2QNJA

Kinase and ubiquitin-associated domains of mark3/par-1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
324
structure length
318
Chain Sequence
b'GAMGSEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITATYLLLGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/microtubule affinity-regulating kinase 3
publication title Conformational instability of the MARK3 UBA domain compromises ubiquitin recognition and promotes interaction with the adjacent kinase domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 318
sequence length 324
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2qnjA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qnjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qnjA01
4JR3A 5A6NA 5TE0A 3R00A 5D7VA 2WFYA 2C6LA 1W84A 3GP0A 4P5QA 3VHEA 4DEAA 4DBXA 4CKRA 2PMLX 1WGLA 2ACXA 2UZWE 2X2KA 5LCKA 3RZBA 2R64A 4EBWA 4CVAA 5KMIA 4U44A 3WE8A 4YJSA 3CC6A 3M11A 4PTGA 4AOIA 4ZSJA 4HZRA 3WIKA 1ZY4A 2FUMA 5JRQA 1QPJA 1WBSA 3FXXA 5HU3A 3DAJA 3AT4A 3G15A 4BDCA 4HZSA 4EZ5A 3OMVA 5FG8A 3D5VA 4V04A 1PY5A 2R3LA 4ZTRA 2P2IA 5IMEA 4AGWA 5J5TA 2YJSA 4EI4A 2PU8A 4GFGA 2PPQA 4F1TA 1PW2A 1URWA 2Y6OA 4EKLA 2OIDA 5J9YA 1ZYSA 2VWIA 2HK5A 4MNEA 5EDPA 2G2FA 3PG1A 3FMLA 4M69A 4XMOA 3F88A 3A7JA 3HUCA 5E9EA 3HEGA 3LFAA 5AV0A 2IZSA 5E7RA 2E9NA 1GY3A 3DLSA 3QCXA 4YC8A 4ALWA 2QR8A 2WPAA 4GK3A 5E1SA 2DHYA 2EKKA 4D9UA 3QQGA 5D7AA 3COMA 5D41A 5H2UA 3ATSA 4FEWA 4UYNA 1ZMUA 3SD0A 4BFMA 3K54A 2Q83A 2XIZA 4G17A 3BHUA 4IB1A 3ETAA 4ZEGA 4A9YA 1ZLTA 5KKRC 3KMMA 1GAGA 3D5WA 3BWFA 3MESA 2YM4A 2KNZA 4BB4A 2YHVA 3E8EA 3ODYX 3PE1A 4MNEB 3CE3A 2QOIA 3OCTA 1YWVA 4J8MA 5BYLA 4RG0A 4M69B 5I3RA 5CEOA 3ODZX 3JVSA 3JPVA 4FV0A 3UPZA 3RM6A 2V7AA 2ZM3A 3F66A 5KE0A 4NZWB 3QKLA 2ZM4A 4IJPA 2QOOA 4QMTA 3W32A 1JSUA 1Q8TA 2GHMA 2LVAA 4BDIA 3TV7A 4CTBA 4O83A 3F9NA 3BKBA 1VYWA 3FWQA 1V92A 4OTFA 3ZSHA 5M06A 2Y6MA 4DH1A 2YCFA 3OCBA 4F0GA 5CU6A 5LVNA 2XNMA 5BUEA 3HMMA 4PDOA 5ETCA 3ROYA 2PVNA 2Z7LA 4IHPA 4QQJA 3TL8A 4ENYA 3FI8A 4FC0A 4R8QA 4XUFA 1OL5A 4RMZA 3OCGA 2ZDUA 4GW8A 4DTAA 3DGKA 5JSMA 4QP1A 3F5XA 3OFMA 4WUNA 3HGKA 4WOVA 1H0VA 1H4LA 4EOLA 3QD4A 5IPJA 4MKCA 3DA6A 3BHTA 3ORKA 4EUUA 2CMWA 2UW4A 2JY7A 3P78A 4EH3A 2W4JA 5K9IA 1G3IA 2JIVA 4OBOA 5HVKA 5J87A 4ZS4A 1A48A 1WBNA 3E5AA 4I3ZA 4O86A 4F09A 5FTOA 5CAPA 2RG6A 3G0FA 3PZEA 1I44A 1FMKA 3LJ0A 3N9XA 3EL8A 1WMKA 3TDWA 2WOUA 5HD7A 4QPMA 3IONA 4EH2A 2C6TA 1BMKA 3MVHA 3FLSA 2B7AA 4MYGA 4FV7A 4NK9A 1UKIA 5GZ8A 5CEIA 3MWUA 3EN4A 3G6HA 4M66A 2VTQA 4GKHA 3TZ9A 5HCXA 1VEBA 2R3RA 3HP5A 4X21A 2VTAA 3EFJA 1CTPE 1H0WA 4CQEA 3DKFA 4XBRA 3UZPA 3NS9A 3P1AA 4J97A 4QNYA 3E63A 4FZ7A 4RVTA 2YABA 3ZLXA 1H1PA 4MCVA 3COIA 5ANGA 4O0SA 3A2CA 2XNPA 3TUCA 4R7BA 2O25A 5HE1A 3H0YA 4JIKA 4IDTA 4KB8A 3IOPA 4F7NA 1LEZA 5DGZA 3B2WA 3NVMB 3OS3A 2DAIA 1QL6A 1W8CA 2BIKB 2JDOA 2PZIA 5A4CA 3CQUA 4DLIA 3FKLA 3UOHA 2OJ9A 3H10A 2JIUA 3VW8A 5L4QA 5AV1A 4PRJA 3GCPA 1OI9A 4NM7A 2C0OA 2GNJA 4ENXA 3FMNA 2DZLA 3S1HA 5FGKA 5AIRA 3ZC6A 1W83A 2W9FB 4XV1A 5TF9A 1KE8A 4UV0A 2GQSA 3Q32A 3SRVA 3O96A 4FNXA 3L9MA 4NW5A 1H1RA 2WD1A 3LXPA 5GNKA 2B9HA 5CX9A 5L6WL 3QHWA 3EIDA 2BROA 5AV3A 3R8UA 3FQSA 4DITA 4YU2A 3V3VA 2XNGA 4IVDA 4AT3A 2IVVA 4MD9E 4F7SA 3R71A 3MFSA 3KCKA 4UALA 2WNTA 2PVHA 3DKOA 3RKBA 4BYIA 3HDMA 2CLQA 3R1QA 4AW1A 2HZNA 2C47A 4ONAA 5LCJA 3AMYA 4WHZA 5EOBA 4QTAA 5LMKA 3VIDA 3UQCA 1H01A 3DBDA 2EU9A 1GIHA 4JS8A 4W8EA 1OM1A 2WMSA 3DK7A 1B38A 5HX6A 2OG8A 2PE2A 1YHSA 3QRTA 2GQRA 5BNJA 3O23A 4XOZA 2DAKA 4EHZA 2V22A 4RA5A 5CXZA 1FOTA 1TQPA 4H39A 4XH6A 2HYYA 4AGDA 4A4LA 5AA8A 3U6IA 2B0QA 4Q5HA 3AGLA 4AN2A 3CKWA 4AGUA 4MXAA 4DAWA 4EK8A 4BHZA 4PWNA 4RQVA 5DR2A 4BVUA 2P33A 4FGBA 2XB7A 4FV3A 4JG8A 2R3MA 3HV6A 5AM6A 1IRKA 4EOIA 4EUTA 5LWNA 3I4BA 4WG4A 3B2TA 5K4IA 4JVGA 1XH7A 3RCJA 5H8BA 5HU9A 4K6ZA 3SC1A 3JS2A 2J7TA 4AA4A 3QF9A 5F20A 1PXPA 4K1BA 2WMWA 4YHFA 2BRMA 2FH9A 5IQFA 3T8OA 2HWOA 4WRSA 4FSNA 4QMPA 4OAUC 2JIIA 4NM0A 5LVOA 4M7IA 3SLSA 3FLNC 4BICA 5LVMA 5I5ZA 3KCFA 1VZOA 5CEKA 4QYYA 2WMRA 4K9YA 4ANMA 4PNIA 4CTCA 2W1ZA 4IJ9A 2WMUA 5EH0A 2REIA 4LMNA 3NNXA 3Q9WA 4GIIA 5HG7A 2QNJA 2C3JA 3I7BA 2ZOQA 3PJ1A 4JRVA 3V5JA 5CNNA 5HO7A 2UZEA 5J79A 1FVRA 3I5NA 4ZTMA 2RKUA 4ZAUA 1YDTE 5GZAA 4N4SA 3R30A 4K77A 4P4CA 4YJNA 4E4NA 2YWPA 1HT2E 5EHOA 3FXWA 2A2AA 5DIAA 2ITQA 2XK3A 5LVLA 2R3IA 3IQ7A 3Q4CA 1VEKA 3BI6A 3RNIA 5L2SA 4X6QC 3I6UA 1E94E 5ANKA 4Y85A 4F9CA 4ZY4A 3WF8A 1TTEA 3F69A 3PZHA 2J4ZA 5A54A 3T3VA 5CT7A 2CDZA 5KBQA 1REJA 2OJIA 3F3WA 5BVFA 4CLIA 3KC3A 3LFCA 3MGYA 4E5BA 5E90A 2O64A 4GEWA 2Y8OA 4WO5A 4ZTNA 3LJ2A 4BWKA 2W99B 4FSTA 2WTJA 3MJ1A 4L44A 3EN7A 1P5EA 5E8UA 2PVMA 4GJ3A 5L3AA 5C1QB 1QMZA 4IEBA 4BIBA 5IQHA 2XKFA 1LPUA 4ANBA 4EWQA 3QKKA 4TW9A 3ALOA 2OIBA 1L8TA 4WNOA 3IGGA 4OUCA 5EM8A 4YJUA 3QTZA 3R8PA 3UNJA 2I0EA 3UTOA 2QSFX 1H1WA 1H24A 2XMYA 3QA0A 3ZO4A 5DEYA 4ZS0A 5AFVA 3D14A 3KGAA 2EWAA 2Z7SA 5E8SA 4FVPA 4M12A 2P0CA 4BGQA 4EZ3A 3POZA 2ETKA 2QOQA 2IO6A 4QMSA 3GNIB 5CU0A 3PLAE 4ZP5A 4E4MA 1M7NA 4BDEA 5DWRA 3NW6A 1FGKA 2LBCA 2ZYBA 3CTQA 3ZUTA 2QOHA 3KF4A 3D9VA 4MF0A 4YZCA 4WBBB 5C9CA 4M0ZA 2J50A 4TTHB 4DFYA 2YCRA 4CD0A 2IJMA 1UNLA 2WU7A 2BALA 4J96A 2I0YA 4I41A 2BKKA 2F7ZE 2WEIA 4BGGA 3O7LB 4RX5A 4TT7A 1LR4A 2BZIB 4CFWA 4DH3A 4IZ7A 1T46A 4IVBA 4ZZOA 1QPCA 2V55A 2F2CB 2PVFA 2W9ZB 3GC8A 4EK4A 2GQGA 3UNKA 1UU3A 4EHGA 2C3LA 1YOMA 3Q9ZA 4HJOA 5DT0A 3E7OA 4QT1A 4UB7A 1YOLA 2CCIA 4PP7A 3PXYA 4YHJA 3W2OA 3NNWA 1FMOE 2PSQA 4FV8A 1XXHE 5CQWA 3RCDA 5FTQA 3UP2A 4KIQA 5K4JA 1HT1E 2DI0A 4TWPA 4RSSA 1F4IA 3WZJA 2XK9A 3FRIA 4IM2A 5TOZA 3ZDIA 2V5QA 4C4HA 2PWLA 1JBPE 5EDQA 2Z02A 3VUIA 3LM5A 1AGWA 5K3YA 4DFXE 3GQLA 2VNWA 3I7CA 4XEYA 3WF9A 4JR7A 3RK5A 1T45A 2VTJA 4GU9A 3RK7A 2CPKE 2EXEA 5EM7A 1ZAOA 1Q8UA 1C7YA 3PY0A 1NVSA 4BKZA 3CBLA 4PPBA 5JFVA 1IG1A 3A62A 4NJ3A 2QHNA 1OKVA 1TVOA 3ZXZA 5KCVA 2GHGA 3PE2A 4J71A 4W8DA 3ZZEA 4B8MA 3UVQA 3QKMA 3QYZA 2BHHA 3BYSA 3BWJA 2X7OA 3DOGA 1V1KA 4EBVA 2ITTA 1TQMA 4D4RA 3G0EA 2Z7QA 5BVNA 4O7TA 4Q7JA 2WQBA 3QC9A 5K5NA 3BHHA 3OBGA 4F6SA 4M0YA 2XNEA 3NR9A 3FZOA 4FKSA 4IX6A 2W0JA 3QXPA 3E46A 5ANJA 1KV2A 4BDAA 4R71A 2BRBA 3CD3A 5AX3A 4BZDA 2B9IA 4ANOA 3GCUA 4Y5HA 2QKRA 4DLJA 3NEWA 3B89A 3FHRA 1VR2A 2HAKA 2C5OA 4GT4A 4OTDA 4XS2A 3C0GA 5KMJA 4DA5A 3Q6WA 2ZV7A 4GJ2A 1UVRA 3PSBA 5EI6A 1UWHA 4AWIA 4XG2A 3ATTA 3PJ3A 4GH2A 4YHTA 3FZTA 5IA1A 1TKIA 2UZBA 1Q41A 3N51A 2WXVA 4I1ZA 1MUOA 2WU6A 3FJQE 5DA3A 5AR2A 4P5ZA 5CSWA 4BGHA 4DFZE 3LAUA 4RC4A 5AR8A 1OZ1A 2JY6B 5HICA 3UC3A 1BLXA 3E88A 4XRJA 4GIHA 4DHFA 5B2LA 4C3RA 4Y95A 2YACA 4J99A 3NCZA 2HW7A 1PXKA 4PMTA 1DM2A 4IAAA 2WMAA 4ERKA 5AADA 1GIIA 3ZUUA 4ASDA 4F2LA 3FMKA 3Q04A 4I5CA 5HVJA 3V6RA 3NVKI 3K5VA 4FIHA 2QOKA 4N70A 5HG8A 3KK9A 4EH9A 1ZYLA 5CZHA 5AR7A 3TIYA 5CXHA 3R83A 3ZSIA 4QP7A 5AEPA 4MBLA 3AT2A 3OEFX 2FSLX 5TR6A 2QOLA 4BCOA 1OL1A 4QMNA 1K2PA 1S9IA 1OKWA 3E8NA 3AC3A 4JX3A 2DWBA 4OTPA 4WNKA 2WAJA 2YLFA 4IXPA 3ROCA 2NPQA 3TNQB 4XG7A 2YCQA 4F1MA 1YQJA 1W0XC 2C5YA 4O6LA 1IAJA 3AC4A 4GMYA 4Q5EA 3TJCA 4EOMA 4KRDA 4JDJA 3FL4A 4FVQA 4O0RA 2CNQA 3ZM9A 5E8XA 3ZLYA 4WD5A 4RJ5A 4LGDA 2FO0A 3ORXA 3RGFA 5HQ0A 4FSMA 1FGIA 3CGFA 3VUDA 1H08A 3ITZA 3BQRA 3IDPA 4FSQA 1PHKA 3WF6A 3MMPA 2XF0A 3U4WA 1OPLA 3MH2A 3DKCA 3QX4A 1SNUA 4RJ3A 3HMPA 4FYOA 4FSUA 5EI2A 1OIYA 2VN9A 5M55A 5HNIX 2C5NA 4AF3A 2GHLA 2V7OA 4WUAA 4E3CA 1CMKE 5FM2A 3ZUVA 2GFSA 4UYAA 4LYNA 4O0TA 2XK7A 3AXWA 4E6AA 1JR3E 4FKLA 4ZTQA 4A4XA 3R9DA 4IM0A 3OZ6A 3RMFA 2G2HA 4M15A 4GG5A 4F63A 1KV1A 3Q96A 3V8WA 5DN3A 4XYFA 5CSXA 4WSQA 2J51A 4ZK5A 1PKDA 3GENA 4RFMA 4WG5A 1ND4A 5BMMA 5D11A 2ERKA 3FY0A 2X8DA 2XCHA 3IW4A 4I4FA 4BDBA 2J5EA 4X3FB 3ZEPA 4AQCA 4PV0A 3UIMA 2UZVA 3QTXA 2JZ0A 3OUNB 1MRUA 3ALNA 3D7TB 4Y5QA 4KNBA 3OD6X 3HKOA 3D0EA 2PZ5A 3MS9A 4U43A 5M57A 4BR3A 4F7LA 4U42A 2Y4IC 4YLJA 2KULA 4O96A 3TJDA 4H1MA 1VYZA 4BIEA 2E9OA 3G9NA 4YNEA 3RAHA 2OH4A 2XEZA 2A1AB 3OF0A 3K9PA 3BCEA 3R2YA 4E8AA 5HTBA 1RW8A 3K5UA 2VGPA 4LOPA 3VO3A 4BIDA 4FZFB 3L8PA 2WMTA 3QWKA 5IU2A 2ESMA 3KXHA 2ZM1A 4J98A 2BIYA 2OBJA 2OW3A 3IKAA 3NW5A 3R73A 4I6HA 2DKLA 3NIZA 1KE6A 1U54A 5DG5A 3ZFYA 3REPA 2VU3A 4UMUA 5EKNA 3BZ3A 4RFZA 2YEXA 2ZB0A 1U5RA 4RVMA 4XP0A 5DEWA 3UYSA 1Z57A 5JFWA 2VTTA 4NCTC 4IFGA 5AP7A 5HNBA 2ZAZA 4KUJA 5EFQA 3R8LA 3ERKA 1T43A 2W1EA 4FSZA 4NTSA 2PVLA 5HBEA 3ZRLA 2WTKB 4F1IA 3PXZA 4LMUA 1YWRA 3B8QA 4G6LA 3TM0A 5HO8A 1FPUA 3CS9A 2PUNA 3WZDA 3NYVA 1YVJA 3A99A 4AU8A 2JDVA 3VNTA 3VW6A 1U54B 2OJJA 2W7XA 3R1SA 4FYNA 3V51A 4EK3A 3BYMA 4C4IA 2UW9A 3LMHA 1VG5A 2WQNA 2QLQA 4O7VA 3DY7A 3KF7A 3EOCA 4LRMA 4R5YA 4RLLA 4AE6A 2R0IA 4E6DA 3JR1A 2P2HA 2OO9A 2OFVA 3NSZA 3VULA 4O2PA 3DXQA 3KREA 4LRJA 5M4CA 3EWHA 3HUBA 4M14A 1M52A 3FSFA 3HZTA 2YIYA 4CXAA 1BVSA 3DJ5A 5DH3A 3HDNA 3KULA 1VEGA 5ANDA 1SZMA 3LXLA 3PA3A 3BEAA 1ZOGA 4I5MA 4F1OA 2RGPA 1OMWA 1NV9A 4PPAA 2XIRA 5T3QA 3TG1A 5HESA 1B6CB 4D2VA 3ZFMA 3FKNA 2BAQA 4I20A 4MHAA 3ZCLA 4L3PA 3LCUA 3O17A 4KBAA 5C4LA 4FKOA 3DU8A 4FTLA 4QP9A 4MQ1A 3N4UA 3IO7A 4QMLA 4CG9A 2OJGA 4KKEA 3DLZA 4F99A 2G1TA 2X4ZA 5IDPA 5AAFA 5K0XA 5TKDA 3PA5A 4PTCA 4GL9A 4A4OA 4OR5A 3KULB 2OXDA 5IA0A 3GU5A 2WMVA 3PSCA 4BN1A 5M4UA 4AN9A 4HEOA 5KX8A 3NUAA 5C8MA 3LKMA 1UNHA 2XM9A 4PTEA 4LUDA 4PUZA 5DI1A 1OKSA 5DRDA 3PVBA 5HCYA 2XCKA 2CKPA 3TNWA 3U9NA 4FIFA 4EHEA 1R4GA 3GEQA 3GFWA 3SHEA 2FVDA 1IFYA 4AOJA 4JNWA 3QTQA 3OY1A 4GV1A 5CSHA 5HE2A 5BVOA 2XEYA 4FT0A 3R8VA 3TKHA 3HAMA 2C68A 2CGXA 3PVGA 2J5FA 3SXFA 4OAVB 1R1WA 3DNEA 3OUKA 2LAVA 2Y9QA 3GT8A 2OXYA 5EYCA 1WAKA 4MWIA 5LARA 1YI4A 2JKQA 1UKHA 4U6RA 3UG2A 1XKKA 4F65A 3LFNA 3NRMA 3UZRA 2UW5A 2RRUA 2CKQA 3R7GA 3UVPA 5EQEA 4WKQA 3TN8A 4L42A 1NVQA 4YZMA 2R0UA 4FKJA 5AM7A 2HWPA 5AX9A 2R3PA 4GFOA 4Z7HA 4CFXA 3HVCA 4X2NA 3FZSA 5CF8A 1QZEA 3R2BA 2OZAB 4DH7A 5EI8A 1REKA 4RIXA 4XP3A 5HE0A 4I0RA 4JAJA 3UGCA 3QZFA 1ZMVA 4IC7A 3AT3A 3SKCA 2MJ5B 1JWHA 1XBAA 2FYSA 4OBPA 4QMXA 4Z9LA 3PYYA 4D28A 3VVHA 2XNBA 3LFSA 1YXVA 3FUPA 3QWJA 3EN6A 3SXRA 2YM5A 4UMRA 1A06A 3H9FA 3C50A 5ANEA 4IAZA 2P3GX 2LVNC 4WNMA 5CTPA 4D4VA 5J1VA 4EQMA 3VS7A 2VWVA 4UY9A 4XX9A 3KK8A 3FL5A 5K5XA 3ZS5A 3BBWA 4FEQA 5EKOA 4ZSGA 2GNLA 3R04A 3RPSA 3ENMA 4APPA 1SNXA 2LGCA 4YJQA 3W2PA 1E1VA 2GFCA 2YIQA 4GG7A 4JXFA 2FGIA 3C5IA 5DRBA 3CLYA 3DJ6A 4AW2A 2X0GA 4H1JA 4YBKA 5EM6A 5AA9A 2H96A 2CNUA 3GLIE 4RIXB 3A7IA 1FVVA 4O6EA 2K9DA 2XKDA 4M13A 4QRCA 2QVSE 4EOJA 4S2ZA 3KKVA 3EJ1A 4NM3A 1KWPA 2GU8A 4O91A 2UW7A 3BU5A 3O8UA 3FYKX 4ZLZA 3FBVA 3O71A 5HORA 5CVFA 3FMJA 4GKIA 2HWJA 4XG8A 4A9TA 4C36A 1ZYDA 4BCFA 2RFSA 3D2KA 1SG9A 3OXTA 1LP4A 3KXGA 5EQPA 5TO8A 5L2IA 3OXZA 3M2WA 1OQYA 1ZZ2A 3NYXA 4FTCA 4ASXA 2KNAA 4RIOA 4FSRA 4RIWA 1IA8A 1YDRE 2PVRA 3UBDA 4NW6A 2ITVA 3C13A 5DVRA 4BZNA 2WTIA 3UZTA 2R3HA 3IDCA 3Q4UA 3DTWA 2XIXA 3T9IA 3BE2A 4C61A 4CCBA 4O21A 1P2AA 2XRUA 4G3FA 4IACA 4JG7A 3COKA 3QAME 5I9VA 2JZ1A 3RM7A 4AOTA 3C9WA 4QMUA 4V01A 2BCJA 4O84A 2PVKA 1DAWA 4TNDA 5AUWA 1R0PA 3UOJA 2YIRA 2JGZA 1IR3A 4RFYA 5DT3A 2IVSA 5K0KA 4BDFA 4G3OA 4C4EA 3BV2A 5LOHA 4ACDA 2BRHA 4OTGA 3VBXA 2EB2A 4FX3A 2JBPA 4HNIA 3R7IA 1SM2A 2R4BA 1Z5MA 4F9WA 4ORKA 4G6NA 3AMBA 3C4FA 4GEOA 1AQ1A 1ZYJA 3KL8A 3HECA 3L9NA 3Q9XA 4HGTA 4RIWB 3HMOA 4OTWA 5CT0A 2PE1A 3KXXA 2CCHA 4QD6A 1OKYA 3KEXA 2CGVA 2RFDA 4MXCA 4RIYA 4J7BA 3UP7A 4C02A 1AD5A 4PF4A 3VUKA 4RWKA 1SVHA 2BDJA 3TV6A 4H05A 2LTUA 2BKZA 3BELA 3Q2MA 4G5PA 4PMMA 2ZTCA 3NDMA 3RVGA 3KY2A 3BHYA 5F4NA 5FUTA 3PPZA 3R8ZA 4C0TA 4R78A 3C1XA 1JSTA 2BILB 4RWIA 4ZZMA 2IZTA 4BCHA 4O0YA 5EK7A 3A7GA 4HW7A 5J95A 2DAGA 1LEWA 3E64A 4IX5A 4TWCA 4L68A 4YJOA 1NV8A 1PKGA 2UZDA 1JVPP 5EYKA 4E7WA 2XK4A 2C5XA 3OCSA 3EQHA 5CU3A 5M4IA 4KKHA 4HVDA 1QPDA 1OUKA 4F0FA 1H26A 2C6DA 3NUPA 2VX0A 5LMBA 5M08A 4YNOA 3LJ1A 1GZKA 2BMCA 3LHJA 4OTRA 3I79A 4QTDA 2QO7A 3MV5A 4RIYB 5BYYA 5CU4A 2W1DA 3FQHA 3OROA 4TYEA 4KS7A 3SAYA 2WELA 2WQEA 4BCGA 2IN6A 2VTOA 3PXRA 3OT3A 4BTKA 1EH4A 3GOPA 3RPRA 4YR8A 3MTLA 2W17A 2YIXA 2OICA 4L7FA 3ZTXA 4TYGA 2B53A 4U7ZA 1S9JA 4YZ9A 2VWZA 3OT8A 4G9CA 3R7VA 4D2WA 1PYXA 1Q02A 5G6VA 3P23A 5GIPE 5KMMA 4QP8A 3DFCB 3QBNA 1OBDA 4L43A 5GIOE 1P3QQ 3AGMA 1IM2A 1OL2A 4Y46A 4AW0A 4FSYA 1Q5KA 4I6BA 2GTNA 3AC8A 5CS6A 5E92A 3WZEA 3QALE 5FXRA 2ZJWA 1B39A 3RJCA 5LMAA 3DZOA 5KMKA 3QRKA 2WMBA 3BYUA 4FT7A 2XNOA 1OIQA 4FG7A 2R7IA 4NIFA 4R7HA 5HLNA 3R22A 4MF1A 5IF1A 1WVWA 4YTFA 4Z3VA 2W06A 2O63A 4FKQA 3MB7A 5KZ0A 5HIDA 3UG1A 2HZ4A 4CZTA 2E9UA 5I4NA 2UVXA 3G51A 3WF5A 2HENA 2QC6A 4BI0A 4CFVA 2RL5A 4W9WA 1LUFA 3SGCA 1BUHA 3UVRA 3R7UA 3ELJA 4NFMA 3G90X 4FL3A 2UZNA 1BL6A 1PMEA 2YZAA 3E93A 3P7CA 3S0OA 1DV0A 1OL6A 3Q52A 3C7QA 4BDHA 2PMIA 2VTSA 4RJ4A 4PDPA 4F4PA 5M4FA 2JLDA 3ZRKA 5IH6A 4FBXA 4NIFB 4W4WA 3LCVB 4I93A 3P5KA 4O7LA 1HCKA 1H27A 4PY1A 2UZLA 2CLXA 5D9HA 4C58A 1JQHA 5FEDA 1WBWA 4KINA 4J52A 3SRVB 3V5QA 4FTRA 4N6ZA 3VBWA 4O1PA 5LQFA 3NAYA 4C4JA 4CMUA 2UV2A 3PPJA 2X7GA 3P0MA 2BVAA 2VWXA 2W4KA 3A7HA 2XYUA 2ZMDA 5KMNA 3VS4A 4F9BA 2C69A 2WTVA 4DTKA 3HRFA 3CSVA 3V01A 3RK9A 4PPCA 3OHTA 2OK1A 4CT2A 3MVLA 2YDJA 4F7JA 3Q9YA 5CVHA 4PNKA 3F92A 3OW3A 3NPCA 2CKOA 3PDTA 2YIWA 3SX9A 3FI2A 2IZRA 1ZRZA 3KXZA 4EQCA 4DEDA 3OBJA 4DCAA 2I40A 2VRXA 3VRYA 3OW4A 3P7AA 4U97A 3QCYA 3F7ZA 2G2IA 3NUSA 1YWNA 3FZ1A 3ZO1A 4HYUA 5JFXA 5BUIA 3BLHA 1YXTA 3TTJA 4C3FA 1ZYCA 4ZIMA 1NY3A 2FA2A 4DGNA 3IPHA 4QQTA 3DZQA 3H0ZA 2XP2A 3WYYA 5JGBA 4C57A 5E8YA 1OVEA 4L6QA 3TNIA 4QMWA 3OOMA 2UW8A 4Q2AA 5CI6A 4YSJA 5IA4A 5IMXA 2I0VA 3MSSA 5FRIA 2JD5A 3HRBA 4UXQA 3UNZA 3U9CA 1W98A 2ERZE 3GLGE 1G8SA 2PVJA 5DYJA 5CU2A 4JDIA 2I6LA 4KIPA 2JDSA 2KTYA 3BRBA 4IWQA 4KSPA 1BYGA 3QZHA 4MXZA 4PMSA 2YCSA 1JKTA 2VTLA 5CNOA 2QOBA 3TCPA 5IQGA 3PRIA 3AMAA 3G9LX 1JSVA 1Q99A 3A4PA 4YTCA 2BTRA 3MFUA 5AR5A 3T6PA 4ACHA 4FR4A 2ITYA 2A27A 4YPDA 4Z55A 5EQYA 1OECA 4LV8A 3R6XA 1OB3A 2JEDA 4J1RA 4LOQA 1Q62A 4FF8A 3V5LA 5J7BA 1WBOA 3EFWA 3KRXA 4RX7A 5ICPA 4AT5A 2PYWA 3H9OA 3MPTA 3U87A 4HYHA 2PZRA 4TYJA 5A4TA 4R3PA 1MN3A 4UN2B 1JKKA 2CGWA 4ACCA 4CKJA 4EJNA 4YZBA 3RBWA 3IW5A 1OPJA 2A19B 1F5QA 4G6OA 4ITIA 3KU2A 4YMJA 4FKPA 3P4KA 4XOYA 2UZTA 1IASA 5HI2A 2RFNA 4ZMEA 2X81A 4BDGA 4FG8A 4E6CA 4XG3A 5J7HA 3BQCA 2OZOA 4YZDA 3GLFE 3DK3A 3LFEA 3FLYA 4KA3A 2BUJA 1OBGA 2VD5A 2QI8A 1WZYA 1IEPA 4FTAA 2YAAA 2C6IA 3F3TA 3ORPA 4DH8A 1JPAA 4ACMA 5FDPA 3DAEA 3ORNA 2YFXA 3KMWA 2R3JA 4OT6A 5IQCA 4RRVA 4C62A 4EH6A 1TR8A 4CG8A 2GMXA 3EHAA 2I0HA 3NYNA 4ZTHA 3RI1A 5J9LA 3O8PA 4QMOA 2F7XE 3EQCA 3FSKA 3IECA 1JAMA 1E1XA 5DBXA 1GOLA 3EN5A 3O51A 4HOKA 2EKFA 3C4CA 4MVFA 3V8SA 5E91A 1SVEA 5J8IA 3HV3A 4BI1A 2YM7A 3Q60A 1MQ4A 1XBBA 1MP8A 3ZFXA 4NCTA 4MXOA 3FQEA 3PY3A 5GJDA 3OWKA 2C0TA 2OFUA 4KD1A 4C8BA 3QTRA 2ZB1A 4FODA 4JX7A 4FMQA 1J7IA 5CASA 3FLWA 4APCA 1L3RE 3SW4A 5B0XA 5BPYA 2EXCX 3MFTA 4R7IA 3UIXA 4AN3A 3OP5A 3HV5A 5HE3A 4RX8A 3C51A 2W1FA 4AFJA 4D9TA 3QZGA 1K9AA 3F2AA 3C4EA 4RZVA 4BBFA 2JKKA 1F3MC 3UOKA 4MXYA 2C5VA 2MGWA 4XRLA 5H3QA 3KRJA 3ANRA 5CVGA 5FBNC 5C03A 3RPOA 2AUHA 3ZDUA 3ULZA 5HD4A 2BZHB 5A9UA 2YWVA 3LLTA 1Q8ZA 3PWDA 5BVEA 4FE2A 5CEPA 4PMPA 1PMNA 2QKWB 4GT5A 4YPSA 5FBOA 1Q3WA 2B9FA 2XVDA 5AUVA 3E62A 3RINA 3BHVA 3DAKA 4RJ7A 4FKIA 3FLQA 3RZFA 1CSNA 4G2FA 3WIGA 2C1BA 2IG7A 5D12A 4LGHA 4II5A 2AYPA 1Q3DA 4Q9SA 4YTHA 5JFSA 3F5PA 4C4FA 5ETFA 5HLWA 3DXNA 1XO2B 3FV8A 3MB6A 4IM3A 4BBEA 3EN9A 2BAJA 2PY3A 2XA4A 4PX6A 5GZ9A 3W55A 2G15A 3IGOA 2OU7A 3QGYA 3Q4ZA 3QFVA 4BCQA 2ZDTA 2XJ2A 4IQ6A 2X9EA 1ZY5A 2DAMA 2UUEA 3NUNA 3ZRMA 4UMPA 5EOLA 2W5AA 3A8WA 3ZH8A 1OUYA 2HY81 4AAAA 4BRXA 4KAOA 4OT5A 1BKXA 2IW6A 4QPAA 4NTTA 2GS6A 3QLGA 5HBHA 1CUKA 4IX4A 1YKRA 4S33A 3R8MA 3K3JA 3DK6A 2A0CX 3ZZWA 4AZEA 2HOGA 4LL0A 4FEUA 3C4XA 5CF6A 3CJFA 4PL4A 5M09A 4QQCA 4A7CA 4WNPA 3QRUA 4AA5A 4EOOA 4FV9A 3MVJA 3QGWA 5AP4A 3RTPA 2H5XA 4DEHA 5HGIA 5LMKC 3QL8A 4ZZNA 3HYHA 3LVPA 4EQUA 3ZO3A 3NUYA 5DR9A 4O27B 1WVXA 3KMUA 3ZMMA 1PYEA 4AS0A 4AG8A 2BDWA 4OW8A 1ZWSA 4QP4A 4FV1A 5LXMA 1RQQA 3DBQA 3LFDA 1UU7A 3NAXA 3ZHPC 3S95A 3PRFA 4FOBA 3IHPA 2A4LA 3FY2A 4TKSA 4XLIA 4ANLA 4ZMFA 4I0TA 5CQUA 4YSMA 2BZKB 4LI5A 3SDJA 3NNUA 4D2PA 4DGOA 5M56A 4FGRA 3W16A 4RQKA 4WSYA 4EH4A 4BKJA 5DFLA 2R9SA 3GC0A 3FPMA 1M2RA 3CPCA 4NU1A 4F64A 5FTGA 3OC1A 4I21A 4M68A 2GS7A 1Q97A 2XZSA 2BHEA 3E92A 3MPAA 4J8NA 4YGAA 4CYIA 4UMTA 2W5BA 1KOAA 2XBAA 2VUWA 2QG5A 3MN3A 1M17A 3MBLA 3O8TA 4R5SA 4RLKA 3S4QA 1XH9A 4F9AA 4MTAA 4DG0E 2HY0A 3DB8A 5EYDA 4L3LA 3G2FA 4FT9A 4O22A 3VUTA 1OKZA 1WJ7A 3CY2A 4ZTLA 5IEXA 4FKUA 2VNYA 1Z9XA 3QTWA 4NJDA 3RP9A 3BE9A 3PVUA 5C01A 4WBOA 3BU6A 1H8FA 2CSNA 1Y8GA 3D5XA 2CWBA 1G8AA 2AC3A 2HW6A 2VTRA 3GLHE 3FZRA 2H9VA 4NH1A 5EHYA 5AR3A 3TDVA 3WYXA 4FUYA 2Q0NA 5IKWA 1KE9A 3QC4A 3VBQA 3U4UA 4FL2A 3JYAA 4K18A 4OBQA 4V05A 3PXKA 2I7QA 2O8YA 3VQHA 5IQIA 2XKCA 2NP8A 3GVUA 2J0MB 4HNFA 1V0PA 4H3QA 4DEIA 5KNJA 3LXNA 3DBEA 4E26A 5HOAA 3WOWA 2J9MA 2SRCA 4DT9A 2XK8A 1OIUA 3NNVA 1GO5A 4FNYA 3VF9A 2UVYA 3Q3BA 4S32A 1O6LA 3VS6A 5C8KA 2BDFA 3EQDA 3VS3A 4WP2A 4L3JA 4I24A 1U46A 2J90A 2O65A 4RWLA 3TV4A 3H3CA 2X9FA 4G1WA 4UZDA 3TKUA 4D58A 3CR0A 1PXIA 3KFAA 4JBQA 2GNFA 3ZBFA 5C26A 4J95A 2ITPA 5KZIA 4IC8A 3ZLSA 2I1MA 3R02A 4ASEA 1Q8YA 2V0DA 3ZLWA 4G3GA 3ZXTA 4LOOA 4FZAB 2X8IA 3W18A 4ZLYA 5HHWA 4RGJA 2PUUA 3LZBA 3K9OA 4IADA 3H30A 5HEZA 1Q4LA 4KIKA 3EL7A 4O82A 5KKRB 2VX1A 5AUUA 3P86A 3RPVA 4HGLA 2C6OA 4G5JA 3R28A 1T6OA 4FKWA 4BHNA 3F7WA 3ZSGA 2WHBA 4XNEA 4E5WA 4EONA 1ZXEA 2R5TA 3VS1A 3VJNA 3WBLA 4B9DA 1XH8A 3VUHA 4WT6A 2YAKA 2XM8A 5GHVA 3LCDA 3M1SA 3R9NA 3TWJA 4DGGA 1I09A 3W1FA 4K33A 4D1SA 4D5KA 3A7FA 3II5A 3WILA 5JH6A 1KOBA 1PMVA 3QX2A 4K0YA 4CV9A 1Q61A 2VX3A 4L01A 4NKSA 2W96B 4TWOA 3UMXA 2BPMA 4R3RA 3ZU7A 5CEMA 2VTNA 5FXQA 1SYKA 4MBJA 3O2MA 4O0XA 2P4IA 5HNGA 5KO1A 4JL9A 4UX9A 2OO8X 3TEIA 3UYTA 4QO9A 2PZPA 1M2QA 2F2UA 3GCQA 4TXCA 4EOSA 2Y7JA 3R7EA 2G9XA 3LQ3A 2BTSA 3U55A 3AD4A 2BRNA 3ORZA 4YJRA 4FT5A 3E8DA 3ORTA 5L6OA 4KIOA 2JNHA 4MX9A 2W1IA 3P08A 3QD3A 3ZC5A 4Y73A 3E8CA 4NYEA 1O6YA 3MH3A 3QHRA 4MD7E 3TIZA 4ASZA 4L45A 5A3XA 3C0IA 5F94A 2WQMA 3LCKA 3D2IA 4X2JA 5E8WA 4EWHA 1IAHA 3BIZA 1V0OA 2YITA 2VTMA 1YW2A 5HIBA 5AUTA 4HVGA 4USFA 5I0BA 2X4FA 3COHA 3UO6A 2BWEA 4AXAA 3U54A 4GK4A 3ZO2A 3L8VA 2JFLA 2LVOC 3LE6A 5DFPA 4W4VA 4HCUA 4HGSA 1OGUA 2OOAA 4ZY5A 4CEGA 4C33A 1XB2B 4BCJA 2WQOA 3NLBA 4YC6A 3IOKA 4IW0A 1DS5A 4AGCA 2DQ7X 1FINA 1JNKA 4FTUA 3AD6A 3DNDA 3POOA 3MY5A 1JKSA 4CKIA 4IB3A 2BZJA 3EQBA 4BC6A 4NSTA 1XH5A 3A8XA 3NUXA 1UU8A 3FLZA 3FRHA 2H34A 2ITWA 3PP0A 3Q53A 5L2QA 3C0HA 3F5UA 4DF3A 3WZKA 1PF8A 3E21A 4S34A 1J3HA 4CT1A 2W05A 4CRSA 4D2TA 4A07A 4G3DA 3MIAA 4FK3A 1U59A 2EB3A 3PG3A 4FIIA 3ULIA 3SW7A 3EKKA 2C1AA 3BGPA 4YC3A 4XCUA 3BU3A 5CWZA 3JY9A 5HCZA 4YURA 4E20A 4FTNA 4NWMA 3EFLA 3FC2A 1VJYA 3PWYA 4O7NA 3G6GA 4I5PA 3MI9A 3VAPA 1PRYA 3PTGA 4LM5A 2DNAA 4GYGA 4BCMA 5F9EA 1DO0A 3R0TA 2JDTA 5IISA 2GTMA 3V5PA 2JAMA 5IUGA 2JITA 4DT8A 3PXFA 4PQNA 2BFYA 5F95A 5JGAA 4E5AX 3GU8A 4G31A 3RALA 3VJOA 3VS0A 4BYJA 1G41A 5AP2A 4BCKA 3ZYAA 3BGZA 3ENHA 2C6MA 4HPTE 2ITZA 4B99A 4B8LA 1XWSA 3GOKA 4Q9ZA 2YZLA 2VZ6A 2OF2A 4U9AA 3ORIA 4FKGA 3F6XA 5DE2A 4UWBA 4TL0A 4I92A 1U4DA 1ZARA 4JAIA 3RHKA 5I3OA 3TZMA 3U6JA 5IQBA 4QMMA 4QP6A 5HLPA 4YJPA 3DQWA 1GJOA 4DBGB 3I0QA 4E93A 3OEZA 2BAKA 4EOKA 3KB7A 4U0IA 4LV5A 2XH5A 4GUEA 3A4OX 4QP3A 2B9JA 4IZ5A 4NFNA 3QD2B 5AAGA 4DTBA 4TYIA 1BX6A 2JUJA 4IIRA 2Z2WA 1GZOA 4U41A 5BVDA 5IEYA 4AUAA 4PL5A 3AC5A 3LIJA 4LGGA 5DNRA 1U5QA 5E4HA 4KKGA 4CLJA 3VC4A 3N4TA 4FTTA 4Y8DA 1UNGA 3DPKA 4NT4A 4FEVA 4JRNA 4N57A 3D7ZA 3F2NA 3FAAA 3K2LA 4JIAA 4L67A 3QQKA 4X3FC 4DFNA 4DEGA 2AC5A 3MYGA 4BTFA 1WBVA 3R63A 2ONLC 2XBJA 2F57A 2RF9A 4PDSA 3UIBA 3E7VA 3GBZA 3L8SA 3PJ2A 4EK6A 4O7RA 3EMGA 4QP2A 5FD2A 5ANOA 1YRPA 3L8XA 4L9IA 1CDKA 5JQ8A 2VO7A 4TRLA 4DCEA 1R0EA 5BVKA 2J6MA 4HGEA 4JQ8A 4RVKA 2Q0BA 1H1QA 3AD5A 1R3CA 4TWNA 5CY3A 5DHJA 2GS2A 4ERWA 3LCOA 2DAEA 3FPQA 4X3JA 1O9UA 1NXKA 1DAYA 3LQ8A 4KABA 3PA4A 1PMUA 3EQGA 1Q8WA 3W2RA 2W4OA 4FNWA 3G5DA 3HRCA 1BI7A 2OIQA 3PIZA 2C3IB 4KWPA 5IA3A 2X1NA 3MA6A 2QR7A 5CYIA 1GZNA 3CKXA 2PULA 4FT3A 4FTJA 3H9RA 4FIGA 4B0GA 4FUXA 3RNYA 2PTKA 2JY5A 3GI3A 4D1ZA 3O0GA 3EZRA 3PP1A 4N6YA 3RWPA 2WTKC 3GXLA 1PXMA 5G1XA 4M97A 4K11A 2IVUA 2WB8A 4FTMA 4JG6A 1YHWA 4HCTA 4W4YA 3UIUA 2BRGA 2XIKA 3OWPA 2MROB 5HTIA 1FVTA 2QO2A 2WZJA 1CM8A 4L46A 3BEGA 5EYMA 4CFNA 1SVGA 4IAKA 4O7WA 1WBTA 3PY1A 3UPXA 5AP6A 2XUUA 2GSFA 5I9UA 3HMNA 1CKPA 4JBPA 4X2FA 2YM8A 4DN5A 4FL1A 2QHOB 2GNHA 4Z16A 4FV6A 2PL0A 3BV3A 4CQGA 4F08A 4DE4A 3VQUA 2JDRA 2EJSA 2R2PA 4USEA 5IH4A 4YJTA 5CI7A 5IQDA 4HYSA 1YI3A 5H8EA 1NVRA 3O50A 4U40A 5DMZA 3EKNA 2W1HA 3FMHA 4RVLA 4M67A 5FLFA 4G9RA 2YM3A 5CAQA 3UDBA 4RWJA 4X6RA 5ANIA 2O5KA 3GCVA 4L00A 2XJ0A 2F49A 4H36A 3PXQA 4IH8A 5E8VA 5CAOA 5JKGA 4LG4A 3KXMA 2HXLA 4FKVA 1OAIA 2OGVA 4FIJA 3RHXA 4A9UA 4F6UA 4QYEA 3LW0A 3W33A 5FQDC 4EH7A 4BWXA 2OOBA 4DEEA 4XBUA 4TNBA 4ANSA 2IVTA 2B3TA 2PZYA 4S30A 1MRVA 1R78A 4I23A 2G3QA 2CP8A 4DH5A 4HPUE 5JRSA 3UJGA 4KBCA 4IBMA 3HAVA 2YA9A 3B8RA 4C3PA 4CFFA 2C0IA 4GCJA 4D2RA 4NKAA 3RAKA 3ZONA 2VO3A 2VTHA 3Q5ZA 2YM6A 4H3BA 4A06A 5H9BA 2CN5A 3ZBXA 4GSBA 3TI1A 2UVZA 2VWWA 3BGQA 3EZVA 4TN6A 1VDLA 4ZJVA 5ACBC 4U3YA 2KHHA 3L9LA 1URCA 2FSMX 3SXSA 3MA3A 3LFBA 3QRIA 2J0KA 4GYIA 4IMYA 4J53A 4EK5A 2QO9A 4FI1A 3R9RA 2QOCA 2W1GA 4QMZA 5AV4A 4BDJA 5GINE 4L8MA 5AP0A 3ZM4A 4BKYA 4EC8A 4BL1A 4XP2A 3HA6A 4IDVA 3TXOA 3UQGA 3FYJX 2WTWA 4D4SA 3WE4A 4AZWA 3GU6A 5AWMA 3BYVA 3CD8A 3I6WA 3IS5A 2OF4A 4UZHA 4AP7A 4FTIA 4YUQA 2XRWA 3DBFA 3IW7A 4BWPA 2VWYA 5B2MA 3NGAA 3OWLA 2VO0A 2NNWB 4IWDA 3KRLA 3QUDA 5JZNA 2B54A 4IE9A 2W1CA 1FQ1B 1XR1A 5EM5A 4YLKA 5IZFA 4B4LA 2JFMA 3V04A 4DGMA 5AUXA 5CEQA 4ALVA 2X8EA 3KXNA 5KHXA 3TZ7A 4I6QA 3EFKA 1J7UA 5IUHA 5JZJA 2C6EA 3NW7A 5HO6A 5KUPA 4C38A 3W2SA 3ZOSA 4EKKA 5B2KA 4FK6A 1DI8A 3C4ZA 3DB6A 2WO6A 5B7VA 4W9XA 3RAWA 3W8QA 3NMUF 5H8GA 3A61A 2UW0A 3FZPA 4R1YA 2E2BA 2HZIA 4QYGA 3BYOA 3QZIA 2XJ1A 5T6KA 2G01A 3OWJA 2CJMA 3KN5A 3NCGA 3D4QA 2C3KA 2Y4PA 5GJGA 2CGUA 2QU5A 3QUPA 4LUEA 3LPBA 3SQQA 2R3QA 4OGRA 4I4EA 3EYHA 3MJ2A 4UMQA 4JI9A 4WA9A 5AP1A 3TNPC 3E3BX 5IA2A 3ID6C 1ZV1A 4IAIA 4XV3A 4RPVA 4P2KA 4ANNA 3OG7A 2QONA 4U5JA 2UW3A 4IFCA 1JLUE 1PGYA 1XHAA 1XH4A 4F6WA 3QQJA 3U6HA 3NZ0A 3SA0A 3OY3A 3PPKA 3MH0A 3JY0A 1APME 3GU7A 4IWPA 2HELA 4O0UA 5CAVA 5I9WA 3F61A 4E6QA 3AOXA 3LFQA 4BBMA 4JT3A 2E9PA 4C34A 4G34A 4HYIA 1ERKA 5FP6A 5ITAA 3WI6A 4CMTA 1M14A 1ZOEA 3EYGA 4C7TA 4F9YA 1YLAA 3PUPA 4JOAA 5EW8A 4ZLOA 3PJCA 2GNIA 4I5HA 4XG4A 4L52A 2VO6A 1JKLA 5HBJA 3KN6A 4TY1A 3VS5A 1P14A 2WMQA 3JVRA 4U81A 3KRRA 4KBKA 3TUBA 4O2ZA 2X2MA 3ACKA 3BLRA 3MY0A 4AA0A 3DXPA 4EORA 4ZXTA 3OVVA 5BVWA 1DI9A 3MY1A 4GT3A 3IW8A 1M7QA 3DDPA 4IAFA 3PIYA 3FI3A 4XV9A 1KE5A 5L8LA 2HIWA 1YXXA 4O7YA 3U51A 3ANQA 4A9RA 4ZOGA 3CCNA 5A4QA 5JGDA 2ITNA 4CSVA 2VGOA 3IDBA 5AP5A 2ITUA 1RDQE 3F2RA 4QMVA 3U8WA 2CN8A 2ZV8A 3C4WA 5DOSA 2VWUA 1SMHA 5HVYA 1G5SA 1Y91A 4AX8A 2YLEA 3F82A 2CNVA 2K0BX 2XIYA 3AQVA 4WRGA 1STCE 4G16A 2C6KA 3ORMA 1PXJA 3R7YA 5CF5A 1VEJA 2VWBA 4NL0A 2R3FA 3EH9A 2WEVA 1IXSA 3R21A 4MAOA 3SOCA 3QYWA 4NUSA 5IA5A 3BBTB 2QOFA 3MIYA 4O1OA 3C5UA 2FSTX 4HVHA 5BUJA 4FV5A 4BTJA 4JBVA 4ZJIA 4BCIA 2X2LA 2OKRA 3GU4A 4JDKA 4O38A 5DR6A 3FXZA 4AZTA 2P55A 5AIKA 3CTHA 2WTDA 3HV7A 4USDA 4QTCA 4FV4A 4C2VA 4QNAA 5A6OA 1J7LA 2HCKA 2OLCA 2QG7A 1UV5A 2ZMCA 3EQPA 1XQZA 2CHLA 2JKMA 2BFXA 2OI4X 3Q4TA 2QURA 3QRJA 2PK9A 2ZV9A 4I6FA 4C4GA 3IG7A 4U3ZA 4QMQA 4EZ7A 1OIRA 2OH0E 2Y4IB 4EH5A 2QHMA 4O0WA 2PVYA 3Q5IA 4BTMA 2GCDA 1BI8A 3CGOA 3D5UA 2H6DA 3A60A 3LQ5A 5EDRA 2VTPA 1KSWA 1Y57A 3KRWA 3QXOA 4IAYA 2R3NA 3Q6UA 3GC9A 4JJRA 1W7HA 5ETAA 4MNFA 4EYJA 4BI2A 1UWJA 4FOCA 3AG9A 1NT2A 1XJDA 2ZVAA 4XHKB 2OJFE 2WTCA 4QTBA 1A5TA 5L2WA 1MRYA 4FKTA 5EG3A 2NRUA 3R9OA 4E4LA 4MXXA 4MD8E 4X2GA 4IB5A 3QQUA 1ZZLA 2LVPC 1GZ8A 1PXOA 4ITJA 4ZTSA 3UODA 5KBRA 3W10A 5M44A 5IQAA 4GFMA 4UWYA 2R3OA 4L53A 1GIJA 4TYHA 5A46A 1UFZA 1A9UA 2VAGA 4EOPA 2Z7RA 4YO4A 1VQ1A 2Z60A 3HX4A 4OLIA 1KUTA 1QCFA 4C37A 5L8JA 4MH7A 1GNGA 4AW5A 4ID7A 4EH8A 4CNHA 2EVAA 4DBNA 1TQIA 3DCVA 4AACA 3QA8A 3P9JA 4HVIA 5E8ZA 3CJGA 3TACA 3WF7A 5A4EA 4XG9A 4I22A 4XLVA 2YN8A 4GK2A 2WOTA 3V5TA 4FZ6A 4I0SA 1WCCA 4Y83A 3UO4A 4W4XA 5FP5A 3HP2A 3NX8A 1UU9A 1R39A 2YDKA 4RC2A 5J9ZA 2C4GA 4H58A 4TYHB 4FEXA 2DUVA 4PL3A 3DDQA 4U80A 3NUUA 4CRLA 2YERA 1ATPE 2WMXA 4WIHA 3SOAA 1H28A 3VUGA 1YOJA 2QQ7A 3BX5A 3Q2JA 3QTIA 1DO2A 5FEQA 2LVQD 4XJ0A 2ZTDA 4BY9E 2QLUA 2GPHA 2IWIA 4ITHA 5AAEA 4QPSA 4CZYB 3MW1A 4NM5A 3F3VA 2ETRA 4NEUA 1H07A 1NA7A 3QQLA 3R01A 3R9HA 4F0IA 4CFUA 3TNHA 4JQ7A 3VWAA 4FA2A 2RFEA 1W82A 4JQEA 1Q24A 4MBIA 2ITXA 4D1XA 3BPRA 4FIEA 1F0QA 1EFUB 3CXWA 4IVAA 3CIKA 4KSQA 4DEBA 4ALUA 3FI4A 3MH1A 2IW9A 1AIPC 2ZV2A 4CFMA 3I0OA 3GUBA 2OSCA 2XKEA 3NYOA 3OOGA 4BF2A 3SVVA 5IDNA 1K3AA 3CPBA 2JBOA 3T3UA 5I9YA 3F3UA 1V0BA 5BMSA 3HNGA 5BYZA 4RC3A 2OWBA 5AP3A 1H1SA 2JY8A 2IW8A 4E1ZA 4DFBA 5HZNA 1RE8A 3ORLA 1OPKA 3F3ZA 4ARKA 3P79A 4A9SA 1HOWA 4O0VA 2HZ0A 3QUEA 5CSPA 3KA0A 5IH5A 4QYFA 2EUFB 2J0LA 2EXMA 3LXKA 4FV2A 3GFEA 1J1BA 2NRYA 2XS0A 3QQHA 5EW9A 3VBYA 4XV2A 3VRZA 3S00A 1P4FA 2QODA 3QCQA 1XBCA 5HG5A 3DJ7A 3KVXA 4D4YA 4G3CA 2DYLA 3LMGA 4E4XA 3QCSA 5FWKK 4LFIA 4C35A 2BWBA 1J1CA 3I81A 4R77A 2PMOX 4ZJJA 2PE0A 2YDIA 5T68A 3LOKA 1G4AE 4XG6A 4DGLC 3E3PA 4M8TA 3SG8A 3I1AA 2X6DA 3CP9A 4K8AA 4UEUA 5JK3A 5AUYA 3TUDA 3CTJA 3CQEA 2GDOA 5HTCA 3OXIA 2E9VA 1Y6AA 3MFRA 3UQFA 3RAIA 5L6PA 5ETIA 4Z7GA 5KHWA 3DT1A 4AZVA 3H4JA 4IZAA 4F70A 5F1ZA 3CEKA 2J2IB 3W2CA 4EC9A 4YZNA 4FKRA 4IVCA 4PP9A 5CLPA 4JBOA 5BQ0A 4FZDB 3VHKA 3GCSA 4DFLA 2O2UA 3I5ZA 4DINA 1WIVA 3DS6A 4R3CA 2RIOA 1NW1A 5DLSA 4CV8A 5JMSA 3RWQA 3RPYA 4H3PA 1WBPA 3HLLA 2QD9A 5HX8A 4U79A 5FEEA 4X7QA 2BR1A 4CCUA 4AFEA 4PDYA 5M53A 3THBA 3WZUA 4X3FA 3QTUA 2ONLA 2YISA 3L1SA 2VV9A 3D7TA 4GVJA 3PLSA 5CSVA 2W5HA 2Y0AA 4N0SA 4CMOA 3QTSA 3EB0A 1J91A 3WARA 1CKIA 2MR9A 5LVPA 3MPMA 1Y6BA 1P4OA 3LCTA 3V8TA 5JT2A 4EJ7A 1KYIA 3BBZA 5JN2A 3DKGA 5AJQA 3TT0A 4EEVA 1WR1B 1OL7A 3VUMA 2PUIA 2F7EE 2B4SB 3QD0A 4DC2A 4X2KA 4YTIA 4TPTA 5ACKA 1H25A 3K3IA 5GJFA 4FTKA 5AMNA 5J1WA 3ZEWA 1ZMWA 3D94A 1H00A 4KS8A 4CZUA 1G3NA 3R1NA 4MEDA 4OTQA 5I9ZA 2F9GA 2X39A 4BDDA 2RSVA 4GU6A 1UA2A 3EQIA 3FE3A 3GGFA 4IB0A 5A4LA 4EHVA 2ETMA 3G33A 3JUHA 3UE4A 3D15A 3VF8A 3JXWA 2L4EA 2UZOA 3AC1A 3FHIA 4DG3E 5IQEA 4E73A 1WHCA 4AT4A 2L4FA 5AV2A 2KNVA 2UZUE 2WIHA 4V0GA 3VBVA 4BCNA 4MQ2A 1KE7A 4LRKA 5DT4A 1OITA 2RG5A 2FSOX 4EOQA 4K2RA 3LLAA 5FDXA 2HXQA 2IPXA 1PXNA 1Y8YA 2PUPA 2C30A 4IANA 4EYMA 2XYNA 4DFUA 3V5WA 3V6SA 2PHKA 3LFFA 4GVAA 3GB2A 4KIKB 5CANA 4AZFA 1XH6A 2R7BA 3S2PA 2JP7A 3TKIA 5BX0A 1WVYA 3LM0A 2DENA 3KQ7A 4DYMA 3M42A 3BLQA 3DQXA 4S31A 3SG9A 3VN9A 4QYHA 3MDYA 3NWWA 5DPVA 3NIEA 2V62A 5L2TA 4RJ6A 2YJRA 2GNGA 1QPEA 5LWMA 2PMNX 4LQMA 1ZOHA 4ZSLA 2NO3A 4KRCA 4V0GB 4D5HA 1OTRA 4FG9A 1PJKA 4RBLA 4U45A 4I94A 4ACGA 3AC2A 1WGNA 1FBNA 5D10A 3GC7A 2Z8CA 1E9HA 1YDSE 4GRBA 5D1JA 4YLLA 2XK6A 1M2PA 2O3PA 4RT7A 2XNNA 5EHLA 5KMOA 3HL7A 4L7SA 5C8NA 4X0MA 3F5GA 4FSWA 3PIXA 4C2WA 4D0XA 2ITOA 3TTIA 3VS2A 3VBTA 5EW3A 3R1YA 4FNZA 4OTHA 3FC1X 2F4JA 3O7LD 4UN0C 1HJPA 4EL9A 2IZUA 2DS1A 2B55A 1RJBA 3HMIA 4FVRA 4OTIA 4YJVA 5HG9A 1MQBA 3OTUA 5E1EA 3UMWA 4B6LA 3FEGA 3PSDA 5IUIA 3LCSA 5E8TA 3DFAA 4TZRA 5C4KA 4UBAA 5J5SA 1YI6A 2OXXA 4GUBA 4LL5A 3W8LA 1X8BA 5I9XA 3GQIA 3FMEA 3IW6A 4JDHA 2X6EA 4MWHA 4AE9A 1WFCA 1CKJA 1BL7A 3PVWA 4GS6A 2R3GA 2UW6A 4IZYA 4QOXA 4Y72A 1HCLA 4QQ5A 3FKOA 4YP8A 5IEVA 2J0JA 3DV3A 4ANQA 2L2DA 4P90A 5CALA 4CGAA 4R1VA 4P7EA 4RA4A 5CENA 5M07A 3I60A 2JC6A 5JQ5A 2QU6A 4YO6A 4DG2E 5CAUA 4O7ZA 5HIEA 2JAVA 4D2SA 3OTVA 5C27A 3T9TA 5CF4A 5L8KA 2R3KA 1PXLA 4FTQA 3UO5A 4ZY6A 2CKEA 5FM3A 2H8HA 3DBCA 5HKMA 4UWCA 3HV4A 5AUZA 4D55A 4FTOA 5FXSA 4D0WA 4FICA 4IWOA 4JLCA 5M51A 3KVWA 2VTIA 2X7FA 3ET7A 3L9PA 3HA8A 4RX9A 3N4VA 4O7SA 4IX3A 4HCVA 4C59A 3FMDA 4M84A 4ZSAA 1HQYE 3E87A 4HVSA 5IG1A 5JI2E 1YXSA 4BCPA 3QLFA 3PJ8A 3UOLA 3IK3A 5KMLA 2WKMA 4G3EA 4MK0A 3ACJA 1YXUA 3QU0A 4RJ8A 4QTEA 2WIPA 3QQFA 3SV0A 5LJJA 2FB8A 2B1PA 4CYJA 4QMYA 5JEBA 5AR4A 2O0UA 3LMIA 3DTCA 4O81A 2J0IA 2WGJA 4YBJA 2OZAA 2QCSA 3D83A 2JKOA 3P7BA 5A14A 3EQFA 3FMMA 3PFQA 3TZ8A 3FDNA 4M3QA 4U8ZA 3CY3A 5CZIA 4R6VA 3EQRA 4UXLA 1JOWB 3MTFA 5TT7A 1YHVA 4AZSA 3W2QA 4BZOA 4ZSEA 3MVMA 1O6KA 3R7OA 1IA9A 4RZWA 4BDKA 3S3IA 3UC4A 4B7TA 3CQWA 2B52A 4WG3A
chains in the Genus database with same CATH superfamily
4JR3A 5TE0A 5D7VA 2WFYA 1W84A 3VHEA 4CKRA 2UZWE 3WE8A 4HZRA 1ZY4A 3DAJA 3G15A 5FG8A 2R3LA 2P2IA 2YJSA 4EI4A 2PPQA 4F1TA 4EKLA 5EDPA 4MNEA 4XMOA 1IY1A 5E9EA 3PUFC 5E7RA 3DLSA 4IBCA 5E1SA 5D41A 4FEWA 1ZMUA 2XIZA 3KFUG 4A9YA 1ZLTA 2YM4A 1E32A 2KNZA 4BB4A 3E8EA 4M69B 5I3RA 3UPZA 3RM6A 2ZM3A 2IEWA 5KE0A 4NZWB 2LVAA 4CTBA 3BKBA 4OTFA 4DH1A 3T1YM 2XNMA 5BUEA 5ETCA 3J80S 3OCGA 5DNYA 1H0VA 3QD4A 2QBYB 4MKCA 3DA6A 3BHTA 3ORKA 2UW4A 3P78A 4EH3A 2W4JA 1G3IA 4OBOA 3E5AA 5CAPA 1FMKA 2WOUA 2C6TA 1BMKA 3MVHA 1D0LA 1UKIA 3MWUA 3EN4A 2VTQA 4X21A 2VTAA 1CTPE 1H0WA 3NS9A 1H1PA 5ANGA 5KQ8A 3A2CA 1OAOC 5HE1A 3NVMB 3B2WA 1W8CA 2JDOA 4PDIA 5DYIA 5L4QA 5AV1A 4PRJA 3TWLA 4NM7A 2C0OA 3FMNA 2DZLA 1W83A 4XV1A 2CFOA 1KE8A 3O96A 4FNXA 4NW5A 1H1RA 5GNKA 1IN7A 3EIDA 4LJ9A 3UK6A 2WNTA 3DKOA 4BYIA 2C47A 2KW0A 3AMYA 3UQCA 1H01A 2EU9A 1GIHA 3DK7A 2PE2A 1YHSA 4B3MM 5CXZA 3U6IA 4EK8A 4AGUA 1PJIA 5DR2A 2XARA 4EUTA 2XB7A 4EOIA 5LWNA 3T8OA 2HWOA 4WRSA 3SLSA 3FLNC 5LVMA 2CEAA 1VZOA 4QYYA 5CEKA 2WMRA 4PNIA 2WMUA 5EH0A 3HJQA 3NNXA 3Q9WA 4JRVA 3V5JA 4BLCA 4ZTMA 3EIEA 4P4CA 4YJNA 5EHOA 3FXWA 2A2AA 5DIAA 3TL4X 2XK3A 1VEKA 4X6QC 3VKHA 3WF8A 3PZHA 5A54A 3T3VA 5KBQA 1REJA 1NJFA 4P17A 2W99B 3MJ1A 2PVMA 5L3AA 1C1KA 1GJSA 2I0EA 3UTOA 1H1WA 3QA0A 4ZS0A 5E8SA 4FVPA 4QMSA 3GNIB 3FTDA 4BDEA 3NW6A 3ZUTA 4DFYA 2YCRA 4BGGA 4RX5A 4TT7A 2BZIB 4CFWA 4IVBA 4ZZOA 4EK4A 2F2CB 2W9ZB 4EHGA 1YOMA 4UB7A 3PXYA 4YHJA 4KIQA 5K4JA 3U6MA 4RSSA 3WZJA 4IM2A 5TOZA 4C4HA 5EDQA 2VTJA 2EXEA 5ITQA 3PY0A 4PDGA 3ZXZA 2GHGA 4W8DA 3ZZEA 3UVQA 3QKMA 3QYZA 4EBVA 3D8LA 3G0EA 4O7TA 3SBJA 3E46A 3CD3A 5AX3A 3GCUA 2QKRA 1VR2A 2C5OA 4GT4A 4XS2A 4DA5A 2ZV7A 3PSBA 1UWHA 4XG2A 4GH2A 4YHTA 3FZTA 5IA1A 2UZBA 3GLIA 3DZDA 2JXNA 3FJQE 5AR2A 4P5ZA 5B2LA 4FVMA 2CUZA 3UDZA 2YACA 4PMTA 1DM2A 1GIIA 4ASDA 2F5QA 3FMKA 4DR3M 4I5CA 3K5VA 1DGHA 2V1CA 5HG8A 2R44A 3R83A 4MBLA 3AT2A 5TR6A 2FSLX 1OL1A 1K2PA 4JX3A 4OTPA 2YLFA 3ROCA 1IAJA 1W0XC 4GMYA 4EOMA 4KRDA 2CNQA 4HLQA 3RGFA 5HQ0A 1SXJD 1FGIA 3IDPA 2EA0A 1OPLA 3MH2A 3DKCA 1SNUA 3HMPA 2VN9A 4QNMA 4AF3A 2V7OA 1GLNA 4GITA 4LYNA 2XK7A 3AXWA 2FE8A 4FKLA 4ZTQA 3R9DA 2G2HA 5CSXA 3UMMA 4WSQA 2J51A 1PKDA 3W0PA 2J5EA 4X3FB 3UIMA 2UZVA 3QTXA 3OUNB 4KNBA 3HKOA 4U43A 2Y4IC 4YLJA 2KULA 1VYZA 2E9OA 2OH4A 3BCEA 5C18A 2VGPA 5IU2A 3L8PA 2WMTA 4J98A 3L28A 3IKAA 1N78A 4I6HA 4DDIA 1KE6A 2XSZD 4NCTC 1T43A 3HGIA 2W1EA 2RKOA 2WTKB 4F1IA 4G6LA 1FPUA 3A99A 3BYMA 4MGZE 3DY7A 3KF7A 3JR1A 4M14A 5DH3A 3BEAA 1OMWA 5T3QA 3TG1A 5HESA 1B6CB 2BAQA 4I20A 3SAWA 1HQCA 4KBAA 4QMLA 2OJGA 4F99A 2O5RA 4JXJA 5K0XA 2AHMA 4A4OA 4OR5A 5IWAM 5M4UA 4HEOA 5C8MA 1UNHA 2XM9A 4LUDA 5HCYA 4EHEA 5CSHA 5HE2A 3R8VA 3TKHA 2LAVA 3OUKA 4MWIA 2JKQA 1PJSA 3UG2A 3R7GA 2Y21A 4YZMA 5AM7A 5AX9A 4Z7HA 5CF8A 3FZSA 1QZEA 3R2BA 4AKIA 5HE0A 4IBIA 1K82A 3AT3A 2MJ5B 1JWHA 4QMXA 4D28A 2XNBA 3EN6A 3GLFA 5ANEA 2P3GX 1W2DA 2VWVA 4UY9A 5K5XA 3BBWA 5EKOA 4ZSGA 3ENMA 2LGCA 3W2PA 4JXFA 2FGIA 3C5IA 3DJ6A 4YBKA 2K9DA 4QRCA 4EOJA 1KWPA 2GU8A 3BU5A 4GKIA 4C36A 1ZYDA 1SG9A 3KXGA 5L2IA 3M2WA 1OQYA 3NYXA 2KNAA 1YDRE 5DVRA 3UZTA 2WTIA 3BE2A 3COKA 5I9VA 4AOTA 4O84A 3C9WA 4TNDA 3UOJA 2YIRA 2FOIC 2M60A 5LOHA 1IY2A 3VBXA 4FX3A 1Z5MA 2ZM6M 5ITTA 1AQ1A 1ZYJA 3L9NA 3Q9XA 4RIWB 4OTWA 3KEXA 2K6BA 2J7NA 2BKZA 3BELA 2ZTCA 2CHQA 5FUTA 4R78A 3C1XA 4RWIA 3KSJA 4HW7A 2DAGA 4DV4M 4IX5A 1NV8A 1PKGA 5M4IA 3EQHA 5LMBA 2C6DA 3NUPA 4O4DA 1GZKA 4OTRA 4QTDA 4RIYB 5BYYA 5CU4A 2ZBKB 3VLFB 2W1DA 3FQHA 3OROA 4TYEA 2VTOA 3PXRA 3OT3A 2BJVA 4L7FA 4TYGA 2HL7A 1PYXA 3HHWA 1Q02A 5G6VA 5GIPE 2CHVA 1OBDA 3AGMA 1IM2A 3KW6A 1OL2A 4Y46A 3AC8A 5E92A 1JB0F 1B39A 5LMAA 3QRKA 4FG7A 1WVWA 5KZ0A 5HIDA 4CZTA 1GVNA 3G51A 2RL5A 1LUFA 3UVRA 3R7UA 4NFMA 3S0OA 1DV0A 3Q52A 3C7QA 2PMIA 5EP1A 4PDPA 3ZRKA 5IH6A 4FBXA 3P5KA 4PY1A 2CLXA 4C58A 1WBWA 4KINA 1SXJA 3GLHA 4FTRA 5LQFA 3NAYA 2X7GA 3P0MA 2BVAA 5KMNA 2C69A 4DTKA 3HRFA 2R45A 4CT2A 3F92A 3NPCA 3PDTA 2YIWA 2IZRA 3EIHA 2I40A 3OW4A 2G2IA 3ZO1A 1YWNA 5JFXA 3FD9A 1ZYCA 1NY3A 4DGNA 3IPHA 4QQTA 3H0ZA 2XP2A 5JGBA 3OOMA 5IA4A 2JD5A 3U9CA 3GLGE 5DYJA 4G4RA 4KIPA 2D7EA 4IWQA 1NY6A 5CNOA 5IQGA 2XSZA 3AMAA 2BTRA 4ACHA 4Z55A 5EQYA 4LV8A 4LOQA 3A98B 5E26A 3U87A 4YZBA 4L78A 3P4KA 4ZMEA 1IASA 5J7HA 3BQCA 3ORPA 1JPAA 5FDPA 5EXSA 2YFXA 2R3JA 3RI1A 3O8PA 3T1HM 3SC3A 3EN5A 4HOKA 3KS8A 4JI8M 3JR5A 2YM7A 4MXOA 3PY3A 3UDSA 5GJDA 1L3RE 5BPYA 2EXCX 3OP5A 3HV5A 4D9TA 3C51A 1QDRA 3HY5A 2MGWA 5H3QA 5CVGA 3ZDUA 5HD4A 5A9UA 2QKWB 1Q3WA 2XVDA 3E62A 3RINA 3BHVA 3DAKA 4RJ7A 3RZFA 2JA2A 4LF9M 2C1BA 5D12A 2AYPA 1Q3DA 4YTHA 5JFSA 5HLWA 3EN9A 5GZ9A 2G15A 3IGOA 2OU7A 2XJ2A 2X9EA 4LJAA 3A8WA 1OUYA 4BRXA 4NTTA 1CUKA 1YKRA 3BLAA 4A7CA 4WNPA 4EOOA 2C98A 4FV9A 5AP4A 2H5XA 5HGIA 5LMKC 4ZZNA 2VF7A 3KMUA 1PYEA 4AG8A 1ZWSA 3DBQA 3ZHPC 3PRFA 3FY2A 4ANLA 4ZMFA 5M56A 4EH4A 5DFLA 1M2RA 3CPCA 4I21A 4J8NA 3E92A 1GL6A 2VUWA 3MN3A 4LGYA 3S4QA 3LVWA 4DG0E 1DGHB 5IEXA 3MK6A 2VNYA 3RP9A 3BU6A 3D5XA 1GL7A 2AC3A 2VTRA 2Q0NA 5IKWA 1KE9A 2VQFM 3JYAA 3VQHA 4DEIA 2J9MA 2SRCA 3T38A 3VS6A 4AG5A 3HHZA 3EQDA 3VS3A 4I24A 2ITPA 4IC8A 2I1MA 3R02A 4ASEA 3W18A 5HHWA 3LZBA 1Q4LA 3W0SA 3EL7A 2KRKA 4BHNA 2R5TA 3VJNA 4B9DA 3VUHA 4WT6A 2YAKA 4B7HA 2VX3A 3ZU7A 4O0XA 2P4IA 3KXEC 4JL9A 3PNVA 3TEIA 2PZPA 4EOSA 2Y7JA 3R7EA 2BRNA 4YJRA 2Q2EB 3AFHA 3ZC5A 4LFBM 1O6YA 3MH3A 3TIZA 4ASZA 5F94A 1YE9A 2WQMA 3D2IA 5E8WA 1IAHA 2YITA 4BBAA 2C96A 3ZO2A 3LE6A 5DFPA 2X8AA 1OGUA 4C33A 4NRWA 3AOGA 4FTUA 2QP9X 3A8XA 3NUXA 1UU8A 2H34A 4DF3A 3GRYA 4CRSA 4A07A 1U59A 2HKJA 2C1AA 3BGPA 5HCZA 3B9PA 4YURA 2QZ4A 4FTNA 3EFLA 3PWYA 3G6GA 4LM5A 3NBIA 3R0TA 3V5PA 2JAMA 2Y0QA 2BFYA 4E5AX 3VJOA 3VS0A 3GOKA 4Q9ZA 3ORIA 3D8BA 4UWBA 3RHKA 3TZMA 5IQBA 4I5SA 3I0QA 3GQ4A 5BVDA 4PL5A 4KKGA 3VC4A 4QOSA 4BTFA 3R63A 2F57A 3UIBA 3L8SA 5FD2A 1CDKA 4TRLA 3K92A 5BVKA 2J6MA 1N32M 1FNNA 4TWNA 5CY3A 2OQ4A 2DAEA 4X3JA 2UXDM 1DAYA 1PMUA 2WSFF 3HRCA 2OIQA 3PIZA 2C3IB 5CYIA 4FIGA 4FUXA 3PP1A 1PXMA 4JG6A 2WB8A 4W4YA 5IZ7D 3OWPA 2QO2A 1CM8A 4CFNA 1WBTA 3PY1A 3UPXA 5I9UA 2YM8A 4DN5A 4FL1A 2QHOB 4L6V6 4JI4M 4CQGA 4DE4A 3VQUA 2EJSA 4USEA 4YJTA 1YI3A 5H8EA 5BPVA 3L26A 2C9OA 2YM3A 4RWJA 5ANIA 2O5KA 4L00A 3PXQA 5E8VA 5CAOA 5JKGA 4DUYM 4LG4A 4FIJA 3LW0A 3W33A 4BWXA 2B3TA 4S30A 4I23A 4HPUE 5JRSA 4IBMA 2C0IA 4D2RA 4NKAA 3ZONA 3Q5ZA 2YM6A 4A06A 4TN6A 4ZJVA 3L9LA 3SXSA 3MA3A 3LFBA 2QO9A 2R65A 4L8MA 3ZM4A 3HA6A 4D4SA 4AQYM 3WE4A 5AWMA 3CD8A 4UZHA 2XRWA 5B2MA 2NNWB 3QUDA 5JZNA 2B54A 4IE9A 1R2ZA 4B4LA 2JFMA 3KXNA 4L8RC 4NSOB 2WO6A 5H8GA 2UW0A 4R1YA 4QYGA 5T6KA 2G01A 5GJGA 3W0RA 3D4QA 2C3KA 4LUEA 3EYHA 3MJ2A 4JI9A 5IA2A 4O4FA 4ANNA 4LRTA 2QONA 4U5JA 3U6HA 3NZ0A 3SA0A 3OY3A 3LFQA 3QAUA 1ERKA 4OVZA 4CMTA 1YUBA 3EYGA 2AEGA 5EP4A 4JMQA 4ZLOA 1JKLA 3KN6A 3VS5A 3TUBA 2X2MA 5BVWA 3IW8A 3PIYA 3U51A 4ZOGA 2ITUA 2ZV8A 2YLEA 2XIYA 3KOXE 3ORMA 1VEJA 2VWBA 3EH9A 4LGMA 4NUSA 3MIYA 3C5UA 4BTJA 2KEBA 4BCIA 3GU4A 3FXZA 2P55A 3RGPA 2WTDA 4USDA 5LMNM 4QNAA 1J7LA 4AKHA 2HCKA 1UV5A 1XQZA 2CHLA 2JKMA 2OI4X 2QURA 4JI3M 4R7GA 4O0WA 2PVYA 3Q5IA 3D5UA 2H6DA 3A60A 3QXOA 2R3NA 4EYJA 4BI2A 3AG9A 1XJDA 4XHKB 2WTCA 5EG3A 4X2GA 2LVPC 1PXOA 4GFMA 4EOPA 2Z60A 4LY6A 4EH8A 4I4LA 2EVAA 4DBNA 1TQIA 3DCVA 4AACA 3CJGA 2VF8A 4XLVA 4I0SA 2D7GA 3HP2A 1R39A 4TYHB 2DUVA 4PL3A 3DDQA 3BX5A 1DO2A 5FEQA 3R9XB 3SAVA 3AKZA 2XEPA 2ETRA 4NEUA 1H07A 4F0IA 4DR6M 4MBIA 4D1XA 1EFUB 4KSQA 4B3TM 3FI4A 3MH1A 4LFAM 3GUBA 3NYOA 4WURA 5IDNA 2OWBA 3ORLA 1OPKA 3KA0A 5IH5A 2NRYA 3QQHA 1P4FA 3QCQA 3DJ7A 2DYLA 2BWBA 3I81A 4ZJJA 2YDIA 4NOOB 4DV7M 4M8TA 2X6DA 4K8AA 5AUYA 3CTJA 3CQEA 3OXIA 2E9VA 3UQFA 5ETIA 5KHWA 4YZNA 1IXRC 4DINA 1NW1A 3HLLA 2QD9A 4PDYA 2YISA 2VV9A 3D7TA 5CSVA 2W5HA 4CMOA 1J91A 5LVPA 3MPMA 1P4OA 3DKGA 3TT0A 1WR1B 2PUIA 4X2KA 5GJFA 3D94A 1QZMA 4CZUA 4LRSA 4MEDA 1TH3A 3EQIA 3G33A 3VF8A 3JXWA 3FHIA 3AC1A 5IQEA 4AT4A 1KE7A 4LRKA 1PXNA 3OTOM 3V6SA 2PHKA 5CANA 5BX0A 2A5YB 3U6EA 3M42A 3DQXA 3QWLA 4S31A 3MDYA 3NWWA 3NIEA 8CATA 1R2YA 2YJRA 2PMNX 4D5HA 4V0GB 1OTRA 1FBNA 5D1JA 1M2PA 2O3PA 4M9ZA 3PIXA 4D0XA 5KQDA 3R1YA 3O7LD 2ZANA 5HG9A 5IUIA 3DFAA 1W5SA 5C4KA 4LL5A 5I9XA 3IW6A 4Y72A 2R3GA 1HCLA 4ANQA 2L2DA 4CGAA 4R1VA 4DV2M 4RA4A 4G4NA 2JAVA 4D2SA 5L8KA 1PXLA 3DBCA 4UWCA 3HV4A 4FTOA 5FXSA 4IWOA 5M51A 2VTIA 3N4VA 4RX9A 4ZSAA 5IG1A 1H6UA 3UOLA 3PJ8A 1G8JA 3IK3A 4MK0A 3SV0A 3QQFA 5JEBA 2CE7A 3LMIA 3DTCA 4YBJA 5A14A 3PFQA 5CZIA 4R6VA 1IA9A 3MVMA 3SYLA 4BDKA 2YNMD 5A6NA 2C6LA 4DEAA 3FUWA 2PMLX 2X2KA 3I01M 4EBWA 4CVAA 4YJSA 3CC6A 4ZSJA 1QPJA 4EZ5A 4IBBA 4LJ6A 2VWIA 2G2FA 3A7JA 3HEGA 3LFAA 5AV0A 2IZSA 1GY3A 4DR5M 4ALWA 2DHYA 2EKKA 3QQGA 3SD0A 3B74A 4BFMA 3K54A 1IN5A 3ETAA 4ZEGA 3D5WA 3MESA 1YWVA 4RG0A 3JPVA 3QKLA 2ZM4A 2QOOA 4BDIA 3TV7A 3F9NA 3FWQA 1VYWA 1V92A 1JQJC 2Y6MA 3UJNA 3HMMA 4QQJA 4R8QA 1OL5A 2ZDUA 4NC6A 4DTAA 4AXEA 5IPJA 4K0KM 2JY7A 5J87A 3U61A 3PZEA 3N9XA 1WMKA 5HD7A 4QPMA 4B7GA 2B7AA 4MYGA 5GZ8A 5CEIA 1VEBA 2R3RA 3EFJA 4CQEA 3DKFA 4XBRA 3UZPA 4QNYA 4RVTA 2YABA 1XMLA 3COIA 3TUCA 4IDTA 1LEZA 5DGZA 2DAIA 5A4CA 3H10A 3GCPA 3S1HA 3ZC6A 2W9FB 1E9SA 2GQSA 3Q32A 5L6WL 2BROA 5AV3A 3FQSA 1L8QA 3V3VA 4F7SA 3KCKA 2PVHA 2KDLA 3HDMA 1G71A 2HZNA 3UZUA 5EOBA 5LMKA 4W8EA 5HX6A 4EHZA 1TQPA 5AA8A 4Q5HA 4AN2A 3CKWA 4FGBA 3HV6A 3I4BA 4WG4A 3B2TA 4JVGA 4L15A 5H8BA 3JS2A 4AA4A 4QMPA 5LVOA 5I5ZA 3KCFA 4K9YA 4CTCA 2W1ZA 2REIA 3PJ1A 5J79A 5CNNA 1FVRA 3I5NA 3R30A 2V6ZM 2ITQA 3IQ7A 3Q4CA 3BI6A 4OVZB 3RNIA 5L2SA 5ANKA 4ZY4A 4Y85A 4F9CA 2OJIA 4CLIA 3MGYA 5E90A 2O64A 2Y8OA 4WO5A 3LJ2A 4BWKA 2YR0A 4FSTA 2WTJA 4L44A 4GJ3A 4BIBA 4EWQA 4TW9A 3ALOA 2OIBA 4WNOA 4YJUA 2QOQA 3PLAE 4E4MA 1FGKA 4CD0A 2WU7A 2BALA 4J96A 2I0YA 2WEIA 4DH3A 3IG5A 4IZ7A 5JI3E 1QPCA 2V55A 2PVFA 3GC8A 2GQGA 2D7HA 4HJOA 5DT0A 4QT1A 4QHTA 3W2OA 2KZSA 3NNWA 1FMOE 5FTQA 3UP2A 2DI0A 1F4IA 2PWLA 2Z02A 3VUIA 1AGWA 5K3YA 4DFXE 3GQLA 2VNWA 3WF9A 3RK7A 5EM7A 1Q8UA 4G6ZA 3CBLA 4PPBA 2F5NA 1OKVA 4MGKE 3PE2A 4B8MA 3BYSA 3DOGA 4Q7JA 3OBGA 2XNEA 3FUUA 4FKSA 4IX6A 1KV2A 4R71A 4BZDA 2B9IA 4ANOA 1NVMA 4AWIA 2BJWA 1TKIA 2WXVA 5DA3A 4BGHA 5AR8A 1OZ1A 2JY6B 3E88A 4GIHA 4A3VB 1PXKA 2GQFA 4IAAA 2WMAA 4F2LA 4LJ4A 3V6RA 3NVKI 4FIHA 3ML1A 3KK9A 5E6JA 4MH0E 1OKWA 4IXPA 3TNQB 4F1MA 3ZM9A 3ZLYA 2FO0A 4FSMA 3BQRA 4FSQA 1PHKA 3U4WA 2GHLA 4WUAA 4UYAA 4E6AA 3RMFA 4F63A 5DN3A 4ZK5A 3GENA 2X8DA 3R8FA 3IW4A 4BDBA 5BV3A 1MRUA 3D7TB 4QHSA 5M57A 4DV0M 4DR4M 2MH8A 3TJDA 4BIEA 3RAHA 3SATA 3R2YA 1RW8A 3K5UA 4LOPA 3VO3A 3W67A 3NBXX 5DG5A 4KLNA 3REPA 2VU3A 2ZB0A 5EP2A 5AP7A 5EFQA 2L09A 1XC8A 4FSZA 4NTSA 4LMUA 1NHGC 4AU8A 2JDVA 1U54B 3LW5F 3LVVA 1VG5A 2WQNA 2QLQA 3LMHA 3I4VA 2P2HA 3NSZA 5M4CA 3HUBA 3HZTA 1BVSA 3DJ5A 5ANDA 3LXLA 4I5MA 1NV9A 2L6OA 3ZFMA 3FKNA 3DFZA 3BL7A 4L3PA 3LCUA 5C4LA 4FKOA 3N4UA 5IDPA 1IBLM 5TKDA 4PTCA 3KULB 5IA0A 3NUAA 3LKMA 4PUZA 4LV7A 3SHEA 2CRUA 3QTQA 1QAOA 5BVOA 3V76A 2XEYA 4FT0A 2J5FA 1R1WA 4F65A 3LFNA 3UZRA 2UW5A 3UVPA 1NVQA 2R0UA 4FKJA 4GFOA 1QANA 4DH7A 4RIXA 4XP3A 4I0RA 4IC7A 2FYSA 4Z9LA 3VVHA 3LFSA 3FUPA 4IAZA 5CTPA 4D4VA 4EQMA 3FL5A 4APPA 2GNLA 2GFCA 2YIQA 4GG7A 3CLYA 4AW2A 5AA9A 5EM6A 2CNUA 2H96A 2P5TA 3A7IA 1FVVA 4O6EA 4D80A 2XKDA 4ZLZA 1MJGM 5HORA 3FMJA 2HWJA 4XG8A 2RFSA 3D2KA 2L7IA 3OXTA 4FTCA 1IA8A 4NW6A 2ITVA 3Q4UA 4NXNM 2XIXA 3T9IA 1P2AA 4G3FA 4JG7A 2JZ1A 3RM7A 2PVKA 2JGZA 4C4EA 1IR3A 4RFYA 4B3SM 4BDFA 3BV2A 4OTGA 2JBPA 3R7IA 4G6NA 4GEOA 3N4TA 4DEGA 4YY3M 1OKYA 2RFDA 3UP7A 3RFWA 3VUKA 4TUWA 1SVHA 2BDJA 3TV6A 2LTUA 3RVGA 3PPZA 4BCHA 5EK7A 5J95A 4TWCA 3TPZA 5EYKA 4E7WA 3OCSA 4KKHA 4HVDA 1OUKA 5M08A 3LHJA 3I79A 2QO7A 2WELA 2WQEA 3RPRA 3ZTXA 3U61B 2F5SA 4D2WA 2Y20A 3P23A 5KMMA 5GIOE 3DFCB 3QBNA 4L43A 4AW0A 4FSYA 3WZEA 3QALE 5FXRA 3RJCA 3DZOA 5KMKA 2WMBA 4NIFA 4R7HA 3R22A 4MF1A 2W06A 4FKQA 4AKGA 4BI0A 2HENA 4CFVA 5EQTA 4W9WA 2XLJA 1QAMA 3A45A 2UZNA 1PMEA 2YZAA 4BDHA 4ANRA 4RJ4A 3LCVB 4O7LA 1HCKA 2UZLA 4J52A 2IF8A 4N6ZA 4LF7M 4CMUA 2UV2A 4F9BA 3CSVA 3CF2A 3OHTA 3MVLA 2YDJA 4F7JA 5CVHA 3OW3A 3FI2A 4EQCA 3KXZA 4DEDA 3OBJA 3J7BA 4GMQA 3FZ1A 1YXTA 4C3FA 4ZIMA 2FA2A 3FYDA 3DZQA 3WYYA 4C57A 1OVEA 3TNIA 3SYKA 4Q2AA 2UW8A 2DZOB 5CI6A 5FRIA 1W98A 5CU2A 2I6LA 2JDSA 3BRBA 2UXCM 1BYGA 3HHYA 4NSRA 2QOBA 3TCPA 3A4PA 3T6PA 4YPDA 1OECA 1L1ZA 4J1RA 1Q62A 3V5LA 5J7BA 1WBOA 5ICPA 3MPTA 1Q3BA 3PNYA 1NHWC 4CKJA 2A19B 4YMJA 5HI2A 2X81A 4E6CA 4XG3A 3FLYA 4KA3A 2VD5A 2QI8A 2C6IA 4ACMA 3KMWA 3NYNA 2I0HA 1JAMA 2R6FA 1E1XA 3C4CA 5J8IA 4BI1A 1MP8A 3FQEA 2OFUA 4KD1A 2ZB1A 4FMQA 1J7IA 5CASA 3FLWA 3SW4A 1PJJA 1MX0A 4AN3A 5HE3A 4AFJA 2W1FA 3QZGA 1K9AA 3C4EA 4O4EA 4LFCM 5BVEA 4FE2A 5CEPA 5FBOA 2B9FA 1CSNA 3WIGA 2IG7A 1TDZA 3U60A 1OJLA 1XO2B 3KOZE 4PX6A 2PY3A 3W55A 3QFVA 4IBDA 3ZH8A 4AAAA 4KAOA 4OT5A 3TWMA 4IX4A 3R8MA 4DHIB 3HJSA 2A0CX 2HOGA </