2QNJA

Kinase and ubiquitin-associated domains of mark3/par-1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
324
structure length
318
Chain Sequence
b'GAMGSEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITATYLLLGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/microtubule affinity-regulating kinase 3
molecule tags Transferase
source organism Homo sapiens
publication title Conformational instability of the MARK3 UBA domain compromises ubiquitin recognition and promotes interaction with the adjacent kinase domain
pubmed doi rcsb
total genus 97
structure length 318
sequence length 324
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2qnjA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qnjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qnjA01
3UVQA 5CF4A 4F4PA 4CRSA 2QG7A 4P2KA 1PXLA 3ZCLA 4PMMA 3HA8A 4EH9A 5J1VA 1IFYA 3NCZA 4MD9E 4PMTA 4OAVB 5EQEA 2W96B 1L3RE 2CMWA 1OQYA 2CDZA 2DKLA 3IGGA 4YHFA 1GNGA 4RA5A 5EM5A 2ESMA 1XHAA 2OH0E 2X7GA 4G3EA 1V92A 4O1PA 5DFPA 1JKSA 4YBKA 1GAGA 3NNXA 3V8SA 5ANKA 4NWMA 4WO5A 4D9TA 3AD4A 4NKSA 2J5EA 4FKOA 4RIYA 4BCMA 5GIPE 2XP2A 1H1QA 4AA5A 4QMXA 4BCHA 2HK5A 1JNKA 3DKGA 3HZTA 1O6LA 4FIHA 3VWAA 3WIKA 4I4FA 4I93A 3WILA 1PMUA 2C47A 1WFCA 4DGMA 2W5AA 1Z57A 3FI3A 5JQ5A 2PVHA 4MEDA 5H8GA 2ITZA 4BR3A 4NZWB 2OFUA 1L8TA 4GCJA 3FHRA 3QXPA 5EHLA 1TQMA 3SXRA 3QGYA 1R4GA 3R6XA 4F0IA 1CSNA 4IVAA 1XJDA 1URCA 1B39A 4JDKA 3WF7A 3ZLXA 2R3PA 3CQWA 4N0SA 5HLPA 3R7GA 4BWPA 3BBTB 4D0XA 5E8VA 2NPQA 3SD0A 3P7BA 1H24A 3Q4TA 3DY7A 5CU4A 3IDBA 2ERZE 3PVWA 2JLDA 4K9YA 4F99A 4K77A 5AP1A 4E93A 4RIWA 4IZ5A 4U81A 4CYJA 1VYWA 5HLWA 3R8PA 3JS2A 3DFCB 2BRGA 3QA0A 4WUAA 2QURA 3ET7A 4RJ4A 3V01A 2OW3A 4GIIA 5HTBA 4U3ZA 3BYSA 4UBAA 1JKTA 5BYYA 3QQUA 3ZU7A 3NVMB 4NU1A 2F57A 4G9RA 2X2KA 5LMBA 4X2FA 5LARA 2XA4A 4J98A 3S1HA 2IVVA 5E1SA 4LL5A 4ZY6A 4FL2A 1YOJA 3TL8A 3AT3A 5CENA 2WO6A 4NM7A 5GZ9A 2H5XA 3K54A 3ETAA 2H96A 3PSBA 4FIJA 3L8PA 2OBJA 4R7IA 4CFXA 1NA7A 4UXQA 5KX8A 1OVEA 3BGQA 4IAIA 1G5SA 3Q96A 1IAJA 2ZVAA 5IQEA 4XOZA 2JAMA 3GCVA 4QMWA 3VIDA 3DXNA 3DQWA 5AR4A 3ZRLA 3OTVA 3GLHE 3U54A 3O8TA 3NAYA 2UW7A 2OO9A 2XK9A 4FTIA 1PGYA 3UOLA 3V3VA 3FDNA 4B6LA 5AAEA 4JL9A 1UV5A 4CKJA 4BIBA 2H9VA 2CP8A 3W2CA 2XNEA 3NYXA 2PZ5A 4DA5A 2G01A 4C4GA 3LE6A 4TW9A 3BYOA 4F70A 3UQGA 3O96A 4UZHA 3KMUA 4G1WA 4FTTA 4HGSA 4KBKA 1PMNA 4IH8A 5HU3A 3F61A 3QKMA 4PDYA 2FVDA 3P08A 3E3PA 3HECA 2QHNA 3MJ1A 1GIJA 4V04A 5C26A 2I1MA 5CNOA 1YXTA 3ANQA 3FC1X 4IAYA 3C4FA 2B3TA 2XMYA 4R8QA 4E4NA 4EOKA 3ORLA 3KCFA 4L45A 3U51A 3AC8A 4BGGA 2HIWA 3BHHA 4WP2A 4XS2A 3ERKA 1K2PA 4AT5A 5I5ZA 4ACHA 2CSNA 4FMQA 1NV8A 5C1QB 5KKRB 5CU3A 2HWPA 3EFKA 2Q0BA 3NX8A 4QPAA 5AV2A 5HX8A 4WG3A 4B4LA 4IBMA 5KBRA 4YJVA 1PMEA 1RW8A 5M08A 5GJGA 2XNBA 2XIRA 2W4JA 2XKFA 5AP0A 3RAKA 4EOMA 5LQFA 5HCZA 3CTQA 3EH9A 3DJ5A 5EI8A 1OM1A 4P5QA 3OW3A 2XKCA 4XOYA 3LQ5A 2XF0A 4QMMA 2GQGA 2XRUA 3OHTA 3POOA 5HE1A 3A60A 4YZNA 1BLXA 2F4JA 3W32A 1U4DA 3I0OA 2WQMA 4F2LA 4USEA 1Q8YA 3UG2A 1KV1A 2VWWA 2R3LA 4USDA 5H8BA 2HOGA 4AN2A 2IZRA 5EI2A 1OKSA 1JKLA 5DT0A 3H0YA 3Q3BA 4FZFB 1JSVA 2HY0A 3VBYA 3SRVB 3KXZA 4FVRA 5CSHA 1LEWA 3G33A 4MCVA 3DAKA 4NH1A 4ASEA 1BYGA 2X7OA 4WNPA 3RM7A 2CNUA 3PRIA 2XIYA 2DAKA 4A9SA 4XP0A 5DR9A 2JEDA 4O6EA 3OBGA 4QYFA 2WTDA 3MPTA 4HW7A 2YCSA 3PJ3A 3TN8A 3ZUTA 3ATTA 5DR2A 4O21A 4DH7A 5D9HA 3N51A 3UC4A 4S31A 1OIRA 3QF9A 3CTJA 2WMUA 2ITOA 3F5PA 5AM7A 5E8YA 3TNWA 3H30A 4OTQA 4IHPA 5F1ZA 2XIKA 4O22A 2YCRA 3T8OA 4DHFA 3TUBA 3SG8A 4F9WA 2OXYA 2B52A 4L00A 1GO5A 2UUEA 2BFXA 1OTRA 4DITA 3KY2A 4B0GA 2BTRA 4RFZA 2VGOA 3LMGA 5C9CA 4BC6A 5K4IA 3ORXA 4IX5A 1REJA 3NNUA 4AT4A 5IQCA 3E87A 1R39A 1RJBA 4PPAA 5FXQA 4DG0E 3VUTA 3W2SA 2HW6A 5BVOA 2R4BA 3VS1A 4L7SA 5AP5A 1AIPC 4JR7A 2E9OA 4W9XA 2JUJA 4J71A 2ZAZA 2DWBA 4RFYA 4BDFA 4EK4A 3DZQA 2RGPA 3E21A 4M69A 2XNOA 3PP1A 4YSMA 1J7IA 4CGAA 3QKLA 3FXWA 4RJ6A 4CT2A 3JUHA 3LJ2A 2J0MB 1QPCA 3AD6A 3TWJA 4IQ6A 1E9HA 4R7HA 4L3PA 2W05A 3QTQA 2RFEA 5C8KA 3OFMA 2I0EA 4M0ZA 5DR6A 5HI2A 4YLLA 2BRHA 2CPKE 2K0BX 5G6VA 5A4EA 4IX3A 4XG7A 2HW7A 5IQFA 5AJQA 1LP4A 3SRVA 2OGVA 2LVPC 4UZDA 4IAAA 1G3IA 4MXOA 4FKQA 1SM2A 3OXZA 4CG8A 1YXVA 3BYVA 4BTKA 4TWNA 4LMNA 2VTPA 2QI8A 4DTAA 3S2PA 2KHHA 2R3GA 3R21A 5HNGA 4ACGA 4KD1A 3LQ3A 4O82A 1PMVA 3DFAA 1ZRZA 5BNJA 4L01A 1WBNA 4YHTA 3S95A 2OZOA 4H3PA 4CXAA 3D7ZA 5DIAA 2PMIA 4OTIA 2F7XE 3PWDA 3E63A 3PXKA 3V5PA 4EH6A 2IVSA 3I6WA 4L3JA 4GJ2A 5DT3A 1OKWA 3ATSA 3QD2B 3W2OA 2R3QA 2VTSA 3QUPA 3WYXA 4M7IA 4L53A 1J1BA 2GNHA 2VTTA 4MQ1A 3NPCA 3RMFA 4M0YA 3K3IA 3D14A 5HQ0A 3SVVA 1H4LA 3CXWA 2P4IA 4FGBA 2BMCA 1YWVA 3FC2A 4QMYA 4XP3A 4EONA 5CS6A 1SYKA 4JDHA 3FMMA 4DH3A 4EK5A 4ALWA 4FKIA 3KEXA 4NSTA 3EJ1A 3QL8A 2QOLA 4LGDA 5HE0A 3HEGA 3IDCA 4J8NA 2DZLA 3F82A 3DGKA 4NM0A 2GPHA 4O96A 4PUZA 3OCBA 4D2RA 1HCKA 4PPBA 4PTGA 4MD7E 3UYSA 4A07A 4DC2A 5I9XA 5EK7A 3ZLWA 5F20A 4F1OA 3FLWA 1BL7A 4NIFB 4BDKA 2CN8A 2BDJA 2UZVA 2ZB0A 3R8LA 4GV1A 4KA3A 4DFUA 2XK3A 5KCVA 5GZ8A 2QHOB 2VWUA 3C4WA 4W8DA 1XQZA 3PRFA 4MH7A 4FZDB 3CQEA 3R1NA 4GFOA 3BGPA 4YR8A 5M09A 1LPUA 4C62A 2XB7A 2GHMA 4QP1A 4X2KA 4B7TA 4E73A 2F2UA 4QMUA 3WE8A 3PA5A 5FG8A 3ZBXA 3LFCA 2CNQA 1PF8A 4I6HA 4ZZNA 5CANA 5JQ8A 2XBAA 3EQFA 4JG6A 4IAFA 5K4JA 3WF8A 3S4QA 4OR5A 1BX6A 3DTCA 3RPVA 4C33A 3QWJA 5KHWA 5CX9A 4E4XA 3DZOA 3TACA 2FUMA 3PXQA 4CD0A 2V7OA 3O0GA 3LXKA 3FZRA 3OXTA 4FL3A 4I20A 2HXLA 4PL3A 4I1ZA 4TWPA 3V5JA 4CKIA 3L9MA 4ALUA 5BPYA 4CTCA 5JH6A 5KBQA 4WD5A 4ANMA 4IEBA 1KSWA 4BRXA 4DFYA 4D9UA 2JIIA 3D83A 5IEVA 3VW6A 3G5DA 2OK1A 4LV5A 4O0SA 4Y5QA 4AW2A 3COHA 3LZBA 4O91A 4QYHA 3ORKA 2ZJWA 3IK3A 4BDIA 3KULB 4UMTA 5I9WA 1WMKA 3LOKA 1F5QA 5A4TA 5BVKA 1V0OA 3GEQA 1O6YA 2Z7LA 5TKDA 5EKNA 3CBLA 1BVSA 2WTIA 2Y7JA 3PIXA 3R01A 3QC9A 4O2ZA 3SLSA 3WI6A 4CTBA 2O2UA 1QPEA 4MQ2A 4F0FA 3AC3A 2Z2WA 4O38A 1HQYE 4RIWB 4YTCA 1ZMVA 4LM5A 3KRWA 4XMOA 4J52A 2C1BA 3BEAA 3OZ6A 3HVCA 2W1IA 4PF4A 2C6TA 3DT1A 2E9NA 2J6MA 2YCQA 3FI8A 3OCSA 3ZLYA 4EOOA 4JQ8A 1H08A 2LVNC 2E2BA 1OMWA 2BTSA 3EHAA 3F69A 4G3FA 4X21A 4CT1A 2CKPA 1OITA 1PXMA 3EN6A 3Q60A 3NW7A 4M8TA 4XBUA 4MYGA 2YDJA 5A6OA 3MFUA 1U54B 1B38A 4C4FA 2IVUA 4QTCA 4C8BA 2R7IA 3Q6WA 2F2CB 3ODZX 4R3CA 3KC3A 2GFSA 3V5TA 4FR4A 4IDTA 4LV8A 4FSRA 4Z16A 3FXXA 4X6RA 1J1CA 2X4ZA 2VX1A 4PP9A 3RPYA 3QLFA 4YP8A 4ZY5A 4G3OA 3LCTA 4YSJA 4AZFA 3PZEA 4YZ9A 3MBLA 2DAIA 4EHVA 3N4VA 4RIYB 3ZM4A 4BZDA 3DBEA 1IEPA 4QMNA 2PPQA 1UNGA 4H05A 4JI9A 5DI1A 5A54A 4IAKA 4DFBA 1XR1A 1KE7A 3W2PA 4M68A 4EC9A 2SRCA 1VQ1A 3ORMA 2X6EA 5EOBA 3HMMA 2QG5A 4FE2A 4AA4A 5IH4A 4AQCA 3IW5A 4CZYB 3FQHA 4M12A 2PZPA 3KA0A 2QR7A 3V5WA 4K1BA 2BR1A 2JY7A 2XKEA 3HRCA 4L7FA 1CMKE 1JPAA 4FX3A 2HELA 5CU2A 2PY3A 2R3RA 3AGLA 2EB3A 2HZIA 3DLSA 3QCSA 4U80A 2QC6A 4CNHA 2VWZA 4FSTA 3KCKA 3NEWA 2UZDA 2VX3A 3R8ZA 2A1AB 4YHJA 4IM0A 3HLLA 4D2PA 4OT5A 5KO1A 5CSWA 2UW6A 5D7AA 4GT4A 5FWKK 3CJFA 3FZ1A 3UIMA 2X9EA 3NW5A 4DBNA 3IKAA 4G6LA 3F2NA 3TZ9A 3ZFYA 2O65A 3W18A 1Y8GA 2IZUA 5H3QA 3HAVA 4F1TA 1P5EA 1H1PA 2JKQA 1Q41A 3TTJA 4YJNA 4ZY4A 4R1VA 3DB8A 4YGAA 3LFAA 3O2MA 2I40A 2UZUE 2XYNA 4BBFA 3E3BX 2JNHA 1WZYA 5IA5A 1FGKA 5ETIA 2PVNA 2VO3A 4W9WA 1OAIA 3E46A 2ZV7A 3HRFA 4LRKA 2BAKA 5I4NA 2OU7A 2QKWB 2C6KA 4RSSA 2UVZA 1YVJA 3CLYA 5AP3A 5HE2A 4DEIA 5CSVA 4JIAA 4IACA 1Y6BA 1Y57A 2JC6A 4F7NA 5TR6A 2C30A 3DDPA 5CVGA 5DHJA 1WGLA 5HGIA 2OXXA 5GIOE 4DEBA 3DA6A 3L9PA 3QTUA 5CXHA 4I5CA 2IWIA 1UNHA 4ZJIA 4K18A 2P3GX 5I9YA 3TNIA 4OT6A 2OF4A 4YBJA 5EW3A 3DKOA 3PG1A 3QQFA 3PTGA 4D5KA 3MB7A 4D1ZA 2WIHA 3W1FA 5JEBA 1OL7A 3QQGA 1XWSA 2OFVA 2VO7A 3A4OX 2PULA 2X2LA 4FV7A 5J7BA 2W17A 2EUFB 4ZTRA 4JVGA 1DV0A 3MH2A 1VG5A 3LCVB 3I6UA 3KN6A 1W84A 3CPBA 2C6OA 3ZRKA 2NNWB 2XNPA 1J7UA 3K9OA 5AADA 5AR3A 2B4SB 3WZEA 3UBDA 4BDEA 3PJ8A 4O7LA 2GFCA 3PXZA 5A3XA 2RRUA 3FV8A 5FTOA 3FMKA 3LMIA 4MKCA 5IQIA 4IB0A 3R2BA 2QOIA 4RVMA 3EB0A 4AFJA 3PWYA 1YOLA 3K5UA 4PPCA 4GW8A 4AGWA 3M42A 5CVFA 1XB2B 4XG6A 4DGGA 1IR3A 3KRXA 4NTTA 5CQWA 1OIYA 2HZ4A 3BWFA 4XRLA 3EMGA 4LUDA 1Y91A 4QQCA 4IXPA 5FBOA 4QYGA 4XG9A 2B9JA 3UGCA 4DEAA 4EKKA 3W2QA 4AOTA 4KWPA 5KZ0A 1BUHA 3CS9A 3VS0A 3PY1A 5L2WA 1IXSA 1T43A 2EKKA 4N4SA 5T3QA 4CG9A 2BRBA 1BI8A 2WMTA 4IE9A 1FPUA 3VN9A 5LMKC 4S34A 1UA2A 2WTWA 4EHEA 4RC4A 3LCSA 5HBEA 2GHGA 4YJRA 3C5IA 2ZV2A 3RHKA 4K8AA 5AA9A 4J95A 1HCLA 2O5KA 3IQ7A 1WBVA 2JKKA 2OZAA 3COIA 4F9CA 2RFDA 1J91A 4RRVA 2MROB 5LVPA 3BX5A 4JBOA 4YJUA 3GENA 4RZWA 3GOPA 3HRBA 3H9RA 3NIEA 5AP6A 1KYIA 2IW9A 3G15A 3BELA 1TQIA 4S30A 2B9FA 5E8UA 3W2RA 2UW8A 1GOLA 3KVXA 1ZMUA 2GSFA 3O8PA 4ZK5A 4PY1A 1I09A 3EN7A 3OCTA 4RLLA 4WSQA 5LWMA 1MP8A 1M7NA 4FEWA 1V0PA 2GS2A 1ZV1A 3VAPA 5DEYA 4IB3A 1YQJA 2E9VA 3IW7A 1H28A 3ACJA 2Z60A 3KXGA 2LTUA 4EUTA 4DT8A 3F3UA 3QD0A 3UTOA 4HPUE 2MJ5B 1OKYA 1Q02A 2V62A 3AC2A 4X6QC 2AUHA 1YI3A 4OBQA 5D7VA 4ZTLA 3I0QA 2V22A 4OTRA 5HVKA 3FSFA 4XYFA 2BIKB 4K11A 4G6OA 1XO2B 4EH3A 4IX6A 4I4EA 4N6ZA 3VS5A 3ZSGA 4AW5A 2B53A 4FEQA 4BTMA 3R04A 4IADA 5HD7A 2VO0A 3D5WA 4M14A 2A4LA 4JQ7A 3NUAA 4GK2A 4BCFA 1YI4A 1ZLTA 3OG7A 4GU9A 3TUCA 2HAKA 3EYGA 1QZEA 3UZPA 1OECA 5CEOA 5HBJA 4R7BA 3GUBA 5I9UA 5K0KA 3VS2A 3MVMA 4DTBA 4RIOA 3WZJA 3I5NA 4EOQA 1TVOA 4M13A 2YZAA 4AS0A 1A5TA 3T9IA 5TOZA 3NLBA 1DS5A 4DTKA 1H01A 3P78A 4AG8A 1AQ1A 3RCDA 3I1AA 3RWPA 5JGAA 1YHWA 4AOIA 4HYSA 2GNIA 3KF7A 4C3PA 4FK6A 4J96A 4MXZA 3MYGA 4R78A 4FT7A 5JKGA 3EQGA 5EDPA 3REPA 5CEMA 4QYYA 4H1MA 5HCYA 3R8VA 2WMSA 3EKKA 2R3HA 2XKDA 4X3FB 5G1XA 1NXKA 1ZY5A 4NYEA 3OWPA 3FQEA 3KXMA 4ZTSA 5C27A 4L9IA 3FY2A 3BZ3A 4Y73A 5TE0A 3SQQA 3WF5A 3QCYA 3BEGA 4WHZA 3VS3A 1WBTA 2UW5A 1GZ8A 4BHNA 4IAZA 4NK9A 1Q8UA 2R3OA 2XM9A 4YO6A 2PUIA 3KGAA 4Y8DA 3IS5A 3SOCA 4O0WA 3C4ZA 2QVSE 4DT9A 5HICA 2Z8CA 1Q8WA 4X3FC 5CT0A 5GJFA 4A06A 4OTDA 3GP0A 3UQFA 2RIOA 4CFVA 5JFSA 1R0EA 3R8UA 3HL7A 3FUPA 2VTJA 4GU6A 3ZRMA 4OTHA 2R2PA 2DAMA 5BUIA 4ZEGA 3KRJA 5JGDA 1YW2A 5AP2A 4EL9A 1OB3A 5L6PA 3FKNA 3TKIA 2EU9A 3KRLA 3BHVA 4WT6A 3CIKA 1P4FA 2KTYA 4FF8A 3GLGE 2X9FA 5CAUA 5BYLA 4TN6A 3EN5A 2RFSA 5HG8A 3DKCA 4FV4A 1GZOA 4GFMA 4F6SA 5J5TA 3UO5A 4QTBA 4GUBA 3COKA 4GMYA 5CAVA 2C6DA 4GUEA 5L3AA 2J51A 3VO3A 3MWUA 4X2NA 5C4LA 3MH3A 4QMQA 5KMLA 4N57A 2DNAA 4KKEA 4X3FA 3U8WA 2A0CX 3RBWA 3VVHA 3GXLA 5HOAA 2ZV9A 3R7UA 3QHWA 1STCE 2C6IA 4ZJJA 3LXLA 4C4EA 4F0GA 2ZMDA 3R02A 3VBTA 3BPRA 1GJOA 5TT7A 4EH7A 4IC7A 3UODA 3NCGA 4HEOA 4LGGA 4RX5A 2PUPA 5LXMA 4LFIA 2VTMA 2YWPA 5C8MA 2Z7QA 2WGJA 4MBIA 4TYHA 3DJ7A 2QNJA 4QP2A 5DT4A 3E8NA 1KV2A 5B7VA 4XH6A 5HD4A 3VUKA 3JYAA 3U87A 3UIXA 4BCPA 3Q53A 4TTHB 3FSKA 4FKJA 4O7VA 4HNIA 1CKJA 1WHCA 4L52A 4IJPA 3FBVA 1YXXA 5JI2E 2E9PA 3R7YA 3SHEA 2V55A 2VRXA 1CUKA 5EM7A 3E88A 2B1PA 2W7XA 3EQCA 3GC0A 3NWWA 5DRBA 2BHEA 1XH8A 2AYPA 2EXEA 4GIHA 4TYJA 3P0MA 1U46A 2PUUA 5BQ0A 2LVQD 1W82A 2W4KA 5C01A 5TF9A 4RT7A 4L43A 4XV1A 5LVLA 4C34A 4J97A 1JOWB 2O63A 4E4MA 1DO2A 2YIQA 2R3IA 3QYZA 3EFWA 3H0ZA 3P9JA 3Q52A 5HNIX 3A7GA 3KL8A 4QOXA 5J9YA 4K2RA 3PY3A 1LR4A 3MMPA 1F3MC 5FQDC 3RZFA 3ENHA 4BB4A 4C4HA 5I3RA 2PYWA 4MTAA 5CYIA 3CCNA 3QQJA 2Y6OA 3TZ8A 3MA3A 3WF6A 2VTIA 4DCEA 2OLCA 4V05A 1MN3A 2BVAA 3L8SA 4C2WA 2JDSA 4EBWA 4RC2A 5AUXA 3QTWA 4JX3A 4BVUA 4XG2A 3H9OA 3U6HA 1YI6A 3QTIA 1LEZA 4GL9A 2C3LA 3KK9A 3PG3A 3TJCA 3WBLA 3UNKA 3QD3A 4BIDA 4H39A 3R7EA 3L8VA 2OWBA 4G3GA 4V0GA 4AZEA 3EFLA 3VW8A 2CHLA 3L8XA 3EL8A 5ETFA 3TZMA 1MRVA 5KHXA 4KKGA 2XVDA 2ZYBA 2LAVA 3RALA 3QYWA 4BF2A 2VWXA 4WSYA 1WR1B 3ULIA 4FKWA 5EQYA 3AG9A 5ACKA 3ZFMA 5ANOA 4KBAA 5IA3A 5GINE 3B2TA 3IW6A 1P2AA 4DLIA 4E26A 4U79A 2YABA 2JKOA 1AGWA 1CKIA 2BAJA 3Q2JA 4FEUA 1JAMA 4ZTMA 5KMJA 3GCSA 4PWNA 3R9OA 2UVXA 2WNTA 2ZDUA 2W1CA 2WQEA 3W8LA 2JFMA 2JKMA 4ZOGA 4KABA 3R73A 2AC3A 3R8MA 1BKXA 2JBOA 4W4VA 3E5AA 4NEUA 1TR8A 1TQPA 2UZWE 3FLNC 3HGKA 4MXCA 2G9XA 4CMTA 4HYUA 4D55A 3BV3A 3KF4A 4UYNA 1SVGA 1FOTA 5AFVA 5FUTA 3UG1A 4U97A 4F1IA 2WEVA 3BU3A 3GQIA 4N6YA 4PTCA 4XRJA 3VUMA 5KMIA 3IO7A 5LVMA 5AR8A 2VZ6A 2IO6A 4EOSA 3NGAA 3OWJA 4Q2AA 4FTMA 4ZSJA 3EZVA 1CTPE 5DH3A 4A9TA 4FTQA 3MW1A 4YJTA 4D5HA 5M06A 2GS6A 3ZO3A 5HX6A 1ATPE 2BWEA 4FKSA 4EQCA 4BDCA 3KXHA 3E7VA 3QRIA 5H8EA 2R5TA 4FNXA 4KINA 2BFYA 5FLFA 4AN3A 3U9CA 4JBPA 3CGOA 4BIEA 4CQEA 4FKLA 4IVCA 4ZZOA 5ANDA 2KULA 5FEQA 4EOPA 4O0RA 3SG9A 2JIVA 2VAGA 3QHRA 4YJPA 4NM5A 3D94A 3A7FA 3PE2A 4UX9A 1YOMA 3PXRA 3ROYA 3RCJA 4QP7A 2EKFA 3QZFA 4DH1A 2YAKA 3C1XA 3Q5ZA 3K9PA 3FMJA 3VRYA 5KMNA 2VN9A 1Q24A 3R30A 3GBZA 3OVVA 4IWPA 3BRBA 4HJOA 2X8EA 3A4PA 4JLCA 2JDVA 3BBZA 2C69A 3UPZA 2YJRA 4NUSA 3BQCA 4FZAB 4FG7A 5CU6A 5D12A 3WZDA 3PUPA 1Y8YA 3GB2A 1SVEA 3O50A 3NDMA 5AR5A 5J95A 5DA3A 2C0TA 3QUDA 3RM6A 5L2IA 2UW4A 4EH2A 3ZM9A 4J99A 2BHHA 3CY3A 4C37A 3V5LA 2YIXA 4IANA 4AE6A 4USFA 3UZTA 2Z7SA 3QFVA 2CKOA 4FV1A 5AV3A 4CEGA 3BI6A 3A62A 5EW9A 5EYMA 3OROA 3W8QA 2CKQA 3PA4A 2WU6A 1AD5A 2BZJA 5FTQA 4PNIA 3JPVA 5HNBA 3TT0A 3WOWA 2Z02A 4MWHA 3DKFA 4FTOA 4F08A 4M67A 3ZC6A 1JSTA 3ZDIA 4R71A 4Y85A 3P23A 1G41A 3LXNA 3OCGA 3LXPA 5FM3A 3VS4A 1FBNA 4FG9A 3TIYA 3H10A 2PMNX 4FTNA 4AZTA 4FV2A 4DBGB 3C51A 4LMUA 2RL5A 1WBWA 2WELA 3NZ0A 2GMXA 3PY0A 4IM2A 2R3JA 3MVHA 1NY3A 4FSNA 4EK3A 1RE8A 2VTQA 4GVJA 4RG0A 3PIYA 4EK8A 4AU8A 5IMEA 3ANRA 4FYOA 4KIOA 4CFUA 1UKHA 4I5PA 3MN3A 3R00A 4ZSGA 3JY9A 1KE6A 4AT3A 4P7EA 3IW4A 2EXCX 1XBBA 3RP9A 3ZH8A 4J7BA 3VHEA 3DAEA 4E6AA 5FEDA 4MXAA 4I6BA 5IUIA 1ZYJA 1PW2A 3D5UA 2C5YA 3ENMA 3QGWA 3FLSA 4G2FA 4X3JA 5CLPA 3FI2A 3RNIA 3TNHA 3VF9A 4BGHA 4AW0A 4RMZA 2C3IB 4LG4A 1JKKA 4O0YA 2XZSA 3F7WA 3MFRA 4YJQA 3LJ1A 5D10A 1H27A 4EOIA 3DXPA 1OKZA 3RJCA 2EJSA 4CFNA 5AUUA 4R3PA 4OTFA 4AACA 3B89A 2CGXA 1M14A 3ORNA 4FIEA 3S0OA 2WEIA 3LFBA 1YHSA 4BTJA 4I24A 1VEKA 1Q4LA 3UP7A 2X1NA 1H0WA 4JXFA 1S9IA 4O7SA 4O6LA 3R7IA 2WPAA 5CEPA 3PLSA 4U8ZA 2V0DA 4OBOA 4Y72A 4BICA 4PTEA 5F9EA 2YJSA 4AW1A 2YM8A 2G15A 5DG5A 4IW0A 5KKRC 3C0GA 5M57A 4J1RA 2HZ0A 2W1DA 3MH0A 5A14A 3FMHA 4QP6A 3HP2A 3E64A 1DO0A 4XNEA 2QOCA 2X0GA 2ITNA 1T46A 1H07A 5M51A 3R9HA 5M44A 3AMAA 2BCJA 2I0VA 3FLQA 3AT2A 3HV6A 4FZ6A 4EWHA 5HU9A 2Z7RA 2OJGA 4YC3A 2EB2A 2Y8OA 2OICA 1M2RA 4H36A 4KIKB 4Q9SA 3FI4A 5CF5A 2IG7A 2YM4A 4UXLA 2VTLA 5EM6A 5DBXA 4O1OA 1O6KA 4JOAA 3TEIA 2V5QA 4BDGA 2QONA 1YKRA 2GQRA 3R7VA 3FRIA 3W55A 2L4FA 3BLQA 1RQQA 1H1RA 3LVPA 4R5YA 4BCNA 5BMSA 1OBGA 1M2PA 3N4UA 2QQ7A 3ALOA 4FV9A 3CD8A 1ZAOA 1YDRE 5IH6A 1WVXA 5L2TA 4W8EA 5CY3A 5E9EA 4CZTA 3FQSA 4FIGA 4FZ7A 4RQKA 4IZAA 2IW6A 2VO6A 2VTOA 2UW3A 3BGZA 3MY0A 4J8MA 3BQRA 4X2JA 2IVTA 3II5A 1UVRA 2WTVA 3GU7A 4RX9A 4DFZE 4PP7A 4C61A 4FC0A 2HY81 3PYYA 5CI7A 5HG7A 5LCJA 5EYKA 3KB7A 4R77A 4IWQA 2CCHA 3GT8A 4GFGA 4OBPA 3RPOA 4PDPA 5BVEA 3L1SA 5AIRA 2G2FA 3R1YA 3MS9A 4XG4A 3FPMA 2AC5A 4C3FA 4MNEB 5AUWA 3VC4A 4GJ3A 5L6OA 2ETMA 4WBBB 4O0XA 1U5QA 1GY3A 5DFLA 4I21A 4LRMA 4ZLOA 3FWQA 2PZIA 3BHYA 2W06A 4CFFA 3QD4A 4FSUA 4CSVA 4Z7HA 5AP7A 3A7HA 3ZO2A 4Y83A 4BN1A 4CCUA 4DCAA 2OO8X 3KN5A 4TXCA 2GCDA 4C57A 3HV4A 3VJNA 3C9WA 3GCQA 2WZJA 3DK3A 1R1WA 2ITPA 4F1MA 1BMKA 3JY0A 3IECA 2W5BA 3HMIA 3QWKA 2GTNA 2I0HA 3ZOSA 4AE9A 2GS7A 5AUTA 2JDOA 2A19B 2UVYA 5L6WL 4A4XA 3DK7A 4ENYA 3O51A 5CAQA 3LFQA 2I6LA 5DN3A 3ROCA 2YEXA 4O0VA 4LOQA 3C0IA 4V01A 4HVGA 3PZHA 4IC8A 2PZYA 1UU9A 2OJ9A 1QCFA 2O8YA 3UIBA 3M1SA 3GU6A 1M52A 4O83A 3D7TB 3SDJA 2VWVA 5EM8A 2P2HA 3QX4A 2WD1A 3NUNA 4FTLA 5AIKA 5J1WA 1MUOA 3V04A 4KB8A 4RVTA 1JR3E 4EEVA 1WBSA 4FNYA 3U6JA 4ONAA 1Z5MA 2C6LA 3QTRA 4L68A 4C4JA 3QQLA 5FP5A 1K3AA 2WFYA 4B9DA 2IPXA 4C58A 5DLSA 5ANJA 5I3OA 2BKKA 2PVFA 3V8WA 3MVLA 4A9UA 4UEUA 2VGPA 2R3MA 1IM2A 1M17A 4FSQA 4D2SA 3SW4A 2PE0A 3PA3A 3FZOA 1DI8A 5EYDA 4Z55A 5ICPA 3F92A 2WMXA 4LOPA 4QNAA 4XP2A 3ZTXA 4GRBA 2CN5A 1OPKA 3M11A 4TT7A 5K5XA 3F66A 1UKIA 2BKZA 5BVWA 4DGOA 2C6MA 2WU7A 4ZTHA 4C7TA 4HYHA 1VJYA 4O7RA 4TYHB 1JWHA 3MY5A 1VDLA 2WTKC 3KQ7A 4G17A 5GZAA 3AC4A 4V0GB 4JG8A 2H34A 4KAOA 5IQGA 3UE4A 1ZY4A 4GH2A 5HVJA 4J53A 2YN8A 2C0OA 2PSQA 5EHOA 4TWOA 4GK4A 1YHVA 2ZTCA 1ZOGA 2WTCA 1OL2A 4KKHA 3R9DA 4BTFA 4EQMA 2Q0NA 5L2SA 3EN9A 3F3ZA 1KE5A 4RIXB 3BLHA 3FAAA 4C3RA 1XH9A 4YJOA 2J2IB 5HE3A 2L2DA 4G5JA 4FSWA 3F2RA 2OIDA 5JFXA 2J9MA 4FSYA 1YRPA 3C13A 4M15A 4FVQA 4GVAA 4GT5A 5L2QA 4O7TA 4RIXA 5IA1A 4BDHA 2J0JA 3HV3A 2QOQA 3OY3A 2XEYA 3GU4A 4WIHA 4TL0A 2QLQA 4ASZA 3TUDA 3BBWA 4YPDA 5IQAA 5CWZA 4JAIA 4PMSA 3KXXA 2W99B 4Q5EA 2ZV8A 1URWA 3AD5A 5EDRA 3BE9A 3TV7A 3HP5A 2UW9A 4ZTQA 5DVRA 4FT0A 4B8MA 4E6DA 3T3VA 4I92A 3DNDA 4GYIA 1DAYA 3VHKA 5D1JA 5F95A 1JQHA 2UW0A 5HO6A 3WZUA 5AA8A 4GKHA 3MI9A 1PXOA 4KNBA 1NVRA 4X0MA 5IDNA 2BRMA 1YWNA 2X81A 3QC4A 5HLNA 4CQGA 2WMQA 2O3PA 5HTIA 2RKUA 3EQBA 5FP6A 3ZMMA 2CLXA 3D15A 3FYJX 4U43A 2QOFA 4PDOA 4F65A 2F7ZE 4FT9A 3TCPA 4F09A 5L8LA 4W4YA 4LYNA 2BROA 2OI4X 4F6WA 3A99A 2PVKA 1WBPA 3HDMA 4FUXA 1KOBA 3O17A 3TDWA 2YERA 3MJ2A 1W8CA 4GG7A 5IDPA 1PRYA 2YM7A 3OF0A 4L6QA 1ZOEA 2ZM1A 1YDSE 2QKRA 4FGRA 3Q9XA 2DI0A 3ITZA 4RA4A 4EKLA 4I5HA 5FD2A 4FTKA 4ZSEA 4F7JA 2ZM3A 3CR0A 1U5RA 2J4ZA 3IW8A 1VEBA 4EZ7A 4LOOA 3DBCA 4KS7A 4D1XA 4QMLA 4YNOA 1LUFA 3OWKA 5EI6A 3OT3A 3DCVA 2ITQA 3OWLA 3F5UA 1OL1A 1X8BA 3HDNA 2WMBA 3IOPA 4DEDA 4PNKA 1PY5A 4CVAA 3SXFA 3G9NA 3UNZA 4AGDA 2X39A 2ZOQA 3ALNA 4H3BA 4H58A 1H1WA 4BKYA 4QMOA 4BI2A 4L67A 2P0CA 3OMVA 5IZFA 1OZ1A 4HGEA 4JRNA 2J5FA 3GC7A 4AZSA 5HIEA 4BKJA 5EW8A 3R7OA 1NVSA 1H00A 3D9VA 4QT1A 3WARA 2PTKA 4MD8E 4BFMA 4FA2A 5IISA 5H9BA 3HUBA 3QUEA 3MSSA 5CF8A 4I5MA 5E7RA 2ITXA 2ITYA 3KK8A 3QLGA 3UO6A 2QR8A 4C38A 4BHZA 1CM8A 2UZTA 2XM8A 4F7LA 5JFWA 1BI7A 5E8XA 4AFEA 1B6CB 3NUXA 4YC6A 3LLTA 3E62A 3NSZA 4DH5A 4A4LA 4CZUA 3THBA 3AXWA 4JIKA 3E8EA 4BCJA 3Q32A 2LVAA 3GGFA 4PV0A 1FINA 4HPTE 5DEWA 3AOXA 5FTGA 4WNOA 3LIJA 3LMHA 4MNEA 4FEVA 1VYZA 5K5NA 2XNGA 3TV6A 4MF1A 3MTFA 4QP8A 4YZCA 3VBVA 4D2TA 4XG8A 3FKOA 4YZDA 1C7YA 4E20A 4ASXA 3CPCA 1KWPA 2JBPA 3FXZA 4FOCA 4S32A 3DLZA 4E8AA 4CFWA 4DF3A 4FODA 2Y4PA 4MNFA 4U40A 3PDTA 1S9JA 5JK3A 3FMNA 1UU3A 2DENA 1U59A 2I0YA 4FKTA 2W1HA 3PVGA 5EKOA 4KRCA 2ACXA 4I0RA 4BCQA 5K9IA 1W98A 4CV9A 3W16A 4EHGA 4U3YA 3JVSA 2PVRA 4OGRA 2HWOA 4JT3A 1FVRA 3FKLA 3F2AA 4KIQA 4GKIA 3LW0A 3RNYA 5FDXA 4C4IA 3OOGA 4C0TA 3S00A 4ACDA 5A9UA 1WAKA 1UWJA 3O7LD 4JDJA 4RX8A 4JG7A 4JX7A 5J87A 3VF8A 3GU5A 3R9NA 1T6OA 3WF9A 3PSDA 3TXOA 1IA9A 3NNVA 1Q5KA 5CZHA 4YTFA 4AN9A 2BRNA 2XH5A 4PX6A 3ZDUA 3SGCA 3K3JA 4ZSLA 2C68A 2WXVA 5F4NA 3HMNA 2HXQA 5IEXA 4IM3A 1EH4A 3WIGA 4G16A 2J0KA 4PL5A 4ZMEA 2PUNA 3MFSA 2G2HA 1OI9A 1MQBA 4ZXTA 4K33A 4FKRA 3RPSA 1CDKA 4ASDA 4O0UA 5LCKA 4E5AX 1H25A 3D0EA 1FVTA 4JS8A 3SXSA 4RZVA 4QQTA 2JZ1A 4IFGA 5I9VA 2GNLA 3LFSA 1Q3DA 3QTXA 4GT3A 5J9ZA 4FV6A 3LFFA 4QD6A 1E1VA 4I6QA 4KBCA 5AM6A 2J0LA 3QAME 2CKEA 2WMWA 4OTWA 1OIQA 3UZRA 4U5JA 3TDVA 3BIZA 3Q5IA 4MHAA 4GK3A 4UMRA 3MVJA 3LCDA 4KRDA 3MPAA 4QMPA 3WYYA 4Q7JA 2YDKA 3E8CA 2W0JA 4D2VA 4M66A 5LMAA 4E6CA 5HIBA 4I6FA 3G9LX 4QP4A 2R0IA 2YM5A 3VUDA 4ANOA 1OUYA 4EUUA 3OD6X 2V7AA 2JY8A 3P86A 4IB5A 1UU7A 5LWNA 2QCSA 3C5UA 3AGMA 5TO8A 4U45A 2OZAB 1VEJA 3G6GA 3QALE 4FKVA 4AOJA 1Q99A 4AZWA 5M53A 4R5SA 4Y95A 3BCEA 4EYJA 1XH4A 2YM6A 5ETAA 4B8LA 4DINA 1F0QA 1R78A 4UN2B 4DFNA 2O25A 2G3QA 1JLUE 1GZNA 2EWAA 3BHTA 3D5XA 3ZZWA 5BUEA 4WG4A 5AUVA 3ZO4A 2XK6A 2BWBA 5IH5A 3MV5A 2OXDA 2WOUA 3CGFA 5AAFA 5IMXA 1VZOA 4UWBA 5A4CA 4LI5A 3DBDA 3NUSA 4G34A 2YIWA 4QP9A 4ANBA 5HTCA 1SNXA 3CP9A 3O8UA 4XHKB 4ITIA 3IHPA 4GS6A 4UWYA 2R9SA 4A9YA 4DYMA 2Y9QA 1DM2A 4EH4A 4Z3VA 5LMKA 4NJDA 3F3WA 2PE2A 3FYKX 5LVOA 4YPSA 5E91A 2XEZA 4AA0A 3C4CA 4HGLA 2OIQA 4APCA 3P5KA 3QRKA 3NAXA 4G3DA 3A7IA 2HENA 3UNJA 4FT3A 4YU2A 1IAHA 5J79A 2IW8A 4YUQA 4TYGA 4MWIA 3PPJA 1BL6A 4FT5A 4RVKA 3UOHA 4EOJA 5IA2A 3ZSIA 1KUTA 4IMYA 3TTIA 2QOHA 4PL4A 4PDSA 4XX9A 3ORTA 2P55A 4RFMA 3LPBA 2MGWA 1XH7A 4GYGA 4RGJA 4D4RA 1HT1E 1GZKA 1Q61A 3OS3A 3BU5A 2LVOC 3CTHA 2ITVA 3U4UA 5FBNC 4JBVA 4AZVA 4IWOA 2XNNA 3CKXA 5IUGA 2OJJA 3NUYA 4C36A 3Q4ZA 2R3NA 4DFXE 2WOTA 4ZSAA 2JD5A 3SC1A 3RAWA 3UYTA 3P4KA 4XJ0A 5HEZA 1KE9A 3ZUUA 3FE3A 3PP0A 3DU8A 4YMJA 4E1ZA 2XYUA 4CFMA 2ETKA 4KSPA 4O86A 3FL5A 3DQXA 4TKSA 4B99A 2PMLX 2YISA 3AC5A 1EFUB 2XS0A 4YC8A 4APPA 5E4HA 1E1XA 2QO9A 4RLKA 4QTEA 2JP7A 2RG6A 3M2WA 4IVBA 3EWHA 2A2AA 5E8SA 3NYVA 5DMZA 4ZS0A 4I41A 3PPZA 1H8FA 4Y46A 4M3QA 3G0EA 4G9CA 4QTAA 2VWIA 4MBJA 5CEQA 4D1SA 3CJGA 3OUKA 3C7QA 5B2LA 3V8TA 1H0VA 5ANGA 5IG1A 4JRVA 4NKAA 2EXMA 3EFJA 1ERKA 4PRJA 2GNFA 4BGQA 5HESA 2WMAA 3BYUA 2NP8A 3F6XA 3KFAA 5DPVA 4EHZA 3IONA 5F94A 3NMUF 2YLFA 5ANIA 2DS1A 1TKIA 4EJNA 3ZSHA 4WNKA 1Q97A 1PXIA 3RK7A 4MX9A 5IF1A 3R9RA 3S3IA 2XK4A 5CU0A 3TV4A 4D4SA 2IZSA 2RFNA 3OXIA 1PJKA 4X2GA 3B2WA 4X7QA 4EOLA 3RWQA 4OTPA 2A27A 3D4QA 5J9LA 3DOGA 4U41A 3HAMA 2YFXA 3H9FA 4BZNA 4ERKA 4F64A 4GEWA 5CSPA 2QU5A 2RF9A 2C1AA 4QMVA 2IJMA 3W10A 2WQNA 3HYHA 4NCTC 5E1EA 5CEIA 4PMPA 2X8IA 2DHYA 4YTHA 2VWYA 3LM5A 2ITUA 4HGTA 3RHXA 1XBAA 5CT7A 5A4LA 1IASA 4U44A 4BWXA 4D58A 4DN5A 3PFQA 2VNYA 4QNYA 3G0FA 3RKBA 4XBRA 2I7QA 3MGYA 3UOKA 2OIBA 4FKGA 2GTMA 2XNMA 3OY1A 5HG5A 3QZIA 2QU6A 3FMLA 5I0BA 3LCUA 3DPKA 3I4BA 3G90X 2JZ0A 4II5A 5DGZA 4FUYA 3D2IA 3CQUA 3QRTA 4L8MA 1PXPA 4FIIA 4RPVA 2B54A 3EQHA 4R6VA 3ULZA 3MB6A 3UMWA 4NL0A 1WVWA 1VEGA 2XRWA 5KE0A 4TYIA 4Z9LA 5FRIA 3MY1A 4YLKA 2IZTA 3ZO1A 3P79A 2QO7A 5M4FA 4C59A 4M69B 2PVYA 4JAJA 4XUFA 5E8WA 5AV1A 5JMSA 3EN4A 4FNWA 2FA2A 1T45A 2UZLA 4WBOA 2W9FB 2YA9A 3ODYX 4ZP5A 4LUEA 3SAYA 4NJ3A 2X4FA 2C0IA 4BCKA 3OT8A 1UNLA 5DOSA 5CAOA 2XIXA 4HCTA 4NFMA 5I9ZA 2ZDTA 3N4TA 4CLIA 2PHKA 4UALA 3ORPA 2C3JA 3O23A 3ORIA 3TM0A 5A6NA 1QPDA 2VTHA 4M84A 1W0XC 4MF0A 1PXNA 4ZLYA 3UOJA 4FV8A 5AX3A 3NS9A 3SKCA 3AMYA 3OTUA 1PXJA 3CEKA 3FZTA 2ZB1A 3IDPA 2ONLA 4AF3A 5C4KA 2ZMCA 3ZEWA 5BX0A 4LQMA 4RWKA 4RJ3A 1ZZLA 4XG3A 3F7ZA 2GQSA 4DE4A 2XCKA 3E8DA 2W9ZB 3QRJA 5IU2A 3AMBA 5BVFA 3ELJA 5B2MA 3SW7A 3C50A 2XK8A 3H4JA 3MIYA 4RJ8A 4K6ZA 4U7ZA 3QU0A 4UYAA 5J8IA 3SOAA 5ITAA 4D4YA 3KVWA 4UMQA 3ZZEA 4DG2E 3LM0A 3DXQA 1W7HA 2WQBA 3BWJA 1FMKA 3GOKA 4JJRA 4FG8A 4MVFA 5L8KA 3JXWA 4IZYA 5ANEA 2P2IA 3FRHA 2DYLA 2PK9A 2WKMA 4HCVA 3UPXA 1SZMA 5A46A 3FHIA 2R3KA 5KUPA 2WQOA 4EC8A 2CGUA 2YM3A 5KNJA 2VD5A 2P33A 2CNVA 4HCUA 2YDIA 3ZXTA 2FSLX 4E4LA 4FBXA 1GIHA 4FKPA 3TKHA 2K9DA 2YITA 2C5NA 4KIPA 2PVMA 4AGCA 4DFLA 3PSCA 3QA8A 3VQHA 4E5WA 4NT4A 3DS6A 4CYIA 4PQNA 3PIZA 4GEOA 5DYJA 3UQCA 2JFLA 3LFEA 5D11A 3A8XA 2UZOA 2JITA 2BILB 4F9BA 4OTGA 2OG8A 2VTRA 3L9LA 4XV9A 1G3NA 4BWKA 4WOVA 3QRUA 4RWJA 4FL1A 3UVPA 4ACMA 3B8QA 3KRRA 2KNVA 5B0XA 5CNNA 4GSBA 1Q8TA 4U6RA 5JZNA 3RTPA 1PYXA 4IJ9A 5T68A 1U54A 2J7TA 3PXYA 2C5VA 3QKKA 2HWJA 1MRYA 2ERKA 4R3RA 3IG7A 4XV2A 1QL6A 5AP4A 3GCPA 4TNDA 4FV0A 2DAEA 4EZ3A 4O0TA 3JVRA 5M4CA 4EJ7A 3ZS5A 2GNJA 2GDOA 3F5XA 4DEEA 3VBQA 2BZIB 3I79A 3LCKA 4FOBA 3V6RA 3UC3A 4JNWA 4LRJA 5EQPA 2BZKB 3Q9YA 5EDQA 2GU8A 3MESA 2VTNA 3LJ0A 4YO4A 4FV3A 1A9UA 4DLJA 4RWIA 2OJIA 2PMOX 4GG5A 3L9NA 3PXFA 3PJCA 3MFTA 5DWRA 5AWMA 2QD9A 5FGKA 3U4WA 3ORZA 5EG3A 4H3QA 1ZYSA 3QZGA 3VULA 5FXSA 5KMMA 3OEFX 5K0XA 1G8SA 3P7AA 3SV0A 4O7NA 4ERWA 4I94A 2F49A 3EIDA 4I0SA 1P4OA 3QTSA 4Y5HA 3POZA 4XEYA 3RI1A 5IA0A 4QMSA 4TYEA 1OL5A 1SNUA 3DNEA 4C02A 3VNTA 2OJFE 4IX4A 5IEYA 1Y6AA 1ZZ2A 2WMVA 1Q8ZA 2FYSA 3GI3A 4IVDA 1Q62A 5CTPA 4QQ5A 5IA4A 4HVHA 3F9NA 4RJ5A 2O64A 4C35A 3GLIE 1NW1A 2QLUA 1WJ7A 3Q4UA 1OIUA 5AV0A 4IIRA 4E6QA 2UZEA 3ZFXA 5CEKA 5HO7A 1V1KA 3QTZA 5KMKA 5IQDA 4QP3A 3U55A 2CLQA 2ITTA 2WAJA 3I5ZA 4NW6A 2ZTDA 2PE1A 4QMTA 4WG5A 4CRLA 2E9UA 1P14A 3VJOA 4NM3A 4FKUA 2J90A 4P4CA 5IQHA 3R83A 3FZPA 3CY2A 3OOMA 2FGIA 4W4XA 1PKGA 3DB6A 4AGUA 4D2WA 1ZYDA 2BALA 5BUJA 5LOHA 3WE4A 3AC1A 5HKMA 3TJDA 4LL0A 4NW5A 1OBDA 3RINA 3PJ2A 4RC3A 2Q83A 3PE1A 4ARKA 4JR3A 1FQ1B 3MDYA 4ZLZA 2YZLA 4WA9A 4BZOA 2CJMA 4BDAA 3A8WA 4O7ZA 2WIPA 3VBXA 3QQHA 4RQVA 2LGCA 3DV3A 4DH8A 2YHVA 5CQUA 3GFEA 4K0YA 4TY1A 2PZRA 3ZHPC 4RJ7A 5IQBA 2JIUA 3FMDA 4FSMA 4BL1A 1Z9XA 2PU8A 5KZIA 4EI4A 2B9HA 1FGIA 2VV9A 4G6NA 4ANNA 4O2PA 4I23A 4EK6A 2NRYA 4QTDA 4O7WA 3EQRA 1IRKA 1H26A 4JDIA 3OUNB 3W33A 3R28A 3LLAA 2R64A 4UV0A 4CMOA 3NNWA 4H1JA 3R1QA 3FPQA 4EWQA 4CKRA 4Z7GA 2FO0A 2VWBA 3BKBA 4UMUA 3HKOA 4EZ5A 4CMUA 1O9UA 5HCXA 3H3CA 1ZARA 2XUUA 2B7AA 4IWDA 4UB7A 4YLJA 3NIZA 4UN0C 1XXHE 2CCIA 3P1AA 4QMZA 3NVKI 4O27B 4HZRA 5FDPA 2F7EE 3V51A 2B55A 2PVJA 3I60A 5DE2A 3GU8A 4DEGA 2C5XA 3EOCA 3F88A 1KOAA 1OL6A 2XK7A 3OW4A 5CI6A 5JFVA 2Y0AA 5GHVA 2QODA 2RSVA 1HOWA 3C0HA 4YZBA 5CF6A 1M7QA 3MTLA 3VRZA 3F3TA 5BYZA 2QOKA 3ZUVA 1JVPP 4AXAA 3DBFA 2GNGA 5J5SA 2VX0A 2DAGA 2XBJA 1PHKA 3D5VA 3NR9A 4FVPA 2MR9A 3IPHA 3NW6A 5J7HA 4S2ZA 3UJGA 2DUVA 1REKA 1VR2A 4RBLA 5D41A 2REIA 1MRUA 1XKKA 2VU3A 4U0IA 5AUZA 2YAAA 4HYIA 4I0TA 3T9TA 2L4EA 4IFCA 4U42A 5AR7A 2YACA 1UWHA 4P90A 4TPTA 5AX9A 3NYOA 3K2LA 3CE3A 5HVYA 3UDBA 4Q5HA 4ALVA 3U6IA 3G2FA 3DDQA 4L46A 2OSCA 4BDBA 2NRUA 3A61A 3A2CA 3CD3A 1J3HA 3PVBA 4LGHA 3R2YA 5ETCA 2NO3A 3DJ6A 4KSQA 3P7CA 3VUGA 3LQ8A 4A9RA 4XLIA 3HMPA 4BI1A 5FXRA 4QPSA 5JN2A 4UWCA 3ZXZA 4EQUA 1J7LA 2X2MA 4N70A 2B9IA 5E92A 3DBQA 2W4OA 3ZYAA 1YDTE 4FV5A 4F6UA 4ZS4A 4MXYA 3MPMA 3KXNA 4E7WA 2YWVA 1PKDA 3HUCA 4CV8A 3Q04A 1IG1A 1QMZA 3G51A 4F7SA 3FEGA 3HNGA 5C8NA 5JRQA 1G8AA 2WHBA 3CKWA 4FTJA 2G2IA 3VUIA 3FLZA 3NYNA 4YZMA 1ZYLA 3EQDA 3Q6UA 3FL4A 1R0PA 2EVAA 4FTAA 3GCUA 4S33A 3PVUA 2J50A 4G3CA 5HBHA 2ITWA 5KMOA 1NVQA 3GLFE 2XJ1A 4BY9E 1OGUA 4HNFA 4KS8A 4EYMA 2JDTA 1A06A 3RK5A 2OF2A 1ZXEA 4MXXA 2LBCA 4AAAA 4YJSA 4ANQA 4I22A 4BYJA 1CKPA 2BIYA 1WIVA 1M2QA 5M07A 1XBCA 4L44A 2PL0A 1ZWSA 2QSFX 4ENXA 1IA8A 4AP7A 1Q3WA 3KMWA 4BBMA 3KU2A 3R71A 4RVLA 4ZZMA 4TZRA 5AAGA 2BZHB 3GC9A 1XH6A 3TZ7A 4XV3A 2RG5A 3O7LB 2QHMA 4MK0A 4DEHA 2X6DA 1OUKA 3PJ1A 5E8ZA 4MAOA 4W4WA 3KMMA 4IZ7A 4YNEA 2PVLA 3HMOA 3MH1A 5K3YA 3V5QA 3QXOA 3EYHA 5CXZA 3EZRA 1ND4A 4FNZA 3D7TA 1WGNA 4HVDA 3VBWA 4QO9A 1ZOHA 3LFNA 2H8HA 3A7JA 3QQKA 4FTRA 4TWCA 1FMOE 2C5OA 4O84A 1WVYA 4BDJA 2J0IA 3OBJA 2CGVA 2BDWA 3SX9A 3LAUA 3UMXA 3LKMA 3QBNA 4FSZA 4ANLA 5LVNA 2ONLC 1SG9A 2GHLA 4HZSA 4FEXA 4AX8A 5IPJA 3QZHA 3R1SA 3U9NA 1NV9A 5AV4A 1ZMWA 2KNAA 3E7OA 4RWLA 3WZKA 2VNWA 3DK6A 2W1ZA 1OKVA 5DNRA 5EFQA 1PXKA 4OAUC 1APME 3SA0A 5AMNA 3TNPC 5EOLA 4FTCA 2CGWA 2CWBA 3HV7A 5M4UA 2WTJA 2H6DA 3CC6A 5AR2A 2BDFA 2IN6A 4O81A 1F4IA 2JY5A 3Q2MA 4QQJA 4ITHA 4BBEA 2OOAA 2ETRA 2PWLA 4ZTNA 4IDVA 2FSTX 1G4AE 5CSXA 2W1GA 5JT2A 3ID6C 4QPMA 3EQIA 4DAWA 2O0UA 2YIYA 2XCHA 3NUPA 5AEPA 2F9GA 5JSMA 3BV2A 4I3ZA 5A4QA 3FY0A 3QX2A 1JSUA 1K9AA 4FICA 4G5PA 3TIZA 4ZMFA 5EH0A 3RZBA 3HV5A 4KUJA 1HT2E 3PPKA 2XIZA 4EORA 2R0UA 3NUUA 3UO4A 4FIFA 4EBVA 3T3UA 4Q9ZA 1A48A 4XLVA 2HCKA 3VS7A 2C6EA 5FM2A 4YTIA 3R0TA 4L3LA 2X8DA 1FVVA 3O71A 4NFNA 4CCBA 1WCCA 5JRSA 1PYEA 5M4IA 5GJDA 4E5BA 1I44A 3JR1A 1P3QQ 1SMHA 3GC8A 2W5HA 4DGNA 4F63A 3GQLA 4TNBA 4CLJA 2OKRA 3F3VA 4MBLA 3RVGA 4KIKA 5CAPA 3FLYA 4QRCA 2JAVA 2C4GA 5ACBC 3FJQE 3HX4A 2UV2A 4M97A 1MQ4A 2FSMX 1JBPE 1GIIA 3EQPA 4ID7A 2R3FA 3C4EA 4NIFA 4A7CA 4E3CA 2W1EA 4DGLC 3TG1A 5BVDA 4JBQA 4EH8A 1UFZA 3RAHA 4NTSA 3KULA 3BE2A 3D2KA 1XH5A 1OPJA 3LHJA 4RX7A 4WRSA 3RK9A 4G31A 5CZIA 4WUNA 4ZJVA 3OEZA 5GNKA 3FZSA 5H2UA 2KNZA 4OUCA 3Q4CA 5EYCA 4A4OA 3COMA 4BKZA 3G6HA 4ANSA 4WRGA 2XJ0A 4UY9A 5C03A 3I7CA 1ZYCA 3E92A 2YIRA 1W83A 2B0QA 4ORKA 3ZC5A 4BI0A 2JY6B 1SVHA 4OLIA 3VQUA 3GNIB 3ZLSA 2BUJA 3AQVA 5HZNA 3TNQB 2UZBA 1YXUA 4FYNA 2BPMA 2FSOX 5M56A 2C3KA 4ZIMA 2YLEA 1OPLA 2QO2A 4FTUA 1WBOA 5EHYA 3VUHA 4BDDA 4EH5A 1QPJA 3BYMA 4NCTA 3BLRA 1YXSA 3F5GA 5BMMA 4BYIA 4C2VA 3E93A 3BU6A 4WKQA 4D4VA 3GVUA 3VS6A 2G1TA 3ZEPA 3C4XA 3B8RA 2VTAA 2W1FA 2WTKB 2Y6MA 3ZONA 3TI1A 3Q9ZA 3RPRA 4ACCA 3ACKA 3QCXA 4ZAUA 4BCIA 1NT2A 2HYYA 2OOBA 1H1SA 1UU8A 5JGBA 2WB8A 5HO8A 3HA6A 5CASA 2JGZA 4IB1A 3T6PA 3FMEA 5CVHA 3OP5A 4BCOA 4QYEA 2R7BA 4HVSA 1DAWA 4YURA 3RAIA 4D0WA 5IUHA 4U9AA 5HG9A 3Q9WA 2FB8A 3MA6A 4UMPA 4O7YA 4BCGA 3IOKA 2JDRA 3K5VA 3BHUA 3LFDA 3UVRA 2QOBA 5BVNA 1DI9A 3AT4A 1KE8A 1YWRA 2VUWA 3EKNA 4DG3E 2DQ7X 3NRMA 4L42A 3ZBFA 5JZJA 4TRLA 3R22A 5M55A 4F9AA 4DBXA 2Y4IB 3QCQA 4JQEA 5L8JA 3I81A 4R1YA 2XJ2A 3EL7A 5L4QA 3MIAA 2HZNA 4OW8A 5CALA 4WNMA 3KREA 3PLAE 1TTEA 3RGFA 5HHWA 4D28A 5T6KA 4AUAA 2BAQA 1V0BA 5HORA 2FH9A 4HOKA 3DAJA 1HJPA 2OH4A 1YLAA 4FI1A 4ITJA 1RDQE 3IGOA 3KKVA 5E8TA 2Y4IC 5B2KA 1R3CA 3GFWA 2UZNA 5FEEA 3OC1A 3N9XA 3CSVA 3DTWA 5DRDA 5HIDA 5IKWA 5LJJA 2ZM4A 3UIUA 4HVIA 4F9YA 2WMRA 3TKUA 2X7FA 5E90A 3LCOA 3R63A 3I7BA 2YCFA 4FK3A 2QOOA 4XCUA 3V6SA 1E94E 4AWIA 4P5ZA 3UP2A 5AUYA
chains in the Genus database with same CATH superfamily
3UVQA 5CF4A 4F4PA 4CRSA 2QG7A 4P2KA 1PXLA 3ZCLA 4PMMA 1XXHB 3HA8A 4EH9A 5J1VA 1IFYA 3NCZA 2P5TA 4MD9E 4PMTA 4OAVB 5EQEA 2W96B 1L3RE 3JR4A 3UK6A 2CMWA 1OQYA 2CDZA 2DKLA 3IGGA 4YHFA 1GNGA 4RA5A 5EM5A 2ESMA 1XHAA 2OH0E 2X7GA 4G3EA 1V92A 4CGYB 4KHPM 4O1PA 5DFPA 1JKSA 4YBKA 1GAGA 3NNXA 3V8SA 5ANKA 2Y0TA 4NWMA 4WO5A 4D9TA 3AD4A 4NKSA 2J5EA 4FKOA 2CRUA 4RIYA 4BCMA 5GIPE 1QANA 2XP2A 1H1QA 4AA5A 4QMXA 4BCHA 2HK5A 3E4RA 1JNKA 2X0PA 3DKGA 1NJGA 1O6LA 2XGNA 3HZTA 4FIHA 3VWAA 4I4FA 4I93A 3WILA 1PMUA 2C47A 1WFCA 1IY0A 2XFSA 1Z57A 2W5AA 3FI3A 2PVHA 4MEDA 5H8GA 2ITZA 4JI1M 5JQ5A 4BR3A 4NZWB 4FWHA 2OFUA 1L8TA 4GCJA 3FHRA 3QXPA 5EHLA 2Y20A 1TQMA 3QGYA 1R4GA 3R6XA 3SXRA 1CSNA 4IVAA 3UDSA 1XJDA 1URCA 1B39A 5FTNA 4JDKA 3WF7A 3ZLXA 2OQ4A 2R3PA 3CQWA 4N0SA 5HLPA 3R7GA 4BWPA 4LV7A 3BBTB 4D0XA 5E8VA 2NPQA 3SD0A 4O82A 3P7BA 5FTJA 4LGYA 1H24A 3Q4TA 3DY7A 5CU4A 3IDBA 3W0OA 2ERZE 3I51A 2JLDA 3PVWA 4K9YA 4F99A 4K77A 1N33M 5AP1A 3HJQA 4E93A 4RIWA 4IZ5A 1QUSA 4JI3M 4U81A 4CYJA 4M0WA 1VYWA 5HLWA 3R8PA 3JS2A 3DFCB 2BRGA 2ZBKB 3QA0A 4WUAA 2R6FA 2QURA 3ET7A 2HHHM 4RJ4A 3V01A 3PUFC 2OW3A 4GIIA 2O01F 5HTBA 4U3ZA 3BYSA 4UBAA 1JKTA 5BYYA 2UU9M 3QQUA 3ZU7A 3NVMB 4NU1A 2F57A 4DV4M 2X2KA 4G9RA 4X2FA 5LMBA 5LARA 5F3WA 2XA4A 4J98A 2IVVA 5E1SA 4LL5A 4ZY6A 4FL2A 1YOJA 3TL8A 3AT3A 5CENA 2WO6A 4NM7A 4P16A 5GZ9A 2H5XA 1S3SA 3K54A 3P5JC 3ETAA 2H96A 3PSBA 4FIJA 3L8PA 2OBJA 4LF8M 4R7IA 4CFXA 1NA7A 4UXQA 5KX8A 4DR2M 1OVEA 1SXJC 3BGQA 4IAIA 1G5SA 3Q96A 1IAJA 1HR0M 2ZVAA 5IQEA 4XOZA 2JAMA 2D7EA 3GCVA 3J2PB 4QMWA 3VIDA 1FJGM 3DXNA 3DQWA 3W0RA 5AR4A 3ZRLA 3OTVA 3GLHE 4LJAA 3O8TA 5KBRA 3NAYA 2UW7A 2OO9A 2XK9A 4FTIA 1PGYA 3UOLA 2XZUA 3V3VA 4QDVA 3SHFA 3FDNA 2LHCA 1D0LA 4B6LA 5AAEA 4JL9A 4AQKA 2GQFA 2JWSA 1UV5A 4BIBA 4CKJA 2H9VA 2CP8A 3W2CA 4O4FA 2XNEA 4BJJB 3B9PA 1PJJA 3NYXA 4KODA 2PZ5A 4DA5A 2G01A 4C4GA 2J7NA 1Q39A 3KOWE 3LE6A 4TW9A 3BYOA 4F70A 3UQGA 1Q3CA 3O96A 4UZHA 5EP2A 3KMUA 3GLHA 4FTTA 5EXPA 4G1WA 4HGSA 4KBKA 1PMNA 4IH8A 5HU3A 3F61A 3QKMA 4PDYA 2FVDA 3P08A 3E3PA 2VQEM 2R4EA 3HECA 2QHNA 3MJ1A 1GIJA 4V04A 5C26A 2I1MA 3KIOC 5CNOA 1YXTA 3ANQA 3FC1X 3GP1A 4IAYA 3C4FA 2B3TA 3KP0E 2XMYA 4R8QA 4E4NA 2CV0A 3ORLA 4EOKA 3RE8A 3KCFA 4L45A 3U51A 4S12A 3AC8A 4BGGA 2HIWA 3BHHA 3GRYA 4WP2A 3ERKA 5EP3A 1K2PA 4XS2A 4AT5A 5I5ZA 4AXFA 4ACHA 2UUBM 2CSNA 4FMQA 1NV8A 5C1QB 5KKRB 4O4EA 5CU3A 2HWPA 3EFKA 2Q0BA 3NX8A 4QPAA 5AV2A 4IJFA 4WG3A 1GJTA 4IBMA 4B4LA 4YJVA 1PMEA 1L1ZA 1RW8A 4RNAA 2XNBA 2XIRA 2W4JA 2XKFA 3W68A 5AP0A 5GJGA 3RAKA 4EOMA 5LQFA 5HCZA 3CTQA 3EH9A 3DJ5A 5EI8A 1OM1A 4P5QA 3OW3A 2XKCA 4XOYA 3LQ5A 4DHJA 2XF0A 4QMMA 2GQGA 4OX9M 3U6QA 2XRUA 3OHTA 3POOA 5HE1A 4DV6M 3A60A 4YZNA 1BLXA 2F4JA 3W32A 1U4DA 3I0OA 2WQMA 2CUZA 4F2LA 4USEA 1Q8YA 3UG2A 1J5EM 1KV1A 2VWWA 2R3LA 4USDA 5H8BA 2HOGA 4JI4M 2IZRA 4AN2A 5EI2A 4J8MA 3NBIA 1OKSA 1JKLA 5DT0A 3H0YA 3Q3BA 4FZFB 1JSVA 2HY0A 3AKJA 3VBYA 3SRVB 1DGGA 1DGFA 1IXSB 3KXZA 4FVRA 5CSHA 1LEWA 3G33A 4MCVA 3AKLA 4DV1M 4MM3B 3DAKA 3QWLA 4NH1A 2JXNA 1BYGA 2X7OA 4WNPA 3RM7A 4ASEA 2CNUA 3PRIA 2XIYA 2DAKA 4A9SA 4XP0A 5DR9A 2JEDA 4O6EA 3OBGA 4QYFA 5ITXE 2WTDA 3MPTA 2YCSA 3PJ3A 3TN8A 3Q8XA 3ZUTA 4HW7A 5DR2A 4O21A 4DH7A 5D9HA 3N51A 1MJGM 3UC4A 4S31A 2X8AA 1OIRA 3QF9A 3CTJA 4FJVA 2WMUA 2ITOA 1OFHA 3F5PA 5AM7A 5E8YA 3TWLA 3TNWA 3H30A 4OTQA 1PRBA 4IHPA 5F1ZA 2XIKA 4O22A 2YCRA 3T8OA 4DHFA 3GLIB 3TUBA 4F9WA 2OXYA 3SG8A 2B52A 4L00A 1GO5A 2UUEA 2BFXA 1OTRA 3VONA 2ZANA 3KY2A 4B0GA 2BTRA 4DITA 2UXCM 2VGOA 3LMGA 4RFZA 3HHXA 5C9CA 4BC6A 5K4IA 3ORXA 4IX5A 1REJA 3NNUA 4AT4A 5IQCA 3E87A 3WHLA 4LJ9A 1R39A 1RJBA 4PPAA 1X37A 5FXQA 3VUTA 3W2SA 4DG0E 2HW6A 5BVOA 2R4BA 3VS1A 4L7SA 5AP5A 1AIPC 4JR7A 2E9OA 3FUWA 4W9XA 2JUJA 3U61B 4AW4A 4J71A 2ZAZA 2DWBA 4RFYA 4BDFA 4EK4A 3DZQA 2RGPA 3E21A 4M69A 2XNOA 3PP1A 1Z5BA 4YSMA 3GLGA 3QKLA 3FXWA 4RJ6A 4CT2A 3JUHA 3LJ2A 2J0MB 1QPCA 3AD6A 4IBEA 3TWJA 4IQ6A 1E9HA 3AL0C 4L3PA 2W05A 3QTQA 2RFEA 4R7HA 3OFMA 5C8KA 1IN4A 2I0EA 4M0ZA 5DR6A 5HI2A 4LF7M 4YLLA 4GC9A 2BRHA 2CPKE 2K0BX 5G6VA 2CV1A 4IX3A 5A4EA 4XG7A 2HW7A 5IQFA 5AJQA 1LP4A 3SRVA 2Z4RA 2OGVA 2LVPC 4UZDA 4IAAA 1G3IA 4MXOA 4FKQA 1SM2A 3OXZA 4AXDA 1YXVA 1QYRA 3BYVA 4BTKA 4CG8A 4TWNA 4LMNA 2VTPA 5KQ8A 3B7QA 2QI8A 3S2PA 2KHHA 3U6SA 3U6LA 2R3GA 2DWLA 3R21A 4KD1A 3FTEA 5HNGA 4ACGA 1PMVA 3DFAA 1ZRZA 5BNJA 4L01A 1WBNA 4YHTA 3S95A 2OZOA 4H3PA 4CXAA 3D7ZA 5DIAA 2PMIA 4OTIA 2F7XE 4LF5M 3KOXE 2V6ZM 3PWDA 3E63A 3PXKA 3V5PA 4EH6A 4LCBA 2IVSA 3I6WA 4L3JA 4GJ2A 5DT3A 1OKWA 3ATSA 3QD2B 3W2OA 2R3QA 2VQFM 2VTSA 3QUPA 3WYXA 4M7IA 4L53A 1J1BA 5IT9S 2GNHA 2VTTA 4MQ1A 2KZSA 3NPCA 3RMFA 4M0YA 3K3IA 3D14A 5HQ0A 1G59A 3SVVA 4F78A 1H4LA 3CXWA 2P4IA 4FGBA 2BMCA 1YWVA 3FC2A 4QMYA 3TPZA 3PVSA 4FCWA 5CS6A 1SYKA 4JDHA 4EONA 1N32M 4RF1A 3FMMA 1LTMA 2DXIA 4DH3A 4ALWA 4FKIA 4EK5A 3KEXA 4NSTA 3EJ1A 3QL8A 2QOLA 4LGDA 5HE0A 4B08A 3HEGA 3IDCA 2DZLA 3F82A 3DGKA 5EXXA 2GPHA 4J8NA 4NM0A 3OCBA 4O96A 3NBXX 4D2RA 1HCKA 4PPBA 4PTGA 2C9CA 4MD7E 3UYSA 4QNMA 4A07A 4DC2A 5I9XA 5EK7A 3ZLWA 5F20A 4F1OA 3FLWA 1BL7A 4NIFB 2LWXA 2CN8A 2BDJA 2UZVA 4BDKA 2ZB0A 4EK6A 3R8LA 4GV1A 4KA3A 4DFUA 2XK3A 5KCVA 5GZ8A 3AJIB 2QHOB 2VWUA 2X49A 4Y28F 2A5YB 1XQZA 3C4WA 3PRFA 4FZDB 4IBCA 4MH7A 4W8DA 3CQEA 3R1NA 4GFOA 3BGPA 4YR8A 5M09A 1LPUA 4C62A 3TWKA 2XB7A 2GHMA 3A45A 4QP1A 4X2KA 4B7TA 4E73A 2F2UA 4QMUA 3WE8A 3PA5A 5FG8A 3ZBXA 3AKKA 3LFCA 2CNQA 4D81A 1PF8A 4I6HA 4ZZNA 5CANA 5JQ8A 2XBAA 3EQFA 4JG6A 4IAFA 5K4JA 3WF8A 3S4QA 4OR5A 1BX6A 1W5SA 2YR0A 3DTCA 3QWJA 3RPVA 5CX9A 4C33A 5KHWA 4E4XA 3DZOA 3TACA 1N75A 2FUMA 3PXQA 4CD0A 2V7OA 3O0GA 3LXKA 3FZRA 3OXTA 4FL3A 4I20A 2HXLA 4PL3A 4I1ZA 4TWPA 1I4WA 3V5JA 4CKIA 3L9MA 4ALUA 5BPYA 4CTCA 5JH6A 5KBQA 4WD5A 4ANMA 4IEBA 1KSWA 4BRXA 4DFYA 4D9UA 2JIIA 3D83A 5IEVA 3VW6A 3G5DA 2OK1A 4LV5A 4O0SA 4Y5QA 4AW2A 3COHA 3LZBA 4O91A 4QYHA 4I5SA 2UXDM 2ZJWA 2CHQA 1NHWC 3IK3A 3KULB 3ORKA 4X62M 1WMKA 4UMTA 3LOKA 4BDIA 1F5QA 5I9WA 5A4TA 5BVKA 1V0OA 3GEQA 1O6YA 2Z7LA 5TKDA 3IG8A 3CBLA 5EKNA 4NSRA 1BVSA 2WTIA 2D7HA 2Y7JA 3PIXA 3QC9A 3R01A 4O2ZA 3SLSA 3WI6A 2O2UA 1QPEA 4MQ2A 4F0FA 3AC3A 3GLHB 2Z2WA 4O38A 1HQYE 4RIWB 4YTCA 1ZMVA 4LM5A 3KRWA 4XMOA 4J52A 2C1BA 3BEAA 4MH0E 4WURA 3HVCA 2W1IA 3OZ6A 2C6TA 4PF4A 3DT1A 2E9NA 2J6MA 2YCQA 3FI8A 1PJTA 3OCSA 3ZLYA 4EOOA 4JQ8A 1H08A 2LVNC 2E2BA 2N35A 4PDIA 1OMWA 2BTSA 3EHAA 3F69A 4G3FA 4X21A 4CT1A 1OITA 1PXMA 3EN6A 2XARA 4LF9M 4LJ5A 3NW7A 3Q60A 4M8TA 4XBUA 2CEAA 3PNVA 2YDJA 4MYGA 5A6OA 3MFUA 1U54B 1B38A 5L8RF 4C4FA 2IVUA 4QTCA 4C8BA 2R7IA 1GVNA 3Q6WA 2F2CB 3ODZX 4R3CA 3KC3A 2GFSA 3V5TA 4FR4A 4IDTA 4LV8A 4FSRA 4Z16A 3FXXA 4X6RA 1J1CA 2X4ZA 2VX1A 4PP9A 3RPYA 3QLFA 4YP8A 4ZY5A 3SAVA 4G3OA 3LCTA 4YSJA 4AZFA 3PZEA 4FGRA 4YZ9A 3MBLA 2DAIA 4EHVA 3N4VA 1ZAEA 4RIYB 3ZM4A 4BZDA 1IY1A 3DBEA 1IEPA 4QMNA 2PPQA 1UNGA 4H05A 2J5YA 4JI9A 5DI1A 3WHKA 4IAKA 5A54A 4DFBA 3TNHA 3HU3A 1KE7A 1XR1A 3W2PA 4M68A 4EC9A 2KEBA 2SRCA 1VQ1A 3ORMA 1YE9A 2X6EA 5EOBA 3HMMA 2QG5A 4FE2A 4AA4A 5IH4A 4AQCA 3IW5A 4G4NA 4CZYB 3FQHA 2C9OA 4M12A 4AKIA 2PZPA 3KA0A 2QR7A 3V5WA 4K1BA 3A46A 2BR1A 2JY7A 2XKEA 3HRCA 4L7FA 2XZFA 1CMKE 1JPAA 4FX3A 1KFVA 2HELA 5CU2A 5ITUA 3U60A 2PY3A 2EB3A 2HZIA 2R3RA 3AGLA 1E9RA 2KW0A 4QHSA 2QC6A 3DLSA 3QCSA 2VWZA 4CNHA 4FEXA 4FSTA 3KCKA 4DR4M 2UZDA 3NEWA 1C1KA 2VX3A 3R8ZA 2A1AB 4YHJA 4IM0A 4IBFA 2UUAM 3HLLA 4OT5A 4D2PA 5KO1A 5CSWA 1PJSA 2UW6A 4GT4A 5D7AA 3CJFA 3FZ1A 2Z3XA 2X9EA 5FWKK 3UIMA 3NW5A 2C98A 4DBNA 4ORKA 3IKAA 4G6LA 3F2NA 3TZ9A 3ZFYA 2O65A 3W18A 1Y8GA 2F5OA 2IZUA 5H3QA 1NY5A 4I4LA 3GPXA 3HAVA 4F1TA 1P5EA 1H1PA 2JKQA 1Q41A 1D0KA 3TTJA 4YJNA 4ZY4A 4LZZA 3J27B 4R1VA 3DB8A 4YGAA 3LFAA 3O2MA 2I40A 2UZUE 2XYNA 2XLJA 4BBFA 3E3BX 1IXRC 2JNHA 1WZYA 5IA5A 2Q2EB 1HNZM 1FGKA 5ETIA 2PVNA 2VO3A 4W9WA 1OAIA 3E46A 2ZV7A 3HRFA 4LRKA 2QQ8A 5HX8A 2BAKA 5I4NA 2OU7A 2QKWB 2C6KA 4RSSA 2UVZA 1YVJA 2MH8A 3CLYA 5AP3A 4DGMA 5HE2A 4DEIA 5CSVA 2QP9X 4JIAA 4IACA 1Y6BA 1Y57A 2JC6A 4F7NA 5TR6A 2C30A 3DDPA 5CVGA 5DHJA 1WGLA 5HGIA 2OXXA 5GIOE 4DEBA 3DA6A 3L9PA 3QTUA 5CXHA 4I5CA 5BR8M 2IWIA 1UNHA 4ZJIA 4K18A 2P3GX 5I9YA 3TNIA 4OT6A 2OF4A 4YBJA 4DDIA 4OW0A 3DKOA 3PG1A 5EW3A 3QQFA 1DGHA 3PTGA 4D5KA 3MB7A 4D1ZA 2WIHA 3W1FA 5JEBA 1OL7A 5GKNA 3QQGA 1XWSA 2OFVA 2VO7A 3A4OX 2PULA 2X2LA 4FV7A 5J7BA 3RGSA 2W17A 2EUFB 4ZTRA 4JVGA 1DV0A 3MH2A 1VG5A 3LCVB 1JR3A 3I6UA 1XNRM 1W84A 3CPBA 2C6OA 3KN6A 3ZRKA 2NNWB 2XNPA 1J7UA 3K9OA 5AADA 5AR3A 2B4SB 4I81A 5ITQA 3WZEA 3UBDA 2DWZB 3PJ8A 4BDEA 3O5AA 4O7LA 2GFCA 3PXZA 5A3XA 2RRUA 1IN6A 4B3TM 3FV8A 5FTOA 3FMKA 3LMIA 1TDHA 4XBOA 4IB0A 3R2BA 4MKCA 3HHWA 2QOIA 4RVMA 5IQIA 3EB0A 3JR5A 1N77A 3PWYA 1YOLA 3K5UA 4PPCA 4GW8A 4AFJA 3M42A 4AGWA 5CVFA 1XB2B 3VFDA 3T1HM 4XG6A 1IR3A 4DGGA 3KRXA 4NTTA 5CQWA 1OIYA 2HZ4A 3BWFA 1XC8A 4XRLA 3EMGA 4LUDA 2NYAA 1Y91A 3C9PA 1TZDA 4IXPA 4QQCA 4QYGA 4XG9A 2B9JA 5FBOA 3UGCA 4DEAA 4EKKA 4OVZB 3W2QA 4AOTA 4KWPA 5KZ0A 1BUHA 3CS9A 3VS0A 3PY1A 5L2WA 1IXSA 1T43A 2EKKA 4N4SA 5T3QA 1J7IA 4CG9A 2BRBA 4MUQA 1BI8A 2WMTA 4IE9A 1FPUA 3VN9A 5LMKC 4S34A 1UA2A 2WTWA 4EHEA 4RC4A 3LCSA 5HBEA 2GHGA 4YJRA 3C5IA 2ZV2A 3RHKA 4K8AA 5AA9A 4J95A 4DR7M 4FWGA 2M60A 1HCLA 2O5KA 1WBVA 2JKKA 3KOYE 2OZAA 3IQ7A 3COIA 4F9CA 2RFDA 1J91A 4RRVA 2MROB 5LVPA 3BX5A 4JBOA 4YJUA 3GENA 4RZWA 3B7NA 3GOPA 3HRBA 3H9RA 3NIEA 5AP6A 1KYIA 2IW9A 1SXJE 3G15A 3BELA 2R18A 1TQIA 4S30A 2B9FA 5E8UA 3W2RA 2UW8A 1GOLA 3KVXA 1ZMUA 2GSFA 2WSEF 3O8PA 4ZK5A 4PY1A 1I09A 3EN7A 3OCTA 4NXNM 4RLLA 4WSQA 5LWMA 1MP8A 1M7NA 4FEWA 1V0PA 1JQJC 4HLQA 2GS2A 1ZV1A 3AOEC 5DEYA 4IB3A 1YQJA 2E9VA 3IW7A 3GQ3A 3VAPA 1H28A 3ACJA 2Z60A 3HY5A 2LTUA 1PJQA 3KXGA 4EUTA 3F3UA 4DT8A 3W0QA 3QD0A 3UTOA 4HPUE 2MJ5B 1OKYA 1Q02A 2V62A 5DNYA 3AC2A 4X6QC 2AUHA 1YI3A 4OBQA 5EXTA 5D7VA 4ZTLA 3I0QA 2V22A 4OTRA 5HVKA 3PNYA 3FSFA 4XYFA 2BIKB 4K11A 3J80S 1W2FA 1XO2B 2L09A 4G6OA 4EH3A 4IX6A 3GLIA 4I4EA 4N6ZA 3VS5A 3ZSGA 4AW5A 1ZQ9A 2B53A 1GKIA 2X0OA 4FEQA 4BTMA 4FW9A 3R04A 4IADA 1Z59A 1HNWM 5HD7A 3KFUG 2VO0A 3I04M 3FTFA 3D5WA 4M14A 4QOSA 4MGKE 4DR6M 2A4LA 1R2YA 4JQ7A 3NUAA 3MK6A 4GK2A 4AXCA 4BCFA 1YI4A 1ZLTA 3OG7A 4GU9A 3TUCA 2HAKA 3T15A 4LG2A 1JB0F 1QZEA 1OECA 3EYGA 3UZPA 5CEOA 5HBJA 2QPAA 3GUBA 5I9UA 5K0KA 3VS2A 3MVMA 4R7BA 4DTBA 3NFFB 4RIOA 3WZJA 3I5NA 3HU2A 4A3VB 1TVOA 3QYEA 1W2CA 4EOQA 4M13A 3FYDA 2YZAA 4AS0A 1A5TA 3T9IA 5TOZA 3NLBA 1DS5A 4DTKA 1H01A 3P78A 4AG8A 1AQ1A 5ITYA 3SYLA 3I1AA 3RCDA 3RWPA 5JGAA 1YHWA 4AOIA 3UZUA 2FNAA 4HYSA 2GNIA 3KF7A 4C3PA 4FK6A 4LJ8A 4J96A 4MXZA 3MYGA 4R78A 4FT7A 5JKGA 3EQGA 5EDPA 3REPA 5CEMA 4QYYA 4H1MA 5HCYA 3R8VA 2WMSA 3EKKA 2R3HA 3W0MA 3AV0A 2XKDA 4X3FB 5G1XA 1NXKA 1ZY5A 4CISA 4NYEA 3OWPA 3FQEA 3KXMA 4ZTSA 5C27A 4L9IA 3FY2A 3BZ3A 4Y73A 5TE0A 3SQQA 3WF5A 3QCYA 3BEGA 4WHZA 3VS3A 1WBTA 2UW5A 1GZ8A 4BHNA 4IAZA 4NK9A 4B3RM 1Q8UA 2R3OA 2XM9A 4WW0A 4YO6A 2PUIA 3KGAA 4Y8DA 3IS5A 3SOCA 4O0WA 3C4ZA 2QVSE 4DT9A 5HICA 2Z8CA 1Q8WA 4X3FC 5CT0A 2J7OA 5GJFA 4OTDA 3GP0A 4A06A 3UQFA 2HKJA 2RIOA 4JI6M 4CGAA 4CFVA 5JFSA 3GRUA 1R0EA 3R8UA 3HL7A 4FD2A 3FUPA 2VTJA 4GU6A 3ZRMA 2APLA 4G4RA 2R2PA 2DAMA 4OTHA 4ZEGA 3KRJA 5BUIA 1YW2A 5AP2A 5JGDA 4EL9A 3RFWA 1OB3A 2FOIC 5L6PA 3FKNA 3TKIA 2EU9A 3KRLA 3BHVA 4WT6A 3CIKA 1P4FA 2KTYA 4FF8A 3GLGE 2X9FA 5CAUA 5BYLA 5EP1A 5EJCA 4TN6A 3EN5A 2RFSA 5HG8A 1IXZA 3DKCA 4FV4A 1GZOA 4GFMA 1IN5A 4F6SA 5J5TA 2R46A 4Z6YA 4QTBA 4GUBA 3UO5A 2V1CA 3COKA 4GMYA 5CAVA 3VKHA 2C6DA 3KXEC 4GUEA 5L3AA 2J51A 3VO3A 3HGIA 2RGHA 3MWUA 4X2NA 4BJJA 3MH3A 4QMQA 5C4LA 1SXJA 5KMLA 4N57A 2DNAA 4KKEA 4X3FA 3U8WA 2A0CX 3RBWA 4BI0A 3VVHA 3GXLA 5HOAA 2ZV9A 3R7UA 1QUTA 2AQXA 3QHWA 4L8RC 1STCE 2C6IA 3LXLA 4ZJJA 4G4OA 4C4EA 2ZMDA 3R02A 3VBTA 3BPRA 1GJOA 5TT7A 4EH7A 4JI5M 4IC7A 3UODA 4NOOB 4HEOA 3NCGA 4LGGA 4RX5A 5LXMA 4LFIA 2VTMA 2PUPA 2CHGA 2YWPA 5C8MA 2Z7QA 2WGJA 4MBIA 4TYHA 5EQTA 2QNJA 3DJ7A 4QP2A 5DT4A 3E8NA 1KV2A 4E3CA 5B7VA 4XH6A 5HD4A 3U6CA 3VUKA 3JYAA 3U87A 3UIXA 4BCPA 3Q53A 4TTHB 4QDEA 3ZH9B 4JN6A 3FSKA 4FKJA 4O7VA 4HNIA 1CKJA 1WHCA 4L52A 4IJPA 3FBVA 3W0FA 1YXXA 5JI2E 2E9PA 3R7YA 3SHEA 2QENA 2V55A 2VRXA 1CUKA 5EM7A 2QZ4A 2B1PA 2W7XA 3E88A 3EQCA 3GC0A 3NWWA 3U6MA 5DRBA 2BHEA 1XH8A 2AYPA 2EXEA 4GIHA 4M9ZA 4TYJA 4U80A 2W82A 3P0MA 3AOEA 1U46A 2PUUA 4BDDA 2LVQD 1W82A 2W4KA 5C01A 5TF9A 5BQ0A 4RT7A 4L43A 4XV1A 5LVLA 4C34A 4NRVA 1JOWB 2O63A 4EIWA 1DO2A 2YIQA 2R3IA 4J97A 4E4MA 3QYZA 2AEGA 3EFWA 3H0ZA 3P9JA 3Q52A 5HNIX 3A7GA 3KSJA 4M9SA 3KL8A 4QOXA 5J9YA 4K2RA 3PY3A 3LVWA 3MMPA 1F3MC 1LR4A 5FQDC 3ENHA 3RZFA 4BB4A 4C4HA 5I3RA 2PYWA 4MTAA 5CYIA 3CCNA 3QQJA 2Y6OA 3TZ8A 3MA3A 3WF6A 2VTIA 4DCEA 2OLCA 4V05A 1MN3A 2BVAA 3L8SA 4C2WA 2JDSA 4EBWA 3NFGB 3SAUA 4RC2A 3QTWA 4JX3A 5AUXA 4BVUA 4XG2A 5EP4A 3H9OA 3U6HA 1YI6A 3QTIA 3CF2A 1LEZA 4GL9A 2XH9A 2C3LA </