2QO5A

Crystal structure of the cysteine 91 threonine mutant of zebrafish liver bile acid-binding protein complexed with cholic acid
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
129
structure length
129
Chain Sequence
b'SAFSGTWQVYAQENYEEFLRAISLPEEVIKLAKDVKPVTEIQQNGSDFTITSKTPGKTVTNSFTIGKEAEITTMDGKKLKCIVKLDGGKLVTRTDRFSHIQEIKAGEMVETLTVGGTTMIRKSKKILVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Liver-basic fatty acid binding protein
publication title A Single Amino Acid Mutation in Zebrafish (Danio rerio) Liver Bile Acid-binding Protein Can Change the Stoichiometry of Ligand Binding.
pubmed doi rcsb
source organism Danio rerio
molecule tags Lipid binding protein
total genus 25
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2qo5A00
3BSZE 2Q39A 2RD7C 3FR2A 4IMOA 2OFMX 4HPAA 1KQWA 3EMMA 2A2GA 5IO5A 1U17A 3WJEA 4A8ZA 3F9DA 3P6EA 1LIEA 4ZFXA 2AT0X 1MUPA 1ZNEA 1MDCA 4YKMA 5L8OA 3CQRA 5D45A 5HCEC 4IAWA 5F6ZA 5D8JA 1EIOA 1X8UA 5LKFA 3VG6A 3WJBA 5F6BA 5LKEA 4NNSA 1BRPA 2RCQA 2CM9A 1G7NA 1MX8A 3P6CA 4QZTA 1XCAA 3APVA 1OBUA 5BVSA 5EPQA 3MBTA 5BVQA 1GKAB 5F58A 2XSTA 1EQDA 2FS6A 5KHPA 2JU3A 2AH7X 4MVIA 4YGZA 5K06A 1DV9A 2WQ9A 4HFOA 1YWBA 2HZQA 3HWDA 5LJDA 3TGAA 5HBSA 4EFGA 4OMWA 4ALBA 2FTBA 2AKQA 3P6GA 1SY3A 3STKA 2HZRA 2X46A 1SY0A 5D4AA 1MVGA 1IW2A 2NNQA 5FAZA 1JZUA 5AQ6A 5DPQA 1ZRYA 1LNMA 2K23A 4GNWA 3U03A 1B0OA 1NP1A 3ELZA 4AZQA 2F73A 1ZNKA 1ZNGA 4Y0RA 4ZH9A 4HPCA 1BRQA 5LJHA 1CBQA 3HWFA 3RSWA 4NLJA 3JS1A 1X8NA 2Q2MA 5HCCC 2JOZA 2P8GA 1BM5A 2ANSA 2QO4A 4YDAA 1U0XA 1L6MA 4NP1A 5CE4A 3EM0A 2RQ0A 4ZHCA 2ASNX 3WXQA 2QO5A 2DM5A 3STMX 4OS3A 3FELA 3BDRA 1HBQA 3TF6A 4ORWA 2A13A 2FS7A 3Q6LA 4QAEA 3KFIA 1QABE 1YWCA 4TLJA 1KT6A 5HZ9A 1A57A 2AT8X 1QY0A 4YGHA 1ICMA 4QYPA 4BVMA 3B2HA 1SXUA 3PPTA 4IB9A 4DQ3A 4QGWA 1ALBA 1ICNA 2RA6A 5HZQA 3FW4A 2R74A 4YH0A 5HA0A 2QOSC 2FT9A 2WUTA 4PSQA 5HZ6A 2JU8A 1IFCA 4O9SA 1GT3A 2A2UA 3WJGA 1KT3A 3HK1A 5HCDC 5HA1A 1T0VA 1E5PA 1DFVA 1GT5A 1GGLA 5DG4A 4K19A 3NPOA 2KTDA 3C77X 1KQXA 5IO7A 3P6HA 2L9CA 2W2BA 1QFVA 3D96A 3UEUA 3C78X 1E06A 1D2UA 4YCEA 4ZJ0A 1SY2A 4I3BA 1QY2A 4WBKA 2POAA 3VG5A 1VPRA 2OVEA 3EBKA 4KIIA 4QYNA 2LKKA 3QKGA 1DF3A 4Y0PA 1CJ5A 1FENA 1A18A 4RUNA 1YUPA 4DQ4A 4TKJA 4ALOA 1E02A 2A3FX 3P6DA 2A0AA 4QGXA 2GC9A 3BX8A 2L68A 1HMTA 1IKJA 3TGBA 1PMPA 1CBSA 2JU7A 2LBVA 1YP6A 2FLJA 1LFOA 5H9LA 2N93A 1OPAA 1DZKA 3FW5A 3TGCA 2XKLA 4ZR2A 2BLGA 5HTDA 1DC9A 2WEXA 1X8PA 2CM4A 3BLGA 4AYHA 3B2KA 1OEKA 4XMEA 1EW3A 5H9NA 1UREA 4IB7A 4OS0A 2KT4B 4ARHA 1KZXA 5H9AA 5FFHA 1ZNDA 1JYJA 3U9PC 5BVTA 4LKTA 1DZPA 4A1YA 3ZQ3A 1X89A 1D3SA 2FRSA 2LB6A 4GRJA 4A60A 1SA8A 1GXAA 1PM1X 3WBGA 1LIFA 5HTEA 4N7DA 2AL0X 1ADLA 3BU9A 4MVLA 5KICA 1O1UA 1KT7A 3BX7A 2WSJA 4YDBA 3CR6A 3CBCA 1S44A 4OS8A 4YFPA 3BY0A 5C0NA 4UU3A 1OEEA 2CZUA 2X45A 1KXOA 5H8TA 3UEVA 1AB0A 2AT3X 1I05A 4NYQA 3RZYA 3L4RA 1BSOA 4BOEA 4I3CA 3DSZA 4ZH6A 3VG3A 4ES7A 1B4MA 3B2JA 2PY1A 3GAQA 3PEDA 1AQBA 4AZPA 1GM6A 3FMZA 3CQNA 2NNDA 2MJIA 1KT5A 2NP1A 3NX1A 1PEEA 3BS2A 3VG4A 5F1EA 5IO6A 4YFRA 1BEBA 1RBPA 1EPAA 1LIBA 1YP7A 2HYSA 4I3DA 1MX7A 4LZVA 4Y0SA 1DZMA 4TQ2A 1HMSA 2EU7X 1I04A 2CBRA 4TKBA 1GX9A 1U18A 3FA7A 5HAEA 1RLBE 4NYRA 1T8VA 2QO6A 3STNA 4QZUA 4GH7A 2GTFX 1BSQA 1SXYA 2OVDA 3OJYC 1TOWA 1EALA 1Z24A 3FR5A 3I17A 1LPJA 1TXLA 2WEWA 5EEDA 1QWDA 3SAOA 1LIDA 3FENA 4ZHFA 1KGLA 3B2LA 4OMXA 1KT4A 4YFQA 3JSQA 4IBAA 1AVGI 1BSYA 3KFGA 3TZSA 4IB6A 1I4UA 1XKIA 3NR3A 1JJXA 1IKEA 1FELA 5LJCA 5LJEA 1FEMA 2WWPA 2ACPX 1O1VA 4M6SA 3KQ0A 1TVQA 1T68X 2ALLX 4UU2A 2CZTA 1IFBA 3T1DA 5EEEA 4AZMA 4TJZA 3G7XA 4LKPA 1NP4A 3U0DA 2R73A 4Y0QA 2NNEA 3AKMA 4ZGUA 3NQ3A 4N7CA 1GT1A 1N0SA 2HNXA 3S26A 1S2PA 3F8AA 3HWGA 5HWZA 4GNYA 2G78A 3CMPA 5H9KA 1G5WA 1EUOA 1PBOA 2HMBA 4LZUA 3EYCA 4YGGA 1G85A 2LBAA 5JR8A 3EBWA 2O62A 1JBHA 1B8EA 5LJGA 4GE1A 3K3LA 3CBSA 3APXA 3VG2A 1YWAA 1SXXA 1BWYA 3APUA 1JYDA 1CBRA 1ZNHA 3APWA 4NLIA 4XMHA 4D6BA 1R0UA 5B29A 4XMGA 1EXSA 1OEJA 3D95A 2LFOA 4XMFA 3BRNA 3FA8A 1SY1A 3FEKA 3KZAA 4WFUA 4D6AA 4ORSA 3NP1A 1LKEA 1ML7A 2Q4NA 1VYGA 4HPDA 5L8NA 1EPBA 1KOIA 3I0AA 1ZNLA 3O22A 4QGVA 4EDEA 1BBPA 3PH6A 4ZCBA 4YBPA 4MVKA 4HPBA 4I9RA 4YCHA 1HMRA 1KZWA 4ORRA 2JN3A 3ZUIA 3PECA 4A1HA 3IFBA 2L67A 2RCTA 1UZ2X 3FLLA 4RUUA 1ACDA 1YIVA 4AZOA 1P6PA 1HQPA 2MM3A 1HBPA 4I9SA 5EDBA 1QY1A 4AW8A 1BLRA 1JJJA 3ZUOA 2Q9SA 1OBPA 3NX2A 4ORXA 4ZHGA 3WJDA 1A3YA 1DZJA 2AT5X 3D97A 3P6FA 3IA8A 1LICA 5D48A 3FA9A 4M7MA 1AELA 1TOUA 4TNNA 1QG5A 1BJ7A 3O2YA 1X8OA 4AZRA 4R0BA 1ERXA 4AZNA 1GT4A 3HWEA 4WFVA 3FIQA 1FDQA 5LJKA 1B56A 2Q2PA 4IB8A 4YMYA 3UEWA 1GX8A 3WJCA 1CBIA 3O19A 1SXWA 4GKCA 2OZQA 2MO5A 3WJFA 2FR2A 3PP6A 5L8IA 2GJ5A 4YKOA 2YG2A 1NGLA 4ZHDA 5LJBA 1S7DA 4BQUA 2WQAE 2E4JA 1OPBA 2W2FA 1JV4A 1CRBA 1O8VA 5KIDA 3VG7A 3C76X 3MVFA 1FTPA 1QFTA 3FR4A 3FEPA 2AT6X 5F7GA 3DTQA 3KFFA 4IAXA 4ODDA 2ACOA 1YWDA 1GKAA 5B27A 1QQSA 2G79A 1X8QA 3BU1A 1OBQA 4GETA 4XMDA 4CK4A 2G7BA 2FR3A 1VYFA 4NNTA 3NADA 2K62A 3WVMA 1G74A 1E00A 1FE3A 1I06A 3B2IA 2OFRX 1LF7A 1HN2A 4TKHA 2CBSA 3FA6A 4YBUA 4XMCA 1H91A 1EIIA 1ERBA 4IMNA 1TW4A 2FWVA 4EXZA 2QM9A 3AKNA 1A2DA 5FENA 2OVAA 4EEJA 1X71A 4ORUA 5D47A 3NQ9A 2HLVA 3PH5A 2L5PA 5HZ5A 3ELXA 5HZ8A 4ZHHA 2AMMX 2IFBA 2WR6A 2R56A 5EZ2A 4ORYA 5EDCA 3KFHA 3UEXA 2W2AA 1IIUA 3CWKA
chains in the Genus database with same CATH superfamily
4C5PA 3BSZE 2Q39A 2RD7C 3FR2A 2VFCA 2OFMX 2OL6O 1KQWA 3N91A 3EMMA 4HPAA 4IMOA 4OKAA 2A2GA 3E3CA 5IO5A 1U17A 1SMPI 3WJEA 3VHIA 4A8ZA 4CDFA 3F9DA 3P6EA 1LIEA 4ZFXA 2AT0X 4MEEA 1MUPA 3WZNA 1ZNEA 1MDCA 4YKMA 5L8OA 3CQRA 5D45A 5HCEC 2LA7A 1LDOA 2BC3A 2OY8A 4IAWA 5F6ZA 5D8JA 1EIOA 1X8UA 1SWDA 5LKFA 3VG6A 5F6BA 3WJBA 4NNSA 2X8SA 5LKEA 1NDJA 1BRPA 1KL3A 2CM9A 1G7NA 2RCQA 4BX7A 1GX3A 2BSZA 5IRAA 1MX8A 2RTAA 2KW1A 1IJ8A 1XCAA 1I78A 1OBUA 3APVA 2X55A 3P6CA 4JHQA 4O3WA 5EPQA 1PTSA 3MBTA 5BVQA 4DNEA 1GKAB 1VWAB 5AJBA 5F58A 4Z6JA 2XSTA 2VDFA 1VWLB 1EQDA 1N43A 2FS6A 4FGIB 2JU3A 5KHPA 2C4IA 2AH7X 4MVIA 4KC8A 4YGZA 3VU1A 5K06A 2WQ9A 4HFOA 1VWHB 5IRWA 1DV9A 1YWBA 2HZQA 3HWDA 5LJDA 3TGAA 2X34A 5HBSA 4OMWA 3SLJA 4ALBA 1AVDA 4EFGA 2FTBA 2X4MA 4CPFA 2RN4A 1RSTB 2C1SA 1RXJA 2IZCB 2AKQA 2RTBB 3P6GA 1VWRB 4MVEA 1SY3A 3STKA 1MEPA 1VWPB 2HZRA 2X46A 3ZW1A 1SY0A 5B11O 5D4AA 1MVGA 1IW2A 1SWJA 2NNQA 1MM9A 2UYWA 5FAZA 3T2XA 1JZUA 5AQ6A 1LELA 3QQ2A 4JO6A 1VWBB 5DPQA 2HKDA 1ZRYA 1LNMA 2K23A 2Y3EA 3H3IA 4GNWA 3U03A 1B0OA 3VE2A 1NP1A 3ELZA 4AZQA 3S60A 1JJUA 1STRB 2F73A 3SZHA 2IZBA 4CPHA 2OYBO 4FBRA 1ZNKA 1ZNGA 3OBLA 4Y0RA 4ZH9A 4HPCA 1BRQA 5LJHA 2F09A 3OD9A 4ON1A 1CBQA 4BJ8A 3HWFA 3RSWA 4NLJA 3ZW0B 3JS1A 1X8NA 1Y52X 2Q2MA 5HCCC 2JOZA 2P8GA 1BM5A 2ANSA 1K3BA 2OVSA 2QO4A 4YDAA 1U0XA 1DF8A 2RTIB 1L6MA 2RTKA 4NP1A 5CE4A 2DJFA 4Y5DA 3EM0A 2RQ0A 3PQUA 3S5VA 2ASNX 3WXQA 4O4UA 4ZHCA 1SWEA 2DM5A 2QO5A 4BX6A 4CDDA 3STMX 3RE5A 4OS3A 1VYOA 1NBXA 3FELA 3BDRA 1HBQA 4L3RA 3HTYA 4Y59A 3TF6A 4ORWA 4U8UN 3T6LA 2A13A 2FS7A 3Q6LA 3T6FA 3CKGA 2BS6A 4QAEA 3KFIA 4OELA 1QABE 3AEHA 1YWCA 4TLJA 3LTWA 4O3ZA 1KT6A 5FQ6E 2RTOB 5HZ9A 1A57A 2AT8X 2OF8A 1SRJA 1SRFA 1SWTA 3MM0A 1QY0A 1SWAA 4YGHA 1ICMA 4QYPA 4BVMA 3B2HA 1SXUA 3PPTA 4IB9A 1SREA 1JIWI 2OL7A 4QGWA 3WOVA 4DQ3A 1ALBA 1ICNA 1JMXA 2RA6A 5HZQA 3FW4A 2G8CO 2R74A 4YH0A 5HA0A 1MK5A 2QOSC 2FT9A 3FYFA 2WUTA 4PSQA 5HZ6A 2JU8A 1IFCA 2BT9A 1Y0GA 3ZZVA 4BX7B 4O9SA 1SWCA 1GT3A 1KL4A 2A2UA 2A5BA 4L1NA 1KT3A 3P02A 3HK1A 4PJ2A 3WJGA 2DJGA 3RKGA 2A8GA 5HA1A 5HCDC 1T0VA 1E5PA 1DFVA 1GT5A 1GGLA 1NC9A 5DG4A 4K19A 3NPOA 2KTDA 3C77X 1KQXA 2Z4HA 5IO7A 1LCWA 3P6HA 4QRLA 1LDQA 2L9CA 2W2BA 1QFVA 3D96A 3UEUA 3C78X 1E06A 1D2UA 4QNIA 4FQBB 3Q34A 1FJ1E 4U8UM 4YCEA 1SY2A 4I6SA 4ZJ0A 2IZLB 2X56A 1QY2A 4I3BA 2POAA 1SWKA 4WBKA 3VG5A 1VPRA 2OVEA 3EBKA 4KIIA 4QYNA 2LKKA 3RDXA 3ZW1B 1NQMA 2RTJA 3MX7A 3QKGA 2IZJA 1DF3A 4Y0PA 3ZW2A 1CJ5A 3LHNA 1FENA 1A18A 4RUNA 1YUPA 4DQ4A 4GZVA 4TKJA 4ALOA 1E02A 2A3FX 1OSPO 3P6DA 2A0AA 4QGXA 2RTNB 2GC9A 3BX8A 2L68A 1HMTA 1IKJA 4GJSA 3TGBA 3X00A 1PMPA 1CBSA 2FHNX 2JU7A 2LBVA 4CPHB 4IABA 2GTLO 2OFAA 1YP6A 2FLJA 1LFOA 4Z2PA 5H9LA 2N93A 4KCAA 1SWSA 1OPAA 1DZKA 3FW5A 4Z2OA 3TGCA 2XKLA 1HY2A 3S5XA 3WZQA 4ZR2A 2BLGA 5HTDA 1DC9A 2WEXA 1X8PA 2CM4A 3BLGA 4NW4A 2VFBA 4OEMA 4AYHA 3VHMA 2Z4IA 3B2KA 1OEKA 4XMEA 1EW3A 5H9NA 5K68A 1UREA 1JMZA 2IZHB 2KT4B 1STSB 4IB7A 4OS0A 5H9AA 4ARHA 1KZXA 3ZI8A 3RY1A 3F6ZB 4GUZA 2ZAGA 5FFHA 1ZNDA 2OF9A 1JYJA 1SWHA 3U9PC 2KD2A 5BVTA 4LKTA 1DZPA 4GK9A 1Y53X 1SWOA 4A1YA 3ZQ3A 1X89A 2RTFB 1D3SA 2IZDB 2UZ2A 2FRSA 4BCSA 4EKVA 2LB6A 4GRJA 4A60A 2RTCB 1SA8A 1GXAA 1PM1X 5AEOA 3WBGA 1LIFA 1SLEB 2JMBA 4N7DA 5HTEA 3CKFA 4JNJA 2AL0X 1ADLA 1LUQA 3BU9A 3VGWA 4MVLA 5KICA 2G5LA 3RWXA 1O1UA 1Y9LA 1KT7A 3BX7A 2WSJA 1E2TA 4YDBA 3CR6A 4ID2A 3CBCA 4CPIA 1S44A 4OS8A 4YFPA 3BY0A 4CSBA 4UU3A 3SZJA 1OEEA 5C0NA 2CZUA 1SLGB 1KXOA 2X45A 1SWPA 5H8TA 3UEVA 1AB0A 2AT3X 1VWJB 5K67A 1I05A 4NYQA 3RZYA 3L4RA 2CAMA 1BSOA 4COTA 4BOEA 5FQ8E 4I3CA 3DSZA 4ZH6A 3VG3A 3JQOA 4FBOA 4ES7A 1B4MA 5L3YA 3B2JA 2PY1A 2ZSCA 3GAQA 1AQBA 3PEDA 4AZPA 2FKGA 1GM6A 1K24A 2QMIA 3CQNA 2IZIA 2MJIA 1KT5A 2NNDA 2NP1A 3FMZA 3NX1A 3PQSA 2RTDB 1PEEA 3UAQA 4BX5A 4DCBA 1N9MA 3BS2A 3VG4A 3MG5A 5F1EA 3VE1A 4BBOA 4YFRA 1BEBA 1N4JA 5IO6A 1RBPA 1EPAA 1SLFB 4GGTA 5B10O 1LIBA 1YP7A 2HYSA 2X32A 4I3DA 3HOEA 4KT5A 1MX7A 1SWUA 4LZVA 4Y0SA 2RTRB 1DZMA 4O49A 4TQ2A 1HMSA 2EU7X 1I04A 2CBRA 1SWFA 4TKBA 1VWOB 1VWEB 1GX9A 1UYNX 1U18A 1VWMB 3FA7A 4I95A 4O4SA 5CHKA 5HAEA 1RLBE 1SLDB 2I5ZO 1KL5A 4GJVA 2RTHB 1T8VA 2QO6A 4NYRA 5CSEA 3V8UA 3STNA 3VHHA 4QZUA 3RDMA 4EQAC 5B5FA 3GE2A 2GH7A 2OY7A 4BGFA 4GH7A 2GTFX 4B55A 1BSQA 1SXYA 2A5CA 2OVDA 3OJYC 1TOWA 4GGZA 1EALA 1Z24A 3FR5A 3RBYA 3I17A 1LPJA 1TXLA 2WEWA 5EEDA 1AVEA 1QWDA 3SAOA 1LIDA 3FENA 5IRUA 4ZHFA 3FIDA 1KGLA 3B2LA 4OMXA 1KT4A 3EW2A 4YFQA 4MIRA 3JSQA 4IBAA 4KH8A 1WUBA 2F01A 4ML7B 2QOMA 1SWNA 1AVGI 1BSYA 3KFGA 3TZSA 4IB6A 1I4UA 1XKIA 2OL8O 3WZOA 4Z27A 2RTGB 3NR3A 1JJXA 1IKEA 1FELA 5LJCA 5LJEA 1FEMA 2WWPA 2ACPX 4WHIA 1O1VA 4M6SA 3KQ0A 1TVQA 1T68X 2ALLX 4UU2A 1KFFA 3RDUA 2CZTA 1IFBA 4Z28A 5EEEA 3T1DA 4AZMA 4YVBA 4TJZA 5B5GA 4CPEA 3G7XA 4LKPA 1NP4A 3U0DA 2R73A 2I5VO 4Y0QA 2NNEA 3AKMA 4ZGUA 5JD2A 3NQ3A 4U9CA 2OFBA 4N7CA 4CDCA 1GT1A 1N0SA 3RDQA 2HNXA 3S26A 3FDCA 1S2PA 3F8AA 3HWGA 5HWZA 4GNYA 2G78A 3CMPA 5H9KA 1G5WA 1EUOA 1PBOA 2HMBA 4LZUA 3EYCA 4YGGA 1G85A 2LBAA 5JR8A 1UYOX 3EBWA 2O62A 4BX5B 1SWLA 2FKJA 1JBHA 1W5RA 1B8EA 1EI5A 5LJGA 3NBXX 4GE1A 4BX6B 3K3LA 3CBSA 3APXA 2MF6A 4INNA 3VG2A 1VWCB 1YWAA 4Z2VA 1SRIA 1SXXA 2AF5A 2RTMA 1BWYA 3APUA 1VWIB 1SRHA 1JYDA 1CBRA 1ZNHA 3APWA 4GGRA 4NLIA 1RSUB 3OE3A 3EC5A 4XMHA 4D6BA 3WYPA 1R0UA 2C1QA 3ZWEA 5B29A 2GTLN 1HXZA 4XMGA 1EXSA 1OEJA 2MWHA 3D95A 2LFOA 4JGLA 3PDFA 3D4RA 4XMFA 3BRNA 1NQNA 3FA8A 3RE6A 1SY1A 3FEKA 1WBIA 2IZGB 3KZAA 4WFUA 4D6AA 4ORSA 3NP1A 1LKEA 1ML7A 2Q4NA 3HPEA 1VYGA 4HPDA 5L8NA 1EPBA 1KOIA 3I0AA 3T2WA 1ZNLA 3O22A 3RY2A 4QGVA 4EDEA 1BBPA 3PH6A 4ZCBA 4HWMA 4YBPA 2WPUA 2IZFB 3EW1A 1VWNB 1N9YA 4HPBA 4I9RA 4MVKA 1HMRA 4U3QA 4YCHA 5IXGA 4ORRA 1KZWA 4U46A 2JN3A 3RDOA 3PECA 1SWRA 3ZUIA 4A1HA 4CV7A 3IFBA 2L67A 2RCTA 1UZ2X 3FLLA 2X8FA 4GDZA 4O3YA 1ACDA 1YIVA 1SRGA 3LV4A 4QZTA 4RUUA 4AZOA 1P6PA 1HQPA 2MM3A 1HBPA 4I9SA 5EDBA 1QY1A 5B2AO 4AW8A 1BLRA 3ZUOA 1JJJA 2Q9SA 1OBPA 3NX2A 4ORXA 4ZHGA 3WJDA 1A3YA 1DZJA 2AT5X 2IZAA 3D97A 3P6FA 3IA8A 1LICA 5D48A 3FA9A 4M7MA 1AELA 4NV8A 4QQ1A 1TOUA 2FHLA 4TNNA 4LQZA 2RTEB 2ZAIA 1QG5A 5BYPA 1BJ7A 2GTLM 3O2YA 2IZEB 1X8OA 2X8TA 4U8UO 4AZRA 4R0BA 1ERXA 4AZNA 4FBVA 1GT4A 3HWEA 4WFVA 3D9WA 3FIQA 1FDQA 5LJKA 2QCBA 1B56A 2Q2PA 1VWKB 4IB8A 3P24A 3UEWA 1GX8A 3WJCA 4YMYA 1VWQB 1CBIA 3O19A 1SXWA 4GD9A 2BS5A 2OZQA 2Y3FA 2MO5A 4GKCA 4NV7A 3WJFA 3HOLA 2YMSA 3SLOA 2FR2A 3PP6A 5L8IA 2GJ5A 3PK2A 3WZPA 1JQPA 2AVIA 2MHDA 4YKOA 2YG2A 4O3XB 1NGLA 4ZHDA 5LJBA 2RTLA 3NQKA 1W4TA 1S7DA 3SOTA 1LCZA 5B3MO 2WQAE 4BQUA 2E4JA 1OPBA 2W2FA 1JV4A 4I60A 1CRBA 1O8VA 1N7YA 5KIDA 3VG7A 3C76X 3MVFA 1FTPA 1QFTA 1STPA 3FR4A 3RDSA 3FEPA 2AT6X 5F7GA 4GU8A 3DTQA 3KFFA 1SWQA 4IAXA 2RTPB 4ODDA 2ACOA 1YWDA 1PBYA 1GKAA 1SWGA 1QQSA 5B27A 2G79A 1X8QA 1Y55X 3BU1A 1OBQA 4GETA 4XMDA 3AUMO 4CK4A 2IZKA 2G7BA 2FR3A 1VYFA 4NNTA 3NADA 2K62A 1HQQA 3WVMA 3WYQA 1G74A 1E00A 1FE3A 1RXKA 1W6FA 1I06A 2PI3O 3B2IA 2OFRX 4GDAA 2M4LA 1LF7A 3VPJE 1HN2A 1LCVA 4IRWA 4TKHA 2CBSA 4MISA 2FGSA 2JW1A 3FA6A 4YBUA 2JGSA 4ZGFA 2OY1O 4O4XA 4XMCA 1H91A 1EIIA 1ERBA 4IMNA 2KTSA 1TW4A 1VWDB 1VWGB 1RAVA 1SWBA 2FWVA 5CYBA 2QM9A 4EXZA 3AKNA 2RTQB 5FQ7E 2Y32A 1A2DA 5FENA 1Y9TA 2BHVA 2OVAA 5BVSA 4EEJA 1I9HA 1VWFB 4KC7A 1X71A 4ORUA 5D47A 3NQ9A 2HLVA 3ZW0A 3PH5A 2L5PA 5AJCA 5HZ5A 1RXHA 1HXLA 3ELXA 4CDEA 3SZIA 4O4OA 2OY5O 5HZ8A 4ZHHA 2AMMX 5F2BA 2IFBA 2WR6A 2R56A 5EZ2A 3KVNA 4ORYA 5EDCA 1MOYA 3KFHA 3UEXA 2W2AA 1IIUA 3CWKA 3SLTA
chains in the Genus database with same CATH topology
3BSZE 2Q39A 2RD7C 3FR2A 3N91A 2OFMX 4HPAA 1KQWA 4IMOA 3EMMA 2A2GA 3E3CA 5IO5A 1U17A 1SMPI 3WJEA 4A8ZA 3F9DA 3P6EA 1LIEA 4ZFXA 2AT0X 1MUPA 1ZNEA 1MDCA 4YKMA 5L8OA 3CQRA 5D45A 5HCEC 2LA7A 4IAWA 5F6ZA 5D8JA 1EIOA 1X8UA 5LKFA 3VG6A 3WJBA 5F6BA 5LKEA 4NNSA 2X8SA 1BRPA 2RCQA 2CM9A 1G7NA 1MX8A 3P6CA 2KW1A 1XCAA 3APVA 1OBUA 4O3WA 4QZTA 5BVSA 5EPQA 3MBTA 5BVQA 1GKAB 5AJBA 5F58A 2XSTA 1EQDA 2FS6A 4FGIB 5KHPA 2JU3A 2AH7X 4MVIA 4KC8A 4YGZA 3VU1A 5K06A 2WQ9A 4HFOA 1DV9A 1YWBA 2HZQA 3HWDA 5LJDA 3TGAA 5HBSA 4EFGA 4OMWA 4ALBA 2FTBA 2RN4A 2AKQA 3P6GA 4MVEA 1SY3A 3STKA 2HZRA 2X46A 3ZW1A 1SY0A 5D4AA 1MVGA 1IW2A 2NNQA 5FAZA 1JZUA 5AQ6A 5DPQA 1ZRYA 1LNMA 2K23A 3H3IA 4GNWA 3U03A 1B0OA 3VE2A 1NP1A 3ELZA 4AZQA 3S60A 2F73A 4FBRA 1ZNKA 1ZNGA 3OBLA 4Y0RA 4ZH9A 4HPCA 1BRQA 5LJHA 2F09A 3OD9A 4ON1A 1CBQA 3HWFA 3RSWA 4NLJA 3ZW0B 3JS1A 1X8NA 2Q2MA 5HCCC 2JOZA 2P8GA 1BM5A 2ANSA 2OVSA 2QO4A 4YDAA 1U0XA 1L6MA 4NP1A 5CE4A 3EM0A 2RQ0A 3PQUA 3S5VA 2ASNX 3WXQA 4O4UA 4ZHCA 2QO5A 2DM5A 3STMX 4OS3A 3FELA 3BDRA 1HBQA 4L3RA 3HTYA 3TF6A 4ORWA 4U8UN 2A13A 2FS7A 3Q6LA 2BS6A 4QAEA 3KFIA 1QABE 1YWCA 4TLJA 4O3ZA 1KT6A 5FQ6E 5HZ9A 1A57A 2AT8X 1QY0A 4YGHA 1ICMA 4QYPA 4BVMA 3B2HA 1SXUA 3PPTA 4IB9A 3WOVA 1JIWI 4QGWA 4DQ3A 1ALBA 1ICNA 2RA6A 5HZQA 3FW4A 2R74A 4YH0A 5HA0A 2QOSC 2FT9A 3FYFA 2WUTA 4PSQA 5HZ6A 2JU8A 1IFCA 2BT9A 3ZZVA 4O9SA 1GT3A 2A2UA 4L1NA 1KT3A 3P02A 3HK1A 4PJ2A 3WJGA 3RKGA 5HCDC 5HA1A 1T0VA 1E5PA 1DFVA 1GT5A 1GGLA 5DG4A 4K19A 3NPOA 2KTDA 3C77X 1KQXA 2Z4HA 5IO7A 3P6HA 4QRLA 2L9CA 2W2BA 1QFVA 3D96A 3UEUA 3C78X 1E06A 1D2UA 4QNIA 4FQBB 4U8UM 4YCEA 4ZJ0A 1SY2A 4I6SA 4I3BA 1QY2A 4WBKA 2POAA 3VG5A 1VPRA 2OVEA 3EBKA 4KIIA 4QYNA 2LKKA 3ZW1B 3MX7A 3QKGA 1DF3A 4Y0PA 3ZW2A 1CJ5A 3LHNA 1FENA 1A18A 4RUNA 1YUPA 4DQ4A 4GZVA 4TKJA 4ALOA 1E02A 2A3FX 3P6DA 2A0AA 4QGXA 2GC9A 3BX8A 2L68A 1HMTA 1IKJA 3TGBA 1PMPA 1CBSA 2JU7A 2LBVA 4IABA 2GTLO 1YP6A 2FLJA 1LFOA 5H9LA 2N93A 4KCAA 1OPAA 1DZKA 3FW5A 3TGCA 2XKLA 3S5XA 4ZR2A 2BLGA 5HTDA 1DC9A 2WEXA 1X8PA 2CM4A 3BLGA 4NW4A 4AYHA 2Z4IA 3B2KA 1OEKA 4XMEA 1EW3A 5H9NA 1UREA 4IB7A 4OS0A 2KT4B 4ARHA 1KZXA 5H9AA 3ZI8A 3F6ZB 2ZAGA 5FFHA 1ZNDA 1JYJA 3U9PC 2KD2A 5BVTA 4LKTA 1DZPA 4GK9A 4A1YA 3ZQ3A 1X89A 1D3SA 2FRSA 2LB6A 4GRJA 4A60A 1SA8A 1GXAA 1PM1X 5AEOA 3WBGA 1LIFA 2JMBA 5HTEA 4N7DA 2AL0X 1ADLA 3BU9A 4MVLA 5KICA 3RWXA 1O1UA 1Y9LA 1KT7A 3BX7A 2WSJA 4YDBA 3CR6A 4ID2A 3CBCA 1S44A 4OS8A 4YFPA 3BY0A 4CSBA 4UU3A 5C0NA 1OEEA 2CZUA 2X45A 1KXOA 5H8TA 3UEVA 1AB0A 2AT3X 1I05A 4NYQA 3RZYA 3L4RA 1BSOA 4COTA 4BOEA 5FQ8E 4I3CA 3DSZA 4ZH6A 3VG3A 3JQOA 4FBOA 4ES7A 1B4MA 3B2JA 2PY1A 3GAQA 3PEDA 1AQBA 4AZPA 1GM6A 3FMZA 2QMIA 3CQNA 2NNDA 2MJIA 1KT5A 2NP1A 3NX1A 3PQSA 1PEEA 3UAQA 3BS2A 3VG4A 5F1EA 3VE1A 4YFRA 5IO6A 1BEBA 1RBPA 1EPAA 1LIBA 1YP7A 2HYSA 4I3DA 3HOEA 4KT5A 1MX7A 4LZVA 4Y0SA 4O49A 1DZMA 4TQ2A 1HMSA 2EU7X 1I04A 2CBRA 4TKBA 1GX9A 1U18A 3FA7A 4I95A 4O4SA 5HAEA 1RLBE 3V8UA 4NYRA 1T8VA 2QO6A 3STNA 4EQAC 4QZUA 3GE2A 4GH7A 2GTFX 1BSQA 1SXYA 2OVDA 3OJYC 1TOWA 1EALA 1Z24A 3FR5A 3RBYA 3I17A 1LPJA 1TXLA 2WEWA 5EEDA 1QWDA 3SAOA 1LIDA 3FENA 4ZHFA 1KGLA 3B2LA 4OMXA 1KT4A 4YFQA 4MIRA 3JSQA 4IBAA 4KH8A 4ML7B 1AVGI 1BSYA 3KFGA 3TZSA 4IB6A 1I4UA 1XKIA 3NR3A 1JJXA 1IKEA 1FELA 5LJCA 5LJEA 1FEMA 2WWPA 2ACPX 4WHIA 1O1VA 4M6SA 3KQ0A 1TVQA 1T68X 2ALLX 4UU2A 2CZTA 1IFBA 3T1DA 5EEEA 4AZMA 4TJZA 3G7XA 4LKPA 1NP4A 3U0DA 2R73A 4Y0QA 2NNEA 3AKMA 4ZGUA 3NQ3A 4U9CA 4N7CA 1GT1A 1N0SA 2HNXA 3S26A 1S2PA 3F8AA 3HWGA 5HWZA 4GNYA 2G78A 3CMPA 5H9KA 1G5WA 1EUOA 1PBOA 2HMBA 4LZUA 3EYCA 4YGGA 1G85A 2LBAA 5JR8A 3EBWA 2O62A 1JBHA 1B8EA 1EI5A 5LJGA 3NBXX 4GE1A 3K3LA 3CBSA 3APXA 4INNA 3VG2A 1YWAA 1SXXA 1BWYA 3APUA 1JYDA 1CBRA 1ZNHA 3APWA 4NLIA 3OE3A 4XMHA 4D6BA 1R0UA 3ZWEA 5B29A 2GTLN 4XMGA 1EXSA 1OEJA 2MWHA 3D95A 2LFOA 4JGLA 3D4RA 4XMFA 3BRNA 3FA8A 1SY1A 3FEKA 3KZAA 4WFUA 4D6AA 4ORSA 3NP1A 1LKEA 1ML7A 2Q4NA 1VYGA 4HPDA 5L8NA 1EPBA 1KOIA 3I0AA 1ZNLA 3O22A 4QGVA 4EDEA 1BBPA 3PH6A 4ZCBA 4HWMA 4YBPA 4MVKA 4HPBA 4I9RA 4YCHA 4U3QA 1HMRA 1KZWA 4ORRA 2JN3A 3ZUIA 3PECA 4A1HA 4CV7A 3IFBA 2L67A 2RCTA 1UZ2X 3FLLA 2X8FA 4GDZA 4O3YA 1ACDA 1YIVA 3LV4A 4RUUA 4AZOA 1P6PA 1HQPA 2MM3A 1HBPA 4I9SA 5EDBA 1QY1A 4AW8A 1BLRA 1JJJA 3ZUOA 2Q9SA 1OBPA 3NX2A 4ORXA 4ZHGA 3WJDA 1A3YA 1DZJA 2AT5X 3D97A 3P6FA 3IA8A 1LICA 5D48A 3FA9A 4M7MA 1AELA 4QQ1A 1TOUA 4TNNA 4LQZA 2ZAIA 1QG5A 5BYPA 1BJ7A 2GTLM 3O2YA 1X8OA 2X8TA 4U8UO 4AZRA 4R0BA 1ERXA 4AZNA 4FBVA 1GT4A 3HWEA 4WFVA 3FIQA 1FDQA 5LJKA 1B56A 2Q2PA 4IB8A 4YMYA 3P24A 3UEWA 1GX8A 3WJCA 1CBIA 3O19A 1SXWA 4GKCA 2BS5A 2OZQA 2MO5A 3WJFA 3HOLA 2YMSA 2FR2A 3PP6A 5L8IA 2GJ5A 4YKOA 2MHDA 2YG2A 4O3XB 1NGLA 4ZHDA 5LJBA 3NQKA 1S7DA 3SOTA 4BQUA 2WQAE 2E4JA 1OPBA 2W2FA 1JV4A 1CRBA 1O8VA 5KIDA 3VG7A 3C76X 3MVFA 1FTPA 1QFTA 3FR4A 3FEPA 2AT6X 5F7GA 4GU8A 3DTQA 3KFFA 4IAXA 4ODDA 2ACOA 1YWDA 1GKAA 5B27A 1QQSA 2G79A 1X8QA 3BU1A 1OBQA 4GETA 4XMDA 4CK4A 2G7BA 2FR3A 1VYFA 4NNTA 3NADA 2K62A 3WVMA 1G74A 1E00A 1FE3A 1I06A 3B2IA 2OFRX 2M4LA 1LF7A 3VPJE 1HN2A 4TKHA 2CBSA 4MISA 2JW1A 3FA6A 4YBUA 4ZGFA 4O4XA 4XMCA 1H91A 1EIIA 1ERBA 4IMNA 2KTSA 1TW4A 2FWVA 5CYBA 4EXZA 2QM9A 3AKNA 5FQ7E 1A2DA 5FENA 1Y9TA 2BHVA 2OVAA 4EEJA 4KC7A 1X71A 4ORUA 5D47A 3NQ9A 2HLVA 3ZW0A 3PH5A 2L5PA 5AJCA 5HZ5A 3ELXA 4O4OA 5HZ8A 4ZHHA 2AMMX 2IFBA 2WR6A 2R56A 5EZ2A 4ORYA 5EDCA 3KFHA 3UEXA 2W2AA 1IIUA 3CWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BSZ E;  2Q39 A;  2RD7 C;  3FR2 A;  4IMO A;  2OFM X;  4HPA A;  1KQW A;  3EMM A;  2A2G A;  5IO5 A;  1U17 A;  3WJE A;  4A8Z A;  3F9D A;  3P6E A;  1LIE A;  4ZFX A;  2AT0 X;  1MUP A;  1ZNE A;  1MDC A;  4YKM A;  5L8O A;  3CQR A;  5D45 A;  5HCE C;  4IAW A;  5F6Z A;  5D8J A;  1EIO A;  1X8U A;  5LKF A;  3VG6 A;  3WJB A;  5F6B A;  5LKE A;  4NNS A;  1BRP A;  2RCQ A;  2CM9 A;  1G7N A;  1MX8 A;  3P6C A;  4QZT A;  1XCA A;  3APV A;  1OBU A;  5BVS A;  5EPQ A;  3MBT A;  5BVQ A;  1GKA B;  5F58 A;  2XST A;  1EQD A;  2FS6 A;  5KHP A;  2JU3 A;  2AH7 X;  4MVI A;  4YGZ A;  5K06 A;  1DV9 A;  2WQ9 A;  4HFO A;  1YWB A;  2HZQ A;  3HWD A;  5LJD A;  3TGA A;  5HBS A;  4EFG A;  4OMW A;  4ALB A;  2FTB A;  2AKQ A;  3P6G A;  1SY3 A;  3STK A;  2HZR A;  2X46 A;  1SY0 A;  5D4A A;  1MVG A;  1IW2 A;  2NNQ A;  5FAZ A;  1JZU A;  5AQ6 A;  5DPQ A;  1ZRY A;  1LNM A;  2K23 A;  4GNW A;  3U03 A;  1B0O A;  1NP1 A;  3ELZ A;  4AZQ A;  2F73 A;  1ZNK A;  1ZNG A;  4Y0R A;  4ZH9 A;  4HPC A;  1BRQ A;  5LJH A;  1CBQ A;  3HWF A;  3RSW A;  4NLJ A;  3JS1 A;  1X8N A;  2Q2M A;  5HCC C;  2JOZ A;  2P8G A;  1BM5 A;  2ANS A;  2QO4 A;  4YDA A;  1U0X A;  1L6M A;  4NP1 A;  5CE4 A;  3EM0 A;  2RQ0 A;  4ZHC A;  2ASN X;  3WXQ A;  2QO5 A;  2DM5 A;  3STM X;  4OS3 A;  3FEL A;  3BDR A;  1HBQ A;  3TF6 A;  4ORW A;  2A13 A;  2FS7 A;  3Q6L A;  4QAE A;  3KFI A;  1QAB E;  1YWC A;  4TLJ A;  1KT6 A;  5HZ9 A;  1A57 A;  2AT8 X;  1QY0 A;  4YGH A;  1ICM A;  4QYP A;  4BVM A;  3B2H A;  1SXU A;  3PPT A;  4IB9 A;  4DQ3 A;  4QGW A;  1ALB A;  1ICN A;  2RA6 A;  5HZQ A;  3FW4 A;  2R74 A;  4YH0 A;  5HA0 A;  2QOS C;  2FT9 A;  2WUT A;  4PSQ A;  5HZ6 A;  2JU8 A;  1IFC A;  4O9S A;  1GT3 A;  2A2U A;  3WJG A;  1KT3 A;  3HK1 A;  5HCD C;  5HA1 A;  1T0V A;  1E5P A;  1DFV A;  1GT5 A;  1GGL A;  5DG4 A;  4K19 A;  3NPO A;  2KTD A;  3C77 X;  1KQX A;  5IO7 A;  3P6H A;  2L9C A;  2W2B A;  1QFV A;  3D96 A;  3UEU A;  3C78 X;  1E06 A;  1D2U A;  4YCE A;  4ZJ0 A;  1SY2 A;  4I3B A;  1QY2 A;  4WBK A;  2POA A;  3VG5 A;  1VPR A;  2OVE A;  3EBK A;  4KII A;  4QYN A;  2LKK A;  3QKG A;  1DF3 A;  4Y0P A;  1CJ5 A;  1FEN A;  1A18 A;  4RUN A;  1YUP A;  4DQ4 A;  4TKJ A;  4ALO A;  1E02 A;  2A3F X;  3P6D A;  2A0A A;  4QGX A;  2GC9 A;  3BX8 A;  2L68 A;  1HMT A;  1IKJ A;  3TGB A;  1PMP A;  1CBS A;  2JU7 A;  2LBV A;  1YP6 A;  2FLJ A;  1LFO A;  5H9L A;  2N93 A;  1OPA A;  1DZK A;  3FW5 A;  3TGC A;  2XKL A;  4ZR2 A;  2BLG A;  5HTD A;  1DC9 A;  2WEX A;  1X8P A;  2CM4 A;  3BLG A;  4AYH A;  3B2K A;  1OEK A;  4XME A;  1EW3 A;  5H9N A;  1URE A;  4IB7 A;  4OS0 A;  2KT4 B;  4ARH A;  1KZX A;  5H9A A;  5FFH A;  1ZND A;  1JYJ A;  3U9P C;  5BVT A;  4LKT A;  1DZP A;  4A1Y A;  3ZQ3 A;  1X89 A;  1D3S A;  2FRS A;  2LB6 A;  4GRJ A;  4A60 A;  1SA8 A;  1GXA A;  1PM1 X;  3WBG A;  1LIF A;  5HTE A;  4N7D A;  2AL0 X;  1ADL A;  3BU9 A;  4MVL A;  5KIC A;  1O1U A;  1KT7 A;  3BX7 A;  2WSJ A;  4YDB A;  3CR6 A;  3CBC A;  1S44 A;  4OS8 A;  4YFP A;  3BY0 A;  5C0N A;  4UU3 A;  1OEE A;  2CZU A;  2X45 A;  1KXO A;  5H8T A;  3UEV A;  1AB0 A;  2AT3 X;  1I05 A;  4NYQ A;  3RZY A;  3L4R A;  1BSO A;  4BOE A;  4I3C A;  3DSZ A;  4ZH6 A;  3VG3 A;  4ES7 A;  1B4M A;  3B2J A;  2PY1 A;  3GAQ A;  3PED A;  1AQB A;  4AZP A;  1GM6 A;  3FMZ A;  3CQN A;  2NND A;  2MJI A;  1KT5 A;  2NP1 A;  3NX1 A;  1PEE A;  3BS2 A;  3VG4 A;  5F1E A;  5IO6 A;  4YFR A;  1BEB A;  1RBP A;  1EPA A;  1LIB A;  1YP7 A;  2HYS A;  4I3D A;  1MX7 A;  4LZV A;  4Y0S A;  1DZM A;  4TQ2 A;  1HMS A;  2EU7 X;  1I04 A;  2CBR A;  4TKB A;  1GX9 A;  1U18 A;  3FA7 A;  5HAE A;  1RLB E;  4NYR A;  1T8V A;  2QO6 A;  3STN A;  4QZU A;  4GH7 A;  2GTF X;  1BSQ A;  1SXY A;  2OVD A;  3OJY C;  1TOW A;  1EAL A;  1Z24 A;  3FR5 A;  3I17 A;  1LPJ A;  1TXL A;  2WEW A;  5EED A;  1QWD A;  3SAO A;  1LID A;  3FEN A;  4ZHF A;  1KGL A;  3B2L A;  4OMX A;  1KT4 A;  4YFQ A;  3JSQ A;  4IBA A;  1AVG I;  1BSY A;  3KFG A;  3TZS A;  4IB6 A;  1I4U A;  1XKI A;  3NR3 A;  1JJX A;  1IKE A;  1FEL A;  5LJC A;  5LJE A;  1FEM A;  2WWP A;  2ACP X;  1O1V A;  4M6S A;  3KQ0 A;  1TVQ A;  1T68 X;  2ALL X;  4UU2 A;  2CZT A;  1IFB A;  3T1D A;  5EEE A;  4AZM A;  4TJZ A;  3G7X A;  4LKP A;  1NP4 A;  3U0D A;  2R73 A;  4Y0Q A;  2NNE A;  3AKM A;  4ZGU A;  3NQ3 A;  4N7C A;  1GT1 A;  1N0S A;  2HNX A;  3S26 A;  1S2P A;  3F8A A;  3HWG A;  5HWZ A;  4GNY A;  2G78 A;  3CMP A;  5H9K A;  1G5W A;  1EUO A;  1PBO A;  2HMB A;  4LZU A;  3EYC A;  4YGG A;  1G85 A;  2LBA A;  5JR8 A;  3EBW A;  2O62 A;  1JBH A;  1B8E A;  5LJG A;  4GE1 A;  3K3L A;  3CBS A;  3APX A;  3VG2 A;  1YWA A;  1SXX A;  1BWY A;  3APU A;  1JYD A;  1CBR A;  1ZNH A;  3APW A;  4NLI A;  4XMH A;  4D6B A;  1R0U A;  5B29 A;  4XMG A;  1EXS A;  1OEJ A;  3D95 A;  2LFO A;  4XMF A;  3BRN A;  3FA8 A;  1SY1 A;  3FEK A;  3KZA A;  4WFU A;  4D6A A;  4ORS A;  3NP1 A;  1LKE A;  1ML7 A;  2Q4N A;  1VYG A;  4HPD A;  5L8N A;  1EPB A;  1KOI A;  3I0A A;  1ZNL A;  3O22 A;  4QGV A;  4EDE A;  1BBP A;  3PH6 A;  4ZCB A;  4YBP A;  4MVK A;  4HPB A;  4I9R A;  4YCH A;  1HMR A;  1KZW A;  4ORR A;  2JN3 A;  3ZUI A;  3PEC A;  4A1H A;  3IFB A;  2L67 A;  2RCT A;  1UZ2 X;  3FLL A;  4RUU A;  1ACD A;  1YIV A;  4AZO A;  1P6P A;  1HQP A;  2MM3 A;  1HBP A;  4I9S A;  5EDB A;  1QY1 A;  4AW8 A;  1BLR A;  1JJJ A;  3ZUO A;  2Q9S A;  1OBP A;  3NX2 A;  4ORX A;  4ZHG A;  3WJD A;  1A3Y A;  1DZJ A;  2AT5 X;  3D97 A;  3P6F A;  3IA8 A;  1LIC A;  5D48 A;  3FA9 A;  4M7M A;  1AEL A;  1TOU A;  4TNN A;  1QG5 A;  1BJ7 A;  3O2Y A;  1X8O A;  4AZR A;  4R0B A;  1ERX A;  4AZN A;  1GT4 A;  3HWE A;  4WFV A;  3FIQ A;  1FDQ A;  5LJK A;  1B56 A;  2Q2P A;  4IB8 A;  4YMY A;  3UEW A;  1GX8 A;  3WJC A;  1CBI A;  3O19 A;  1SXW A;  4GKC A;  2OZQ A;  2MO5 A;  3WJF A;  2FR2 A;  3PP6 A;  5L8I A;  2GJ5 A;  4YKO A;  2YG2 A;  1NGL A;  4ZHD A;  5LJB A;  1S7D A;  4BQU A;  2WQA E;  2E4J A;  1OPB A;  2W2F A;  1JV4 A;  1CRB A;  1O8V A;  5KID A;  3VG7 A;  3C76 X;  3MVF A;  1FTP A;  1QFT A;  3FR4 A;  3FEP A;  2AT6 X;  5F7G A;  3DTQ A;  3KFF A;  4IAX A;  4ODD A;  2ACO A;  1YWD A;  1GKA A;  5B27 A;  1QQS A;  2G79 A;  1X8Q A;  3BU1 A;  1OBQ A;  4GET A;  4XMD A;  4CK4 A;  2G7B A;  2FR3 A;  1VYF A;  4NNT A;  3NAD A;  2K62 A;  3WVM A;  1G74 A;  1E00 A;  1FE3 A;  1I06 A;  3B2I A;  2OFR X;  1LF7 A;  1HN2 A;  4TKH A;  2CBS A;  3FA6 A;  4YBU A;  4XMC A;  1H91 A;  1EII A;  1ERB A;  4IMN A;  1TW4 A;  2FWV A;  4EXZ A;  2QM9 A;  3AKN A;  1A2D A;  5FEN A;  2OVA A;  4EEJ A;  1X71 A;  4ORU A;  5D47 A;  3NQ9 A;  2HLV A;  3PH5 A;  2L5P A;  5HZ5 A;  3ELX A;  5HZ8 A;  4ZHH A;  2AMM X;  2IFB A;  2WR6 A;  2R56 A;  5EZ2 A;  4ORY A;  5EDC A;  3KFH A;  3UEX A;  2W2A A;  1IIU A;  3CWK A; 
#chains in the Genus database with same CATH topology
 4C5P A;  3BSZ E;  2Q39 A;  2RD7 C;  3FR2 A;  2VFC A;  2OFM X;  2OL6 O;  1KQW A;  3N91 A;  3EMM A;  4HPA A;  4IMO A;  4OKA A;  2A2G A;  3E3C A;  5IO5 A;  1U17 A;  1SMP I;  3WJE A;  3VHI A;  4A8Z A;  4CDF A;  3F9D A;  3P6E A;  1LIE A;  4ZFX A;  2AT0 X;  4MEE A;  1MUP A;  3WZN A;  1ZNE A;  1MDC A;  4YKM A;  5L8O A;  3CQR A;  5D45 A;  5HCE C;  2LA7 A;  1LDO A;  2BC3 A;  2OY8 A;  4IAW A;  5F6Z A;  5D8J A;  1EIO A;  1X8U A;  1SWD A;  5LKF A;  3VG6 A;  5F6B A;  3WJB A;  4NNS A;  2X8S A;  5LKE A;  1NDJ A;  1BRP A;  1KL3 A;  2CM9 A;  1G7N A;  2RCQ A;  4BX7 A;  1GX3 A;  2BSZ A;  5IRA A;  1MX8 A;  2RTA A;  2KW1 A;  1IJ8 A;  1XCA A;  1I78 A;  1OBU A;  3APV A;  2X55 A;  3P6C A;  4JHQ A;  4O3W A;  5EPQ A;  1PTS A;  3MBT A;  5BVQ A;  4DNE A;  1GKA B;  1VWA B;  5AJB A;  5F58 A;  4Z6J A;  2XST A;  2VDF A;  1VWL B;  1EQD A;  1N43 A;  2FS6 A;  4FGI B;  2JU3 A;  5KHP A;  2C4I A;  2AH7 X;  4MVI A;  4KC8 A;  4YGZ A;  3VU1 A;  5K06 A;  2WQ9 A;  4HFO A;  1VWH B;  5IRW A;  1DV9 A;  1YWB A;  2HZQ A;  3HWD A;  5LJD A;  3TGA A;  2X34 A;  5HBS A;  4OMW A;  3SLJ A;  4ALB A;  1AVD A;  4EFG A;  2FTB A;  2X4M A;  4CPF A;  2RN4 A;  1RST B;  2C1S A;  1RXJ A;  2IZC B;  2AKQ A;  2RTB B;  3P6G A;  1VWR B;  4MVE A;  1SY3 A;  3STK A;  1MEP A;  1VWP B;  2HZR A;  2X46 A;  3ZW1 A;  1SY0 A;  5B11 O;  5D4A A;  1MVG A;  1IW2 A;  1SWJ A;  2NNQ A;  1MM9 A;  2UYW A;  5FAZ A;  3T2X A;  1JZU A;  5AQ6 A;  1LEL A;  3QQ2 A;  4JO6 A;  1VWB B;  5DPQ A;  2HKD A;  1ZRY A;  1LNM A;  2K23 A;  2Y3E A;  3H3I A;  4GNW A;  3U03 A;  1B0O A;  3VE2 A;  1NP1 A;  3ELZ A;  4AZQ A;  3S60 A;  1JJU A;  1STR B;  2F73 A;  3SZH A;  2IZB A;  4CPH A;  2OYB O;  4FBR A;  1ZNK A;  1ZNG A;  3OBL A;  4Y0R A;  4ZH9 A;  4HPC A;  1BRQ A;  5LJH A;  2F09 A;  3OD9 A;  4ON1 A;  1CBQ A;  4BJ8 A;  3HWF A;  3RSW A;  4NLJ A;  3ZW0 B;  3JS1 A;  1X8N A;  1Y52 X;  2Q2M A;  5HCC C;  2JOZ A;  2P8G A;  1BM5 A;  2ANS A;  1K3B A;  2OVS A;  2QO4 A;  4YDA A;  1U0X A;  1DF8 A;  2RTI B;  1L6M A;  2RTK A;  4NP1 A;  5CE4 A;  2DJF A;  4Y5D A;  3EM0 A;  2RQ0 A;  3PQU A;  3S5V A;  2ASN X;  3WXQ A;  4O4U A;  4ZHC A;  1SWE A;  2DM5 A;  2QO5 A;  4BX6 A;  4CDD A;  3STM X;  3RE5 A;  4OS3 A;  1VYO A;  1NBX A;  3FEL A;  3BDR A;  1HBQ A;  4L3R A;  3HTY A;  4Y59 A;  3TF6 A;  4ORW A;  4U8U N;  3T6L A;  2A13 A;  2FS7 A;  3Q6L A;  3T6F A;  3CKG A;  2BS6 A;  4QAE A;  3KFI A;  4OEL A;  1QAB E;  3AEH A;  1YWC A;  4TLJ A;  3LTW A;  4O3Z A;  1KT6 A;  5FQ6 E;  2RTO B;  5HZ9 A;  1A57 A;  2AT8 X;  2OF8 A;  1SRJ A;  1SRF A;  1SWT A;  3MM0 A;  1QY0 A;  1SWA A;  4YGH A;  1ICM A;  4QYP A;  4BVM A;  3B2H A;  1SXU A;  3PPT A;  4IB9 A;  1SRE A;  1JIW I;  2OL7 A;  4QGW A;  3WOV A;  4DQ3 A;  1ALB A;  1ICN A;  1JMX A;  2RA6 A;  5HZQ A;  3FW4 A;  2G8C O;  2R74 A;  4YH0 A;  5HA0 A;  1MK5 A;  2QOS C;  2FT9 A;  3FYF A;  2WUT A;  4PSQ A;  5HZ6 A;  2JU8 A;  1IFC A;  2BT9 A;  1Y0G A;  3ZZV A;  4BX7 B;  4O9S A;  1SWC A;  1GT3 A;  1KL4 A;  2A2U A;  2A5B A;  4L1N A;  1KT3 A;  3P02 A;  3HK1 A;  4PJ2 A;  3WJG A;  2DJG A;  3RKG A;  2A8G A;  5HA1 A;  5HCD C;  1T0V A;  1E5P A;  1DFV A;  1GT5 A;  1GGL A;  1NC9 A;  5DG4 A;  4K19 A;  3NPO A;  2KTD A;  3C77 X;  1KQX A;  2Z4H A;  5IO7 A;  1LCW A;  3P6H A;  4QRL A;  1LDQ A;  2L9C A;  2W2B A;  1QFV A;  3D96 A;  3UEU A;  3C78 X;  1E06 A;  1D2U A;  4QNI A;  4FQB B;  3Q34 A;  1FJ1 E;  4U8U M;  4YCE A;  1SY2 A;  4I6S A;  4ZJ0 A;  2IZL B;  2X56 A;  1QY2 A;  4I3B A;  2POA A;  1SWK A;  4WBK A;  3VG5 A;  1VPR A;  2OVE A;  3EBK A;  4KII A;  4QYN A;  2LKK A;  3RDX A;  3ZW1 B;  1NQM A;  2RTJ A;  3MX7 A;  3QKG A;  2IZJ A;  1DF3 A;  4Y0P A;  3ZW2 A;  1CJ5 A;  3LHN A;  1FEN A;  1A18 A;  4RUN A;  1YUP A;  4DQ4 A;  4GZV A;  4TKJ A;  4ALO A;  1E02 A;  2A3F X;  1OSP O;  3P6D A;  2A0A A;  4QGX A;  2RTN B;  2GC9 A;  3BX8 A;  2L68 A;  1HMT A;  1IKJ A;  4GJS A;  3TGB A;  3X00 A;  1PMP A;  1CBS A;  2FHN X;  2JU7 A;  2LBV A;  4CPH B;  4IAB A;  2GTL O;  2OFA A;  1YP6 A;  2FLJ A;  1LFO A;  4Z2P A;  5H9L A;  2N93 A;  4KCA A;  1SWS A;  1OPA A;  1DZK A;  3FW5 A;  4Z2O A;  3TGC A;  2XKL A;  1HY2 A;  3S5X A;  3WZQ A;  4ZR2 A;  2BLG A;  5HTD A;  1DC9 A;  2WEX A;  1X8P A;  2CM4 A;  3BLG A;  4NW4 A;  2VFB A;  4OEM A;  4AYH A;  3VHM A;  2Z4I A;  3B2K A;  1OEK A;  4XME A;  1EW3 A;  5H9N A;  5K68 A;  1URE A;  1JMZ A;  2IZH B;  2KT4 B;  1STS B;  4IB7 A;  4OS0 A;  5H9A A;  4ARH A;  1KZX A;  3ZI8 A;  3RY1 A;  3F6Z B;  4GUZ A;  2ZAG A;  5FFH A;  1ZND A;  2OF9 A;  1JYJ A;  1SWH A;  3U9P C;  2KD2 A;  5BVT A;  4LKT A;  1DZP A;  4GK9 A;  1Y53 X;  1SWO A;  4A1Y A;  3ZQ3 A;  1X89 A;  2RTF B;  1D3S A;  2IZD B;  2UZ2 A;  2FRS A;  4BCS A;  4EKV A;  2LB6 A;  4GRJ A;  4A60 A;  2RTC B;  1SA8 A;  1GXA A;  1PM1 X;  5AEO A;  3WBG A;  1LIF A;  1SLE B;  2JMB A;  4N7D A;  5HTE A;  3CKF A;  4JNJ A;  2AL0 X;  1ADL A;  1LUQ A;  3BU9 A;  3VGW A;  4MVL A;  5KIC A;  2G5L A;  3RWX A;  1O1U A;  1Y9L A;  1KT7 A;  3BX7 A;  2WSJ A;  1E2T A;  4YDB A;  3CR6 A;  4ID2 A;  3CBC A;  4CPI A;  1S44 A;  4OS8 A;  4YFP A;  3BY0 A;  4CSB A;  4UU3 A;  3SZJ A;  1OEE A;  5C0N A;  2CZU A;  1SLG B;  1KXO A;  2X45 A;  1SWP A;  5H8T A;  3UEV A;  1AB0 A;  2AT3 X;  1VWJ B;  5K67 A;  1I05 A;  4NYQ A;  3RZY A;  3L4R A;  2CAM A;  1BSO A;  4COT A;  4BOE A;  5FQ8 E;  4I3C A;  3DSZ A;  4ZH6 A;  3VG3 A;  3JQO A;  4FBO A;  4ES7 A;  1B4M A;  5L3Y A;  3B2J A;  2PY1 A;  2ZSC A;  3GAQ A;  1AQB A;  3PED A;  4AZP A;  2FKG A;  1GM6 A;  1K24 A;  2QMI A;  3CQN A;  2IZI A;  2MJI A;  1KT5 A;  2NND A;  2NP1 A;  3FMZ A;  3NX1 A;  3PQS A;  2RTD B;  1PEE A;  3UAQ A;  4BX5 A;  4DCB A;  1N9M A;  3BS2 A;  3VG4 A;  3MG5 A;  5F1E A;  3VE1 A;  4BBO A;  4YFR A;  1BEB A;  1N4J A;  5IO6 A;  1RBP A;  1EPA A;  1SLF B;  4GGT A;  5B10 O;  1LIB A;  1YP7 A;  2HYS A;  2X32 A;  4I3D A;  3HOE A;  4KT5 A;  1MX7 A;  1SWU A;  4LZV A;  4Y0S A;  2RTR B;  1DZM A;  4O49 A;  4TQ2 A;  1HMS A;  2EU7 X;  1I04 A;  2CBR A;  1SWF A;  4TKB A;  1VWO B;  1VWE B;  1GX9 A;  1UYN X;  1U18 A;  1VWM B;  3FA7 A;  4I95 A;  4O4S A;  5CHK A;  5HAE A;  1RLB E;  1SLD B;  2I5Z O;  1KL5 A;  4GJV A;  2RTH B;  1T8V A;  2QO6 A;  4NYR A;  5CSE A;  3V8U A;  3STN A;  3VHH A;  4QZU A;  3RDM A;  4EQA C;  5B5F A;  3GE2 A;  2GH7 A;  2OY7 A;  4BGF A;  4GH7 A;  2GTF X;  4B55 A;  1BSQ A;  1SXY A;  2A5C A;  2OVD A;  3OJY C;  1TOW A;  4GGZ A;  1EAL A;  1Z24 A;  3FR5 A;  3RBY A;  3I17 A;  1LPJ A;  1TXL A;  2WEW A;  5EED A;  1AVE A;  1QWD A;  3SAO A;  1LID A;  3FEN A;  5IRU A;  4ZHF A;  3FID A;  1KGL A;  3B2L A;  4OMX A;  1KT4 A;  3EW2 A;  4YFQ A;  4MIR A;  3JSQ A;  4IBA A;  4KH8 A;  1WUB A;  2F01 A;  4ML7 B;  2QOM A;  1SWN A;  1AVG I;  1BSY A;  3KFG A;  3TZS A;  4IB6 A;  1I4U A;  1XKI A;  2OL8 O;  3WZO A;  4Z27 A;  2RTG B;  3NR3 A;  1JJX A;  1IKE A;  1FEL A;  5LJC A;  5LJE A;  1FEM A;  2WWP A;  2ACP X;  4WHI A;  1O1V A;  4M6S A;  3KQ0 A;  1TVQ A;  1T68 X;  2ALL X;  4UU2 A;  1KFF A;  3RDU A;  2CZT A;  1IFB A;  4Z28 A;  5EEE A;  3T1D A;  4AZM A;  4YVB A;  4TJZ A;  5B5G A;  4CPE A;  3G7X A;  4LKP A;  1NP4 A;  3U0D A;  2R73 A;  2I5V O;  4Y0Q A;  2NNE A;  3AKM A;  4ZGU A;  5JD2 A;  3NQ3 A;  4U9C A;  2OFB A;  4N7C A;  4CDC A;  1GT1 A;  1N0S A;  3RDQ A;  2HNX A;  3S26 A;  3FDC A;  1S2P A;  3F8A A;  3HWG A;  5HWZ A;  4GNY A;  2G78 A;  3CMP A;  5H9K A;  1G5W A;  1EUO A;  1PBO A;  2HMB A;  4LZU A;  3EYC A;  4YGG A;  1G85 A;  2LBA A;  5JR8 A;  1UYO X;  3EBW A;  2O62 A;  4BX5 B;  1SWL A;  2FKJ A;  1JBH A;  1W5R A;  1B8E A;  1EI5 A;  5LJG A;  3NBX X;  4GE1 A;  4BX6 B;  3K3L A;  3CBS A;  3APX A;  2MF6 A;  4INN A;  3VG2 A;  1VWC B;  1YWA A;  4Z2V A;  1SRI A;  1SXX A;  2AF5 A;  2RTM A;  1BWY A;  3APU A;  1VWI B;  1SRH A;  1JYD A;  1CBR A;  1ZNH A;  3APW A;  4GGR A;  4NLI A;  1RSU B;  3OE3 A;  3EC5 A;  4XMH A;  4D6B A;  3WYP A;  1R0U A;  2C1Q A;  3ZWE A;  5B29 A;  2GTL N;  1HXZ A;  4XMG A;  1EXS A;  1OEJ A;  2MWH A;  3D95 A;  2LFO A;  4JGL A;  3PDF A;  3D4R A;  4XMF A;  3BRN A;  1NQN A;  3FA8 A;  3RE6 A;  1SY1 A;  3FEK A;  1WBI A;  2IZG B;  3KZA A;  4WFU A;  4D6A A;  4ORS A;  3NP1 A;  1LKE A;  1ML7 A;  2Q4N A;  3HPE A;  1VYG A;  4HPD A;  5L8N A;  1EPB A;  1KOI A;  3I0A A;  3T2W A;  1ZNL A;  3O22 A;  3RY2 A;  4QGV A;  4EDE A;  1BBP A;  3PH6 A;  4ZCB A;  4HWM A;  4YBP A;  2WPU A;  2IZF B;  3EW1 A;  1VWN B;  1N9Y A;  4HPB A;  4I9R A;  4MVK A;  1HMR A;  4U3Q A;  4YCH A;  5IXG A;  4ORR A;  1KZW A;  4U46 A;  2JN3 A;  3RDO A;  3PEC A;  1SWR A;  3ZUI A;  4A1H A;  4CV7 A;  3IFB A;  2L67 A;  2RCT A;  1UZ2 X;  3FLL A;  2X8F A;  4GDZ A;  4O3Y A;  1ACD A;  1YIV A;  1SRG A;  3LV4 A;  4QZT A;  4RUU A;  4AZO A;  1P6P A;  1HQP A;  2MM3 A;  1HBP A;  4I9S A;  5EDB A;  1QY1 A;  5B2A O;  4AW8 A;  1BLR A;  3ZUO A;  1JJJ A;  2Q9S A;  1OBP A;  3NX2 A;  4ORX A;  4ZHG A;  3WJD A;  1A3Y A;  1DZJ A;  2AT5 X;  2IZA A;  3D97 A;  3P6F A;  3IA8 A;  1LIC A;  5D48 A;  3FA9 A;  4M7M A;  1AEL A;  4NV8 A;  4QQ1 A;  1TOU A;  2FHL A;  4TNN A;  4LQZ A;  2RTE B;  2ZAI A;  1QG5 A;  5BYP A;  1BJ7 A;  2GTL M;  3O2Y A;  2IZE B;  1X8O A;  2X8T A;  4U8U O;  4AZR A;  4R0B A;  1ERX A;  4AZN A;  4FBV A;  1GT4 A;  3HWE A;  4WFV A;  3D9W A;  3FIQ A;  1FDQ A;  5LJK A;  2QCB A;  1B56 A;  2Q2P A;  1VWK B;  4IB8 A;  3P24 A;  3UEW A;  1GX8 A;  3WJC A;  4YMY A;  1VWQ B;  1CBI A;  3O19 A;  1SXW A;  4GD9 A;  2BS5 A;  2OZQ A;  2Y3F A;  2MO5 A;  4GKC A;  4NV7 A;  3WJF A;  3HOL A;  2YMS A;  3SLO A;  2FR2 A;  3PP6 A;  5L8I A;  2GJ5 A;  3PK2 A;  3WZP A;  1JQP A;  2AVI A;  2MHD A;  4YKO A;  2YG2 A;  4O3X B;  1NGL A;  4ZHD A;  5LJB A;  2RTL A;  3NQK A;  1W4T A;  1S7D A;  3SOT A;  1LCZ A;  5B3M O;  2WQA E;  4BQU A;  2E4J A;  1OPB A;  2W2F A;  1JV4 A;  4I60 A;  1CRB A;  1O8V A;  1N7Y A;  5KID A;  3VG7 A;  3C76 X;  3MVF A;  1FTP A;  1QFT A;  1STP A;  3FR4 A;  3RDS A;  3FEP A;  2AT6 X;  5F7G A;  4GU8 A;  3DTQ A;  3KFF A;  1SWQ A;  4IAX A;  2RTP B;  4ODD A;  2ACO A;  1YWD A;  1PBY A;  1GKA A;  1SWG A;  1QQS A;  5B27 A;  2G79 A;  1X8Q A;  1Y55 X;  3BU1 A;  1OBQ A;  4GET A;  4XMD A;  3AUM O;  4CK4 A;  2IZK A;  2G7B A;  2FR3 A;  1VYF A;  4NNT A;  3NAD A;  2K62 A;  1HQQ A;  3WVM A;  3WYQ A;  1G74 A;  1E00 A;  1FE3 A;  1RXK A;  1W6F A;  1I06 A;  2PI3 O;  3B2I A;  2OFR X;  4GDA A;  2M4L A;  1LF7 A;  3VPJ E;  1HN2 A;  1LCV A;  4IRW A;  4TKH A;  2CBS A;  4MIS A;  2FGS A;  2JW1 A;  3FA6 A;  4YBU A;  2JGS A;  4ZGF A;  2OY1 O;  4O4X A;  4XMC A;  1H91 A;  1EII A;  1ERB A;  4IMN A;  2KTS A;  1TW4 A;  1VWD B;  1VWG B;  1RAV A;  1SWB A;  2FWV A;  5CYB A;  2QM9 A;  4EXZ A;  3AKN A;  2RTQ B;  5FQ7 E;  2Y32 A;  1A2D A;  5FEN A;  1Y9T A;  2BHV A;  2OVA A;  5BVS A;  4EEJ A;  1I9H A;  1VWF B;  4KC7 A;  1X71 A;  4ORU A;  5D47 A;  3NQ9 A;  2HLV A;  3ZW0 A;  3PH5 A;  2L5P A;  5AJC A;  5HZ5 A;  1RXH A;  1HXL A;  3ELX A;  4CDE A;  3SZI A;  4O4O A;  2OY5 O;  5HZ8 A;  4ZHH A;  2AMM X;  5F2B A;  2IFB A;  2WR6 A;  2R56 A;  5EZ2 A;  3KVN A;  4ORY A;  5EDC A;  1MOY A;  3KFH A;  3UEX A;  2W2A A;  1IIU A;  3CWK A;  3SLT A; 
#chains in the Genus database with same CATH homology
 3BSZ E;  2Q39 A;  2RD7 C;  3FR2 A;  3N91 A;  2OFM X;  4HPA A;  1KQW A;  4IMO A;  3EMM A;  2A2G A;  3E3C A;  5IO5 A;  1U17 A;  1SMP I;  3WJE A;  4A8Z A;  3F9D A;  3P6E A;  1LIE A;  4ZFX A;  2AT0 X;  1MUP A;  1ZNE A;  1MDC A;  4YKM A;  5L8O A;  3CQR A;  5D45 A;  5HCE C;  2LA7 A;  4IAW A;  5F6Z A;  5D8J A;  1EIO A;  1X8U A;  5LKF A;  3VG6 A;  3WJB A;  5F6B A;  5LKE A;  4NNS A;  2X8S A;  1BRP A;  2RCQ A;  2CM9 A;  1G7N A;  1MX8 A;  3P6C A;  2KW1 A;  1XCA A;  3APV A;  1OBU A;  4O3W A;  4QZT A;  5BVS A;  5EPQ A;  3MBT A;  5BVQ A;  1GKA B;  5AJB A;  5F58 A;  2XST A;  1EQD A;  2FS6 A;  4FGI B;  5KHP A;  2JU3 A;  2AH7 X;  4MVI A;  4KC8 A;  4YGZ A;  3VU1 A;  5K06 A;  2WQ9 A;  4HFO A;  1DV9 A;  1YWB A;  2HZQ A;  3HWD A;  5LJD A;  3TGA A;  5HBS A;  4EFG A;  4OMW A;  4ALB A;  2FTB A;  2RN4 A;  2AKQ A;  3P6G A;  4MVE A;  1SY3 A;  3STK A;  2HZR A;  2X46 A;  3ZW1 A;  1SY0 A;  5D4A A;  1MVG A;  1IW2 A;  2NNQ A;  5FAZ A;  1JZU A;  5AQ6 A;  5DPQ A;  1ZRY A;  1LNM A;  2K23 A;  3H3I A;  4GNW A;  3U03 A;  1B0O A;  3VE2 A;  1NP1 A;  3ELZ A;  4AZQ A;  3S60 A;  2F73 A;  4FBR A;  1ZNK A;  1ZNG A;  3OBL A;  4Y0R A;  4ZH9 A;  4HPC A;  1BRQ A;  5LJH A;  2F09 A;  3OD9 A;  4ON1 A;  1CBQ A;  3HWF A;  3RSW A;  4NLJ A;  3ZW0 B;  3JS1 A;  1X8N A;  2Q2M A;  5HCC C;  2JOZ A;  2P8G A;  1BM5 A;  2ANS A;  2OVS A;  2QO4 A;  4YDA A;  1U0X A;  1L6M A;  4NP1 A;  5CE4 A;  3EM0 A;  2RQ0 A;  3PQU A;  3S5V A;  2ASN X;  3WXQ A;  4O4U A;  4ZHC A;  2QO5 A;  2DM5 A;  3STM X;  4OS3 A;  3FEL A;  3BDR A;  1HBQ A;  4L3R A;  3HTY A;  3TF6 A;  4ORW A;  4U8U N;  2A13 A;  2FS7 A;  3Q6L A;  2BS6 A;  4QAE A;  3KFI A;  1QAB E;  1YWC A;  4TLJ A;  4O3Z A;  1KT6 A;  5FQ6 E;  5HZ9 A;  1A57 A;  2AT8 X;  1QY0 A;  4YGH A;  1ICM A;  4QYP A;  4BVM A;  3B2H A;  1SXU A;  3PPT A;  4IB9 A;  3WOV A;  1JIW I;  4QGW A;  4DQ3 A;  1ALB A;  1ICN A;  2RA6 A;  5HZQ A;  3FW4 A;  2R74 A;  4YH0 A;  5HA0 A;  2QOS C;  2FT9 A;  3FYF A;  2WUT A;  4PSQ A;  5HZ6 A;  2JU8 A;  1IFC A;  2BT9 A;  3ZZV A;  4O9S A;  1GT3 A;  2A2U A;  4L1N A;  1KT3 A;  3P02 A;  3HK1 A;  4PJ2 A;  3WJG A;  3RKG A;  5HCD C;  5HA1 A;  1T0V A;  1E5P A;  1DFV A;  1GT5 A;  1GGL A;  5DG4 A;  4K19 A;  3NPO A;  2KTD A;  3C77 X;  1KQX A;  2Z4H A;  5IO7 A;  3P6H A;  4QRL A;  2L9C A;  2W2B A;  1QFV A;  3D96 A;  3UEU A;  3C78 X;  1E06 A;  1D2U A;  4QNI A;  4FQB B;  4U8U M;  4YCE A;  4ZJ0 A;  1SY2 A;  4I6S A;  4I3B A;  1QY2 A;  4WBK A;  2POA A;  3VG5 A;  1VPR A;  2OVE A;  3EBK A;  4KII A;  4QYN A;  2LKK A;  3ZW1 B;  3MX7 A;  3QKG A;  1DF3 A;  4Y0P A;  3ZW2 A;  1CJ5 A;  3LHN A;  1FEN A;  1A18 A;  4RUN A;  1YUP A;  4DQ4 A;  4GZV A;  4TKJ A;  4ALO A;  1E02 A;  2A3F X;  3P6D A;  2A0A A;  4QGX A;  2GC9 A;  3BX8 A;  2L68 A;  1HMT A;  1IKJ A;  3TGB A;  1PMP A;  1CBS A;  2JU7 A;  2LBV A;  4IAB A;  2GTL O;  1YP6 A;  2FLJ A;  1LFO A;  5H9L A;  2N93 A;  4KCA A;  1OPA A;  1DZK A;  3FW5 A;  3TGC A;  2XKL A;  3S5X A;  4ZR2 A;  2BLG A;  5HTD A;  1DC9 A;  2WEX A;  1X8P A;  2CM4 A;  3BLG A;  4NW4 A;  4AYH A;  2Z4I A;  3B2K A;  1OEK A;  4XME A;  1EW3 A;  5H9N A;  1URE A;  4IB7 A;  4OS0 A;  2KT4 B;  4ARH A;  1KZX A;  5H9A A;  3ZI8 A;  3F6Z B;  2ZAG A;  5FFH A;  1ZND A;  1JYJ A;  3U9P C;  2KD2 A;  5BVT A;  4LKT A;  1DZP A;  4GK9 A;  4A1Y A;  3ZQ3 A;  1X89 A;  1D3S A;  2FRS A;  2LB6 A;  4GRJ A;  4A60 A;  1SA8 A;  1GXA A;  1PM1 X;  5AEO A;  3WBG A;  1LIF A;  2JMB A;  5HTE A;  4N7D A;  2AL0 X;  1ADL A;  3BU9 A;  4MVL A;  5KIC A;  3RWX A;  1O1U A;  1Y9L A;  1KT7 A;  3BX7 A;  2WSJ A;  4YDB A;  3CR6 A;  4ID2 A;  3CBC A;  1S44 A;  4OS8 A;  4YFP A;  3BY0 A;  4CSB A;  4UU3 A;  5C0N A;  1OEE A;  2CZU A;  2X45 A;  1KXO A;  5H8T A;  3UEV A;  1AB0 A;  2AT3 X;  1I05 A;  4NYQ A;  3RZY A;  3L4R A;  1BSO A;  4COT A;  4BOE A;  5FQ8 E;  4I3C A;  3DSZ A;  4ZH6 A;  3VG3 A;  3JQO A;  4FBO A;  4ES7 A;  1B4M A;  3B2J A;  2PY1 A;  3GAQ A;  3PED A;  1AQB A;  4AZP A;  1GM6 A;  3FMZ A;  2QMI A;  3CQN A;  2NND A;  2MJI A;  1KT5 A;  2NP1 A;  3NX1 A;  3PQS A;  1PEE A;  3UAQ A;  3BS2 A;  3VG4 A;  5F1E A;  3VE1 A;  4YFR A;  5IO6 A;  1BEB A;  1RBP A;  1EPA A;  1LIB A;  1YP7 A;  2HYS A;  4I3D A;  3HOE A;  4KT5 A;  1MX7 A;  4LZV A;  4Y0S A;  4O49 A;  1DZM A;  4TQ2 A;  1HMS A;  2EU7 X;  1I04 A;  2CBR A;  4TKB A;  1GX9 A;  1U18 A;  3FA7 A;  4I95 A;  4O4S A;  5HAE A;  1RLB E;  3V8U A;  4NYR A;  1T8V A;  2QO6 A;  3STN A;  4EQA C;  4QZU A;  3GE2 A;  4GH7 A;  2GTF X;  1BSQ A;  1SXY A;  2OVD A;  3OJY C;  1TOW A;  1EAL A;  1Z24 A;  3FR5 A;  3RBY A;  3I17 A;  1LPJ A;  1TXL A;  2WEW A;  5EED A;  1QWD A;  3SAO A;  1LID A;  3FEN A;  4ZHF A;  1KGL A;  3B2L A;  4OMX A;  1KT4 A;  4YFQ A;  4MIR A;  3JSQ A;  4IBA A;  4KH8 A;  4ML7 B;  1AVG I;  1BSY A;  3KFG A;  3TZS A;  4IB6 A;  1I4U A;  1XKI A;  3NR3 A;  1JJX A;  1IKE A;  1FEL A;  5LJC A;  5LJE A;  1FEM A;  2WWP A;  2ACP X;  4WHI A;  1O1V A;  4M6S A;  3KQ0 A;  1TVQ A;  1T68 X;  2ALL X;  4UU2 A;  2CZT A;  1IFB A;  3T1D A;  5EEE A;  4AZM A;  4TJZ A;  3G7X A;  4LKP A;  1NP4 A;  3U0D A;  2R73 A;  4Y0Q A;  2NNE A;  3AKM A;  4ZGU A;  3NQ3 A;  4U9C A;  4N7C A;  1GT1 A;  1N0S A;  2HNX A;  3S26 A;  1S2P A;  3F8A A;  3HWG A;  5HWZ A;  4GNY A;  2G78 A;  3CMP A;  5H9K A;  1G5W A;  1EUO A;  1PBO A;  2HMB A;  4LZU A;  3EYC A;  4YGG A;  1G85 A;  2LBA A;  5JR8 A;  3EBW A;  2O62 A;  1JBH A;  1B8E A;  1EI5 A;  5LJG A;  3NBX X;  4GE1 A;  3K3L A;  3CBS A;  3APX A;  4INN A;  3VG2 A;  1YWA A;  1SXX A;  1BWY A;  3APU A;  1JYD A;  1CBR A;  1ZNH A;  3APW A;  4NLI A;  3OE3 A;  4XMH A;  4D6B A;  1R0U A;  3ZWE A;  5B29 A;  2GTL N;  4XMG A;  1EXS A;  1OEJ A;  2MWH A;  3D95 A;  2LFO A;  4JGL A;  3D4R A;  4XMF A;  3BRN A;  3FA8 A;  1SY1 A;  3FEK A;  3KZA A;  4WFU A;  4D6A A;  4ORS A;  3NP1 A;  1LKE A;  1ML7 A;  2Q4N A;  1VYG A;  4HPD A;  5L8N A;  1EPB A;  1KOI A;  3I0A A;  1ZNL A;  3O22 A;  4QGV A;  4EDE A;  1BBP A;  3PH6 A;  4ZCB A;  4HWM A;  4YBP A;  4MVK A;  4HPB A;  4I9R A;  4YCH A;  4U3Q A;  1HMR A;  1KZW A;  4ORR A;  2JN3 A;  3ZUI A;  3PEC A;  4A1H A;  4CV7 A;  3IFB A;  2L67 A;  2RCT A;  1UZ2 X;  3FLL A;  2X8F A;  4GDZ A;  4O3Y A;  1ACD A;  1YIV A;  3LV4 A;  4RUU A;  4AZO A;  1P6P A;  1HQP A;  2MM3 A;  1HBP A;  4I9S A;  5EDB A;  1QY1 A;  4AW8 A;  1BLR A;  1JJJ A;  3ZUO A;  2Q9S A;  1OBP A;  3NX2 A;  4ORX A;  4ZHG A;  3WJD A;  1A3Y A;  1DZJ A;  2AT5 X;  3D97 A;  3P6F A;  3IA8 A;  1LIC A;  5D48 A;  3FA9 A;  4M7M A;  1AEL A;  4QQ1 A;  1TOU A;  4TNN A;  4LQZ A;  2ZAI A;  1QG5 A;  5BYP A;  1BJ7 A;  2GTL M;  3O2Y A;  1X8O A;  2X8T A;  4U8U O;  4AZR A;  4R0B A;  1ERX A;  4AZN A;  4FBV A;  1GT4 A;  3HWE A;  4WFV A;  3FIQ A;  1FDQ A;  5LJK A;  1B56 A;  2Q2P A;  4IB8 A;  4YMY A;  3P24 A;  3UEW A;  1GX8 A;  3WJC A;  1CBI A;  3O19 A;  1SXW A;  4GKC A;  2BS5 A;  2OZQ A;  2MO5 A;  3WJF A;  3HOL A;  2YMS A;  2FR2 A;  3PP6 A;  5L8I A;  2GJ5 A;  4YKO A;  2MHD A;  2YG2 A;  4O3X B;  1NGL A;  4ZHD A;  5LJB A;  3NQK A;  1S7D A;  3SOT A;  4BQU A;  2WQA E;  2E4J A;  1OPB A;  2W2F A;  1JV4 A;  1CRB A;  1O8V A;  5KID A;  3VG7 A;  3C76 X;  3MVF A;  1FTP A;  1QFT A;  3FR4 A;  3FEP A;  2AT6 X;  5F7G A;  4GU8 A;  3DTQ A;  3KFF A;  4IAX A;  4ODD A;  2ACO A;  1YWD A;  1GKA A;  5B27 A;  1QQS A;  2G79 A;  1X8Q A;  3BU1 A;  1OBQ A;  4GET A;  4XMD A;  4CK4 A;  2G7B A;  2FR3 A;  1VYF A;  4NNT A;  3NAD A;  2K62 A;  3WVM A;  1G74 A;  1E00 A;  1FE3 A;  1I06 A;  3B2I A;  2OFR X;  2M4L A;  1LF7 A;  3VPJ E;  1HN2 A;  4TKH A;  2CBS A;  4MIS A;  2JW1 A;  3FA6 A;  4YBU A;  4ZGF A;  4O4X A;  4XMC A;  1H91 A;  1EII A;  1ERB A;  4IMN A;  2KTS A;  1TW4 A;  2FWV A;  5CYB A;  4EXZ A;  2QM9 A;  3AKN A;  5FQ7 E;  1A2D A;  5FEN A;  1Y9T A;  2BHV A;  2OVA A;  4EEJ A;  4KC7 A;  1X71 A;  4ORU A;  5D47 A;  3NQ9 A;  2HLV A;  3ZW0 A;  3PH5 A;  2L5P A;  5AJC A;  5HZ5 A;  3ELX A;  4O4O A;  5HZ8 A;  4ZHH A;  2AMM X;  2IFB A;  2WR6 A;  2R56 A;  5EZ2 A;  4ORY A;  5EDC A;  3KFH A;  3UEX A;  2W2A A;  1IIU A;  3CWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...