2QPEB

An unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title An unexpected outcome of surface engineering an integral membrane protein: improved crystallization of cytochrome ba(3) from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 40
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2qpeB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2qpeB02
3V2WA 2Z55A 2JAGA 4BV0A 2LLNA 4AKPA 2VM4A 1FA4A 2KS9A 3H4HA 4X31A 5F8UA 1JZJA 1T5KA 1WA0X 1XB3A 2UXTA 3IN0A 3MX0B 3TBCA 1WS8A 2XU9A 3T6ZA 5H2OA 5AFAA 1AZBA 1MG3C 1NIFA 3AYNA 3OE8A 3KW7A 3HAQA 4GYBA 1OOWA 3FSWA 2X87A 1OCCB 1E12A 2BWIA 3IE9A 3JT2A 1ZIAA 2XYBA 4GY4A 2UXFA 3REYA 3JTBA 2HLEB 2QPDB 3C9LA 3NYAA 4A4MA 3T45A 2GC4C 3NJMA 3NJIA 4KNSA 1ETJA 5TGZA 2P80D 2OV0A 3PBLA 2JFCA 4DP2X 2I20A 1KDJA 1AACA 1A4AA 2FT6A 1P8IA 2J55A 4TXVB 5H2NA 3VG9A 4CSZA 1JVLA 1BQ5A 3SBPA 1F4ZA 5G2CA 2PEDA 1SJMA 3ASOB 4XTNA 2HX7A 4PXKA 4DKLA 4XXJA 2RACA 2R4RA 2W8CA 2XV2A 4KO7A 5I26A 5B6XA 5PAZA 5B7EA 1BQRA 3WQJA 2ZZLA 5BR5A 3NS0A 4AMJA 2XWZA 4QLWA 4GRVA 2XV3A 1PXSA 1MDAA 3X1GA 5B7MA 4DPBX 1EZLA 2QDVA 3DIVA 1AIZA 4AKQA 3MBVA 1BEXA 5B1JC 3ABWA 3NJJA 1OCZB 3QBKA 2TSAA 1H2SA 1ET8A 2CALA 2J56A 1OV8A 1KYAA 4DP6X 2JXMA 5B6YA 1W6LA 2IDQA 4RH4A 3WNIA 4BXSV 1GZMA 3CG8A 3AYMA 4BXVA 3T6VA 5FC9A 1L9QA 4GYCA 2WJKA 3FQ1A 1IBYA 4JKVA 4ENZA 3KW8A 1SFHA 1XB8A 1HAWA 4GXFA 2FQFA 3ZPQA 5H2HA 1KGBA 5B35A 5JJJA 4A2GA 3UAAA 1AZCA 2VSMB 3DQBA 4KLYA 2HZHA 1UATA 1J9SA 4KNFA 3ASNB 4TL3A 4OV0A 4L0PB 3X1BA 1WA2X 1GUEA 4MQSA 1FBKA 1GS6X 2Q5BA 2FQGA 3IEAA 3PAVA 1AOZA 1P8HA 3ABLB 2I7SA 5I28A 2L6XA 5I6LA 5A45A 3UZAA 1L0MA 2YCZA 2DWSA 4FBZA 2J57A 4UF7C 1IW9A 3IN2A 3NSDA 5A7EA 2R4SA 4CSPA 7PCYA 1M0MA 4FAAB 2FNWA 2HRGA 1NINA 3X1EA 1NPJA 1Q5JA 2P80A 2YDOA 4A68A 1JZEA 2PPDA 2XLLA 1X0K1 4HYXA 1ADWA 2YXVA 3ABKB 3AG3B 5ETZA 5B7FA 2GBAA 4GP8B 4M4RB 2VM3A 1CWQA 3QJVB 1PF3A 1URIA 1AP9A 4N4YB 4A2HA 1ILSA 1AS6A 1FFTB 2GC7C 2GI0A 3N55A 1C8SA 4YSPA 1UCQA 3UACA 1KCBA 5TK4A 2OCCB 4QI1A 5B3SB 2VT4A 4G7SB 1SFDA 4YSOA 3PAZA 2DY2A 1IUZA 3CODA 3ODUA 3HARA 1GR7A 1UAZA 2AFNA 2WSDA 4GP5B 1QKOA 2BO0A 4GP4B 4P5SA 3V2YA 1AZUA 2MRYA 2YXWA 3T9WA 3WI9A 1J5DA 4E9QA 1O0AA 2ZXWB 2YQBA 3UAEA 4GPOA 2BW5A 2EINB 4JHUA 3EF4A 3AY2A 1PZBA 4KO5A 3NJGA 1V55B 2DV6A 5B1KA 4LDEA 2F93A 2NTUA 3ABGA 1BYPA 2GIMA 2Y02A 1M57B 3OE9A 1GS8A 2HX9A 3X3BA 1L9PA 1L9SA 4XT3A 2YAEA 1VGOA 4LDLA 1DZ0A 1KBVA 5AWZA 2WO3B 1J9TA 3CDZA 2QPEB 3PQRA 1QLEB 3X3CA 1PLAA 4BEYA 3FYIB 1B3IA 1BXVA 2CUAA 1NZRA 2YAMA 4LDOA 3ERXA 4XT1A 1JXDA 1OE1A 2I7OA 4MQTA 5DHGA 2IWEA 3GYRA 4AX3A 4G7QB 4J4QA 4BVNA 2VSKB 3SBQA 2HPYA 4JQ6A 2VMJA 4HIPA 5DHHA 3CDZB 4G71B 4QIDA 1KMEA 4DJHA 4YSUA 1E0PA 3HEIB 2TSBA 1SHXA 3NJHA 2KSYA 2IWFA 3QDCA 1TN5A 1NDTA 1XIOA 1PXRA 3EMLA 5H2KA 4WKXA 4F2FA 2G87A 3IBOA 5G28A 1JFPA 1IBZA 1MZZA 4YSEA 1N68A 3HAOA 2WJLA 4PAZA 1AQ8A 4HWLA 3T71A 1GSKA 5G53A 3MBWB 5G36A 4HALA 1LN6A 2BP8A 3BQVA 4EIYA 1R84A 4UHRA 4DPAX 2H3XC 2Y00A 2GB2A 1SF5A 3UZCA 1JZGA 3S3CB 4BDVA 1FBBA 1X0I1 4IARA 5B2NA 5ANHA 3RYMA 3UADA 4WAVA 1BAWA 4KOCA 2YDVA 1IC0A 2YAFA 4MD1A 5PCYA 1AT9A 1IXFA 1PY0A 2BP8B 1PCSA 2YAOA 1NWPA 1JZIA 2YAHA 1NIBA 2QT6A 4YL4A 1WAEA 3UTVA 3NY9A 3NSBA 4JKNA 1E5YA 1FWXA 4BDVB 2YAPA 1NWOA 1PZAA 1JZFA 1H68A 4BWBA 1ZV2A 1TEFA 1OCRB 2PLTA 4BWWA 1QHQA 3FSVA 4UANA 1PY6A 2XX1A 1GU8A 5I6OA 2XXFA 3KJ6A 3WKQA 4YVUA 1PLCA 4Y9HA 1PMYA 5TK2A 2IDTA 3EH4B 1RKRA 4G7RB 4A2DA 3OD3A 5I6NA 4FA7B 2Z73A 3FQYA 2ZOOA 4HCFA 3COCA 2VW6A 3NJKA 1XJIA 2CBPA 4YSAA 4KO6A 1J5CA 2IDFA 1JXFA 4E9YA 2X72A 1U19A 1JV7A 1QHJA 2FT7A 3V9CA 4K5YA 3EH5B 3QBIA 4YSDA 2FTAA 4AKOA 1A4BA 2YCWA 1AZRA 2PP9A 1VJMA 1M9WA 1MG2C 1NIDA 3AG4B 3PAUA 3V9EA 2FQDA 3OE6A 3PXOA 2VW4A 3FPYA 3HB3B 3QBLA 4EF3A 3NSFA 2OJ1A 4N8UA 4E9SA 4YSRA 2PP8A 1WS7A 3ZBMA 1AANA 3ZPRA 3QAKA 2ZWNA 3TBBA 3A7KA 2I35A 3N2JA 3QJSB 3UGEA 3WIAA 4MFHA 2BRDA 2JAFA 2ZIYA 4NC3A 1ET5A 1NTDA 1W6WA 2BHFA 2IH8A 3PPSA 1P8UA 5IY5B 3QJQB 1CYWA 4YSTA 5D4IA 3ZEVA 3S3BB 1HFUA 4DP9X 1ZPUA 3QJUB 5H2JA 1W8EA 3FYEB 1KDIA 1XB6A 3T6WA 5B0WA 3VGAA 3WNJA 4KNTA 3FQ2A 5JJNA 3FU9A 1ZIBA 2FJSA 1L9HA 5JJEA 2DYSB 1ID2A 2B08A 2ZONA 3X2QB 4AI7A 2EI4A 2UX6A 3NP4A 2PPFA 1S8JA 2PPCA 1E5ZA 4BWUA 3NYKA 3VVKA 4X1HA 5B6VA 1A8ZA 5EHFA 5D4HA 3WG7B 3ZX1A 4HHGA 1GW0A 1Q5IA 1S53A 3OAXA 1BRRA 3FU8A 2HXAA 3H4FA 1TN0A 2Y69B 1JZHA 1R1CA 1BYOA 4HYJA 3QBGA 3AW5A 3EHBB 2AT9A 1AZNA 4A2FA 1X0SA 2RH1A 2B3IA 5AZUA 1KV7A 1MGYA 1X9RA 2I1XA 1L9TA 3G5WA 3H56A 3QPKA 2J4YA 1SNRA 1JERA 3VW7A 4UG2A 1CYXA 4DP8X 3BVDB 3S8GB 1E65A 1KG9A 2EILB 3VHZA 1KCWA 3RFMA 5FJGA 1ASQA 2FQEA 4KOBA 1PLBA 3UABA 2GHZA 1ILUA 2IH9A 3OE0A 1TEGA 4QKTA 4DAJA 4IB4A 3ZDWA 1SHWA 2I85A 5I6KA 2KSAA 1DYZA 1L9RA 3HAPA 5B1AB 3QJTB 4HAKA 4W1TA 1CURA 2A3TA 4G70B 1GYCA 5H2PA 3AM6A 2PCFA 1BQKA 1V10A 1QM8A 1BXUA 2BZ7A 3AG1B 5G2AA 2N0MA 4BUOA 1JV6A 5D4JA 3RZEA 4A67A 4E9TA 3S8FB 1J9RA 4AZUA 1BM1A 4NAJA 3U25A 1PZCA 3ABMB 1AG0A 2HRHA 3CAPA 4WW3A 2MTAA 2H47C 3GDCA 3NSYA 4YSCA 3QJRB 3FPXA 5B6WA 5AX1A 3D4SA 1F50A 3UG9A 3QQXA 4P5RA 3NSCA 3TU6A 2YCYA 2AANA 1EHKB 3UTWA 3UTYA 1DZEA 3UTXA 5C1MA 1RZQA 5AZDA 2VW7A 2Y01A 5I6MA 2UXGA 2AVFA 1I53A 1X9UA 1ZDSA 3FS9A 3AZUA 3OMIB 4PCYA 2FWLB 1MZYA 2XX0A 5H2LA 1E30A 2CCWA 1PNDA 2H5UA 3AG2B 4DP4X 2QDWA 9PCYA 3CVDA 1CUOA 2PCYA 1S52A 2HX8A 1QNIA 5AKRA 2KSBA 3C9MA 4MD2A 2AZAA 2XVBA 3CZUB 2ZFEA 1AS7A 1C8RA 3PDSA 5A44A 5ITCA 2DYRB 4L6RA 4WTQA 3SQRA 3FSZA 4DP5X 8PAZA 3DTUB 5AHZA 1OE3A 5I6PA 1GS7A 1V54B 2UX7A 5EN0A 4MBSA 1S8LA 3HANA 1F88A 3P0GA 4GBRA 3CVCA 5AX0A 4EA3A 1HAUA 1CC3A 3OQRA 4HZ1A 4ZK8A 2YAQA 1SF3A 2XV0A 4YSQA 3X1NA 2PPAA 1KGYE 4Q89A 5G2DA 3WKPA 4DP0X 5H2IA 1JGJA 2BWDA 4E9WA 6PCYA 4PXFA 1A3ZA 1F56A 2UXVA 3DDLA 1IKOP 1JXGA 2JKWA 3NJLA 1L9OA 3FSAA 1S54A 4G72B 2GSMB 3C75A 1N70A 4E9VA 2M3GA 2EIMB 1J9QA 4DP7X 2FT8A 2VN3A 4AMIA 2BW4A 5LWEA 2Q9OA 1KG8A 1SDDA 2PP7A 3PLYA 5I5MA 2XUWA 4UAHA 1M0LA 2YARA 1S51A 1E67A 6PAZA 1AG6A 1PAZA 2W88A 4QRYA 3PXLA 5ITEA 1WA1X 1R2NA 3OMAB 2IDSA 1M0KA 4DPCX 1A4CA 4L35A 1RZPA 4FPDA 3NP3A 1NIAA 3OMNB 4X4KA 3ZIYA 1JOIA 4BWTA 3D12B 3NJFA 4KNUA 3CVBA 2YCXA 5BR2A 3NY8A 1SDDB 5H2MA 3FT0A 4Q8BA 1YLBB 4N6HA 5F7BA 1PNCA 1ET7A 2DWTA 3NJNA 4W9ZA 4EJ4A 3HASA 2EIJB 3T6XA 4NB7A 4N4WA 4NERA 1OCOB 5DYSA 3FU7A 5E9NA 5I5JA 2Y04A 1AS8A 2PPEA 3PCYA 4KO9A 4X32A 4E9RA 2I21A 1A65A 4IAQA 5J7AA 3S3DB 2X88A 1AAJA 2EIKB 5A8EA 3NT0A 4F2EA 2J5WA 1BRXA 1GY2A 3DKHA 4K9JA 3SBRA 1KBWA 5B1BB 2E86A 1ASPA 5B6ZA 2AZUA 5KKHA 1OF0A 1ASOA 2BZCA 2WO2B 5B1JA 1HZXA 5LDUA 3FU7B 2LNLA 4BK5C 1QKPA 4HHWA 5G54A 2CAKA 4A66A 4XTLA 1ZDQA 5AHYA 2IDUA 4HCGA 3TASA 4E9XA 2NTWA 1XMEB 3EH3B 2NRDA 4JHVA 2R7EA 4YSSA 1AR1B 5F7AA 4DP1X 3PWHA 4XTOA 1GY1A 1BXAA 1NIEA 3VI0A 3GXUB 1OE2A 4YVNA 1TKWA 1TU2A 2BP0A 7PAZA 4M3HA 4A2EA 2IAAC 4JR8A 1M56B 5B34A 1JVOA 3X1FA 2XXGA 5I5IA 1VLXA 2IWKA 2Y1AA 2R7EB 3UONA 3OM3B 3TA4D 4BEZA 2CJ3A 1NICA 3L45A 4F7KA 2Y03A 3SN6R 3QAPA 1RCYA 1BRDA 1NPNA 2BP0B 4HCIA 2F95A 1IW6A 1C3WA
chains in the Genus database with same CATH superfamily
1GGIL 2EDEA 2Z1PA 4BFRA 3D4ZA 2VM4A 3FU0A 3MOBL 3G6AA 2UXTA 1EEYB 3L6FA 4BRJA 1FGVL 5FXCH 5FDWB 5A16A 5HVGB 3ZDZE 2YZ8A 4DGUA 4CGTA 1AD0A 5DLMH 5AVXB 1M6OB 4D9RE 4GYBA 4K9EL 3OXSA 3VE0B 5CGTA 1LILA 2VR7A 3D3VA 4KTEL 4O4YL 4I4WA 4PG9A 4OKVB 2XYBA 3UAJA 5BQ7A 1CCZA 2KLRA 3KH3A 1CDUA 1FE8H 4PJDB 3S36X 2A6DB 3CLEH 3QAZC 1TNMA 3LZRA 4XVUC 3MROB 3KLQA 4KDTA 3X12A 1OP4A 5J6HA 2D0HA 2CO7B 3TLRA 1Q9LB 1OSPH 2CLVA 5EZPA 3WNPA 3UROR 3KJ6H 3ES6B 4PEEA 4IRSB 4BKSC 5ICZA 2JJTA 1F6AA 5DI8B 3ZJAA 3QFDB 3WY1A 5I26A 5E1GA 2WBXA 2R69L 4BIKA 1ACCA 1FC2D 3QHTC 5I9QC 3MUGA 5F3BB 4NRZB 2FX9H 1T6VN 4MD4A 1AR1C 5EBLB 3DX7B 2VLKB 5LGYA 5MENE 2BX5A 5BR5A 3CN3A 5D6CA 1UZ8B 5DQJB 4K3EH 2E8ZA 5E5MA 1RK1B 3O3AB 4PJ5E 2DTMH 3GHEH 4G5ZH 3VRLF 2ZJSL 1EZLA 4DPBX 1HJBC 2OMTB 3N06B 3GM0A 2J56A 4DP6X 4BXSV 4DVRH 4HJJH 3FTGB 5I17B 2MEJB 3WFHA 4K94L 4LEXH 1DO6A 2N4IA 1I9RH 2P42B 3IGUA 2CBQA 4JPKL 3SKOB 2H0PA 3BLBA 4PJAB 5IHLB 1L3WA 2QADD 4L23A 4O9HL 4FG4A 4NQDA 4S2SB 1EH9A 5D7SH 4Y2OB 4JM4H 1D6VH 4CA4A 3RBGA 2QLVB 4N20A 4R96B 3IXAB 2KL6A 2F53D 4WW2A 1CGSH 1P1ZA 1P7QA 2BOBB 4NBXB 5DWUL 4R7NB 4NZJA 3TF7C 4X8JB 1HYSC 4NFBA 2P8LA 3LKOA 5EIVA 5BNXD 5L7XH 1IGYB 1IC7L 1G7QA 3WGVB 2Q1EA 1JXJA 1KCKA 3BAXA 3V4VL 3L4CA 4N2BA 2HLFD 1V3KA 3OLDA 1TFHA 1WDAA 4TSCL 4AV4A 3LPOA 5HYSG 4MMZB 1CWQA 4M7LT 1G0XA 1R6VA 1DJIA 5DZVA 1N0LB 5FGRA 2XWJB 4FFWC 1DCEA 2V2TA 2H9GA 3QXUA 3FCTA 3WTUA 1PIFA 5DD6B 5E7BA 1SQMA 2FYYA 5T8IA 4KDTC 3K7UA 4JFDA 1YPZB 4QRSA 4UM9B 4PJ7F 3U0WH 4IYKA 2XBZA 1UXSA 3UP6A 4R7VA 3GI9H 4ELMB 1CPUA 2B5IC 4ONGL 2EAEA 3S5ZA 2JJTC 1U92B 4A7GF 1NFIA 3QS2A 1SOQA 4JHUA 1NBZA 1OT4A 4PJ8A 5FX3A 3BQUA 4I77H 5I1LB 3QVAA 4LDEA 1HCZA 4G1MB 2ZXCA 4EBQL 5L2JB 3X3BA 2YPLE 4N28A 3VFNA 2VLRB 4H4NA 1A7BA 3Q13A 1MLCA 2Q76A 2ZOLA 1EFQA 1FV1B 1YN6B 1MHEB 2JKXA 2L7EA 4JX0A 3BUYA 3GSQA 5D1XD 4HQQH 1WFIA 2EIZA 3QDJE 4XT1A 3KDMB 2A6IA 4JFVA 1T21B 4F8LA 3B7RL 3IGLA 2C3XA 5CCKL 1G84A 5DRNA 1W8NA 2B9AA 1KY7A 2Y2YA 4JFHE 4ZTOH 1RH8A 3MV9A 4PRIB 2BVOA 1R5WA 2YEVB 3EUDA 3NIGE 1IX2A 2W9DH 3NJHA 4P5KB 4ZS6D 2DI8A 4LDOB 4ANWA 1I7ZA 2OM5A 3DMMD 4YK4C 2EE0A 4EAEA 3EMLA 3IJSA 1YC8A 4K23L 1QZNA 3ARRA 3SKMB 4WW2C 3N0AA 3ZGHA 4GW1B 4QHLA 2WJLA 2QKIA 4D7BA 4KGLA 4J3TA 5KW9L 3BH8A 2DKUA 3KBEA 3GMRA 4XP6H 2RA1A 4RWHA 3BSZH 3M8OL 4UHRA 4DPAX 5HGHA 3UJJL 4XP9H 5TPWH 3HI6L 2H1PH 2XQYG 4QJ5B 4LCYB 1K85A 3VMNA 5B2NA 3EO0A 4AYMC 2UWEE 3LXAA 4LCCB 5I8OL 2YKLL 2DDQL 1RULH 3MTXA 1LVEA 2YAOA 4PJ5B 2OS7A 4JJHA 2YAHA 4GKLA 2NNAA 4G8GE 2WAQA 4X6EB 3S35X 2B0SL 3IETB 5HPOA 4JFFB 4FXLA 5EF2A 3B2UD 4MD5A 5E08H 4Z7WA 1S7XB 1N59B 1QWNA 3ZTEA 2BIHA 2YXFA 1A6PA 5DK0B 3B9AA 1Q1JH 2R0ZH 3LD8B 3NCXA 5IWLA 1CYGA 4GAGL 3QDHA 4LLUB 4W4NA 1DBKH 4ONOA 1ECZA 3QXDA 3QJFA 4IS6A 4GKNB 1FPTH 3EFDH 2JJWA 4OFIA 3EH4B 4PJ8C 3BQUC 1NKOA 5HI3C 4FTVE 3UG3A 4KI5D 4WW2F 2D0FA 1OGSA 3LQAL 4TUUA 4YDMA 2ZNWA 4ZUUA 3NJKA 1J5CA 5ICUA 3DVNA 3NA4A 1JXFA 4UQIM 4FFTA 1OAZH 3LIZH 1IBHA 2EDMA 2WKOA 1DN0A 3HZYA 1U6AH 3V95A 4FQCL 2AABH 3A5VA 3PAUA 2EH8H 3F7YA 1MIEL 3H53A 3HB3B 1TMCB 3MYJA 4LLWB 3CN0A 1KYOK 1DQLL 2VITB 1IAII 3OXRA 1U41A 1KZYA 1ZLEA 4L5FL 2C26A 3MBXH 5FKAB 3A0OA 3AB0C 5D93B 4X4ME 2VN5A 3Q01A 3EOTL 4X9IA 1T20B 3PWNA 2Q7YA 3WS3A 1UACL 2G5BA 1W8EA 2X9XA 3T6WA 3IJEA 3O9WA 1ZHNA 4KKLD 3WNJA 2QKIC 4FJZA 2XZAH 4KROB 1H9VA 3BN3B 3CDFA 1P5VA 5HD8D 4Y9FA 4QGYA 2BDNL 5F6IC 1NJ9B 1A14L 2YKKA 1RHFA 4M29A 1CQYA 3E7JA 4P23B 3IFPA 1S4IA 1LDPL 1GW0A 1R3KA 3L2LA 1FFPB 3EBIA 4FKEA 3VGAB 1TN0A 2Y69B 2YA2A 4H5SA 5G4OA 3I6GA 4H8WC 1KTJA 1BLNB 1FF5A 2VLKD 3DOIA 3ECUA 5T1MA 1MGYA 1TJMA 4I1RA 5EEYA 3TTYA 3BX7C 1DBJL 4W6XB 5EC1A 1S7TA 4CKQA 5C0FB 1ZHLA 1CD8A 1ZT4A 3BW9B 2AC0A 2MHAA 3OKMB 1CVRA 5DZAA 2OAAA 3UC0L 5IWLC 2ALAA 1DL7L 1L9RA 3ZR5A 1MFMA 2DS4A 2G30A 3NIGB 3J2PA 4XCYA 1YEHL 2D3JA 1B90A 3DK0A 3I3EA 3L4VA 4JQVC 1ZD6A 4QRUA 1HL9A 4GOSA 2PCFA 3N1GC 3RWDB 3Q7JA 4HAFA 2DH3A 1QSEA 2G9HA 2PN5A 1XCWA 2BWQA 4AY0A 1HL8A 4BCXA 4Z77A 5FM8A 1UGKA 4HMCA 4YE4H 4G7YL 1QRNE 3ABMB 4JRYE 3RURA 4HIIA 3WDHA 4AGPA 1Y6KR 3L3DB 1JFHA 2J88L 2OL3H 1EFXB 3GM8A 1MREH 5CEYA 3RB5A 3I85A 4XMWA 2X6AA 3J27A 2WXJA 3A6BL 2ICWB 3RWIB 5D7JC 5KSAD 4AW7A 3HC4H 1AQDB 2XJKA 3WXVL 3CXHK 4ZFZA 5DURB 4X99B 4EN3C 3IRCA 5AW7B 4P59L 3M07A 5KVFE 2UXGA 2YGOA 3REWA 1C12A 4FEIA 4Z7WF 4R3SB 2J43A 4YXLH 1LQBC 3QWOB 1MZYA 4TUJA 4HK0B 4NNXA 4APQC 1LWRA 3O9WC 1HQ4B 3BT2L 3FUKA 3VI3A 4PGJA 3DUSA 3PV6B 3RPKA 3FTZA 3FU6A 4R2GC 1DJZA 8FABA 3K0WA 4G9DB 2DYRB 3FSZA 3W2DH 4YDLC 1IIIA 3OAYK 2MFNA 4FTVB 5L2KD 4NKMB 5EEXA 2XBTA 4NKOB 1XH2A 1J8HD 4MAYA 1MIMH 3P3SA 1SY6H 1U4FA 5EG6C 3GZQA 5DS1A 3HBQA 3CTTA 2WKOF 3UIYA 1KJMA 3GEFA 5I18L 5IMLB 3D85B 1O9WA 1DSYA 2AGJL 2F15A 4F9PA 5JOFA 1FAIL 1B2WH 1T0NA 2MOGA 3QI9A 5E2JA 4FQHB 2D03L 3JV4A 4UDUB 2IPKA 3QRGL 4NSKA 2QVTA 3WKNA 5DJDB 3DX3A 4H1LB 4LRIA 2XG5A 4IBSA 1ZANH 2G75B 1TJGH 1ZTXH 4YC2C 3BH9A 1WBYA 4NZUL 1UKSA 2WBJA 4HJGB 4LHUD 4D9RD 2K6YA 5L0QB 1WD8A 4MTMA 4PRID 4DGYL 4H25B 2OXGA 1DANU 2CIIA 2ICWJ 2W88A 5EO9A 2RGSA 3D69B 4N87A 1J86A 4HPYL 1UTDA 2E6QA 1QTPA 3OKEA 5B3JF 3B83A 3V8OA 2YC1A 1S7WA 3A67L 1NCBH 2YMTA 1JOIA 4RLDA 4AV0A 5JZ7C 5BUGA 4E9XA 1C5BL 2R2EB 3NCCB 3NJNA 1XR9B 3S35L 4G43A 2DQIH 1KCLA 2R2CA 1C16B 3QAZB 4KO9A 3S4SA 4HH8A 1V8HA 3D1MC 1R0AH 4AITA 4IAQA 4HCRA 3LIUA 5A8EA 4JO5A 2ZOUA 5KVEE 2GQHA 2V2XA 3GBEA 3EYSL 4QRBA 1GY2A 5HDBE 5F1IB 3UG4A 5MEND 1N5AA 4WNQA 3EO1B 4J27A 5LNEA 3ROOA 5I8CA 4PJ5D 3UPAA 3BDYH 1GCYA 5DHVA 2DWEB 1RVFH 5AW9B 1CI5A 5JMOC 3K46A 5EN3A 4YWGH 3GKWL 4AIZB 3AUWB 4NQVA 5CN2A 2E76C 1JK8A 1XCTB 1AR1B 3K8KA 4X80H 3PWPA 2XWBB 1B9KA 2XWCA 3O2WL 5DT1L 1TTUA 1CD1A 2IAAC 4JR8A 2M8XA 5DUBA 1AFVL 2XXGA 2QKSA 1FL5A 3O4OB 1VLXA 2F7OA 4JFDE 3ZKXC 5I5IA 4L18A 4Z7NE 3IDMA 2DQDH 3QNFA 4MAYC 1U21A 2XNAA 3A24A 4PJ7B 5D7EA 2CDFB 2HYMA 3H7BA 1C3WA 3EGSA 2JAGA 3OWEA 4LSQL 1J1XL 3P30H 4DVBB 4W9KC 4F9PC 5F8UA 5EU7C 3SDCD 5FKPA 2NSMA 3TBCA 1BBJA 1INQB 5EBWB 5H2OA 1AQKH 2OMWB 1RSYA 1NIFA 5AZ2H 4OUUA 3II1A 1XIWA 2ZCLH 4LRIC 3FBKA 2E7MA 4Y2DB 3FO1A 4PR5B 2WBJC 1S3KH 2Y7SA 4QYAA 3G6AB 4ODXA 3CSYA 4L05A 5GRXG 3L6FB 4DEPC 1T0MA 2VYRE 2QPDB 3CHXA 3NYAA 3B4NA 1ANUA 5A16B 5CP7A 1T7VA 3T2NL 5J3HD 4Z7OE 5IVZA 1AD0B 4LRNL 5GZND 3ETTA 4LCIH 2XVLA 3OXSB 2IBBA 2D9CA 4KROD 4KZ0A 2QHLA 2QVKA 3D3VB 3IMSA 4KK9D 1BQ5A 4I4WB 4PG9B 4TL4A 2QQLL 3UBXB 5BQ7B 5CJ5A 1F4ZA 1Q9KA 1IM3A 2D2CC 4LOVA 3RIAF 2JKTM 3X12B 2ITFA 3WQJA 4V33A 1XF1A 5F1SA 3M1OA 5J6HB 4M4PA 2ID5A 1MKFA 2BHYA 1BHGA 2CLVB 3BPOC 1RPUA 5CZVH 2B5IB 2HCZX 1NA8A 1NAMA 5ICZB 5TGBA 1OCZB 3VXME 4S0HA 1DCLA 2G0KA 4OIAA 1ET8A 4M5TA 1EXHA 2Z0BA 3OLIA 3UYPA 4J6IA 4AJVA 5K9JH 1NCJA 3MUGB 1NUDA 1JGUL 4X7EC 4MD4B 3RGVA 3ZYZA 5F7LB 4IDLA 2OMZB 5D6CB 3T2OA 1YN7A 5E5MB 1ROCA 2YGQA 3UOAB 2HT2D 3W1ZA 3WNOA 3PU7A 4JFHD 4GBXC 1FN4A 3MRHB 4MNHA 2RAMA 2VDMH 3G6DH 3WFHB 1KN4H 1IZKA 1JF1A 3O3BA 4QHMA 4TF4A 3VWKD 3GZOA 3BKCL 5FGSA 2YGVA 3D6GA 1I1AC 5J9PB 1TENA 2XYCA 1E6OH 4HKBA 4K71C 4FBZA 2BSRA 2NR6D 2PR9A 1IW9A 3TA3A 4DO5A 3IN2A 5JDJA 2AJUH 3V9FA 4NQDB 2K7PA 4WGKA 3LHPL 2HFGH 4YK4B 4PWGA 1C7SA 4WAFA 3BZ5A 4NQEE 4WW2B 1P1ZB 1P7QB 4WNJA 2OMUA 2ZG3A 4NFDA 2P8LB 3LKOB 2GTWA 2P48B 3QCUL 1VDGA 4A2HA 1G7QB 1ILSA 2BCKA 2GI0A 5CKAA 4GI9A 2LU5A 3MRKA 3WLWC 5AB9A 2XZCL 3KYKL 1F90H 4G8GD 4M7ZC 3VGBA 4PREA 1OAXH 4G7SB 2IO5A 5F9OH 1F0LA 3FOLA 3D2UA 4XGZA 4ACTA 2VZSA 1F4XH 1KCUH 1XDTT 4G6FD 2V2TB 5LBSA 2H9GB 5EF1A 5C3IA 1HT6A 4F93B 4WJ5A 5IGXL 2FYYB 2FEDC 1R3LA 3AADB 4JFDB 4WU7A 4FTVD 4QRSB 3ZGIA 1BVOA 3SJVE 1UXSB 3T2PA 3NSXA 2Q10A 1PLAA 3VD2A 1NFIB 1MCFA 3BE1L 1INEL 2H4EA 4ZI8A 1NBZB 1RP8A 4PJ8B 3BQUB 1E4XH 3UZQA 3U0PA 4LDEB 1TLMA 5F89B 5EOQH 3RGVC 5AKTA 3GNMH 4K5NA 4DZ8A 3O6LL 3VFNB 2PWFA 4Q2ZA 3F85A 1EMTH 4UQBA 1MLCB 1T4KB 5JMRA 2Q76B 4QIDA 2ZOLB 2ZXGA 4GW5A 4ODSL 2DJUA 2UUDH 4WU5A 3BUYB 5I0VA 3GSQB 3BP7A 4MZ3A 2EIZB 3VQ2C 2A6IB 2ZWZA 3VTMA 3MFGB 1WZKA 2IGFH 3KPPA 3HAOA 5DRNB 2IANE 3ZQWA 4MA1C 3MV9B 3TA3C 3W5MA 3WO4C 2BVOB 3AB0B 1R5WB 4KXAA 5EB9A 5EIIA 3U82B 3E2HC 5K9QG 4X5LA 5LXGL 5D71L 2WQVA 4RFNB 1R84A 2EE3A 5K69A 1I7ZB 3O2DL 4HOZA 1DBBH 3IJSB 4N9GA 4NC1E 2R15A 1O9ZA 1VCBC 3QORD 4QHLB 4B5EA 2QKIB 1RURL 2VO8A 2XTSA 3HIZA 3OSVA 3BH8B 3GMRB 5LWYL 1RP9A 1X7QA 2MMXA 1PW3A 3MAWA 5HGHB 2IDCA 4HSAC 3VXMB 2WBKA 3NY9A 1PFOA 1ZKAA 3BAWA 2EUWA 3EOBA 4JEGB 4G6MH 3EO0B 3I74A 1XTLA 4WFFE 3ULAB 3WKML 3A4DA 1UT1A 1NCOA 1D5IL 3RHWK 3T0EE 2ZYSA 5D1QE 1XX9C 5C07A 1WV7T 5GGVH 3HC0A 4GRWH 4XP5H 3KL0A 4MD5B 3T4AA 3QUHA 2A9CA 4Z7WB 3VI3E 2X4NA 2E27H 4M62L 4LASH 4LOUC 1YYML 3MV7E 1CBVL 1UH3A 3ZDYE 3DJ9A 3QXDB 2VZUA 5E6ZA 4FNPA 4AG4H 3QJFB 3EGXA 1W15A 3MRCA 4IS6B 4LCWA 5FHAH 3BRGC 4JFYA 3B6SA 1QRND 2PP9A 3DYMA 1OEZW 3IMVA 1MG2C 5KJRH 4K5PA 5B1CA 2I32A 2ESVA 3B2VH 2B20A 2X6VA 1U93A 1OPGH 2BHUA 3NSFA 1PZ2A 4ZUUB 4YSRA 1P0SE 4LBEA 4JVUA 3DVNB 1GGUA 1FFNA 3PY9A 4HISA 3QJHA 3GBML 4Y2DD 5TDPB 3KWXA 3MV01 4UNUA 1DN0B 3HZYB 3ZTCC 4WF7A 4R5VA 2YQGA 1IV8A 2EH7H 4YSTA 3F7YB 2Y22A 2NLJA 3MYJB 4H2AA 3O8XC 4PMFA 1ECYA 4UBDC 4LVEA 1XAKA 4FQ1L 4BGLA 3OXRB 2YD9A 2FJSA 3SEPA 5D2NE 1L9HA 3OAUL 5AW4B 3NTCL 2A9NH 2YD4A 1UT2A 1DSWA 2CG9X 3RI5K 2OK0L 3D3VD 3PWNB 4YHLH 5B6VA 3UAJD 2Q7YB 3TZVD 5TFSL 1JRHH 3WS3B 3WAJA 2G5BB 3C60C 4F7TA 4DW2L 3IJEB 2HXAA 3O9WB 1ZHNB 3CFEA 2Q7AA 4IMLA 4QR7A 4X6CE 5BRQA 4KV5F 3QBGA 2VDNH 3F2LA 5FW8A 4OLWH 4QRTA 4NLAA 4R2GB 2EDXA 1L9TA 3LKSA 4N24A 4D8PA 1OK0A 4JRXE 4TRPH 3NCEB 1VEOA 5FJGA 2OKMA 4KQ4H 4H5SB 3T3MF 4AUYA 5LVEA 5HYFA 3W3BA 3FC8A 3I6GB 4L3EA 4YFLI 4H0LC 3SOBH 5T1MB 5I6KA 4YDVA 1KMGA 1E43A 1K4DA 4UQAA 4BEIA 3K4DA 2VDQL 5DHMC 4P05A 3EYQC 3P3UA 4JFWA 4MQXC 5EC1B 1S7TB 2F8XC 1ZHLB 2ED7A 3O6FC 4NUGL 4HJ0D 1NMAL 3T4AC 2MHAB 4UCFA 5GRUL 3L4TA 3RPBA 2FEJA 3OWRA 3PWPE 3TVMB 1WBXA 1CF8H 1SBBA 4BUOA 1EAJA 4AGMA 4O02L 1AGEA 4LPTA 3KPSE 4C56A 4YC2B 1IGMH 5JHDE 1F1GA 3WFEL 1NCIA 4XCYB 1EVUA 5ICXA 3GLDA 4OLXH 4FJ6A 1G9NH 4Z7UA 2NXYC 5AWNL 4OIIL 2C9PA 4QRUB 4BSJA 2PCFB 4MCMA 2BS9A 3UG9A 1N6QL 1QSEB 1T2XA 3BI9X 4IOFC 4WHTA 5DHXB 2MSPA 4Z77B 2GSIA 4TLTA 1SVCP 4HIIB 1UWEL 2LAGB 2OZ4L 1X9UA 5EDSA 1TO5A 4J3VA 2PWEA 3L7FA 3ZXAC 5D55A 2HVBA 5GS2D 1HNGA 3IM1A 1AXSA 5CEYB 1MQ8A 3LZFH 1QW9A 2CCWA 4OCLC 1F18A 3WIHH 2H6PA 5GRWA 1XGYH 3AABA 1KBPA 3UTSE 4ZTEA 1IC1A 2F19H 2ZKXA 4NQTA 4UILH 3ZHKA 2Y36H 1AS7A 3V5HA 3RY5A 3CZNA 1UD6A 3REWB 5AHZA 1C12B 5TQ0L 1ZV9A 4TUJB 1Z9NA 1X5FA 4NNXB 1F88A 3QPQD 3GMOA 4RGOL 4X7SL 3VI3B 3VSVA 3DUSB 3IPEA 3OQRA 5HYEA 4GINA 5E9AA 4PCTA 4JFDD 1CGXA 5DZ9A 5I73C 2XV0A 1JCVA 4GFTB 8FABB 4HWBA 4WNSA 5F0MB 4LXFA 2BFGA 4P99A 3W0WA 4HJEA 1YEFL 4BCYA 4E41A 2GBVA 3Q8CA 4HUCA 3HI5H 3FSAA 4Z6AT 3P4LA 4MAYB 5DUPL 4X42A 1G7PA 1G9EA 4S1RH 4ATTA 3HN8A 2Q2LA 1KJMB 4IJ3C 4HXAL 3MJ8A 1KBGL 4ZXBA 5JOFB 1T0NB 3QI9B 4KUZL 1G43A 2EVIA 3DOHA 3JV4B 1BZQK 1CICD 1OO2A 2IPKB 4NSKB 1BOGA 4XHJC 4RMVA 3CBKB 3BUPA 2XG5B 4YHOH 5DJ8A 2CHNA 4W9LC 4HEME 2WNGA 5FK9A 3BH9B 1OB1B 1WBYB 2UZXA 4BWTA 2X1WL 2YWYA 3G5VA 5TK2A 1CTMA 4AOFA 2GJJA 3PHAA 2Y25A 4DEPB 3T6XA 2OXGB 1JHKH 4FKHA 5EO9B 2CHXA 5GHWH 1U58A 1KT2A 1I9IH 3OKEB 4FNLH 4ZDHA 2YC1B 1S7WB 2F6AA 4QMEA 2KLSA 2G60H 3CHSA 4HFUL 5FFLA 1L3NA 4XCFL 1T5XA 2BZCA 5KKHA 4G43B 2X89A 5A2KH 5C0BE 1KGWA 4UT7L 5EPMA 3W9EA 2BPBA 3ARVA 4DQOH 1M7IA 3BFOA 3D87B 3S4SB 3VXMD 4XP4L 3QAQA 3THML 1M71A 4UIMA 1YQ2A 2DKMA 3OZ9L 3VG9C 3QEUB 4YHNA 4XXCA 5I1JL 1S7RB 1OE2A 1N5AB 3MMEA 4HIHA 4UNIA 3PDDA 4UOJA 3ROOB 2R59A 5I8CB 3IT8D 3PJNA 4PJHA 5DHVB 3ZRFC 4F57H 5D6DA 3CC5A 3PNWA 4KAQL 5EWIH 1JK8B 3PWPB 4HEPG 1J10A 3IPBA 2OPCA 2ZCZA 4MNGE 3DGGA 1XL6A 4A6YA 5J89A 1NPNA 5FWRA 4WI2A 2AK1H 2P46B 4XNMA 4Z7UF 3U6XS 1UOKA 1ZGLP 5DUBB 4QLRA 2WLMA 1K5NB 4OBRA 1FL5B 2XU9A 3GSRA 4FLOA 4I7ZC 4AK1A 3IDMB 3TPUA 3KW7A 2XNAB 4JHWL 3VQLA 4K71B 2CGRH 5E9DA 3H7BB 4ZSOA 3EGSB 3F7PC 4PJGE 5AAWA 4ZXBC 2Y6SC 1VHPA 3QULA 2Y2TA 5FKPB 2GY7B 2YMXL 3H9HA 1BBJB 2MPAL 4AGNA 1JN6B 2ENSA 3H3PH 4JVWA 2QHRH 2PTVA 4ENED 3VFVA 4OUUB 1XIWB 2OV0A 2JFCA 3BZEA 2IJ0C 1ORSB 1KDJA 2CKBA 3TO2A 4QNPE 3FO1B 3NCWA 4CSZA 2OR8A 4ODXB 2NY2B 3CCHB 3CSYB 2PETA 5E8EA 2CHZA 1T0MB 3STBA 3FO2A 1GYVA 5CP7B 4M7ZB 1R9FA 2VXSL 2N1TE 5IVZB 1KC5L 1KB5A 2F58H 2V8LA 4IQHA 4U6HA 1JSYA 4OF8A 1HINH 2WNKA 3SJVD 4AMKH 3F05A 4ZW8A 1HI6A 1Q9KB 3VD1A 1PQZA 1IM3B 1U3YA 2NY3C 1ONQB 4LO9A 2NXZD 3AYMA 2BVTA 1EHLL 3KGTA 2X3AA 4J23A 1MW2A 3V7MA 1DO5A 4XXCC 5J6SA 1A7OL 4HU2A 1VJSA 2LR4A 3JWDL 3RVTD 1NAMB 2GFBA 5TGBB 4HG4K 2QPUA 1MJUH 3KLHC 1UATA 4LSTL 5D6DC 5DA4A 4B6ZA 2KYIA 2RFXA 3UYPB 3KPQB 3M45A 1AOZA 3RGVB 1P8HA 4QOKA 1NC2A 3HE6A 1YN7B 3TVMD 2R39A 1Q9WA 3TO4A 3FUJA 1PS3A 3NGBB 4N1EA 2J21A 1PEWA 1V3LA 2R4SA 1DBAH 2IAND 4GQZA 1FN4B 4P5TD 1H3GA 2FNWA 1P84J 3ZTNH 4YHYC 4WEBL 1Q5JA 1A6ZA 2WQRA 3SPIA 2AV7A 3O3BB 1JF1B 4HF5L 4NN7C 2D7QA 2B1AH 4HWNA 4QJ3B 1MCIA 1FH2A 1QSED 1PIGA 3GLEA 3D0LA 4HKBB 4MA1B 3TJHD 2BSRB 3MRQA 3WO4B 4OD1H 1U42A 1BBDH 5AAWC 4ZMPA 3K1KC 4UYQA 3E2HB 2FH6A 1QO3A 4FQIH 4A04A 4M5SA 2OCCB 3MNVA 4TPRL 2QSQA 3TBTA 1C08A 5EZOL 4RWYL 2NDGA 2OMUB 5F9AC 4QRPE 4UQCA 2A38A 5CSGA 2GTWB 1BFOA 1BEYH 2MRYA 5L6YL 5DC4B 2BCKB 2I5YL 4PJHF 4ATWA 1TTFA 2YQBA 2XWEA 5GGQL 3H42H 4TQEL 3MRKB 5JUEH 2YQ3A 1EVTC 1DQVA 4PREB 1V55B 5D1QD 3V5DA 1EZSA 3ABGA 2MQGA 1LHZA 4QXUH 2EXWC 3S96A 2HX9A 3FOLB 3HG0A 3D2UB 3LB6C 1KBVA 1EUTA 1UA6L 4XGZB 5D72L 3V6FA 4AMWA 1INDL 2OJZH 1QLEB 3MV7D 4ALAL 1BIIA 4PLKC 2CR6A 5H2BA 3KBFA 4KUCF 4WJ5B 4N85A 1HWWA 2VKWA 3CBJB 4LGSB 3WFBL 1R3LB 4K2UH 4WU7B 4IBWA 5TTRA 1NUNB 2BSTA 4U7MA 5AW2B 4N2EA 1X4ZA 3HLAA 3HMWH 2DYPA 2A6JA 1AHWA 2TSBA 3IU4H 3MZTA 4WFHD 4ETYA 5BUPA 2YPVL 4LHUG 3UZQB 2JI1A 1NGQH 4QEGA 4XNBA 3QI9D 2PO6C 4QXTA 2JH2A 5AW3B 4DZ8B 3HE6C 5G28A 2I25N 2COVD 5DQDL 1IBZA 4PBWD 5TF1L 3T3MB 1FL3A 4FJYA 5HHPA 2CCLA 4Y7OC 3TO4C 4HD9A 3LNHA 5CJQH 3DETD 5G36A 4GW5B 2B15A 5FGBA 3BFWA 3DXAA 3NSJA 5TQ2L 4OY9A 2BP8A 4WU5B 4M5YL 3BP7B 4F8OA 4XN7A 5IOKA 1RLBA 4AK2A 4JFEE 4U49A 1PVHA 2RIKA 5E1AA 1YJDL 1CXHA 3SSGA 4OCYL 1WT5A 3KPPB 3V7AE 1DUYA 4U33A 5CGBA 4R5XA 5PCYA 5EZIH 3SE3C 3PFUA 4R97C 1PY0A 4F7EA 4GUOA 2MOVA 3TNMA 3L1OL 5KW9H 2F54E 4N9GB 3HKZA 4PJFF 4JRXD 4MJ4A 4LEOA 4FG6C 3ZY7A 1M3JA 4HK3N 5DMIL 1MHHA 1SM3L 1PY6A 1GAFL 2WKLA 4PWEA 4IKLA 1X7QB 1QASA 1RFDH 1M7DA 2AQ1A 4AC2A 1TQBB 1KB9J 4A2DA 1G7JA 3EOBB 2DPKA 2ITEA 1YEJL 3VX0A 5DVLA 5CILL 3U79A 4Y9BA 2H1LM 1MY7A 4LP4A 2NZ1A 2ADFH 1EO8H 3PWPD 4HVBA 4GQQA 1QBML 5B4MC 3O4LA 4Q4EA 3AS2A 5GGTL 3CVHH 2IQ9H 5JHDD 3N9GH 5C07B 1UM4L 5D70L 3HC0B 4RDQG 3ZUNC 4OGQC 3T4AB 1NFDA 4MXVF 4LSPL 1THAA 2X4NB 5FO7A 3GUFA 1A22B 1HIMH 2NMSA 4RGNC 2Q7NA 2AJ3B 3GFUA 3CC1A 3F00A 5EUOA 3EGXB 4LCWB 3MRCB 3ILQD 3B6SB 2NXYB 1JGLH 3PV7A 4DN4L 3WV0A 1NSNH 2HWZL 1G0DA 4OT1H 2ESVB 5DYOA 3D8MA 1U93B 2X0VA 4FHKA 4LBEB 2VXQL 3WNLA 1XIWD 3FU9A 4CBPA 1FFNB 2D3NA 3QJHB 5FGBC 1ID2A 4XX5A 2A73A 3UTSD 3GGWA 2H0EA 4CDGC 4KPHL 3WNNA 2NY2D 3L54A 4X1HA 3L1EA 2NLJB 5K59F 2R9HC 1BRRA 1N8ZA 4X5QA 5DTFA 4M61B 1DQIA 2A9BA 4XN5A 1TZAA 4I9WE 3LVEA 1PZ3A 1ZVNA 3ULVH 4JMNA 3OJMB 2Y7MA 5AW1B 1EA9C 4JPIA 1SNRA 4H8VA 2XTLA 4RFEA 3KPTA 1DLHA 1G6RH 5DLLA 5B21A 3JWOL 5DRZA 1IM3D 4JKPH 3NCBB 2VAJA 4F7TB 2FQEA 4IMLB 4PS7A 2ADGA 3CFEB 1PLBA 3UABA 5HSFA 1XV8A 1ILUA 4YDNA 4PMEA 2NYKA 1KFGA 2W9LA 1O9VA 4IB4A 3MYZA 4UM8A 4WEUD 4XNYL 4QRTB 1LDPH 2VTFA 3ME0A 1MCPH 3LKSB 2J6EA 4D8PB 5IESL 1CURA 3SDYL 3ZSSA 1EEQA 4G70B 3ZT7A 4OJYA 6FABH 1NLBL 1NDMA 2V7HA 4H0HB 5D8JL 5AYUL 1TQWA 2QSVA 5KS9A 3ULUE 4HWZA 2E9JA 2G3NA 4RFOL 3MVSA 2VN6A 3F7VA 3QS3A 3KPRE 4YDVB 2ZWLT 4IJ3B 1K4DB 4QIRA 4ZMXA 4ZW3A 5IKCA 2F5AL 2H47C 3G08A 2OP4L 1UEMA 2DWXA 2OTUA 4JFPA 3T8VA 5C97A 3KXFA 5AG8A 3QWRA 2IH3A 1QTSA 3S3JA 1WBXB 5CZXC 3ZKSD 1N4XL 1AGEB 1CU4L 2JSFA 4OFQA 4C56B 5MEOA 3GI8L 4GSXA 1PG7W 2NY7H 3MACH 5JQHC 3VAEA 1Z9OA 1P6FA 2G3XA 3SGEH 1MRDL 1NOFA 2XWXA 4U6VL 1YNKH 1ORQA 5C0BD 1CDJA 2FBJH 3POCA 4WHTB 4A7VA 5GRJL 3ZMRA 5KVGL 3HNVL 4MA3A 1ED3A 5IFJA 2GSIB 3FHEA 2VISA 3MJ9L 2FIRT 2AXGB 2DLFL 4R7DA 4WTQA 1JYWA 4AZ8A 1NCGA 3B9EA 3L7FB 5IQ7L 4MXQD 3QO0A 3SE6A 2H45A 2EE2A 1AXSB 1ML0A 3FSOA 2H6PB 2YPKA 1UZ6E 1IU1A 5CS7A 5BJTA 3CAFA 2W81C 1A64A 5DO2D 2TRYA 4CAGA 1OM3H 3V5HB 2H2PC 3CSGA 3WKPA 2KQNA 3LKQA 2VNCA 4OFVA 5HJDA 1BECA 3I6LE 1NFDF 2Y06H 3FFCA 2A6KA 5CEZH 3GMOB 1MCOH 4OAWA 4D9LL 4B5ZA 1GXEA 4WWPA 1E40A 5EUOF 5DEJA 2GAZA 2NX5E 2R29L 5I15L 4TS6A 3P0YL 4OJFH 4P49A 4ZMQA 4IBZA 2AK4A 1M0LA 3W0WB 4UWQB 4HAGA 4E41B 3BSHA 3D4YA 2X0UA 3TEXA 1BJMA 4Y1SA 1WIPA 4UB0H 1G7PB 2BY1A 2VSDA 5HGBB 4BINA 3MJ8B 3FT0A 1JNLH 4UTCA 2AJSL 4ZXBB 4XPTL 2FWOA 5C6TH 1MHPH 2M83A 2XIBA 2E7CA 2VC2B 4ZBJA 5IQ9A 1MCHA 4K8RL 1BOGB 1BD2E 3EADA 1CZ8H 1I8IA 2F5BL 1BGXH 3G7TA 1AY1L 2ZWYA 4JM2A 5DJ8B 5FK9B 4MNQA 5GGSA 4GG6F 3G5VB 2X38A 4PP1D 4Q14A 5AYQA 1KBWA 5B6ZA 4N2DA 4BSVA 1KV3A 4M00A 3WFZA 1QKPA 1U58B 1KT2B 4M7KH 1KTLA 4WK4B 4DK6A 4XTLA 3BMWA 4W4OA 4ZDHB 4DP1X 2VJXA 2E47A 5AKVA 4X7TA 1WAAA 1E9QA 1T5XB 4JQIH 3NCJL 5EPMB 2CA3A 3W9EB 1M7IB 2NY3B 3MU3A 1GZPA 5TDNA 5G55A 4UIMB 3CSPA 1RERA 2BNUA 4MQ7B 4YDZA 4YHNB 2X3BA 3WELA 3IFLL 4HIHB 1AP2B 4P5MA 5DD3H 1RI8A 1QFWM 4MVBC 4PJHB 1TYRA 3T0BA 3CC5B 1XB3A 3PNWB 4PB0L 3UBFA 2F8VA 3BAJA 2XZZA 3W57A 4YAQA 3F7LA 3QUZA 2LFGA 5GXBB 5I71C 4W81A 2IMNA 1OM9A 2XZQH 5KOVC 3DGGB 1U95A 4A6YB 1Y18A 4NKDA 4XNMB 5AKSA 5FUOH 1R5VA 1RLWA 1N64L 2JKSA 4TLSA 4YHYB 4LCWD 1V05A 2VUOA 5EU6E 2XWRA 4NN7B 3ZL1A 3GSRB 3NJMA 3TPUB 4KNSA 1KCRH 2NW3A 1G1CA 2ED6A 1DJXA 5E9DB 2NCMA 4ZSOB 1LO4H 3MBEA 4HDIA 2K4WA 3QULB 1JFQH 3H9HB 4EOWL 2RMNA 1WWCA 5DVMA 3TXAA 2GABA 3UYOD 4D0BA 3WSQL 3U6XA 3VFVB 2ZNXA 2ZPKH 1W72L 3CFCL 2E7DA 5CXPA 3UBXG 3BZEB 1X5KA 1YA5A 3BZFA 2OMNA 1REIA 1DBMH 4JM2C 4JKKA 1MCEA 2CKBB 4WI9A 3TO2B 2ZZLA 3V4UH 4QLWA 1QKZH 2WCGA 4OM0L 4XH2A 5E8EB 5E6RB 4AKQA 3RA7H 5HYIA 2GPZA 4YHMH 3FO2B 2YMOA 1NGXA 4WSKA 2FUQA 4BELD 3FB7A 3K8MA 1OQOA 4GXUN 4JGNA 1PD0A 3PHOA 4FG0A 3N91A 1F2QA 1L9QA 4DSYA 1KB5B 4U6HB 1VGEL 3VDAA 4Y4KC 3QFJA 2D0GA 1QW8A 5H37G 3CD4A 1MXDA 1WEJL 3FMGL 4CU8A 1SXNA 1HI6B 2JQMA 1PQZB 5T5FL 4KMQA 2QFPA 4N1CA 3P2TA 2J1ZA 4P4KD 5EOCH 2Y2WA 2J1WA 5HHOE 1TIUA 1HHJA 3ABLB 3SD5A 3EJZC 4WWKA 1CGTA 4JN2A 1I85C 2CZNA 2DWSA 4LQFH 2GFBB 1C1EH 4M1CC 3FZUD 1J18A 1J1PH 4PG2A 2RFXB 4G6KL 4GMTH 2P80A 5ADPH 3NIFE 3I9AA 3ABKB 2MPVA 4HYXA 5IVXE 2GVYA 4QOKB 1NC2B 2A83A 2CXGA 2RJMA 1VGKA 3HE6B 3QUZC 4JM2F 4XXDA 4Y0GA 1PF3A 1Q9WB 3TO4B 4XVSL 3FUFA 1H5BA 1CLOL 2D4FA 3WEAA 3R18A 4PSPA 5DYFA 1FFTB 5DU7A 5K93A 4M6NH 3FTUA 1UCQA 1A6ZB 4QTFA 3QWNA 2AV7B 4NJ9L 3RKDC 5KTEL 4OZ4A 1RUQL 2BM3A 3TBWA 4PRAA 4OLYH 5JLZA 1KTRL 2F54D 4JPVH 1VFMA 5DC9B 5E24E 5JXEC 3D0LB 3FUMA 1WAAF 3MRQB 1A7QL 3K91A 3MBEC 4RGMB 3QE5A 1I7TB 3U4AA 1QO3B 1RZFL 4MA8L 4FQXA 1PZBA 3OPZL 3CBRA 4KO5A 1C08B 2DQMA 1HQRB 1ZWIA 4GH7B 3TBTB 3D9AL 4U1HA 2ZUTA 2VXUL 5FGCE 4ANVA 3HJ0A 4FZEL 4ZUVA 3NZUA 1BFOB 2WZPA 2XZCH 4BA8A 4X8CA 4EI5D 1GC1L 2AJVL 4DF9A 1URZA 3BD3A 4KXZH 1ETZA 3GMPA 5AL8A 4MDIA 5AOKA 4L9DA 1FGNH 5JOPE 3QR1A 4LE8A 2GJ6A 3V5DB 3D39A 3S96B 1PJ9A 2APSA 5I0XA 4H8PA 1A21A 4WCYL 4HLJA 4Z0BL 3V6FB 2CA4A 4RAUA 1MJ8L 4YEEA 1L0YA 4LHQB 4PQXA 2V33A 4KTDL 4JREB 4DK5A 1KG0A 1OP9A 2KZKA 3SQOH 2OMBA 2BSTB 3FQRA 4GKZA 4RGNB 1KEGL 5LN4A 3MLZL 3HLAB 1VPOH 1FORL 2HKFL 5I1GL 2DYPB 3IRZA 4HU8A 2A6JB 4YLBA 1AHWB 4JO3H 4ERSL 3AS3A 4PG2C 3S3SA 3TYGH 4ZTPL 5B8CA 1ZCRA 1T7ZA 5IHUH 4L0ZA 1JZGA 3U30C 1MFAH 1DP0A 3WFDL 1FBBA 4BDVA 1TYJA 4IARA 1UADC 5J13B 2IG2H 1FL3B 5HHPB 1DQKA 5DJ0B 3NABH 3VRIA 1NMBL 4NRXA 3DXAB 4I9WD 4NNPL 3GRBA 2BP8B 1E7VA 3FH7A 4JCWA 2X10A 1YAZA 5E1AB 5CD5D 4BGDA 1S5IL 2OTWB 4Y4HD 3D0VB 2B8OT 2JIXD 2HVKB 3QZWA 1LE5A 2GUOA 1VZGA 1AQMA 3VDBA 2V9RA 3L5IA 4FXKC 3B34A 2PXYC 2A4EA 4F7EB 2K4AA 3ZLQC 3DK2A 1IAKA 3AY4A 5DHEA 3IDYC 4PM1A 3T4YA 4X50A 2WXKA 4FQXC 5AZEL 5I16A 4DO4A 3MRJA 4JRWA 1RIUH 1YEWA 4M6OH 3Q44A 4LEOB 4XCCH 5MEQA 2FZ3A 5IROA 3HMXH 4Z7QE 5GGVY 3OHMB 1F11A 1QFUH 5JW4N 1MHHB 3ULUD 2APXA 4E9YA 1CL7L 1JZDC 2OMVA 1M7DB 3KPRD 3V9CA 3EH5B 1S7VA 3L9YA 4AKOA 1IBGL 1DVQA 1YNLH 3TONA 3QFGA 4N0UE 4XO3A 1NIDA 3B1TA 3PXOA 1FC1A 3FPYA 1PZUB 1MFBH 2FH8A 4MRBA 4E42A 3P11L 1A7RH 3SCMA 2I35A 3OZKA 1HKFA 3O4LB 2ZSWB 3WE6A 3KCPA 3RJDA 4XCNA 1W6WA 1OGAE 2BHFA 5DFVD 1LEIA 5HP5A 4RMWA 4FFZA 4U1NB 5GQBA 1NFDB 3D34A 2LU4A 3JWNE 1CTOA 4LU5L 2EXYC 5FO7B 1QABA 4D3CL 1KDIA 1XB6A 5A6IA 2F18A 2GIYA 4WK0B 1IM9A 3RGBA 1PJWA 4Y19A 5EUOB 5JHLH 2WLJA 2VDPL 5EU3A 5ID1A 5B8CC 2VDRL 4LARL 4HPOH 4KJWC 5DYOB 3BP5A 3CFTA 4JJOA 5EO0A 3GBMH 1AJ7L 2DJ4A 4QXGH 4UV7L 4AEIH 5FGCB 2E4FA 4G6AC 1JZHA 1HYSD 5DHYA 2Y9RT 3EHBB 5IF0A 3QIWA 5IJCC 2A73B 4IK6A 2HN7A 2MQ3A 3GGWB 4GEIA 1GGBH 5HDQL 4XB7A 4MJ2A 3WBDA 1JZ3A 3NQIA 5FO2A 2BK8A 4FNTA 2G9KA 4CMMA 2YLKA 4PJXA 2DL2A 2PF6A 3I6LD 1N8ZB 5DTFB 4OCMC 4RETB 3ESPA 2V4LA 1MEXL 4WI8A 3Q1SH 5DA0B 2I85A 1X7TA 4AC4A 4JPIB 3AY4C 4AENA 4I13B 2NX5D 5I76A 4RFEB 1BDYA 1A6WL 1DLHB 2D3LA 5MEPA 5DRZB 5HI5D 1FNGA 4NO2A 5A43C 4IRZL 3EJYC 2ADGB 4ZPTB 4IKNA 5IROC 1J5OL 5T1KA 3IMUA 1FDLH 4G3YH 2QQKL 2R8SH 2BC4A 4UM8B 3BAKA 1DVSA 2BNQE 4E0RA 2HRPH 3ME0B 3WU1A 1J9RA 3VFRA 2V6HA 1C7TA 1WFOA 2WK2A 2ATAA 4Z78A 3GHBH 4KKAD 2BJML 2VAAA 3LPWA 2B2XL 1JL8A 2DQEL 4EDWH 1JMXA 1N0XL 4K5LA 5GZOA 1NDMB 2V7HB 4WUKL 3RE0A 4FQLH 1F50A 5I30H 5T1LA 3TU6A 3FJTA 3EG9A 3GXPA 4GQPH 4HWZB 3UTYA 5KS9B 3F7VB 1BD2D 1U36A 4IRJA 3WHXA 5GS0D 5I23A 1XXFC 1FH5H 4U1LA 3NEOA 3TJEL 1T1ZB 4TQPA 1VADA 2K78A 5IKCB 3WKYA 3V52L 1YY8A 3OJ2C 1E4WH 4JFPB 2ZX7A 1BZ7A 3KXFB 3GJFH 3EOYG 2IH3B 1S9KC 1WGVA 5KYNA 1J5HA 3RNQA 5KYWA 5MEOB 4WWNA 4CMHC 1ZRUA 3CVDA 5AWNH 3TURA 1S52A 2HX8A 3HC3H 2KSBA 3S3PA 4LFHD 3KJ4C 4W9JC 4LSRL 3SQRA 5HHXH 1KGJA 4JCMA 4PH8A 5I6PA 4A1RA 1ORQB 3ARUA 3T3PE 4XBEH 2ZWKA 4NCDA 2E8YA 4MA3B 1ED3B 4BFKA 3W37A 5IFJB 4ZK8A 1CC3A 1ACZA 4JB9L 5CUSL 1QNZH 3QIWC 3FONA 2ZZUT 2VISB 5KANI 5F7NC 1A3RL 4R7DB 5E2UH 3ETBF 3ATAA 4AZ8B 1ES0A 2EO9A 3QH3A 2KI6A 2EO1A 3QO0B 1F56A 1G94A 2PR4H 3ZZ1A 3WIHA 2VLMD 4UINL 2JKWA 2YPKB 3NJLA 1KN2H 4G72B 1QBBA 1YDPA 1NGYA 3C6SA 1YUKB 4FMVA 3WXWL 2EYRA 2J2ZA 3NPSB 4DHLA 5HYSA 5DCCA 3LKQB 4GRWF 3US1A 2QMJA 3CVIH 1NUFA 3FFCB 5FOJA 3UJTL 3WIFA 2QVIA 1BP3B 1P1VA 2A6KB 1AE6L 2FE0A 3NRPA 3QUMH 1DFXA 1WA1X 1BF8A 4OAWB 3ZIMA 1NM4A 1T7XA 3KLLA 5EU6D 3ZTJG 5I71B 2NTFA 2YK1H 4KHXH 1A4CA 3INOA 4N5EC 1RZPA 4Q56A 4XC3L 2GAZB 3IYLW 5FYKE 5F96H 4ZFFB 3GMQA 5BOPA 2L7JA 2D7OA 2AK4B 1ET7A 2DLHA 4KKCC 4PW3A 3TT1H 1JPTH 2X09A 5DUPH 2LU3A 4XNZC 3V0JA 3EYOA 3VYPA 2P5WA 1B4RA 5M95B 3MLSH 3BIKA 1T03L 1AO7A 1NL0H 4F2EA 2NYZA 4GRMA 3GSNL 2FWOB 5F1NA 2QTEA 1OF0A 4N1HB 4M03A 4PJXF 3OGCA 5I1IL 2LNLA 3K4ZA 5IQ9B 3OB0H 4ODHH 3MUZ1 5AOLA 5FYJL 1KUMA 3WN5A 5D7HA 3CDCA 1I8IB 1PYWA 1NCCH 2NTWA 4Y1TA 3TASA 1F4WL 1E5CA 3EH3B 1IT9L 4DTGH 4PYGA 1EQWA 4MNQB 5GGSB 1XF2A 4RISL 4PIBA 1R34A 4JM0A 4Y4FD 3GXUB 3KAAA 3S4SG 2Q8BL 1L7TL 3CN1A 4UTAH 1G9NC 1SQ2N 3BJLA 3L3IA 4BSVB 2VWEE 2WVUA 2YBRA 3AQXA 4OLVH 5B34A 1KTLB 2VDOL 3PDGA 1NBVL 5DS2A 2HKAA 3IB4A 2XN9E 3DHJA 4PS3A 2HT4C 4O51A 4BEZA 5F1OB 4GEJA 5HHOD 1NICA 4JO2L 4L1BA 1PD6A 4X7TB 4UOW0 4ODVH 2KKQA 2NY5L 1E9QB 2JJVA 1H15B 1HHIA 1J0IA 3NN8A 4A38A 5EA0H 4HOWA 3OG4B 2VXVL 3MA9L 4AYSA 1CLVA 1GRWA 5LGJA 1GZPB 3UZEA 2WWOA 2X3CA 2CUMA 1DQMH 5FS5A 1Z9LA 2BNUB 2YGNA 4LLDA 3VQ1C 5AENA 1KLFA 3RIFK 1OT1A 4XN4A 4MJIE 1RPKA 1A6UL 2ZOTA 1EUUA 2XQYA 4P5MB 4GKSA 2EDOA 2GBTA 5SWSA 2AV1A 5I1CL 3MODH 1SEQL 4DKEH 1R46A 3OR7A 5MI0C 1H3PL 4YAQB 3ZRCC 3QUZB 3UG5A 4L8SC 5DMGC 3QGVA 4CC1A 2Y3NA 4FLSA 3MGAA 1U95B 1Y18B 4NKDB 3H8NA 2ODIA 1ZLSH 1R5VB 4WTZG 5JXAH 3OLGA 3UJIL 1F97A 4Y5VA 5AG9A 5C0CE 4JHWH 5KZCB 1OSYA 5DR5L 3RX7A 2X9YA 1S6NA 1DJYA 3SE8L 4BZYA 5AL0A 2NW3B 3Q8BA 2CDGA 4XOCA 5KBNC 3H7LA 3D50A 5BMFL 3A6CL 3MBEB 4GRVA 2WWMD 3MREA 3EHBD 2HJKB 2P1YA 5J12B 5LUMA 5IW6A 1FIEA 4U1IA 4ETQA 4D0BB 3WN5C 5FYJU 5I1HL 3U7YL 3BZFB 3CFIC 5I8EA 4I3RL 4JKVA 4HJUA 3PUUA 2VXSH 4XH2B 5C0JA 5JIQA 4KZDL 2PW2A 3U2JA 1NGXB 1J9SA 2GSGA 1EDHA 1FRGH 3PAVA 3PHOB 4MA7H 3TWYA 4MCYA 4P3DA 1RQ5A 5C0NC 1UB6A 3QFJB 4PGDA 1EJOL 2NYYC 1X9QA 2AEQH 3H0TA 7PCYA 4YH6A 3UO1L 5CGYC 3CQFA 2IQAA 3OLEA 1RU9H 2KUTA 3Q9PA 6CGTA 1YMHA 2DW5A 5I8KL 1ADWA 3U4KA 1HHJB 5JW4R 1TLKA 4WWKB 1AQHA 4GAJH 4JN2B 2R69A 4PRPE 2PUQT 4MGXA 2EZ0C 4P3CH 1CLZL 1MRFH 3TM6A 2HTLD 3RZCA 2EIEA 1B4JL 4AIOA 1N8OE 3N55A 3S2AA 2JVUA 4NBYB 4FCHA 2NOYA 1HHHA 3V8CA 1N7ML 4PB9H 5HYJA 2Y5EA 1DUZA 4KBPA 4TUKL 4XNQA 1TO4A 4U1KA 5F7EH 3U30B 3MV8A 1VGKB 4XXDB 5B3SB 3SKJL 1QBLH 1OLLA 3Q9QA 2YUWA 2E9BA 2DY2A 4X4YA 4M5ZH 3VFUA 5KYYA 3VA6A 2Q6WB 1H5BB 2WSDA 2BO0A 5IM7A 5BO1L 2I9TA 2VDMB 4Y5VC 2MCAA 1NMCB 4YBHA 2J25A 4QI3A 4YHPA 2DQJH 4OZ4B 5D7IF 3SQBA 2QV2A 4PRAB 4YGVA 3TBWB 4A2MA 5JLZB 2DD8H 1IBFA 5ALCH 3HNTL 3HW7A 3OE9A 5E2VL 5HHMB 4P9HH 1MPAH 5K9KB 4Y1AA 2FHCA 4DGIL 3HPLA 1U8OA 3QHZH 2HKHL 4IU3A 4FQXB 1JTPA 3SE4A 1GPOH 1MNUH 4GO8A 4XI5C 4XMPL 2B3RA 4DOHB 1ZWIB 2CU9A 5GRVK 4U1HB 5CJOL 2IWEA 2EUXA 2D7NA 4NP4H 4ZUVB 3O45A 2IALA 3SBQA 4NENA 4G71B 1L6ZA 4YSUA 1Q9OA 2AEPH 3GMPB 4M7JL 4MDIB 5L4JA 3U7WH 1OGAD 4LNRA 1CDYA 2GJ6B 1NDTA 4HC1H 1VA9A 2EKJA 5DFTA 2DF3A 2PYEA 1TNNA 1CBJA 4AUUA 1BPVA 5EFIB 3CWGA 3U9PL 4DKDC 4Z7VE 1Q72H 4RAUB 2LHAA 1IO4C 3UBHA 5JQ6H 4WV1C 1FG9C 1KG0B 2AK4D 2ZCHL 2IOMA 3ARFA 3CH1A 4Q9BA 5J1SC 2CGYA 2D7PA 1XT5A 3S3CB 1E8WA 1FI8C 2VZTA 3ARDD 3B2XA 3FQRB 4GKZB 3CK0L 4L4TA 4JW3A 4XVJH 2XDHA 3FO9A 5LB1A 4FERA 2C9RA 4H1LH 2YAFA 4WUUA 3PGFH 3HG4A 4BUGA 5F7UA 2VMCA 4MB3A 1RZKL 1N67A 5B8CB 4FG2A 4DK3A 2Z1KA 1P4IL 2H0FA 3KDPB 4PS4L 4BDVB 3S34H 3GXMA 3MXVL 4L4VE 5TQ2H 4IBVA 4DUXA 3VRIB 3D48R 3TCLA 3O2VH 2PLTA 4NRXB 1IL1A 1LEGA 3E3QC 4LL9A 2XX1A 4MB4A 4WEMB 5CR1A 5CGMA 2FIKA 4KDWA 4OJEH 4OCYH 2FB4L 1PLGL 1E2WA 1PMYA 1Y1DA 1TZHA 2YSSA 4G7RB 2X2IA 3QZWB 1J8RA 1H3WM 4N2AA 3VFPB 1LE5B 1W80A 2GUOB 5CJ8A 5AVRB 2R0WH 1UWGH 1UVQA 1L5GA 2VDLB 2EVGA 4PWHA 2EABA 4C54A 1U19A 1IAKB 1R3IL 2BNQD 3T4YB 2FT7A 1L9MA 2FGWH 5CU9A 4GJTB 5I16B 4OGAC 3MRJB 4WWOA 4CKVX 5MEQB 3BGFC 2FZ3B 3VGDA 4EF3A 1F11B 3HCVB 3KM2A 1LGVA 3GMNB 4FKKA 2ZXDA 2OMVB 2VM9A 1YEJH 4XO4A 2YOCA 5I2IA 1T89A 3GRWL 1OP3K 3QUYA 1S7VB 1BX2A 1UXWA 2VCOA 3FRPG 2JB5H 4PJBE 1KIUA 3L9EA 5C0IA 4DP9X 4NO3A 2BMKA 1ETA1 4E42B 1EBAA 2XKUA 3SCMB 3WD5L 3WE6B 3GIZL 3CVHA 3KCPB 4FNQA 3SPJA 4HZLA 4XCNB 5KSBA 2OZNA 2G3MA 3NJXA 1IC4L 1MW1A 1LEIB 4MCNA 1P2CA 4GRWB 2AERT 3ARFC 4UDTA 2BRQA 5AOIA 3ZX1A 3BKYL 3ROLB 3GSXA 4CMHB 1MCBA 5AEAA 4L29A 4MJ5B 3EAKA 1BYOA 5GRYA 1ZGLA 1IM9B 2DQCL 2F2HA 2FX7H 3CFQA 4FQJL 2Z35A 4P46A 4TUOA 4Y19B 5CF3A 1GOHA 3KJ4B 4M6MH 1KV7A 5AZUA 5IB3A 5EU3B 1WF5A 5ID1B 5D9SA 1LMIA 1W0VA 1YEKH 3FQ4A 4YUEL 5C09A 4LPVA 3ZYJA 5KVFH 3RKPA 3S88H 3BP5B 5EO0B 3VHZA 3UFIA 4P2YA 1F45A 2BFVL 4ZW5A 1OB0A 3NACH 1F2XK 2IPTH 5DHYB 1BQLL 2R27A 3BLKA 5IF0B 3QIWB 4UTBL 2HN7B 1WFJA 3QZOA 2OSYA 4FF9A 4X5RA 1H3VA 3IFOA 3QJTB 5FYLD 4HAKA 4CMMB 4PJXB 4CL7A 1KIRA 1U8LA 2ZT9C 1IB5A 3AG1B 3BFQG 3BUIA 5IQNA 4A39A 4B53A 2BVUA 4MB1A 2ZXBA 3ETBJ 3U36A 2FAUA 1UH4A 3EZJB 1MXGA 2Z7ZA 4Q0XL 5A2AA 3U25A 4A7SA 4AENB 2O6EA 1I8LA 1YECH 3CMOH 3QDME 4NOBA 2O5XL 5E2WH 3PP3H 5FYKD 5I76B 1IRAY 1FNGB 1SEBA 5B6WA 1YEGL 3MA7A 2VDNB 5T1KB 3NSCA 5H35A 3DO4A 2BC4B 4X83A 5H37H 1V7ML 3RU8H 3E8UH 5BPPA 4E0RB 1Y6NR 1L9NA 4XNAA 5C2UB 3VFRB 1AHKA 2CLZA 4J2XA 1T89C 4Z78B 4FZ8L 3QUYC 3QYMA 2VW7A 3V7AG 3QXWA 2NCEA 3IS0X 1I53A 2QBWA 2R0KH 4RBPK 3FS9A 1LL1A 5FCUH 3K6SA 5T1LB 3EG9B 3AG2B 1EDYA 4PJIE 3GSOA 1HDMA 2QDWA 1CFQA 4IRJB 3E1F1 1XCXA 4WSJA 3WHXB 4AV5A 2DMGA 2OJEA 4U1LB 5IT2L 1GHFH 1VADB 3ELQA 1G9MH 4R6UA 4YZWA 4HOXA 1YY8B 4JKWA 1JPSH 2WCSA 4Q7DA 2P5EA 5IV2A 1BZ7B 5EO1A 1MCSA 2R0LL 4ZMTA 2EE9A 3CMGA 3QSKB 4TQ8A 3RNQB 2CJUL 3HG1E 5CM1A 2HH0L 5KYWB 3MCLH 2Y3AA 2D9QB 3EDEA 4JG9A 4X5PA 1OQXA 2XN9D 1QFHA 4J3OD 4P46C 3EDJA 5HHMD 1G1OA 4R5TA 1HSAA 5KVEH 2FJHA 1L7IH 2D8KA 4HKXA 1KEMH 1JZ5A 2PTUA 5GS2H 1BWWA 1JXGA 2VH5H 2AQRA 2OI9C 2Q3ZA 5LJYH 4U7SA 2JJSA 4KRPC 3FONB 4QCIA 3PP4H 5BZZA 5C08E 2WZPD 3H9SA 1RUPL 5LWEA 1SJEA 4IM8A 2XACC 4BE6A 4RSVA 5LNGA 1ES0B 4BV1A 3QH3B 1MWAH 3INUH 1YYLL 3K6IA 4QPEA 1V3JA 3KLDA 3PXLA 1JGIA 3FTVA 3T77A 2XI9A 3ULVC 1YDPB 1NGYB 3C6SB 1MFCL 5KSBF 4F15B 3NP3A 3JTSA 3D25A 3OMNB 2EYRB 1JZ6A 2J2ZB 5HYSB 3NJFA 5FUCE 1YY9C 5GIRA 4EJ4A 3WIFB 1NEUA 4EXPX 3HI1A 4M8RA 4GXVL 5C0CD 5C86A 5J57B 4QY8A 3X13A 3VXQA 4X32A 2NTFB 2Z6FA 3S3DB 3WGUB 3BGAA 3X3GH 3CV5A 3GMQB 3CX5J 4XNUH 3ZKND 4ZAKD 4YXHH 4CU6A 4OD3H 4MMYA 1SUHA 4F33A 3EYOB 3QUXA 5G54A 2P5WB 2X1OA 5AHYA 3RX9A 3WNMA 3NESA 2HT3C 3CFKA 4AQ1C 2HG5A 1NCDL 3BIKB 1H3UA 4AQ8A 4ZMLA 3PWHA 2JTYA 4ZX3A 2FNBA 2QQNH 1NIEA 4TTGA 1WBZA 4GRMB 4OFKA 5F1NB 2BP0A 4U6YA 3OGCB 5GGRY 5HYJE 5SWZE 4MLSA 4ONFL 1MJ7H 3BAYA 3BKML 2A1WH 1XL4A 3WN5B 4FQ2L 1PYWB 4DJMA 3V0AC 3ULVF 5HHVL 4XBPA 3TA4D 3MFFA 3O6MH 1XF2B 2F7RA 4XMLH 2EDNA 3L3IB 4G7VL 4QYOA 4O58H 2LLNA 2YBRB 3H4HA 4LAQH 1OARL 3NZ8A 5GRVL 3IN0A 5HGDA 3F3HA 4OD2A 4ZS7H 1AZBA 1GH7A 2FX8L 3DUHA 4FC3E 2BXZA 4GLRH 4O51B 3W81A 5C0RL 1TYEB 1RL1A 1NH6A 2JJSC 3OTTA 4P9ML 4POZD 1HHIB 3UZVA 1PX8A 3HG5A 4PRPD 3C2AL 1HZHH 4MDRA 5LGJB 1XMWA 4NWTH 4S1SL 3OJVC 4IDJH 2IAMD 4OQTL 3MC0A 4PJEE 1AC0A 4B9FA 4LLDB 3DRTA 4HX1A 4B9GA 1KLFB 4PJIB 3UMTA 1A4AA 1TJHH 2E6PA 3SCMD 4GKSB 4NHCH 3REVA 4FABH 5SWSB 2AV1B 1BAGA 3ZDXF 4BUHA 5E6IA 3HUJE 4LSVH 2PEDA 3OR7B 4JFXA 3EJPA 3B5HA 1SLVA 5LCVH 4HUMB 3FL7A 3HG1B 5DDHA 3AGVA 1QI5A 5GS1C 2Y7NA 1YQVH 1ZEAH 5D4QA 1FL6A 1IM9D 1PXSA 5HDLA 4G8FA 4OLUH 3FT4A 3Q8AA 1MVYA 3QBKA 1H2SA 3QUXC 1D9KC 2CALA 2BXYA 3MO1A 4RH4A 3ILDA 3WNIA 3MUUA 3CG8A 2CDGB 4B27A 2O5ZL 4JUTA 5KVMC 4ICWA 4AQ8C 4IKKA 1A7NL 5J11C 1SLWA 4JG0L 1BJ1H 3MREB 4HT1H 2EDFA 5C08B 4OLZH 5IW6B 1U8PB 5BOJA 4U1IB 3WEBA 2V2WA 4KLYA 3VI4E 1JF5A 2HZHA 4KNFA 3FU5A 2AJYL 2XXMB 4Y5XA 5DZLA 3RAJH 3QZNA 5GJSL 3RVXD 2HSIA 5E51A 4KK8D 5I8EB 5C7XL 1QYGH 3NA9L 4GSDL 2W0KA 3B7UX 5A45A 2QJDA 5C0JB 2ZXQA 3JSSA 1XEDA 2PW2B 1JPGA 2FATH 3K6OA 4TVPE 4UT6L 2GSGB 2I26N 2G2PA 4I2XA 2TRHA 5H94A 4LEBA 4P3DB 1WEJH 4NN5C 1UB6B 3IPFA 5DD5H 1KXQE 4PGDB 3BESR 5I1EH 5D1ZA 3AXHA 4N4YB 1WYJA 1A47A 1PSKH 3BD4A 3G9AB 3H0TB 5KUKA 3QJXA 1X6NA 2IQAB 1U3NA 1YMHB 2WWKO 4Q6IA 1ND0A 2RQEA 2P5PA 3B9KC 3QG7L 5DJCB 3NEEA 3EDDA 4H40A 1SUJA 4U1JA 3FAWA 4IRJD 3LH2L 5ADOL 3RZCB 1J5DA 4JN1L 5F9DC 2MOQA 2RALA 5E6IC 5KG9A 1HHHB 4LFHG 1KENL 4XVSH 3QIUA 5HYJB 2J73A 1DUZB 2ZCKH 4XNQB 4U1KB 2GK0A 3MV8B 4XC1L 2CO2A 3SDAD 2YZ1A 4XMKL 4N8CH 3UGXA 4X4YB 2F9BT 5KYYB 3VFUB 4OZIE 5IM7B 1L9SA 4XT3A 1FLRH 3L1FA 4LDLA 4OIBA 5CHNA 1KFAL 3PQYA 3RIAK 4C59B 5AWZA 5F7HA 3PNRB 2I9TB 3CDZA 4YBQD 2GJPA 4TSAL 1X6LA 2XHNA 3V0WL 1B3IA 5IFHL 1X5JA 4YHPB 3SQBB 3DUUA 4OCNC 3OKOB 4YGVB 3C09B 1WE5A 1CE1L 1U2CA 4LGPB 5HPMA 1ZK5A 1CGWA 4LSUH 4FLRA 3ILPA 4I8DA 4Y1AB 3T2LA 3U1SL 3VM7A 4Z76A 4JS7A 3HPLB 1CLCA 3NG5A 5DJZA 5KBPA 1CL7I 1U8OB 3EH1A 4IU3B 2CNYA 5CWSA 1OALA 2FO4A 4JPQA 4Y5XC 4DN3H 1BF5A 4JHAH 1GGCH 1P5UA 2A9ML 3BGFB 3OKLB 3VD9A 4PJEB 2QMKA 1ZJBA 4WKXA 4B9ZA 3O45B 1IAIL 2P43B 2IALB 3VXPA 4ZFGH 2B1HH 1G4RA 1H6FA 4NENB 4W93A 1N26A 1Q9OB 4NS0A 4M7LL 4L5FE 2FO8A 4WEEA 5FCSH 3TN0D 3HUJB 4LNRB 1FO0H 4PVBA 3DTDA 1MJ8H 2IC2A 1ZJAA 2MNUA 2PYEB 4M3JA 4KMLB 4MAUH 3AT9A 2YD1A 1LK3L 2HA1A 2XVGA 1H6UA 3HN3A 4WY7L 3R7QA 1RZGA 1NWPA 3ARFB 1V3MA 3ZTJH 3CH1B 2BIMA 1K4CA 1A5FL 2DJMA 2HKFH 4G6JL 4Q6IC 5J8OA 4BFFA 1BZDA 1MHCA 2JCCE 4L4TB 2FWUA 2DTSA 2LAAA 1JZFA 2N7BA 3FO9B 4WUUB 3VG0L 3QQ9D 1NBCA 1E8ZA 3OQ3B 7CGTA 5D1XA 5KBKA 4JG1H 4Y9HA 3VI4B 3FXIC 1Z5YD 2HPTA 4PP2A 4Z7IA 1NMBH 5I6NA 3I50H 4Z3IA 2WZ6A 3LNFA 2RR3A 1BW8A 3COCA 3EBAA 4ZG1A 1RUKH 1BCIA 1DLFH 1LEGB 2QADC 4PJFE 4MZIA 3CXDH 2FIKB 3G9VA 3MRGB 1MSPA 4WW1A 5D96C 2A0LD 1CXIA 4BQ6A 1TZHB 2YSSB 1A4BA 4JZJB 4XBMA 1FVCA 2DLIA 3QDMD 1DFBL 3AG4B 1R47A 4FMFA 1L5GB 1E2VA 1P84K 3OSKA 5CCHE 4KQ3L 4W9HC 3O3UN 1MVUA 3UERA 2HLFC 3F62A 1SHSA 4XNXL 1FYTE 5DHVH 1S8DA 1MRCH 3HMXA 1J1OL 1MCCA 1VIWA 2DBJA 3L95A 1RUMH 4YE0A 5F88A 1K5WA 1PG7H 3GBNH 1BM3L 2Z31A 4DGVH 5LQBL 5I2IB 3QUYB 2I60H 1BX2B 5JOEA 1UXWB 2PPFA 5DS8A 3DROA 1KIUB 4PJ9B 3VVVA 5C0IB 4NO3B 3FFOA 2BMKB 5ABAA 5T3ZH 1Z66A 4EVNA 5IEHA 1KJ3L 2ICEC 1UM5H 4HYJA 3HG1D 4H8WL 3AW5A 4M9OA 2ROXA 3CVHB 1IFHH 4HZLB 4HS8L 3A4AA 1KLGA 1P2CB 4HEPA 4UDTB 3C08L 2GJZA 4DP8X 1HVXA 4POUB 3S8GB 3NRQA 3T09A 3MLXL 4X6DA 3GSXB 4OB5L 1QI3A 4L29B 1ZGLB 2WXMA 3A47A 2EVFA 2IH9A 2NY1B 3WMQA 5JHLA 2WXRA 2CXKA 4P46B 2Z35B 3DARA 4TUOB 4V2CB 4AQEA 3FO0L 5KVDL 2OR9H 4UT9L 4UV7H 4I18A 5SX4I 5D9SB 3U2SA 5DZJA 5C08D 3P9LA 2X4RA 1W0VB 3EYUH 4RCAA 5C09B 4Z3JA 1FNHA 5C0EA 1YG9A 3QCTL 1JDCA 4HMEA 4GMSH 3VACA 1JUFA 1OAUH 2OI9B 3D09A 4BKLA 2EYSA 4P3WA 3VE0A 3I02A 5E0FA 4ZS6C 3IFOB 3DMMC 1AG0A 4OKVA 3LZLA 5IMMA 2MTAA 3AC0A 1NGPH 5JIKA 5GGUA 5HBBA 2J8UE 2NY0B 3SGJA 5DGRA 5AAMA 1U8LB 1MWOA 4P5RA 4O2CA 3RGHA 4I85A 2V7NA 3U36B 3NH7L 1TQCC 1AKPA 4R8WL 2P8MA 3WTTA 1NAMH 4KXZI 4BK4A 1LO0H 2Z93A 1VSCA 2I9LA 3I9GH 2JKRM 1F8TL 3MA7B 4N3TA 2VXTH 4PCYA 1DSFH 2XX0A 5H35B 1IC5L 2ZSVA 4OBSA 4DP4X 3H2PA 3D05A 4JKMA 1CUOA 5I19L 1QNIA 3K6FA 2CLZB 3L5WA 1YCSA 2Z8WC 4DKFH 3RZCD 2E46A 3B2UC 3ARYA 3GO1L 5K1JA 1OAKH 4YZFE 2DICA 3K6SB 5HYJD 5SWZD 2QGEA 4N90E 4BYHA 5EN0A 1NBYA 3GSOB 3N1PC 1HDMB 1CFQB 1NGZA 3K5SA 4ABWA 4GBRA 5AX0A 2OJEB 4NXKA 4AGOA 5CFAA 4NXSA 1KB9K 4YBLC 2XOTA 4FXGA 2P5EB 5DUML 3GJFA 5IV2B 4KI5C 4S2SA 3ZDXB 4Y2OA 2A5UA 1PKQE 3CNKA 5EO1B 1XD0A 3M86A 4LEEA 3N42F 2XG4B 1ADQL 4AQAA 3V6BR 3F6LA 3AXIA 1L9OA 2BRRL 1R17A 5D2LE 1JWUA 4CVZA 4KRMB 1H9DA 2FJHB 1OZTG 2BOLA 3V0FA 2VR8A 4HKXB 3FCGA 1FYTB 1OTUD 3LMJH 3V0VB 3F12A 3EGDA 5IQOA 1B0RA 1KTCA 1KZQA 2Q3XA 5KSAA 4JNXA 4ELKA 2FECI 3AMLA 3NFSL 5E23A 1KXTA 4QCIB 4QRRE 1NIAA 4GKOA 3H9SB 1SJEB 3JWNG 4OF5A 4OZFG 1MAML 5EN2A 4DAGH 1G0YR 1T83A 5FO8A 1QLEH 5BV7H 2XY1A 5IFAH 3LH9A 3MLRL 4Y16A 5AAMC 5DYSA 4KKLC 3T77B 4NQSA