMA 5AAEA 3L8SA 2W17A 5IQAA 2YFXA 5HZNA 2J90A 4X3FC 2GNGA 1V0BA 4FVRA 3BELA 2OGVA 3F5UA 1Y8GA 3O51A 3PVWA 3BHHA 4NCTA 4X2NA 3UIMA 1UNHA 2I40A 4C4GA 5H8BA 3VBWA 4LRKA 4BFMA 3DBEA 4N4SA 2F49A 4DFNA 5C8NA 3R00A 2OXDA 5FGKA 4CRSA 2Y8OA 4ZP5A 4FKOA 5FBOA 5J79A 2C6LA 2PUUA 3E64A 4BTKA 3POZA 1BYGA 1R0EA 3LKMA 3PXZA 2B55A 4FSTA 3DK3A 1PXIA 1OKYA 1GO5A 4U40A 2BRMA 4DFXE 4KS7A 1M2RA 1F3MC 2YCQA 4FMQA 4RVMA 4ZJJA 3QHWA 4FIIA 5C03A 2Y4IC 3TV6A 5GHVA 4E6QA 4HOKA 4BDDA 2Y7JA 4WBBB 4DEHA 3CCNA 5EM5A 5DGZA 4PY1A 3BYUA 3GC0A 3C0IA 1OUYA 4FT3A 4N6YA 3ANQA 2XUUA 3OHTA 4IADA 2PUIA 2C6DA 3I6WA 1U54A 2QODA 4C61A 4FV0A 2VO6A 4EK8A 3IPHA 4YTCA 2B54A 2BAQA 2WMBA 2VTMA 3MPTA 5BVDA 3SXFA 3HP5A 2IJMA 3VBQA 4P90A 2YM4A 3E87A 2X2MA 3UIXA 4D4RA 2HK5A 5JRSA 2W06A 4ZLYA 2DHYA 4W4VA 1ZZLA 4C3FA 4C4JA 4FGRA 2YCSA 1QMZA 5DIAA 1WBTA 3PXQA 1KE9A 3OTUA 2ITTA 1OUKA 5IQDA 2B7AA 3MVMA 2CHLA 2VTQA 4XP2A 2PHKA 4IVCA 1PF8A 3Q5ZA 4FGBA 5FXSA 2L4FA 2O64A 3IW4A 2B9JA 4FSMA 4F70A 5GIPE 5TF9A 3KXMA 2ETKA 4G3EA 3OFMA 3W8QA 1OIUA 4AW0A 2ITYA 4QMOA 4BWPA 4A07A 2Z7LA 3LLTA 2OICA 4USFA 2CNVA 2XEYA 3CGFA 2PMIA 3EJ1A 2JY8A 5ACBC 3ZFMA 5AX9A 2ITOA 5DR2A 3MIAA 3FI2A 5TKDA 3U9NA 4YZMA 4TKSA 5TE0A 2BRBA 4FSRA 4H3PA 4F63A 1K9AA 4JR7A 4CZYB 4O86A 3KMMA 2IN6A 3GCVA 5M06A 3B2TA 4NWMA 2I7QA 2WMRA 1AD5A 2HIWA 2JDTA 3EZRA 4AZEA 5JQ5A 4BICA 3RPOA 2ZV7A 1ZRZA 3VO3A 3LCDA 4I41A 4QPMA 1JKSA 3MN3A 4DC2A 3SG8A 3HA6A 2XRWA 4FTQA 5DEYA 4EOPA 3R30A 5IEXA 2B53A 1ZYDA 3NAYA 2PUNA 2WIHA 4DTKA 2XA4A 3IONA 2W1ZA 2J0KA 2OLCA 5JFSA 3Q6UA 1OITA 2HOGA 4YJQA 3WZJA 4FYNA 4PDOA 4XEYA 4O6EA 4PMSA 3WI6A 5A4CA 4M97A 3UMWA 4PMMA 4EQUA 2I0HA 1Q62A 4HGSA 3R22A 4QP2A 2I0VA 5IA5A 4G3DA 4YJTA 1V92A 3HLLA 1URWA 1QCFA 4ARKA 3A7HA 1H1RA 3PVGA 3OBGA 4W4YA 4S2ZA 2G01A 2JY6B 3RNIA 3V5TA 2X9EA 2WTKC 1R4GA 2HCKA 3NYNA 4DHFA 3Q52A 3HV7A 4KKGA 3FZSA 4RG0A 4FTNA 5HG9A 1J1BA 1OIRA 4BZDA 4JR3A 1IA9A 2CLXA 4PQNA 5EYCA 4O83A 5AV2A 4UN0C 3KC3A 3IG7A 3L9PA 4D4VA 2XYUA 4OTWA 2OSCA 2J0MB 4ID7A 1IRKA 4EH3A 3IW6A 4J8MA 3OOMA 2J50A 4LFIA 2UW0A 4AGCA 4BDEA 4BIEA 4EOOA 5KMNA 5CF6A 2Z8CA 2OXYA 4DITA 3BI6A 3DTWA 3G9NA 3R6XA 4GT4A 3P7BA 2XJ0A 5IEYA 3VUIA 3L9MA 3C4FA 4IW0A 1FINA 3NYXA 2W1HA 4JJRA 2MJ5B 4LI5A 5AM6A 3V01A 1UU3A 3EFKA 3KMWA 4IX4A 4FSWA 5EDPA 3R7IA 4FSQA 3GXLA 3SV0A 4QMVA 4MXZA 4NM7A 4F7JA 5KMJA 5KKRB 3R7UA 2XVDA 3A8XA 2CJMA 3EQPA 4TWNA 2VU3A 3CD3A 3THBA 1JSTA 3N51A 4F6SA 5JT2A 5GINE 4KINA 5JN2A 2PZRA 5CEPA 3D7TA 3OF0A 3EB0A 1QPDA 3HDNA 4IE9A 4UB7A 2LVQD 2UZWE 1YXUA 3KRLA 4QTDA 3NAXA 5AJQA 1E9HA 3COMA 4KBCA 3I5NA 2DAMA 3MYGA 1FGKA 2Z02A 2VUWA 4C59A 4U8ZA 4I6FA 2H96A 3R9HA 4A7CA 1GZNA 1Q8YA 4HGLA 4P2KA 3ZLSA 3HV3A 2O63A 4XH6A 4NM5A 5KE0A 3BBZA 4EH6A 3PWDA 4F1MA 3WOWA 1K2PA 3R8PA 2WPAA 2Q0NA 4DN5A 4DH3A 3PG3A 2EKFA 4I4FA 2FUMA 1OPKA 4GK2A 1L8TA 4O7VA 1SNUA 3TG1A 3MW1A 3EQHA 5C9CA 3FLYA 3B8RA 4ZJVA 2DYLA 4R5SA 3DXQA 2VTHA 1OBGA 1YDRE 4XBRA 3IHPA 4EHVA 4AN3A 2B9IA 3QRKA 2BKZA 2PY3A 1G3IA 2BZKB 3QUDA 4O0SA 4EC9A 3CKXA 5HTIA 4ZLZA 5I9VA 4IZYA 3GLHE 1KOAA 4U97A 4G17A 3R9NA 2PVRA 2JEDA 5A4TA 2DAKA 4ZIMA 4C4EA 5CZIA 2R5TA 2BPMA 4MXYA 1HQYE 4LV8A 1JPAA 5BVFA 2GHLA 2KHHA 2YACA 3KKVA 1HT1E 4KAOA 4HGTA 4YNEA 2J5FA 3QQUA 5L2TA 4F09A 1UU7A 3I5ZA 4B9DA 5AR7A 4CRLA 5KMIA 1OKSA 3EFWA 4XBUA 3W2RA 4BI1A 4M7IA 5JFXA 3QYZA 2GMXA 4YJNA 1YOJA 2VRXA 1Z9XA 4DE4A 2I0EA 2X81A 3FMLA 5LWNA 4UY9A 5HBJA 3U51A 4ASXA 4AFJA 4Q7JA 3ZLWA 3JYAA 3ORLA 2KTYA 4C2VA 3HECA 3ORZA 5A6NA 1WBVA 2W5BA 4BIDA 4DAWA 4I21A 1TKIA 1PJKA 3PVUA 4I24A 3UO6A 3CQWA 4RVLA 4CKIA 1NXKA 4YLJA 2PULA 3EOCA 4ZSGA 3ULIA 4APCA 4R6VA 4H58A 3O50A 3EQBA 4IMYA 4IXPA 5AV1A 3UGCA 4ANMA 2ITPA 3BU5A 2X9FA 3RP9A 5HVKA 4IQ6A 4EOQA 3OS3A 5LCKA 2XBJA 2ZJWA 4O0XA 4BZOA 3M1SA 1ZYLA 4DT9A 2BAJA 3LFCA 4CYJA 4IVDA 4BGGA 4EK3A 3L9LA 1YOLA 5AIRA 5DFPA 4ZTLA 5IQEA 2PSQA 2C6OA 4YP8A 4ZZOA 4O7SA 4YBKA 3RZFA 4FKIA 1W0XC 3BYOA 4FV4A 4DEEA 4YURA 2VTIA 4RGJA 5CF8A 3ZBXA 4JRVA 3ZUUA 1ZMVA 3GLFE 3ZDUA 3Q2MA 1REKA 3FJQE 2CKEA 2ITVA 2YJSA 3K9PA 4G9RA 4QYEA 5CVGA 3A61A 3UC3A 4ANSA 2QI8A 2RIOA 5EYMA 4CFWA 4JQ7A 2OXXA 4EJNA 1IFYA 1OKZA 2OG8A 2VTRA 4LGDA 4TYJA 3AXWA 2YLEA 5CI7A 4YTIA 4BRXA 4USEA 4IJ9A 3C5UA 4BCJA 5JQ8A 5JRQA 1Y6AA 1VYZA 3QZHA 5DT4A 4BHZA 2Z2WA 2HELA 2ONLC 1YLAA 5L2IA 3LVPA 4NJ3A 3V8SA 4HPTE 4WO5A 2HENA 3C9WA 4KRCA 4YGAA 3SGCA 4JAJA 4IH8A 2QOIA 4O96A 5A6OA 2YEXA 1SVEA 2V7AA 2E9UA 5B0XA 3R71A 3LZBA 4BDAA 3LOKA 2A4LA 4V0GA 4FVQA 2CGWA 3QQKA 3U54A 2F2UA 2OF2A 1KE5A 4IVBA 1GY3A 5HO7A 1VG5A 3QLGA 1TQMA 3PJCA 4GW8A 4IZ5A 3E8NA 4MNEB 4OW8A 2LVAA 3VUDA 4PMPA 1WVYA 5HU3A 2DZLA 1OQYA 3UOJA 3FQHA 2XM8A 2YITA 3GT8A 4O1OA 3HEGA 5AR2A 5KX8A 3QFVA 2K9DA 4IM3A 4XX9A 1H1QA 3W33A 3E63A 1CMKE 3OEFX 3BRBA 2JFLA 3GU4A 4IANA 3EYHA 1VEBA 2VZ6A 3FY0A 4H3BA 5HBEA 3VC4A 2R0IA 5EDRA 2OJ9A 4CV8A 5J7HA 3UQCA 4APPA 3FMKA 5IUGA 1Q8ZA 4O2PA 4DTAA 5HICA 3H4JA 3AMYA 3ENHA 3NVMB 4AT4A 2MROB 3V6RA 4IAKA 4RLLA 1S9IA 4FV6A 1FQ1B 1G8SA 5KCVA 2QG7A 1TTEA 3RGFA 3QLFA 3UVQA 5LMAA 2XF0A 4HCVA 5AMNA 3DAJA 3LCVB 3PZHA 4M3QA 3DFAA 4U43A 1FMKA 4E4NA 5CF4A 4GU9A 1XH8A 4HNFA 5IA1A 3ATSA 5EW9A 4QRCA 3OCGA 3A4PA 5HCZA 3MFTA 4OT6A 3LE6A 4KBAA 5DT0A 2VD5A 3DCVA 4RIYA 1OKVA 2VNWA 5CU4A 3RPSA 4DYMA 3GU5A 2HWJA 3KQ7A 3CD8A 2XNOA 2F57A 3MTLA 4AE9A 2RL5A 4QOXA 1OPLA 4NFNA 3RNYA 3ENMA 2VO7A 5AV3A 3D2KA 4AFEA 4ANLA 5HE0A 1BVSA 2WTWA 4EQCA 3D0EA 4RMZA 1YXVA 3R7VA 4BYIA 2CLQA 4EOKA 3IOPA 4X6RA 4BIBA 2Y9QA 4JBOA 3REPA 1U5QA 3LFNA 4YC6A 4YR8A 4DEAA 1ZAOA 2UZDA 4BCHA 3NS9A 3FKNA 3TZMA 3VW8A 3ZEPA 3EHAA 5AP7A 4FTTA 3P79A 5J1WA 4YJPA 3F69A 4TYEA 2B52A 3FDNA 3GU8A 3TZ7A 5ANGA 1W83A 5CU6A 4TW9A 4WIHA 3VRYA 1LEWA 2O0UA 2WOTA 4EEVA 5CALA 3DK7A 1Q41A 4I5PA 4WD5A 3DKCA 3NSZA 3QTZA 1P2AA 4Z3VA 5AR5A 1BI7A 4YBJA 3D4QA 3R7OA 5IUIA 4O7RA 5DEWA 1HCLA 2R3LA 3A60A 4EOLA 2IZRA 3F3ZA 1KE6A 4CFVA 4F9CA 2ZYBA 1H01A 1UU9A 2O3PA 4RT7A 2WO6A 3OWJA 3LFFA 3Q9XA 2WTKB 5C4LA 3VQUA 4FA2A 3PA5A 5FDXA 5DMZA 4BCKA 1J7IA 2GS2A 4G3OA 1CKPA 2R3HA 2R64A 4XCUA 2W1DA 5DA3A 3BWJA 3UYSA 3VHEA 3VRZA 4BKJA 2DNAA 4C3PA 3KB7A 4J97A 5LVPA 4NM0A 3VW6A 5GZAA 3OXIA 4L6QA 1M2QA 2CDZA 2UZEA 3HP2A 5EW8A 5KZ0A 1WAKA 1V0OA 4R5YA 4YZDA 3NIZA 3QRTA 4XUFA 4AN9A 3CBLA 4EOSA 4NH1A 3EQDA 5AA9A 1ZOHA 2VX3A 5FM3A 3MPMA 3SD0A 5EI6A 3TKIA 3R8UA 3KULA 4FSZA 4J96A 5JFWA 5CENA 3RK9A 3LJ1A 3KCFA 5IQHA 4D2VA 4EH8A 4YSJA 4IZ7A 4FKLA 5M4UA 5EFQA 2RSVA 1H1SA 2E9NA 3HMOA 5GNKA 5HNBA 4HCTA 4WOVA 3PSBA 1BL6A 1T6OA 5AWMA 3ACJA 3MB7A 4Z7GA 4QMYA 4AGDA 4ITHA 2OBJA 2OH0E 4V04A 4E5WA 1VDLA 5A9UA 2X8IA 1M14A 4OAVB 2J0JA 1PY5A 4U81A 2QOBA 3F2RA 4PTEA 3C7QA 3EQCA 3NW5A 4XLIA 4Y5HA 5CX9A 5CAVA 4ORKA 2JZ0A 3RM7A 3TTJA 2PE1A 2GU8A 3A7FA 2QOLA 4PL3A 1PYEA 2RKUA 4YO6A 2JGZA 3QGYA 4RA5A 3P08A 1UKIA 3Q9YA 5H2UA 5I3RA 3FWQA 3GC7A 4O0WA 3QZIA 4NEUA 2OOBA 5J9LA 5M4CA 5T6KA 4TYIA 4RBLA 4FV2A 1ZMUA 3IDPA 4RQKA 4PPBA 3FPMA 3UPXA 3KRJA 4D58A 4Y8DA 4AT5A 3DJ5A 5D11A 5A4LA 5I9ZA 3MH1A 4G3GA 4LUEA 4NJDA 2HXLA 3EH9A 2UW5A 4NSTA 3W32A 2BRNA 3LCKA 4FZDB 3G0EA 1XR1A 3EQGA 3UZPA 3VJNA 1JQHA 4EH7A 3ZRKA 5AUVA 3PRIA 4RZVA 5LOHA 4QTCA 4XV9A 4BCNA 4X3JA 5E8WA 3CKWA 3VWAA 4DGGA 3ZFYA 1H0VA 3R9RA 2JDRA 3UNKA 3E3BX 4JRNA 1VEGA 4FUYA 5DVRA 4UXLA 2OH4A 4FSYA 2AYPA 4U79A 3Q4CA 3Q4TA 3W2PA 4O84A 4AGUA 4MD7E 2H5XA 2R3NA 1JOWB 3OEZA 1ZOGA 3MIYA 1G5SA 4EOJA 3G2FA 5FTQA 3EN4A 3KXGA 4D2RA 2XM9A 4QP6A 2UZUE 1TQIA 3UOHA 5IA4A 2J4ZA 1OTRA 4RIYB 5CSHA 3UQFA 2J9MA 3A7GA 4GFMA 4IBMA 3FMDA 3OY1A 3G5DA 2OW3A 2UZLA 5HKMA 3LM0A 2VV9A 4NZWB 3EYGA 5C01A 4TY1A 2DAEA 3LLAA 1IG1A 1XH6A 2QHOB 4RFZA 4ZSLA 2UZVA 3BYSA 4FIEA 3MJ1A 5HG5A 2PYWA 4MEDA 4FEUA 1PXLA 4RIWB 3CR0A 5CVFA 4ACMA 2JBPA 3PLAE 2PZPA 2ESMA 3MVHA 4LGGA 3U6HA 4PRJA 3BBWA 3G6GA 3GNIB 4YZNA 1LR4A 4FBXA 4MWHA 3SX9A 4U0IA 3MDYA 4D0WA 3DOGA 4RX8A 3FRIA 4YZBA 3PSCA 1NT2A 4RX9A 3GQIA 2J0LA 3NVKI 5HO6A 1XKKA 4GCJA 4Y73A 3RVGA 4DGOA 2HW6A 1GNGA 4WA9A 2WAJA 4BBFA 4UZDA 3UC4A 3PJ2A 3ZZWA 2VWUA 4GS6A 2VWZA 3LMHA 3ZLXA 4L7SA 3A62A 4WHZA 5CYIA 4I94A 5DLSA 3A8WA 5B7VA 3WF9A 3R04A 3HRFA 3MY1A 4FV3A 3UZTA 4QMTA 2W1IA 1HCKA 1I09A 3DBFA 3QD3A 4QP9A 3G6HA 4GKHA 2XK9A 3BZ3A 3ZMMA 1OL2A 4GT3A 4RJ5A 2BRHA 2YWPA 4KA3A 3TNQB 3PY0A 1UVRA 5C8KA 2E9PA 2QNJA 3LFBA 3OMVA 4RC4A 3D5VA 3VF8A 3ZUVA 4PF4A 4KSPA 2UZOA 3W18A 3PPKA 4F7SA 4PP7A 3D15A 5ANDA 3TNHA 3W1FA 4BVUA 3O71A 5AUUA 2JLDA 4HVGA 3ORPA 5HTBA 5AFVA 5B2LA 5CQWA 2PMOX 4RJ3A 3HNGA 3PYYA 3QTRA 5B2MA 3VULA 4KNBA 3FMHA 4FODA 2CGUA 5FP5A 1R78A 4BWXA 5M44A 3UPZA 4UMUA 4QQCA 3RTPA 1OI9A 3SOCA 2X7GA 4F2LA 4MXXA 5CI6A 4IX6A 4D28A 5AUXA 2K0BX 2WQBA 4FX3A 2IPXA 1CUKA 1OM1A 4G16A 3UP2A 2ZV2A 3F9NA 5IH4A 4CMTA 3F5GA 4GK3A 2GNIA 3IECA 5JI2E 4FI1A 5EW3A 4ALVA 4AT3A 1BUHA 3PIXA 3LW0A 4TT7A 1JBPE 3FL5A 3I6UA 5E8VA 3GB2A 4HYUA 3RAWA 3VQHA 4BDFA 2C6EA 2WOUA 4LL5A 1VZOA 4EZ3A 3RPVA 2QONA 2WMXA 2JD5A 1JKTA 1UU8A 5EI8A 3BV3A 2YISA 2Z7QA 3G0FA 3MJ2A 4KSQA 1MRYA 4FTLA 3KF4A 3CQEA 4FV7A 4IJPA 3TL8A 3C5IA 2GTMA 2EKKA 2BZIB 4QYFA 4LV5A 4BCFA 1PXOA 3QC4A 4BCOA 5L3AA 3ZU7A 2DWBA 3D94A 1YHSA 3FLZA 4S33A 2PE2A 3ORMA 4W4XA 4A9SA 2CN8A 3PLSA 3TIZA 4DTBA 4BBEA 5L8LA 1PKGA 4I0RA 2FA2A 3FC1X 5KUPA 2YIXA 3R1NA 3BKBA 2JY7A 3FLWA 2E9OA 2JDOA 2YIRA 3F66A 3E8EA 4X2GA 3A4OX 3GP0A 3K5VA 4IDVA 3UOKA 4DG3E 2WB8A 2BDJA 1Y91A 2RG5A 3QRIA 4XOZA 2E2BA 2A0CX 5IMEA 2ZTCA 3DT1A 3FXXA 2OJJA 2R9SA 2B4SB 2LTUA 4BZNA 3NPCA 4H39A 3UDBA 3NCZA 4EUUA 3LFDA 3LJ0A 4O22A 5IH6A 3VVHA 4FE2A 3NW6A 2LVNC 5IA0A 2BALA 3R7EA 3N4TA 1H07A 2GTNA 3B8QA 3COIA 3PY3A 4TZRA 4RIOA 2PTKA 3RPRA 1HOWA 3QD2B 4OBPA 5CASA 3LCOA 4IX5A 2YZLA 2XNPA 2ITXA 4MQ1A 5JFVA 3FXZA 3KRWA 4YUQA 4A4OA 2C5YA 3GC8A 2H9VA 3MV5A 1OECA 2CN5A 3TKHA 4CT2A 2IG7A 5GIOE 4OTDA 4AQCA 4FTOA 2CCHA 5JEBA 3D5XA 5BMMA 3I79A 3TI1A 2VTPA 1YKRA 1Q4LA 1H4LA 3GC9A 5M51A 4CQEA 3MPAA 3WF5A 3RMFA 2OJFE 2YM8A 2P4IA 5LQFA 4FKJA 3QKMA 3K3IA 3KK8A 1GJOA 3C50A 3S0OA 2RFSA 4ERKA 4JL9A 3EN7A 5HE2A 4O0UA 2ZM3A 2XIXA 2JKOA 1SG9A 1BX6A 2R7IA 3DLSA 1WJ7A 4MF1A 5EH0A 4E4XA 5DBXA 2C6MA 4XP3A 2VTLA 4UX9A 2W9FB 4TPTA 4DGLC 4PX6A 3RHXA 2XNEA 3OC1A 3BPRA 4GV1A 3R0TA 3HA8A 4O7TA 4DFBA 5FP6A 1ZMWA 3AT3A 5K5XA 1F0QA 3FI3A 5EK7A 1OBDA 3E21A 1RE8A 2BR1A 3E93A 4J71A 4C38A 3S2PA 2F4JA 3GBZA 3LXKA 3AT4A 3BGZA 5DI1A 4ZJIA 4E93A 1H26A 4AW2A 2WHBA 1R39A 3OT8A 2DKLA 4IC7A 5DG5A 5L2QA 3UO5A 2V22A 1U4DA 1G3NA 3C4ZA 1M7QA 1YI6A 1R1WA 3JVRA 3F88A 5CSVA 2LBCA 2XJ1A 1MRVA 3PG1A 5FDPA 1FBNA 2C5NA 1H08A 4L3JA 1VEJA 2RFNA 4AOTA 2CNQA 3TIYA 4FK3A 3AT2A 1CTPE 1VR2A 4PDSA 5FRIA 4C2WA 3DXPA 4II5A 2OF4A 4JNWA 2W05A 4XG3A 3AQVA 3ORNA 2J6MA 3KGAA 3KXZA 3OWLA 4AA0A 4FTKA 4O82A 1RQQA 4I6HA 4MAOA 3BLHA 2GCDA 5HESA 3NUSA 4R8QA 3VUMA 4C3RA 5M56A 2W5AA 4H1JA 2BMCA 4RC2A 5DPVA 3IQ7A 4AXAA 4JBVA 2R4BA 4EH5A 4X6QC 2H8HA 4MWIA 1E94E 4GMYA 4J52A 2DUVA 3F3VA 2CKQA 3D7ZA 3IGOA 4G2FA 5M4FA 4NIFB 4BY9E 4EH9A 3VIDA 3GUBA 2IW6A 3SVVA 4Y72A 2G15A 4BGHA 4JQEA 5AUZA 3LXPA 4TL0A 5M57A 4IB1A 4GL9A 4M0YA 2IVUA 5CT7A 3OT3A 4B8LA 4RA4A 3FZRA 4B8MA 2J2IB 4HVIA 4KIPA 2G2IA 2XNNA 3UMXA 3E62A 3E7VA 5KO1A 5FLFA 4IX3A 5EYDA 3NMUF 2BZJA 4D4YA 1YRPA 4K0YA 1ZV1A 3POOA 4Q9ZA 3DDPA 3H30A 3NUYA 4G5JA 2VAGA 3LXLA 3IO7A 3K3JA 2OWBA 3F3UA 1PGYA 2LVOC 3NUXA 3QD0A 5HG7A 5EQYA 3V5LA 4L7FA 4BCQA 3SAYA 4DH8A 4S34A 3QGWA 4AAAA 5KMOA 3ZUTA 2OKRA 3R8VA 3RK7A 4YZCA 4EK5A 2ZB1A 3BQRA 3I81A 3P9JA 3LHJA 5K9IA 5IQIA 1WFCA 3FLSA 3S3IA 4U3ZA 2BDWA 4CLJA 3RAIA 1QZEA 2V7OA 4PL4A 3FRHA 1J91A 1T46A 3MH0A 2YA9A 3QZGA 2ONLA 5EKOA 2R3OA 2V62A 3A99A 2P33A 5J1VA 1R0PA 2WMQA 2HXQA 1FMOE 2WELA 4NW5A 4ZXTA 4OAUC 4XG2A 4NUSA 3WE8A 3MY5A 3SXSA 2XBAA 3IK3A 3TACA 4DBNA 4ZY5A 5EHOA 2PUPA 4QP7A 5GZ8A 2HZIA 5FD2A 3EMGA 3QCQA 4FF8A 2Q83A 2AC5A 3B89A 2GPHA 2R3IA 2BVAA 3L8VA 5D41A 2P55A 3EKKA 4D55A 4D2WA 3RK5A 2WEIA 4AS0A 2NP8A 4EZ5A 4AOJA 2XIZA 4FK6A 2L2DA 4C4FA 4EKKA 3FE3A 3ACKA 5TR6A 2XCHA 4FTJA 3HAMA 4AGWA 4NTSA 4CKJA 2XYNA 3NWWA 2YHVA 2PVLA 4IAIA 4V0GB 2NRUA 5HE3A 3RBWA 3FUPA 2XEZA 3UIUA 4E3CA 2UUEA 5L2WA 4Y85A 3S1HA 1YQJA 4JQ8A 2B9HA 2YJRA 2ZDTA 3P23A 4C36A 2RFDA 5IA2A 4IZAA 2R2PA 2QHMA 1ZY5A 3QQFA 4DFLA 3UO4A 5A4EA 3BX5A 5CTPA 5DHJA 3SDJA 1F4IA 3PFQA 1Q97A 4IWQA 4ALWA 2UW6A 4FVPA 2RG6A 4I1ZA 4M15A 4C0TA 1OL7A 4M13A 1LUFA 4QYYA 2VNYA 3EFJA 4QPSA 5IMXA 3MH2A 1XH5A 2OU7A 3SW4A 4YJOA 4DF3A 3F3WA 4AA4A 3SHEA 4EK6A 2FVDA 5FTOA 1QL6A 4AP7A 3DZQA 4FV5A 3GCSA 4TYGA 1WGLA 3OTVA 4RIXA 4YJSA 3PXYA 5KHWA 4FTIA 3MA3A 4ZTSA 3ZSHA 4D2TA 4CQGA 4QMZA 1FOTA 2QLQA 2X6EA 3BQCA 2HW7A 4AW1A 2JKMA 3TDWA 2CP8A 1ZZ2A 1CKJA 1VEKA 1PW2A 4CYIA 4O1PA 3FV8A 3MTFA 5DE2A 2VTTA 3ZCLA 4XG8A 4O21A 3LCUA 2W0JA 5BUJA 5BYLA 4FEWA 3EN6A 4JOAA 2X1NA 3CY3A 5CEQA 5M07A 1DAYA 1M7NA 3QQHA 3K2LA 4EL9A 2CKOA 4FKVA 5HHWA 3CLYA 4J1RA 3V5WA 2QURA 5CAPA 3U55A 4B7TA 2J5EA 5T3QA 3CTJA 3PP1A 3R28A 2QSFX 5HNGA 2NRYA 2BFXA 3QWJA 4I0TA 5H8EA 1TR8A 2C0TA 5I9UA 4C62A 3E5AA 5JH6A 4EBVA 5ICPA 1V0PA 3EQIA 2XP2A 2Q0BA 4NFMA 4C37A 4CMUA 2VWVA 2QLUA 2JIUA 2WTJA 3BHTA 3COKA 3KCKA 5ANIA 1KV1A 5EG3A 4E8AA 5L4QA 4O0RA 2OFUA 4Y95A 3QTUA 2F7ZE 1SM2A 1U5RA 4M69A 5CXHA 1YWNA 3ZM4A 4Y83A 3UNZA 2BHEA 1MN3A 2YABA 5J5TA 3UOLA 1BMKA 1DI9A 3D2IA 4PP9A 5DOSA 3U9CA 2PVKA 3BYMA 4HW7A 3DQWA 4YU2A 1A06A 3H9FA 2VTSA 2WTCA 1WGNA 3ODZX 1O6KA 4MHAA 5LARA 2YDKA 2P0CA 2BZHB 3NYOA 3T8OA 1G41A 5HX8A 2CGXA 4BTFA 4BTMA 3C4EA 2XIRA 4C35A 2BCJA 4NTTA 4ZK5A 2OK1A 4CFFA 3MFSA 4XRLA 3CC6A 2DQ7X 3C4CA 4BDCA 3R2YA 4F9AA 1GZ8A 5HGIA 1YDSE 2WTIA 3GI3A 4F64A 4FIHA 5E8ZA 4N57A 2AC3A 3ORKA 2C5XA 3U8WA 4CGAA 2C6IA 4IDTA 5FXQA 1ZYCA 3BU6A 2EB2A 4FKSA 2FYSA 3FI4A 2ZOQA
chains in the Genus database with same CATH superfamily
3GOKA 3NIEA 2UV2A 2XGNA 2EJSA 5EHYA 4OTHA 3QRUA 4RRVA 4BBMA 3ZEWA 1P5EA 4J99A 3L9NA 5M55A 4LF8M 3FTDA 3HUBA 5CEIA 3W0OA 1PXMA 1KUTA 3QZFA 2F7EE 2YLFA 4E4MA 4AXFA 1XO2B 1JKKA 3AL0C 2G1TA 3IW5A 4S31A 4JDIA 4WG3A 1J7UA 3ALNA 5HE1A 2PPQA 1YUBA 3W0PA 1WZYA 3LFAA 4CJ6A 2QO7A 2FH0A 4RX7A 5IKWA 2OZOA 2F4VM 2B0QA 4O6LA 4F6WA 3TDVA 4QP3A 2QOFA 1IBLM 4U5JA 4BCMA 5CZHA 2FSOX 4TNDA 1Q99A 4AG5A 3TWMA 2PL0A 4RIXB 4GITA 4DHIB 2X8AA 2Y0AA 2PWLA 4YJUA 3SXRA 2DWLA 4FZAB 5J7BA 4FV8A 3F5XA 4WNKA 4EOIA 2VWWA 4ZMFA 4XP0A 4L01A 4WNOA 2CCIA 4GT5A 1IN8A 4KIOA 5CWZA 2VDBB 5HLPA 5HEZA 2QP9X 2KNZA 3H4MA 1SVGA 3QYWA 4FZFB 3IKAA 4AWIA 3LQ3A 2XH9A 3KY2A 4TTHB 3KRXA 1G8AA 4L3LA 1Z5MA 3KK9A 4UEUA 5CU2A 4M66A 4WSYA 5E8SA 1NY3A 2OIQA 4JVGA 1NJGA 4MH0E 4KKHA 3P5KA 4ZAUA 2VGPA 3UBDA 1Q8WA 3Q4UA 4GG5A 1N75A 4FYOA 3IDCA 4W8DA 3NNVA 4P4CA 4BI0A 3CQUA 4IM2A 4UV0A 1OB3A 3U6OA 1PXJA 2C6TA 4JIKA 2CKPA 3HX4A 4U45A 4ANBA 2WMAA 1ATPE 4O4BB 5L8KA 2UW9A 4AZWA 4E6CA 3D9VA 5CU3A 1MQBA 1JLUE 3AKZA 5H8GA 3ZZEA 5A14A 1O9UA 2AQXA 4X7QA 3OXZA 2WQEA 3R21A 4D81A 5B2KA 3VNTA 4M84A 3WZKA 3NFFB 4FEXA 4ZSEA 3EIDA 3GPPA 2Z4SA 3M7GA 3DJ6A 1IEPA 2QOOA 2N35A 2WU7A 1S9JA 1J7LA 5EHLA 4RFMA 4C8BA 4DUZM 3QTQA 2X7OA 4EUTA 1CDKA 3GGFA 4U6RA 5FM2A 3CE3A 4L43A 4NRVA 4HL4A 2OOAA 2XANA 4CXAA 3ANRA 3PDTA 4QHTA 5IQGA 5HIBA 4NC6A 2P2IA 3DPKA 1P4OA 3UTOA 4TRLA 3CSVA 4DDIA 3WHKA 3F5PA 4EJ7A 1R6BX 3RM6A 3QAME 4QMWA 2QO9A 4TWOA 3ZHPC 4BKYA 5AP1A 2O5RA 2BAKA 2W9ZB 4DR5M 2IW9A 3R8LA 1AIPC 5KPZA 2LXEA 2UUBM 2CWBA 1DO0A 3NX8A 4KD1A 4UMTA 1XH9A 4BF2A 2XALA 4FW9A 2R3QA 3O7LB 1QYRA 4FNZA 2W1FA 2WGJA 3E3PA 4M0DA 1PMEA 4IIRA 5BVWA 5BPYA 4L53A 5ANEA 2OZAA 4YHFA 2YM7A 2F5QA 3BV2A 3OXTA 3VS5A 3PA4A 4NU1A 4XG7A 3KXHA 2JBOA 3QX4A 2UZBA 1IBMM 5CNNA 5ANOA 4XV2A 1G4AE 1URCA 3KEXA 1GIJA 3VONA 3R83A 4R3CA 1YE9A 4QMUA 5H9BA 4RPVA 4NL4H 3JVSA 3V51A 3KOXE 1MUOA 1NW1A 3L25A 3UJGA 5ITXE 1IAJA 4EH4A 2V5QA 1P3QQ 4PPAA 5E8YA 2WNTA 1Q61A 4L16A 2FSTX 4C4HA 1WIVA 5JKGA 1QPJA 4J8NA 2KA6B 2XIKA 2FSLX 1E9RA 4P5ZA 4YHJA 4JS8A 5AR8A 3WE4A 4TWCA 2VO3A 5JK3A 3WARA 3AKJA 2ETMA 4D4SA 3FI8A 5EKNA 3C0HA 3DB8A 3T15A 2HZNA 3AOEA 2R0UA 4FIJA 4MKCA 3VN9A 5JZJA 4DV3M 3MGYA 4L9IA 1F5QA 1FPUA 5CAQA 3DNEA 3LPBA 4FD2A 3SYKA 1MQ4A 4NKSA 4CCUA 5K5NA 4ZTHA 5ANJA 3SQQA 5IT9S 3VUKA 3DLZA 1VYWA 4HNIA 5J9YA 5KBQA 5AV0A 5M08A 4X64M 4RVKA 3C0GA 4F9WA 1FVVA 4MK0A 1VDDA 4KT0F 3GLGE 4DT8A 2NPQA 4JI2M 2QKWB 1DO2A 4BKZA 4ZOGA 3P1AA 2YERA 3FPQA 4L8MA 2JNHA 4N6ZA 1GKIA 4QMNA 4KUJA 3OG7A 5KBRA 4PWNA 1UNGA 1U54B 4NSRA 4R3DA 4I5MA 3VBTA 4R78A 4DV0M 3BGQA 4CSVA 5HQ0A 4GFOA 4O7VA 5HU9A 2H6DA 3SAWA 2UVXA 5LVLA 4IAYA 1B6CB 3MI9A 4FTRA 2J7NA 4U44A 1J1CA 4LDTA 4QTBA 2C6KA 2ITZA 4BDHA 1H1PA 4FSUA 1TH4A 4JMQA 5FTMA 3VHKA 3PE1A 1GIHA 4QQJA 3GCQA 5HIDA 2CSNA 4FG9A 3FZPA 4JDJA 4Q2AA 4ZMEA 3DZDA 1SZMA 4KB8A 2O2UA 2XJ2A 4I3ZA 3V3VA 3U5ZB 3FQSA 4BR3A 4FT0A 1K3XA 2Z7SA 1B38A 4HGEA 4G6LA 4OT5A 4IBBA 3V8WA 4CGYB 4S12A 3I7CA 5AIKA 1IA8A 3FXWA 4PL5A 3SAUA 4AXEA 3FHRA 3DKGA 3KU2A 2HY0A 2NNWB 4OVZA 4GRBA 4H3QA 3VS3A 1KE8A 3A45A 5EM8A 3ZH8A 5E9EA 2BFYA 2XARA 2EXMA 2HKJA 5C1BA 3UK6A 3BBTB 5AA8A 5FXRA 3SA0A 3HAVA 3EFLA 1AUAA 2ACXA 2GSFA 4YMJA 3KOWE 2PVJA 4E1ZA 4IFGA 5A54A 3ZXTA 4I0SA 3C13A 2LGCA 2HZ0A 3ORXA 3DZOA 4LG4A 2ERKA 4E6DA 4DHZA 3L2AA 1SNXA 4CTBA 2C4GA 3JPVA 1Y8YA 3O8UA 2JAMA 3Q3BA 4MBLA 1O6LA 4A9YA 1XMMA 2KZUA 4YLLA 3UVRA 3W2OA 4DBXA 1WMKA 2RKOA 4CG8A 4ASZA 4UN2B 3FKLA 4FC0A 4X66M 4BJJA 4FNYA 1PKDA 2IVTA 4IBDA 3HV5A 4FTAA 5A46A 5AAGA 4E6AA 4BBAA 2O5KA 4GC9A 4XV3A 1JQJC 4REZA 2VQEM 3HJQA 4FOCA 3PVBA 4MXOA 3WIGA 5I5ZA 1BKXA 3FSKA 4CFXA 5IA3A 3MK6A 1SYKA 3NW7A 3K92A 3F61A 3GRYA 5KO3A 1H25A 3DB6A 4IB3A 3Q53A 4OBQA 4RVTA 4A9RA 2WQMA 1LTMA 2KNVA 5TO8A 2W1EA 2VWYA 4ERWA 4OU7A 2LHGA 1SMHA 3KF7A 4K2RA 4QQ5A 1EE8A 2FGIA 3R9OA 4F99A 1NVRA 2DAGA 2VX0A 4EWQA 4DH5A 2SRCA 3SC1A 2PZYA 4LFBM 1DI8A 1KV2A 5IG1A 3E92A 1Q8TA 5TT7A 5LVNA 1IXSA 1UWHA 1EH4A 2NO3A 2YIYA 2R4EA 4IFCA 2XB7A 5CS6A 4CD0A 1D0LA 4KIKA 3BWFA 3TNWA 2GS6A 3AC4A 3C4XA 3FZ1A 2QR7A 3MVLA 4I22A 4AE6A 2PK9A 2WSFF 1WCCA 4D9UA 5HX6A 4FKTA 2UU9M 2IZSA 3LXNA 4F65A 2G8LA 5E8XA 3RPYA 3FLNC 1PMVA 3GOPA 4WT6A 4FVMA 3PSDA 1UFZA 3U60A 2WXVA 4F4PA 4QYHA 3NR9A 5F9EA 2ERZE 4R1YA 2FO0A 3U60B 1UA2A 2HAKA 4CISA 3C51A 4UBAA 4C3RA 2WTVA 3UJNA 3AC3A 1PJJA 2BIKB 1XMQM 4OTGA 1XWSA 3FAAA 3GLIA 4LV7A 1T43A 3S4QA 3GPXA 4ENYA 4NW6A 3RHKA 4UWYA 1GIIA 1DGBA 3NLBA 3IG5A 3D14A 2A19B 4UZHA 5GJDA 3QWKA 3VS4A 1L1TA 3AD4A 4LGMA 3IS5A 3FLQA 4XK8F 4IEBA 2X2KA 5LVOA 2JFMA 5E92A 4DINA 4LG2A 2QOHA 3U6JA 4D0XA 2L4EA 2DS1A 3GU7A 3J80S 3SG9A 2R3PA 4AG8A 5CSPA 3RWQA 4F78A 3UDTA 4HYSA 2QZ4A 5A4QA 2GQRA 5AUWA 3ZRLA 3SMPA 1STCE 2C68A 2V55A 3NCGA 3OD6X 5F94A 5GJGA 4TN6A 3ZO4A 2RF9A 3CY2A 3DAEA 3WIKA 3K1JA 2C5VA 3TEIA 5K0KA 2X8DA 3GEQA 3DBQA 4I23A 2C1AA 5FEEA 4L45A 3W67A 4ZTMA 5CXZA 3LAUA 1V1KA 1IR3A 4ZSJA 3RALA 1NHGC 1OIYA 2C69A 2OIBA 4AXCA 4U7ZA 4BGQA 2V1UA 3DBDA 5K4IA 1C7YA 4MB7A 4G6NA 5I9WA 2JC6A 4DFLA 3WF8A 4O0TA 3BLRA 2F7XE 3GCUA 4FKWA 1GZOA 3PP0A 1XH4A 2UVYA 2JZ1A 4FT9A 2C0OA 1IN4A 4IBKA 1APME 2QVSE 2X2LA 4HVDA 4K8AA 4B3MM 2R3MA 3MFRA 5ETIA 4PNKA 2WMSA 2VTAA 4PTCA 1OGYA 1GL7A 3MFUA 3Q60A 4XJ0A 5KZIA 3MH3A 1R2YA 2QKRA 3HGKA 3P7CA 5KNJA 1UWJA 5J87A 3QTWA 4L44A 1DAWA 2VTOA 4G31A 3E8CA 4C57A 2CNUA 5IQFA 3D8LA 3R2BA 4E20A 2GDOA 1FGIA 4CCBA 2VTNA 3FYJX 3U6EA 3QRJA 4FKGA 5JZNA 2A2AA 3FMMA 3W0LB 5FG8A 3TJDA 3SAVA 2HHHM 2QQ7A 4G4OA 4XBOA 4J7BA 5E7RA 5DNRA 4DA5A 1N78A 5EI2A 4GHAA 4GUBA 4LGHA 3W55A 5AR3A 4I5CA 5I3OA 3NDMA 5HO8A 3V04A 2DAIA 1DGHA 3R7GA 3PJ3A 4PDYA 2V0DA 4MBJA 5EXSA 2EA0A 3I04M 3CJFA 4FRFA 4GIIA 4DDGA 3QKKA 1WVXA 4H36A 1YI4A 2HY81 4IAZA 4XNEA 2HWPA 5IH5A 2HL7A 4XG4A 3KN6A 3O8TA 2DWNA 3OWKA 4V01A 4PV0A 5L6WL 4ANQA 3FEGA 4GG7A 2EB3A 3HZTA 3QQJA 4TYHB 2YR0A 3JY9A 1Q3DA 5CNOA 3UQGA 4PUZA 4LRSA 3DQXA 4JG7A 5D1JA 2WSEF 2CV0A 3HGIA 3DKFA 4NCTC 1Y6BA 5DRDA 4CFNA 5BVEA 3NYVA 4YHTA 3UG1A 3GLHA 4W4WA 4E7WA 5J9ZA 4X3FA 5HCYA 3J7BA 3ZCBB 4ITIA 1B39A 4QYGA 3TN8A 3MB6A 3T9IA 1ERKA 2V1CA 4QMLA 3HU2A 1NVMA 4XMOA 4MUQA 3G90X 2IVSA 3RAKA 4LM5A 4IWDA 5E8TA 3U6MA 4RNAA 5HTCA 5AV4A 1YOMA 5AX3A 3ZO1A 1W8CA 5BNJA 1RDQE 2C5OA 2GS7A 3H9RA 3QA8A 1XXHE 2W4JA 3EWHA 4BN1A 2UW8A 2X0QA 3BU3A 4EKLA 3COHA 2QCUA 4GEWA 4EZ7A 5EQPA 2HCBA 4FG8A 4FKQA 4R3RA 2R18A 4DR1M 2Y6OA 3DS6A 4GUEA 3CPBA 4Z9LA 4DEBA 1XBBA 5CEOA 3DY7A 3IW8A 3QXPA 2WEVA 1FNNA 1GAGA 3R01A 4S32A 1P14A 2Y4IB 1DV0A 3U4UA 2JDSA 3PVSA 3UE4A 3QU0A 2IF8A 5HG5A 4A9UA 3VUHA 5HNIX 3OUNB 4L68A 3ROCA 4DGMA 4HPUE 2HZ4A 4F7NA 3ELJA 4EI4A 4LF4M 2UW3A 3ZDIA 3TV4A 4C7TA 1L1ZA 4DH7A 2W99B 4JX7A 4KBKA 4FIFA 4FIGA 2JIIA 1MU5A 4LUDA 4Y5QA 5BYZA 3FZTA 3WILA 4IWOA 2JITA 3SRVA 3Q5IA 4NIFA 3RINA 1NSFA 4GKIA 4HEOA 1JSVA 2OO8X 3LFQA 3LMIA 5D12A 3O23A 3ILKA 3T9TA 4EK4A 4EWHA 5JSMA 3BLAA 3OVVA 2XNMA 2ETRA 4XV1A 3VBVA 4FL2A 2C3LA 4HJOA 1OGUA 3SLSA 4QMMA 3V8TA 2XF3A 1LP4A 3KS4A 4MF0A 4RWJA 4ZTNA 4HZRA 2J51A 1XH7A 5CAOA 3ML1A 7CATA 2O25A 4DFUA 3PIYA 5LJJA 1OIQA 4W9XA 4AU8A 5DYIA 3R73A 4AF3A 5IUHA 4JDHA 5BVOA 2YIWA 2RRUA 1ZY4A 4F9BA 3DKOA 2W96B 2JAVA 4GFGA 4GH2A 3SBJA 4I4EA 4UMRA 2ZM4A 2DZNB 3PZEA 2UW4A 3HRBA 5AP5A 1YHVA 2QU5A 2I6LA 5DFLA 1L2CA 2C3KA 2PZIA 4B6LA 3EN9A 2AUHA 3KN5A 2BWBA 4MGKE 4IBGA 3NUUA 1J3HA 3QX2A 4JIAA 3S00A 4F1OA 3PPZA 5IISA 4QMXA 3VS6A 2XKDA 4RIWA 3LCSA 3CTHA 4KABA 2XMYA 2XKFA 4YPDA 3CPCA 4QMQA 3HL7A 3ZO2A 1X8BA 4O7NA 3BE2A 3AD6A 4BC6A 2UW7A 3QD4A 4IACA 2BNKA 4FT5A 4RZWA 4AKIA 4OUCA 4XYFA 3RWPA 3CF6E 1NV8A 3TTIA 3MESA 5M09A 4M0WA 2G5GX 3GFWA 3Q9WA 4KS8A 4LF6M 4ASEA 2XSZA 4M9XA 4NKAA 5K3YA 3QC9A 1HJPA 3D83A 5I9YA 4F9YA 3ZLYA 2IO6A 3D5UA 3R1YA 2O65A 3HY5A 2I0YA 3UODA 4B4LA 3QCYA 5FTGA 2GNHA 3GQLA 3QALE 4FKPA 4WSQA 3R8ZA 2F5SA 3W2SA 4O7ZA 2IWIA 3PE2A 4MVFA 5EOLA 5HLWA 4WRSA 3BGPA 3MS9A 5DYJA 5E6JA 4TUWA 2QOQA 1TFFA 3QQGA 1TQPA 2B3TA 2BIYA 2XK3A 5L8JA 4CMOA 2XAOA 3ID6C 2Z60A 3N4UA 4NL0A 5IDPA 2J0IA 2OJIA 2DWMA 2BRGA 3L1SA 3W10A 5HCXA 4M69B 4RJ7A 3T3UA 1OL1A 3FKOA 3OCSA 4MTAA 4QTEA 1FVRA 2ZTDA 1QUSA 3I4VA 4II7A 3TWKA 2WTDA 4U80A 4FL1A 3RCJA 3NEWA 2R44A 1QPCA 3BEAA 4RJ8A 4CZTA 2PE0A 4N70A 2MR9A 5KKRC 3SW7A 3AKLA 2CE7A 2REIA 3MVJA 1E1XA 4LQMA 4I93A 1K3WA 3TNIA 4DCEA 2F2CB 4CNHA 5HIEA 1JR3E 4CFUA 2Z7RA 4DEIA 3TNPC 5LWMA 5EM6A 5L2SA 2W1GA 4F6UA 5HORA 2FSMX 3PA3A 2A1AB 5A2QS 2GNFA 3CP9A 4FKRA 4IWPA 4DG2E 4BJJB 5AP6A 3NWLA 5BR8M 2GNLA 2QO2A 4GVJA 4YTFA 1Y57A 4DUYM 5IDNA 3QHRA 1W82A 2BUJA 3ZH9B 2J7TA 3E7OA 4P5QA 2WZJA 4L67A 4QO9A 2BTSA 2JKQA 2PZ5A 3FBVA 5AP2A 1YHWA 3JUHA 5DRBA 3P5JC 3WBLA 2ZM1A 5JGAA 1Z6TA 4G3CA 3HMPA 4DFZE 3DA6A 2PVYA 3PY1A 3VAPA 5LMBA 3FY2A 3WZEA 4L4UA 5GZ9A 3FHIA 4PTGA 3D7TB 3W0FA 5LCJA 4O2ZA 2YWVA 4FUXA 1A9UA 4K18A 2XAMA 2AHMA 3NZ0A 2PVNA 4M8TA 4YC3A 5FBNC 1Q3WA 2VF8A 2OIDA 4K11A 4BCIA 3DAKA 5DN3A 3FKEA 5EM7A 5JGDA 4P17A 4X0MA 2PMLX 3TZ9A 2BILB 4BDGA 3E88A 4AW5A 3DXNA 4LRTA 3U6CA 3R1SA 4N0SA 4EH5A 4FWDA 3NNXA 4D9TA 4R71A 2MGWA 3RZBA 3G9LX 1WR1B 4GEOA 3DJ7A 3UZRA 4YNOA 1CKIA 2BROA 3PXKA 2VWBA 3F2NA 4G6OA 4J53A 2X49A 3BYVA 3F82A 3MWUA 5I0BA 3LFSA 4FL3A 1OMWA 3K54A 5AP4A 4A4XA 4O7LA 2OI4X 3VUGA 3I0OA 4CV9A 2W1CA 1WVWA 3VS0A 3ZO3A 1W7HA 3LCTA 3OOGA 4JG8A 4ACCA 3UP7A 3ZTXA 2YM6A 4DLJA 4FT7A 3GFEA 3U87A 3V5QA 4EORA 3ZM9A 4H05A 4ZY4A 1JVPP 3HU3A 1DGGA 2ZMDA 1WBWA 3DNDA 5FSWA 1M52A 3I1AA 1VQ1A 3TKUA 2CGVA 4L42A 4ZS0A 3DTCA 3E4RA 4O91A 1BI8A 4KRDA 3JAMS 2F5NA 4PT5A 4LCBA 2UUAM 2R3GA 4FTUA 3O2MA 2B1PA 1KWPA 2F9GA 4FZ7A 4WNMA 3UG2A 4ONAA 2PMNX 2R3FA 2YN8A 2QQ8A 4LOQA 4CZUA 4M0ZA 4JLCA 4OTQA 4LYNA 4ZEGA 3O96A 3NRMA 1G71A 5C26A 3VF9A 2XIYA 3C3DA 3DK6A 4ZY6A 3A7JA 4R7IA 4AA5A 4U3YA 1PJTA 4X2JA 3F92A 3QCSA 3PFIA 4QD6A 3Q8XA 4BHNA 4WRGA 4DEDA 3C4WA 1RJBA 5E4HA 3IDBA 3R02A 2UXCM 2ITWA 4TNBA 4MBIA 4E5AX 1E1VA 3LIJA 5EQEA 4C58A 3BIZA 1LEZA 3K9OA 2QG5A 4AZFA 1KSWA 2XKCA 4RLKA 2XNBA 2GFSA 2VO0A 1UNLA 2GHGA 4M12A 3L8PA 4Q5EA 3EQRA 3R9DA 2YDIA 4YJRA 1WBPA 4FSNA 4G1WA 1R5LA 3BHUA 3C3EA 4DEGA 1TZDA 4DLIA 3KSXA 4RF0A 2JUJA 2YM3A 4QMPA 3CTQA 4JBQA 2EXEA 1H1WA 2OZAB 3H0ZA 4I6BA 1U59A 2XK7A 2ZMCA 3M11A 3AGLA 4GJ2A 4RJ4A 5HLNA 5HBHA 5ITAA 3LW5F 5CSXA 4O38A 3KFAA 5CANA 3DBCA 1EFUB 5E1EA 3QL8A 3GLGB 4XG6A 4G34A 2VN9A 4AZSA 1AQ1A 3ORTA 4GK4A 4K9YA 4UYNA 3ALOA 4V05A 3TJCA 3ZRMA 1JSUA 3PJ8A 4Z16A 4D1SA 3N4VA 4ZZMA 4C34A 2UXDM 4QNYA 3VUTA 3B7ZA 4QQTA 2Y4PA 4BB4A 4YSMA 1NA7A 3Q32A 4GYIA 2XZFA 4L00A 4FCWA 4WP2A 4AKGA 4MXCA 5BUIA 1HR0M 3FTEA 1H0WA 2YCFA 2A27A 4FEQA 4OR5A 2X8EA 1YW2A 4UMPA 2X6DA 3C1XA 3FZOA 4DV2M 4I20A 4LOPA 4X21A 4ACHA 5FQDC 2YAKA 3P0MA 5LMKA 4LJ6A 2Y6MA 1XBAA 1ZOEA 4S30A 5HI2A 3V5PA 2E9VA 3OW4A 4JI5M 1ZXEA 2WMVA 4I6QA 4JXFA 4FOBA 5HOAA 2UVZA 4AKHA 2ZVAA 4OTIA 3RJCA 4RFYA 4RWKA 2KNAA 3UNJA 3GRVA 4GMQA 2JP7A 1YWVA 2X39A 3QF9A 4GJ3A 5F95A 3F7WA 1I4WA 4D2SA 4ENXA 3KVWA 3ITZA 4YLKA 3Q9ZA 4Q5HA 4FICA 4A9TA 3LQ5A 4O0VA 4EQMA 3CJGA 3ORIA 4D5HA 1PMUA 3Q6WA 3FUVA 1OVEA 4LY6A 5C8MA 2XH5A 1YXSA 2DI0A 3HZJA 4K1BA 3LM5A 4QP8A 5A3XA 3IOKA 4OW8A 5AAFA 3VS2A 5BQ0A 5M53A 4EOMA 4KWPA 5G6VA 1Q39A 5HG8A 2FH9A 4LJ9A 2HWOA 1VLRA 5L6OA 3PTGA 3KULB 3AD5A 4Z7HA 3E46A 1XJDA 2LAVA 3PXRA 2VGOA 5AUYA 3S95A 4XCUA 4AX8A 1Q5KA 1OZ1A 1H24A 1PRYA 3GLIB 1PMNA 4HYHA 4QMSA 1K3AA 1PHKA 3W16A 4CTCA 2RFEA 4KKEA 4CT1A 2EXCX 4WG5A 4AAYA 2EWAA 1TVOA 3FL4A 4NT4A 1O6YA 3PXFA 5AADA 1Q3CA 4E5BA 4RQVA 1JWHA 4TWPA 2XK6A 4XOYA 5FWKK 4GU6A 3HHYA 3T3VA 3EN5A 2VTJA 3QBNA 1TH3A 3EL8A 5ANKA 5CAUA 3W2QA 3DU8A 2BWEA 5CEKA 4M14A 1VJYA 5KMMA 4QP4A 3VS1A 3W2CA 2IVVA 1XBCA 1QPEA 2GHMA 2JIVA 4W4YA 3ZFXA 1JAMA 4I92A 1AGWA 4ITQA 2I1MA 4NK9A 5C27A 3V6SA 1ST4A 5C4KA 2R7BA 3AC2A 3TE6A 2PVHA 2L6OA 1H27A 1NVSA 3HVCA 1ZYSA 3DFCB 3LJ2A 3OUKA 3G51A 4PNIA 1IQPA 4BDIA 1YWRA 3QTXA 3JR4A 3IGGA 3PUPA 2JDVA 1YDTE 4Q9SA 4ANOA 2YM5A 3HKOA 3FC2A 3LMGA 3II5A 3OBJA 1A5TA 4FV9A 1E32A 3LQ8A 3FMNA 4MH7A 4JAIA 5E1SA 3VJOA 1YXXA 4HYIA 5D7VA 4OGRA 3NUNA 4UMQA 5BYYA 4K6ZA 1Q02A 1YXTA 4GIHA 4AQKA 3RAHA 4WBOA 1L3RE 5D10A 2YFQA 3VBXA 3FSFA 3TM0A 1CM8A 2Z7JA 4O0YA 5F20A 4DH1A 4F0FA 2OFVA 4H1MA 4PCZA 4EONA 3ZS5A 2KW0A 4GHLA 4NM3A 4IBIA 3W8LA 1R3CA 3AG9A 5DR6A 5AR4A 2DXIA 5GKNA 1SVHA 2G9XA 3SRVB 3CF0A 3C9PA 1H00A 2EU9A 3BE9A 4BL1A 5M4IA 4NYEA 1XHAA 2R3JA 2W5HA 2ZAZA 3EL7A 3OCTA 3PWYA 3I60A 5K4JA 2X7FA 4EIWA 3BHYA 3A7IA 3KRRA 2QHNA 2H34A 3BEGA 4JV5M 2C47A 5C18A 4D1XA 3LFEA 4L3PA 2P5TA 1RW8A 1WHCA 3QCXA 4R1VA 5CY3A 1H28A 1Z59A 2XNGA 3F7ZA 3ZOSA 2X0GA 4JI4M 3R7YA 4AACA 5EYKA 3GU6A 1OAIA 4IBEA 4D1ZA 5BVNA 3B7NA 3P78A 5CSWA 5M56A 3EKNA 2ITQA 2QU6A 4FTCA 4W8EA 4WUAA 4QNAA 1IN6A 4R77A 3Q4ZA 4OTPA 5AEPA 1ND4A 1G8JA 4CVAA 3G33A 4YTIA 5FD2A 4L52A 4XS2A 3PJ1A 3L8XA 2C30A 3QYBA 4QT1A 4J95A 3BHVA 5LMUM 3CEKA 4YTHA 5F4NA 1H6UA 3MMPA 5LVMA