2QPEB

An unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title An unexpected outcome of surface engineering an integral membrane protein: improved crystallization of cytochrome ba(3) from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 40
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2qpeB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2qpeB02
1NWPA 4A67A 1F4ZA 4BWWA 1FWXA 2IWFA 3REYA 2OJ1A 5TK4A 5TK2A 3NSFA 3WNJA 1CWQA 4GP8B 1AQ8A 1BEXA 2BZCA 2DYSB 2WSDA 3OMNB 3JT2A 2GIMA 4YSDA 2KSYA 1IW9A 1A3ZA 3DIVA 4N6HA 5G2DA 1RZQA 2XXFA 3CAPA 4XTOA 2BO0A 5G2CA 1IW6A 2VM3A 1OCZB 3CDZB 2HXAA 3NJMA 3T6VA 2HX7A 1TN0A 3IN0A 3UAEA 3AG2B 1OE3A 1MGYA 4E9QA 4KO5A 4XT3A 5F7BA 3T6ZA 1NPNA 4NC3A 4ENZA 2N0MA 2XV3A 3UONA 4K5YA 2OCCB 2HPYA 3C9LA 3HARA 1E12A 3NP4A 2FNWA 1GS8A 1BYOA 2JAGA 4QI1A 1OCOB 3NSCA 2YCXA 3S8GB 5F7AA 1GS7A 2BP0A 5AKRA 2XLLA 1Q5IA 1J9SA 3X1NA 2YQBA 4HAKA 2PPEA 2CALA 4Q8BA 2X72A 2Y01A 2FQDA 2PP9A 2XU9A 1W8EA 3T9WA 2LLNA 1JVOA 3VVKA 3NY9A 1AZRA 1BRDA 4KOBA 2YDVA 5D4IA 1GUEA 3AZUA 1ASPA 2VMJA 4AX3A 2GHZA 3HB3B 3WKPA 3ZX1A 1SFHA 1BQRA 2VT4A 3OE0A 4HWLA 1X0I1 2JAFA 3KJ6A 1JZGA 1B3IA 4GYCA 1SF5A 1DZEA 1X9RA 2I85A 2XUWA 3H56A 3VGAA 4YVNA 1JV7A 1VJMA 3QAPA 2FT8A 1JXFA 4JQ6A 1CYXA 4WTQA 3FQ2A 1QKPA 3ASNB 4BEYA 3X3BA 1IC0A 5B1BB 2YAMA 1H2SA 3OE9A 4YSOA 1AZUA 2WJLA 1XB3A 3HEIB 3V9EA 1AS8A 2Y04A 3X2QB 3FSVA 2DYRB 2F93A 5D4JA 4KOCA 1AS7A 5LDUA 3HANA 3G5WA 4XTLA 3UZAA 3X1FA 4X31A 1M56B 3FS9A 5B1KA 1O0AA 1AZBA 1PAZA 5PCYA 1BRXA 2J56A 2A3TA 1A8ZA 3PAZA 2J4YA 1SJMA 4EIYA 4QLWA 1S51A 3U25A 1AG0A 1KG8A 1J9TA 3ABMB 3OE6A 1OF0A 3PXLA 2YARA 3AG1B 4MD1A 2R7EA 4DP9X 2PP7A 1F88A 1PY6A 3C75A 3AG3B 5EHFA 3X1GA 3HASA 3IBOA 1A4CA 4XTNA 2FTAA 1A4BA 4BK5C 5AHYA 3FSZA 1HZXA 4UF7C 1V55B 1KDJA 5I6PA 1TEFA 4EF3A 3EH4B 3EH3B 1AACA 2FT6A 2ZWNA 4GY4A 1QHJA 5G54A 2PCFA 2PPFA 3CZUB 3ABGA 4K9JA 1AT9A 2KSBA 3N55A 4GP4B 1GR7A 2BRDA 3FT0A 3NSYA 1JZEA 1MG2C 3MBWB 1J9RA 5ANHA 3FU8A 1KGBA 5H2OA 5I6MA 1KV7A 3V9CA 4AZUA 2KS9A 1KBWA 1OV8A 3WNIA 4IB4A 2HX8A 1BRRA 3T45A 2YAQA 2B08A 4N4YB 2IDFA 4YSUA 3X1EA 5AWZA 3IN2A 1KGYE 4DKLA 1WS7A 3UZCA 3BVDB 1PCSA 1E5ZA 4A2DA 3AYNA 1SF3A 4GP5B 1SDDA 1ZV2A 3TBCA 3EH5B 2OV0A 4F2FA 1V10A 2FT7A 3PWHA 4BV0A 5AHZA 2E86A 2EIMB 2YCYA 2VN3A 3GDCA 4E9RA 1JZFA 4YSCA 1ILSA 2HRHA 1TU2A 3X3CA 1J9QA 2Z55A 5B35A 1OE1A 1VGOA 3QBGA 3QJRB 1IBZA 1QLEB 5ITCA 5E9NA 9PCYA 5JJEA 1TEGA 1W6WA 3QBKA 3FSAA 2MRYA 4AKQA 3ZBMA 1X0K1 3FQ1A 5IY5B 1DZ0A 4DP1X 2LNLA 5EN0A 1P8UA 5A44A 3FU9A 1NIAA 1E30A 2I7SA 2NTUA 2BP8B 4E9SA 4W9ZA 4G7QB 4E9TA 3TU6A 5B6YA 2VM4A 2XX1A 3AY2A 1M9WA 1A4AA 3VHZA 2ZZLA 1I53A 2XV2A 2BW4A 2ZIYA 4YSPA 3TASA 4DPCX 3FU7A 1JXDA 3S3DB 1OE2A 1JERA 4DP4X 1BXUA 1V54B 3H4FA 4Q89A 4A2FA 3X1BA 2CAKA 3KW8A 5DHHA 4BWTA 4A68A 3OQRA 2BZ7A 1L9PA 1GW0A 4M4RB 1VLXA 3NJGA 5H2HA 4AI7A 5I6NA 3IE9A 3NYAA 1BAWA 4HCIA 4E9YA 2BWDA 5H2KA 2IH9A 4DP8X 4AKOA 3OMIB 4JKNA 4LDLA 1L0MA 4NAJA 5H2PA 3MX0B 2IAAC 1CURA 3QDCA 3H4HA 4KNTA 1X9UA 2R7EB 1PZCA 1W6LA 1KG9A 1RKRA 3QQXA 5AZUA 3S8FB 1JGJA 1SHXA 2DV6A 3NT0A 2PLTA 2YAOA 5JJJA 1NIFA 1TKWA 1XMEB 1ZDQA 2PPDA 3HAQA 2PPCA 4YVUA 5G53A 3PBLA 5B6WA 2DWSA 2BHFA 1ETJA 3UTWA 1C8SA 5LWEA 2NTWA 4GXFA 2VW4A 1GSKA 5I26A 2WJKA 1IUZA 1NDTA 3P0GA 1R2NA 1XIOA 4DP0X 4LDOA 4MD2A 2GBAA 1KCWA 1ET7A 3UACA 3VI0A 3UABA 4X4KA 1M0MA 1KMEA 1QNIA 1MZZA 3WKQA 4WKXA 1QM8A 3QJQB 4GRVA 1M57B 4L35A 1M0LA 2VSMB 1S8LA 5AX1A 2KSAA 1KBVA 2Y69B 2J55A 2DY2A 3OM3B 3PAVA 4BDVB 2QDVA 4MFHA 4PXKA 5B6VA 4HHWA 2J57A 5B1AB 1JV6A 1OCCB 4P5SA 4DP2X 4PAZA 4BXVA 2YAHA 4E9VA 1PMYA 3DKHA 2HX9A 2IDTA 3S3CB 2QDWA 2P80D 3NJJA 4BDVA 3D12B 1NICA 3AG4B 5C1MA 4UAHA 3AM6A 1UATA 3C9MA 3QJSB 2JXMA 3A7KA 2R4RA 1ET5A 2M3GA 3CG8A 4FPDA 2TSAA 1FBBA 2YAPA 1C3WA 1BQ5A 4A2GA 1KCBA 4FA7B 2AFNA 3UTYA 2IDUA 1R84A 5B0WA 1GS6X 4HCFA 3CDZA 4LDEA 2TSBA 3PPSA 1AZCA 3NJHA 2H3XC 5H2IA 5JJNA 4A4MA 2IDSA 7PCYA 2I35A 3EHBB 2I21A 4A66A 5DHGA 4JHVA 3NSBA 3SQRA 5H2LA 2CJ3A 5AZDA 1NIEA 1XB6A 2FQGA 1RZPA 1XJIA 1J5CA 3GYRA 4AMIA 4YL4A 1NZRA 1JFPA 2NRDA 2CCWA 1FBKA 1BQKA 1BXAA 5FJGA 4HYXA 4J4QA 3RFMA 2BW5A 2PP8A 2VW7A 3WG7B 2H47C 4P5RA 1URIA 4X1HA 5I6OA 4BWUA 1PNCA 1TN5A 1N70A 1PLAA 2IWKA 2WO3B 1ZIAA 2EILB 1L9RA 2CUAA 2XV0A 3MBVA 2EIKB 2VW6A 4G71B 1AIZA 2BP0B 3UAAA 4DP5X 1E67A 5I5IA 1PY0A 5A8EA 3T6XA 3AYMA 4E9WA 4MQSA 2YCWA 3SBQA 5B6XA 4TXVB 1PXSA 3GXUB 1IBYA 4KLYA 1CYWA 1PLBA 2XXGA 5A7EA 3NY8A 4NB7A 1KYAA 1GYCA 5H2MA 4GBRA 5B6ZA 1NINA 1AZNA 2QPDB 4EA3A 1NWOA 2B3IA 8PAZA 1AP9A 2L6XA 1Q5JA 1WA0X 4CSPA 3CVCA 1EZLA 5J7AA 2G87A 3DQBA 4BUOA 1N68A 1ET8A 2W8CA 1JZJA 4E9XA 3QJVB 2Z73A 1WAEA 4YSQA 2PPAA 5BR5A 2GSMB 3VG9A 2F95A 5F8UA 1MG3C 3N2JA 3JTBA 1ASQA 3PAUA 4CSZA 1OCRB 1NIBA 1WA2X 2RH1A 3PLYA 3NS0A 4AMJA 4AKPA 1T5KA 2YXWA 1MDAA 2UX6A 3OMAB 3V2YA 4UG2A 5KKHA 2X88A 4ZK8A 1ASOA 4G7SB 3SBRA 3QJTB 4DP6X 4UANA 3OAXA 4BEZA 1S8JA 5ETZA 2IH8A 1C8RA 2I20A 2YAEA 3FYIB 4YSEA 1ILUA 3ABWA 1HFUA 1ZPUA 2DWTA 2XVBA 2XX0A 4KO6A 1S52A 5H2NA 2JKWA 4M3HA 3NYKA 7PAZA 3PXOA 4BXSV 1PZAA 6PAZA 3WIAA 1JZIA 5AFAA 5B7FA 4DPAX 2HZHA 3D4SA 1EHKB 5G36A 3UTXA 2H5UA 4JR8A 1P8IA 3QJUB 3CVBA 3TA4D 4DJHA 3RZEA 1JOIA 3FPYA 2Q9OA 4EJ4A 1WS8A 2AT9A 1GU8A 4JKVA 4FAAB 1CUOA 1ADWA 1NPJA 2ZFEA 3ZDWA 2YDOA 1AOZA 1L9QA 3V2WA 3UADA 2IWEA 2EI4A 1PXRA 2AVFA 2YAFA 4DPBX 3PCYA 1F50A 4BWBA 3HAPA 3NJFA 5D4HA 3FQYA 1H68A 2MTAA 1ZIBA 5PAZA 1SFDA 3QBLA 3CODA 2UXGA 3FYEB 1ID2A 2WO2B 1AANA 2BWIA 4QRYA 3FSWA 5I28A 4HIPA 1SDDB 5I5MA 1PZBA 2CBPA 1GY1A 1PLCA 4YSRA 3PQRA 3KW7A 1QKOA 3NJKA 4UHRA 1A65A 3L45A 4N8UA 4F7KA 5B34A 2JFCA 1S53A 4HYJA 1L9HA 2HRGA 4W1TA 1JVLA 2Y02A 2BP8A 3NJLA 4KNSA 2I1XA 1X0SA 2YCZA 4G72B 4TL3A 2GI0A 2X87A 4WAVA 4MBSA 2P80A 2ZOOA 4HALA 1PNDA 3ZIYA 1E65A 1FFTB 5DYSA 4X32A 4GPOA 2Y00A 5B1JA 4N4WA 3WQJA 1AG6A 1OOWA 1KDIA 4YSTA 4YSAA 4NERA 5B3SB 2J5WA 2Y03A 3FPXA 3IEAA 5AX0A 1NTDA 3BQVA 1CC3A 3NJNA 1U19A 4RH4A 2IDQA 3QAKA 4FBZA 4JHUA 4QKTA 5BR2A 3EF4A 3T6WA 3ABKB 3ZEVA 4QIDA 2YXVA 3QBIA 2UXVA 2Y1AA 3FU7B 2RACA 3DTUB 4WW3A 1WA1X 3NJIA 4IAQA 3COCA 3UGEA 4XT1A 4HZ1A 2W88A 4GYBA 1ZDSA 4BVNA 3AW5A 1HAUA 3RYMA 1M0KA 4XXJA 5TGZA 1L9TA 3WI9A 2EIJB 4L0PB 1YLBB 4HHGA 1UCQA 1AAJA 1L9OA 1NIDA 2FJSA 1L9SA 3NP3A 1PF3A 1P8HA 1J5DA 2I7OA 1E0PA 1FA4A 1RCYA 2PEDA 3ZPRA 3S3BB 3PDSA 1AS6A 1F56A 2EINB 3SN6R 4Y9HA 1JZHA 1MZYA 4IARA 2AZUA 1IKOP 3OE8A 1QHQA 4A2EA 3VW7A 4MQTA 2AANA 3ZPQA 5FC9A 2FWLB 2AZAA 3DDLA 6PCYA 1GZMA 3UG9A 2FQEA 1R1CA 3ODUA 1DYZA 3ASOB 4KO7A 2UXTA 3SBPA 4YSSA 4PXFA 3CVDA 3ABLB 3T71A 4A2HA 4G70B 4L6RA 2GB2A 5H2JA 5I6KA 1UAZA 5ITEA 3OD3A 1BM1A 2QT6A 4KNUA 1JXGA 5A45A 1XB8A 1BYPA 2ZXWB 4DAJA 2XYBA 4KO9A 4F2EA 3UTVA 1GY2A 1BXVA 2FQFA 1LN6A 5B1JC 5B7EA 3QPKA 4DP7X 2UXFA 2R4SA 3EMLA 2XWZA 3ERXA 5G2AA 2HLEB 2QPEB 3TBBA 4PCYA 2GC7C 4KNFA 2PCYA 5B7MA 3HAOA 1HAWA 1E5YA 2UX7A 1SHWA 5B2NA 2GC4C 2Q5BA 2ZONA 2VSKB 1AR1B 1IXFA 4G7RB 1S54A 5G28A 5I6LA 5I5JA 4HCGA 4OV0A 1SNRA 3NSDA
chains in the Genus database with same CATH superfamily
5C1MB 2FEEI 3NSFA 1CWQA 4PD4K 4Y4HD 1OB1B 1P7QB 4PJBB 2H32H 5IT2H 5I1HL 5IHZA 1CMOA 1JN6A 4XT1C 4IOIA 1JSYA 3JUZA 4H8WL 1LK3L 3DBXB 4L5FL 5I8KH 5G2DA 3DOIA 4PRHA 2XXFA 1T0MB 4BRJA 1G84A 1DQKA 4HP5A 2ZYSA 3V5KA 1JGEB 2NYKA 5EO9A 3QEQE 3VUAA 2APWA 1PKQB 4K3DH 3ZQ9A 1A21A 2YEZA 4UV7L 5FK9A 5FDYA 3C9LA 4HS3A 3CZJA 3M1BA 1AGBA 3S8GB 4I3GA 1YEDB 3EYVB 3NEEA 4MJJA 2DLIA 4NUPA 1T80A 1JPTL 2R69A 4WKZA 3GI9L 5HHPB 3NQKA 3WY4A 5DMYA 3DC0A 4TUKL 3QDHA 4N2IA 1J1OL 3P30H 3ZL4L 1EXHA 2ZYRA 4OGAC 1GUEA 1G7LB 4M62L 1JTTA 3MYZA 1S9XB 4RMRA 3OKNA 3IPEA 4MQSB 1MRDH 1BZEA 4PRNA 1JFQL 5HDOA 3IPFA 2J2ZA 1X9RA 1BEYH 3IS0X 4BFEA 1JV7A 3N0AA 4JREC 5IQ7L 5JHLL 4AEEA 3GMNA 3NZHL 4N0CC 3CWGA 5HVHC 4IKNA 4MZ3A 5CJQH 4HWZB 2JSFA 4N2DA 4WI8A 4UTBL 2VLJB 4HX1A 1NLBL 4JFHE 1BMGA 3AQYA 1I1AC 4JPVH 4E5XG 5KSVB 3CVHH 4GXUM 5IBTH 4U1NA 5JW4Q 3APMA 4FCAA 4LOVA 5PCYA 5DJ0B 3U4EB 1SBSL 2HB0A 1CBVH 3PAZA 2WVVA 5BS0A 3AS3A 2OMZA 4LQ1A 2IAMA 3ABMB 1BBJA 3V4VH 4JVUA 3U7AA 1G9HA 1MY7A 5D7LA 2ETWA 35C8H 1GXEA 3GHEL 4FKHA 4D3CL 1ZSDB 1CQYA 1FPTL 3KPSD 5IUSA 3K2MC 4LSRL 3BFWA 4WFGE 3OBAA 3BIAX 4FFYL 4MZRA 1F3RB 1D5RA 5CINH 4CW1A 3AC0A 4XCFL 4NRZB 4U0QB 3D87B 1T66C 4WK0B 1URZA 2D0GA 2OSYA 2YD1A 4C4BA 4D0BA 2R2HA 2DWEB 1JNNL 1MCNA 1LK2A 3OR7B 1HYSC 1AY1L 2ADIA 4NEHB 4FJYA 2OTPA 5AWZA 3S4SG 4UQAA 1PCSA 4K2UH 3FO1A 2JB5H 2ORBL 4A2DA 5F7EH 4RMTA 3WJMA 5EC2A 1ZSHA 2L4OA 3NGBB 5LKNA 3BSGA 1WRFA 4X6CA 3MA9L 2K8QA 2XTJD 2MHAA 2GPZA 4UM8B 4P9HH 1E2VA 5KUMA 2Z55A 1LDSA 3L3GB 4IMKC 3VVWA 5LGHL 4P06A 3QBGA 4L4VD 1X4YA 1EK3A 1E6OL 4KTEH 3QBKA 3EBHA 5TDOB 1NH6A 5DHDA 2E9BA 5IY5B 3Q5OA 4HEMA 3WN6A 1CO1A 1G7IA 3GBML 5JQHC 2FIKB 3NK4A 3RUGA 1FJ1B 4X0KB 1S46A 3ESOA 2FDBP 5F1IA 3AY2A 1I7RA 3R8BB 5MP6L 2WN3A 4MA8L 2ZZLA 2QQKH 4NKIH 5FGCE 4YSPA 3HLAA 2CUIA 5HTSA 4DP4X 1OCWL 4J6RL 1P5UB 4F24A 1PJ9A 3ISRA 4QXTA 1MI5E 1V54B 5HYSA 1ZT4A 5E6RB 1EEQA 3KPOB 5SWZD 5KVDH 2WBJD 3DV4A 4XNDA 1SYSA 3GBEA 3Q44A 1I7UA 4M1DH 2W94A 3SE4A 5B39B 3B8SA 2IXQA 5KVGH 3RY4A 1L0MA 5BO0D 4ZW3A 2P5WB 3OV6A 2GG1A 1HEJC 1JGJA 3IGLA 2LOEA 5D93C 4JQIH 2IGTA 2NTFB 2Z4QA 3KLLA 3ZDXF 4PG9A 4HWEL 4QTIL 1BLNB 2WZPA 2DIBA 1YSOA 3S35X 3TM6A 4A38A 1BQLH 4X83A 3BSZH 3H0TB 5T5FH 5C0NC 4LVNB 4YE0A 2NYZA 3MLYH 3SCMB 4WO4B 2RCSL 1KJ3L 3C6SB 1F4WL 2P3YA 2WJKA 1IUZA 4JHWL 3DX7A 3QCTH 4LBEA 3B9KC 4Y9CA 2H1LM 1KCWA 1OAKH 2SEBA 1RZ8A 4KXZI 3PWVB 4G8FB 1BF5A 2BDNL 1J8RA 3QDJD 2R59A 3EGSA 2X42A 2X9ZA 1BWWA 4UT9H 3TT3H 3O8XB 5FCSH 1N19A 4G6JH 1LO4H 5HJBA 3GQFA 1JYVA 1BJMA 1YN7B 2NNFA 2BPBA 3FB8B 2IOIA 4GSRA 4K3EH 5EOCH 1U4FA 5F7FA 2YPVH 5MERB 1Q38A 4KRPB 5F96L 1T03H 3ZZLA 2N1TE 1EVUA 1RMFL 4OZGE 3IKCB 5CUSH 1E50A 1A1MA 1LWJA 3LKPB 1SM3L 1UM4L 3IYLW 3OF6D 4GIAA 3MLRH 3SYAA 4HK0A 4JN2B 1D6EB 3O4LE 25C8H 3C12A 4PB0L 4W9JC 4MCMA 5MI0C 1JGLL 1ET5A 2C3GA 2Y72A 3QZMA 4RA0C 1J8KA 3T65B 8FABA 4YXKH 2AXGB 2AFNA 1KPUA 3C09B 1FCCA 5DJZA 2IGLA 5IJKC 3TC9A 2J88L 5F1OB 2WLMA 4U1KA 3MV7A 1X5JA 3V0GA 2XFXB 4V2CB 1R19A 5CR1A 1E3ZA 2W0FB 2OP4H 2P24B 2FX8H 4AMIA 1J8HD 1MJUL 3EO1B 1KGWA 2BNRB 4OB5H 3D0VB 4YDJA 2HG5B 3T0VA 3MLSH 1W91A 3PP3H 4JCLA 1BVLA 5D7JA 4P5TC 5I2IB 2WGXA 2WO3B 2EILB 2NDGA 3MNMA 1R0AL 3OPZH 4IGBD 5CLYA 5I16A 1C5BH 4DGIH 3SO3C 1QUNB 1KBBA 1CF8H 2P28B 3EOTH 5HI3C 1KBPA 1S2EA 1VZHA 3C08H 3NCYS 3QZNA 4JY4B 4PG2C 3WL9A 1MEXL 4AIZA 4N86A 3PQYD 3QRLA 2CK2A 1CG9B 1G9MH 3RWJB 2IGFH 1AHKA 4FQCH 3RWDB 1UKTA 4M6ML 5IQMA 4YUEL 2L6XA 5JQ6H 3CZEA 3FFDA 2BY2A 1AKJB 1F11A 1DQMH 3FCUB 4PJFB 4XBPA 1UD6A 3QZLA 1JZJA 3ETBJ 5EMYA 4RFEB 1IAKA 1SYVB 1J1XH 1B4TA 2AJSL 2KH2B 2WB1A 3N44F 1TLKA 2CQVA 3QUZD 3U9UB 3UO8B 4U1JB 3THML 4AV4A 1X6NA 3UBFA 5F8UA 3N2JA 4HEPA 1CWVA 4D9QD 1TTAA 5IJCC 2RH1A 2YPLD 4LSPL 3DXAD 5F1NA 1HCZA 1WAAA 1UOKA 2B59B 5HDBE 1Z32X 4AITA 1NQBA 4HPHA 4P2AA 3SDDD 5D72H 1R17A 3ZJAA 3VXPA 3QUXD 3OKMB 3SDAC 4MDJB 4Z7OF 1LXMA 1E2WA 1H6TA 1NEZB 2JKWA 4OCSH 3HLKA 4NQDB 1PZAA 3WIAA 3LCYA 1JZIA 1PZDA 4ZPTA 1RFDH 4JFPB 1JZ3A 1I8MB 3VD4A 4YK4B 2F8VA 1NGXA 4OCMC 5JHLA 3TNMB 5KVDE 4EJ4A 1N18A 1U8LA 1IKFH 3BN3B 4ABQA 1RZJC 1P2CB 1EEZA 4OSUL 1YYMH 4NKOB 5DZLA 5GZNA 3ZK0A 3RX8A 5DDHA 4UTBA 3TYFA 3UTTB 4HH9A 5KVGE 1PXRA 4F8LA 1O5PA 5D6CB 3D69B 5I1CL 1A6ZA 2BOBA 2QGDA 2X6AA 2ZKYA 3OAWA 2XWJB 4ZO6A 2IFGA 5ICXB 2MTAA 2VT0A 5FV2A 3P54A 4JPQA 3K6DA 3DRTB 5LGJA 3QG6B 4GKNB 5AZEL 5L8KB 3RIFK 1FFPB 5IQ9B 1RL1A 3LDBB 2Z31A 5ETUB 1GY1A 3WY1A 1L7TL 1RURL 5BV7H 3UTQA 3PRZA 4UHRA 4Z7IA 1MCBA 3KWUA 2X4TA 3RFZB 2GTZA 2WXKA 2WYTA 3AY4A 4FFYA 1HZHL 2NSXA 1JK8B 4WV1C 4AXWB 3SDCA 1PFOA 4BSJA 4G8EA 1DHKA 3SJVD 3BKCL 1M1XA 1JDAA 2Y00A 1H5BA 2C9RA 3V8OA 1XCWA 1L6PA 5EEYA 2X2HA 1X5AA 1Z0MA 2WYIA 4S1QL 4AW4A 3HUJF 4HOWA 2CO6A 5DT1H 1D7BA 4HWBH 3W9DB 4O2CA 3DUUB 2XN0A 4F7MA 1XO8A 4ZOBA 4G59C 2K6WA 2Z7ZA 5AB9A 1OAZH 3V4LA 2V3DA 5AW1B 4LSVL 2X4UB 1XEDA 3CX2A 2Y22A 1LEKA 5A2KH 1VERA 1JPGA 4KMQA 2WM0A 3SBWC 1FDLH 1LHZA 3QDAA 3FQUB 4BVNA 3H42L 3PWPA 4X5QA 4ZS7L 5FO7B 4WI9A 2EH7H 5CBEB 4XXJA 3CPUA 4HHGA 1L9OA 4JAMB 3H7BB 4OZHF 2ZUQB 2UZIL 3AT8A 5SV3A 1OOAA 2A9CA 2ZAIA 4DN3H 3A21A 4DT2A 3CSYB 2E8YA 1CGSL 4PJHF 2B4CC 4PS7A 4WTWA 4GBXD 5CJ8A 2Q0ZX 2WSPA 3FO9B 1N64H 3L3IA 2XG5B 3MACL 2BSDA 4Z7UA 4XXWC 2EEFA 3OAYK 4TLSA 5GHWH 4CADA 6PCYA 4UTAL 4KXZH 4YBHA 3ALXA 3BQUC 4UAOC 1OD9A 1OQOA 4XO5A 3ZKMC 4DIXA 2JJTC 3ODUA 1OTTD 1VFBB 4IIQA 4LEEA 5DHXB 3P4NA 4EDXA 3ASOB 5KZCD 5LQBH 2AK4E 3SBPA 3CVDA 3N41F 3V0VA 1BFTA 1Q9OB 1U8HA 1UT9A 4NUQA 1K9TA 3VI4E 1N0LB 1V7ML 5B8CB 1TTUA 2AJVH 1DSFH 1W72H 1WFTA 2OSLA 4UIKH 3PWNB 5FGSA 2X12A 5GXBB 2UYLB 1HSBA 4H26A 5K9KA 2CNYA 4JQVA 1GY2A 1KIUA 4TSCL 1WYJA 4XMKH 1ZHLA 5EUKA 3INOA 1DDHB 5DC9B 3ULVH 1T89A 3HFMH 4LFHD 4W9IC 1LO5B 4IRJA 4OR1A 3ZQWA 1QLRB 2IBBA 3WFBL 5I17A 1ORQB 3MNZB 4OJFL 2G9KA 3S3PA 4BCYA 2EH8L 3FAWA 2DWYA 3SE3A 1AO7D 2FLRT 3B56A 3WHE0 4A67A 3VCLB 4DKDC 4M29A 2NUPB 3FOMA 1NLDL 1DJZA 2HCZX 3VTMA 2BSSA 3VJ6A 4WI6A 3IBEA 5DJXA 4N6HA 3F7VB 5FO9B 1NMBL 3PS6A 3T6VA 2KLSA 1UXWB 5I8EB 5CNHA 2W9EL 2MWCA 2UZXB 9CGTA 3C2AH 3P0YH 1X5MA 3P4LA 4XCNA 1DQLH 2I9TB 4LIQL 3O2WL 3MV9D 1NPNA 5B39G 2WLHA 4OF7A 3STZB 1K4CA 1YEHH 3IDXL 5B21A 4QI1A 4NKDB 5FM5M 3TP4A 4ZMNA 2ZXQA 5EZLA 3O11B 5EF0A 4PMEA 3CLWA 4NKQB 2FO8A 1CK0L 4Z7VA 1MY5A 4NFBA 2Z0BA 3CPLA 1MIMH 4HLEA 7FABL 3HI1A 3QDGD 3VWJD 3HAEA 4A7TA 2WSKA 3OWRA 5HDRA 1H8OA 4BSWA 3S5ZA 1S5HB 4M8UA 1ED3B 3D2UA 2PO6B 1QFUL 1BP3B 4UINH 1JV5B 2NY5L 4K5PA 5FO8B 1KWKA 3F00A 4L29B 3V0EA 4NRYA 5I0WA 4P2RB 3BAKA 2OXGB 1DVFB 3CFEA 3MC0A 1EVTC 3ASWA 3RILA 3VSVA 1E4KC 4GQ9L 3FW6A 2X4SA 5SWSA 3D39A 3KYMB 4WNJA 2Z34A 2MOQA 1MVFA 4KOCA 2XHNA 1QLFB 1WT5A 1XQ4A 3FS9A 1SLWA 3HIZA 3WFHB 2XWBB 3M1OA 1YPZA 2J4YA 3PE9A 5CCKH 1KB5B 1WC7B 3BGFB 4UOW1 3VQMA 4HOZA 1JGVL 3QCUH 4PV8B 3D4YA 2RFXA 1HDMB 4OJAA 3TA3C 2PP7A 3HZMA 3AG3B 1KSRA 2HFGH 3IBOA 5IGXH 4Y1AD 4CUCA 3BE1L 4B9CA 4N25A 1RSFA 1D6VL 5ANMB 1JI2A 4AM0Q 2X6CA 5ICUA 4FG6D 3F7RA 3KL3A 5AL0A 3OSKA 3IDGB 4N8CL 5G54A 1MREH 1A6WH 4GMTH 5H8DA 5L88L 3ABGA 5EN2B 1FFOB 3K8KA 4PUBH 3ZR5A 3QUYA 3HE7D 5EU6A 4NGHL 3G9VA 1AJ7L 4FXGB 1MHEA 4PJ5A 1AHWC 1NSNL 3NGBC 4HSAC 4Z7NF 1NL0L 4PJEE 2DYPD 2ZOKB 1UEMA 3GSRB 2K9FB 5IROC 5DJAB 3JV0A 1QBBA 1GCYA 1HOEA 1S6NA 2P5EB 1AI1H 3PUCA 4IKLA 5JHDE 3MLUL 1Z3RA 2YD7A 3OXSB 2XWTA 2ED7A 5CP3H 3K81A 1ZVSA 1TZIB 3MBEA 5D5ME 1W2KT 2DQEH 4NM8L 1EWHA 2ZUYA 3HJ0A 4F3FB 3RWCA 1I8LA 4A6YA 4ZMVA 2VLKB 4TNEA 4N2FA 3OZ9H 4QNPF 2BIMA 1OPGL 3LZQA 1AZVA 1DEEB 4MDIA 1OARH 1TEGA 2QV2A 3O0RL 4Y1TA 3V0HA 3FQ1A 2NR6A 3K1DA 4DP1X 1ADQH 4WU7B 5A44A 4XB8A 1QR4A 3AQDA 3GMLA 1AIFB 2Z93B 3OB0K 5TF0A 1X9LA 2AGJH 2WANA 4PREB 2ADFL 3ILQC 3D3VD 3FUNA 4YDIH 5T1LD 3D4ZA 1L5GA 4Y4HA 5E6UB 2NNRA 3EFOB 3GSXA 1OE2A 4N5EC 3TBYA 3ULVE 1DP0A 4HQQH 1N6QH 2PNDA 3SDXB 3U0WL 5DYOA 3X1BA 2HFEB 4ATTA 2A4CA 3D51A 2EDRA 4QRPB 2A73A 3G6JE 5CBAA 2NW2A 2ZUTA 3NYAA 1Y1DA 1RZJH 3BUTA 2XQ0A 4N26A 2ZX6A 1NCCL 4KKBC 5EOCJ 5E23A 1CURA 1B0RB 4L2YA 4NUJA 3SCMC 4WO4C 4MTMA 5J11C 1S7RB 3S8FB 4JZOA 3VDBA 4YPGA 4F9PC 4KKPA 3DDGA 3UO1L 2EVJA 3GNMH 3ES6A 4NQCE 4F1ZA 2X3BA 3T2QA 2DWSA 2BNQB 3N85H 3KBEA 2FL5B 5CCGE 4FZ8L 3O8XC 1DSWA 3WS6C 4M6OH 4P5KA 4M1CD 3ZE2F 3I84A 1F4AA 1OM3L 1FI8C 2QEJA 4KRPC 4RETB 3QHFL 4F80A 2B1AH 1EAOA 2QHRH 2A74A 4NWUH 4KK6D 5AX1A 3G6DL 4ZI8A 3T2PA 2DY2A 32C2A 4L9LB 4B7LA 1RU9H 1OK8A 3T4YA 3QIUB 4HFWB 3WDIA 2ITDA 2NX5D 4DP2X 3FCSB 3U48A 1MFVA 3EJJX 3NMEA 4Y19D 1Z66A 1PMYA 4JGNA 4W6XB 2IDTA 1OAQL 2F08A 1T7VA 1BAFL 3D0LA 3GKWH 1G7PB 3KLDA 4IHOA 4AZ8A 2P80D 4BE6A 1CL7L 5H35A 1KEGH 4YWGH 4F9LC 4GI6A 3D12B 1V3LA 4ES9A 3IGKA 2FEDC 3RGVC 1P4LB 3D08A 5AW3B 5IJVB 4LAQH 5IHWA 3GSUB 1MIEH 4FULA 3LKQA 2EIDA 1L0XA 4EQ3A 3PIQB 3BCFA 4XB7A 3EH1A 1P4BL 3KPSA 4JRLA 5LWYL 4ODWB 3NIGE 3CTTA 2VC2L 3PWJB 7PCYA 3WE6A 3UGXA 4RDQG 3NSBA 5JDSB 4L8SA 3KDPB 3IDMA 4JRWA 3MRPB 1KYUA 4MNQD 2B4CH 3O6FD 5LVEA 1BGXL 3HG1E 2O6CA 4YHIB 1NDMB 3UC2A 4J4QA 5CD3A 3WG7B 1Y6KR 3X3FH 1HXYA 3LKSA 1R3JA 3QR1A 4AMKL 4JFSA 1C12B 1ZT1B 1RUPH 3C5SA 3E6HB 2BP0B 3HA0A 1MQKH 3HRPA 3QDMB 5HGAA 3T6XA 2RALA 3NQIA 3ILDA 5GZOC 4JFVA 3DX9B 5AWNH 1IBYA 5A3IC 1CYWA 4XPHH 3MA7B 3BIKB 2EDQA 3PUUA 2G5RA 2H26B 1UH3A 4L4VA 1FGVH 1J0HA 5CZVL 2HTKC 5K9OA 2V6HA 5B3NA 4TVPD 4WFED 2C3VA 3DQBA 3BP5B 2IF7A 1F02I 2A9NH 1GHFL 4GNKB 2Z8VC 1A14H 2AJXH 1PKOA 3WJJC 1DEDA 2XSKA 1THAA 3L4WA 5GGUB 3ZDXE 3QWOA 2J3SA 1TR7A 3WXWH 1VESA 2J6WA 1S7VB 3QJFA 2DTML 3RTLA 2C4XA 3VSQA 3QAZB 3APFA 2E4FA 1UQSA 2DLFL 2VLRE 4NQSB 4MAZA 2AQ2A 4OLUH 4YK4C 5SWZA 1VZGA 2WBJA 1F2XK 3S37L 1ZPUA 2XVBA 4GRWF 4AW7A 5H2NA 7PAZA 3WFCH 1BVNP 2PXYD 2VXQA 3NK3A 1D9KC 1GAFH 3ZE0B 5C92A 5GRVK 1YJDL 4JKPL 3IXTB 5GGTH 2F53E 4NJ9L 3PDOA 3PWLA 4NHCH 5BQ7B 3T8VA 4GW4B 2PWEA 3W56A 1FZKA 4ZNEA 2Q3ZA 5C0DA 3PHOA 1WS8A 3QXDB 2OQJB 3LPOA 4XPBH 4KX8A 4AT6A 1E42A 4JFYA 4FNTA 1L9QA 3CFUA 1IB5A 4PW3A 5IWLC 1CICB 3LDBC 5CMAB 1F86A 3QS2A 1MVYA 5AG9A 4YLCA 3OVUB 2CE6A 3O2DL 1G7HB 4ES8A 5E4IA 3WIHH 3ARGD 3GSNA 1OM9A 2Q7AA 3QR0A 3QDJA 3S5LB 1T20A 2LU4A 3QH3B 5J6GA 2OMVA 2BNUB 4CSSA 1HE7A 4OUUB 4WJ5A 2GJRA 1YY9C 4Y5YB 5AZ2L 4NZRH 4F2MB 3JZYA 2YWZA 3OZKA 5IB3B 5EOQL 4F7KA 4HMCA 4XI5C 4BGDA 4HYJA 4ODTH 1U8QB 3ECUA 1OLZA 4QHNA 3MLWL 2OR8A 3OF6A 4Y4FB 3IDNB 4Q56A 3CZFA 4TPRH 4XCCL 4BKSC 1A4KB 4HALA 1UJ3C 4EN3D 2QSCH 2VERA 4N4WA 5DZOA 3MRRA 4MKMA 2V9TA 1B4LA 1OAYH 5CS7A 1TZ8A 4OLXH 2Y1ZA 4ESKA 3Q6FB 2XZCL 2XZZA 2YMXH 1CE1L 3RNQB 2HT2C 2YSSB 4NO3B 3QR2A 5SX5K 4I9WE 3G6AB 4FBZA 3H53A 4U1HB 4PJAF 3MRNA 4PQXA 2WAQA 4GG6B 2ZOLB 4M4RA 3RE0A 3FOLB 1AXIB 3ECWA 5C09D 4U49A 1BFVH 4D0DB 1G6RL 1IBBA 2ADGA 3MJ9A 3RVUD 5AQ0A 2K70A 2YIHA 4W93A 1J8HA 4QHPA 2MIZA 2VDKL 4WWID 3RIKA 5BUAA 3EJRA 1NIDA 3P2TA 5TJWK 1GMEA 2BC4A 3LN4B 5EDXA 5IR1B 1Y1UA 1I9EA 5F7KC 4RAHA 3IS1X 4MHHG 3SN6R 5C0CD 4IGBA 4N2NA 1W16A 5JPNB 4P2QE 5AW6B 3RVTD 3OAYH 2M83A 5B8CC 3SE9H 4AE1A 3OC8A 4PD4J 5CJOL 4OVVA 2YKLH 5BW7A 3TN0B 2UXTA 5E94A 5FUCC 4AM0A 1GJWA 5DEFB 4Q9QH 2VRAA 2OLDA 3VD3A 3F7PC 3I6GB 3CFKA 3FFCB 3CMOL 2JLLA 1TPXB 3VQ1C 1E9OA 1FORL 1XF3A 4GG8A 2R2EA 3S3JA 2P42B 5C9JB 1O6TA 5FF6B 3QUZA 3CDGB 3O6KL 1IEHA 2BVEA 4EO5A 2DM3A 4BFIB 3EGXB 5JIDA 1DTUA 2YPLA 2NLJA 3DXAA 2YMOA 4DP7X 3ARBD 4MJ5B 2XKUA 3TBBA 3SDDA 3ZKQD 3QUXA 3U79A 4N28A 2AV7A 5E00B 1PDKB 4L4JA 3P4MB 2Y24A 1O7DC 1QI4A 1OAJA 3MOAH 1Q9LA 3NSDA 4W9GC 5DC4B 4L2LA 2RAMA 1PD0A 2P8LB 3ZZSA 5DMKB 3P73B 5C2UB 2BZCA 2AQQA 2Y3NA 5DJDB 5ITFA 4YSDA 2EC8A 1YZZA 2A5UA 3B2UD 4I2XB 3SGEI 3TBWB 4XC1H 2VDRB 3FONB 3PGCA 4HJJL 5EBGA 2BCKA 5T3XD 3RZCB 1XIWB 2CRIA 5EORL 3VH8A 3RIAK 2CXKA 4L3ED 3MCG1 4FNPA 4HCRL 3VFGH 3H9SB 3JV4B 2EDYA 2VDLB 2I60H 2VDNB 1LMKA 4H8UA 4X6EA 2EXWC 2K0RA 3DVFA 1TTGA 2VLME 2JKLA 4LZKA 4XH2B 5JA8B 3LPPA 1GS7A 1RJCA 4N2GA 2OSXA 4LSSH 1B88A 2PO6C 2J72A 1B0GB 2XU9A 1B4JL 5I6XC 5KYXB 1BZQK 4QYOA 4WTXA 4HUWB 3SE8H 4EUPH 1OTSD 1DVFC 1DFBH 1NAML 4HAGA 4HF5L 4UQ3B 1N8OE 3AZUA 2BSRB 5F3BA 3OQ3B 1DUZB 1MRFL 2W60B 1GZPB 1LWRA 2YLHA 3CZGA 3UTZB 1FIEA 1GGCL 3ZRFC 3NRPA 4HKZB 2Y2YA 1JE6A 3CFIC 4AQEB 4BFFA 4GYCA 2BFGA 2GJ6D 2I85A 5K1JA 1XF4A 1JZ2A 2Z7YA 1AXTH 3QAPA 2CO7A 4PPTA 4MA7L 4YN3A 5CHNB 4ZFZA 3SJVA 4HZLB 1JF5A 4XVTH 5L4MA 2V2WA 4HJSA 1WHPA 2O6FA 5JO5A 3N42F 1AS8A 4WW1A 1HILA 4PRDA 2XC8A 1HHGA 3CH8A 5TGBB 2OSWA 1P4IL 2NCMA 5EIIG 5IEHA 3VQ2C 3GTVA 3II1A 4W4OC 1RAMA 5B4MD 2GTWB 2G2NA 1FC2D 1HESA 3QJHB 1AG0A 1N5YL 4N2HA 2YARA 1T5WB 1T83C 2R7EA 4FXGC 2R0LL 2CBMA 1RUMH 1INDH 3D1MC 1KJMB 3CZLA 3QUML 4M7KL 4R4BA 3S98A 2RQEA 4KHXH 1UB5A 2GSIA 4A7GF 5AHYA 2LAGB 1ECYA 5I6PA 3FTGA 1TEFA 2D0FA 2DH2A 4OZHA 3U7YL 4LOUC 2R56H 4GY4A 3LKNA 2PPFA 3DO7B 1MCOL 4GBXA 2XJLA 4PJHA 1JZEA 2EDKA 2X9WA 4JANA 3MBWB 2I69A 4ZXBB 5C08B 4X80L 1VGEL 3TBTA 3GT6A 1WFIA 5I6MA 4LGPB 4QXGH 4HPYH 1BRRA 1HWGB 3Q5TA 5JW5B 1P7KA 4PGBA 4XO4A 2VDPB 1JHTA 2HT4C 4K9EL 5EBMB 4UUJB 3JTSB 2HJFA 2XVKA 4KY1H 2DEXX 5BRZE 2FK9A 2X0VA 1ZV2A 5EEXA 5A6MA 1V10A 3TTYA 5ID1A 3SYQA 2EIBA 2AXFB 4NC0B 3ZTEA 3D9AH 5E0QA 4FHKA 4DFIA 2O5YL 4ELMB 3WTWA 4PGEA 4CGTA 4EOWL 4UBDC 4H1LB 1C5CL 2QKIC 2ENYA 4R96A 3BZEA 3F2LA 4N20A 3C9NB 1TVHB 1WFMA 5JORA 1YO4A 2BERA 5J89A 1E30A 5T1DH 3C5XA 3U2SA 4NNPL 2HN7B 4XMLH 5B6YA 1YUKB 2XX1A 1YQVH 1AO7A 1A7OL 2XN9B 4PTUA 1QABA 3O2DA 3QCVH 4PB9L 3U1SL 3ELQA 4WFFD 4LESA 5GRUH 3X3GH 1EPFA 1TJGH 4AYBA 5BOZG 2WO4A 5J12B 1A1OB 4BH8B 2P5WE 1WPCA 2CAKA 4PY7A 5IVXF 4XXDB 2J8OA 2BIIA 2P8PA 3QIWD 1VLXA 4HJGA 2B2XL 2QGEA 4HCIA 3ZTJH 5BZDB 1V7NH 2NDFA 1DBAH 1RPQA 3MV9A 3QRGH 4XBMA 5FKPA 5HYQA 3CCHB 4P4KD 3MX0B 1BOYA 2AC0A 1PZCA 3QQXA 4WFHD 3D07A 2UY6B 2NY0D 2B0SL 4KKRA 5EEWA 2PR4H 3L3OB 1YC7A 2CKBL 2NYYD 3OKEA 4J8RB 4R2GD 4RRPM 3MGOB 5KYYA 1CBJA 5G53A 1CYGA 5ISZB 4OAWA 2C8NA 1WGOA 4S1SL 2AXJA 3MR9A 2ERJB 3WTTA 3QDGA 2AJYL 4PCSA 4X4XB 3VWJA 2V7HA 4GXFA 4HD5A 1UWGL 2YEQA 1WCBA 1ECZA 5KBKA 4L9LC 5C8JB 5EPMA 1QWNA 3KL0A 5C0RH 3GIVA 3QZWA 1RIUH 4J3UA 3UBXI 5FOBB 4V1DB 2DQUH 3WTVA 5D7KD 4LCIH 1XCQB 3S9DB 1KMEA 1PIFA 5I1GL 4WKXA 1G6RA 4QRSA 4GH7B 3ZDYB 3S5LG 4L35A 1OQXA 3L7EB 3N0PB 1J18A 4QY8A 4UQIM 2OJEA 5IBLD 4OIBA 4L4TE 3BD3A 4OLWH 1SMDA 3SGJA 3ZUNC 5JLZB 5KAQF 5L2JB 2UZYB 2X4PB 3JUYA 2D7TH 3T04D 3OXRA 1OCCB 5GRWA 4BXVA 4YHML 2Z92A 3CHQA 2YZ8A 2MQGA 6FABL 4CVXA 5F7UA 3VI3A 4DK5A 3REWA 2YD3A 3MOBH 4UYQA 2CLZA 2A9BA 3UAJA 4XTRD 1BJ1H 1A7BA 1IC4H 4FCHA 4JDTH 2X7LB 3X13B 3SGEH 2ZSWA 3R19A 5EZIH 3P3UA 1HQRB 3I3DA 3QQ3B 2MPAL 1XGTA 3DYOA 4Y1AA 5ID0B 3JV6A 4FA7B 1K6QL 1K5WA 1T1YA 4ZQTA 4EI5C 3CDZA 2IMNA 3OKLA 1AZCA 2BNRE 3AM8A 4XR8C 1A5FH 3IFLL 5IHZB 3AQXA 1JN6B 4A66A 4IOIB 4OFQA 3G5YA 3UBHA 2DMHA 3JWOL 5H2LA 2WZ6A 3HE7A 2K4AA 4WY7L 4PRHB 1EAPB 5CZXD 4NKMA 1RZPA 4JLRA 1X5FA 3NIDB 3QXUA 3V5KB 4CN1A 5EO9B 2DYPA 1IFRA 5E95B 1BQKA 1BXAA 5FM5O 4R3SB 4NO5A 2YEZB 2DIEA 5FK9B 4ZX3A 1KGCD 4HS3B 5I6OA 1TMCB 3M1BB 2H6PA 4XVJL 1XGUB 1AGBB 3FB5A 3T2LA 3MBVA 1RLBA 4RGNE 2WXIA 4XP6L 1E67A 5TQ2L 2A83A 3WS3A 3ISWA 4WKZB 3K71A 4BKLA 4FA8A 3EXLA 4PJFE 3P3TA 3MRQA 4TXVB 3EO0B 3IMVA 1MHCA 3TOPA 3REVA 1T0NA 1OGPA 3NY8A 3V5DA 1SOXA 2D9QB 2X0UA 2YUZA 2ZX8A 3KS0H 3SO5A 4IOFD 1NWOA 3GXPA 3OKNB 4D9LH 4U3CA 2BMKA 5DO2D 4CSPA 3KPNB 3WFDH 2NY4D 1TVDA 1UUSA 1PVHA 4HCRA 1EHAA 3KYNA 4FABL 1NC2D 5BR5A 2D03H 2NZ9C 3N43F 4KKLD 3GMNB 1SVBA 1KLGA 3D3VA 3HZVA 3CH1B 2WLZA 4C55A 2XN2A 4YBQD 5T1LA 5BO1H 3LZPA 1NIBA 2MQ3A 1ESOA 1WA2X 3L9RA 3PLYA 2H3KA 1G94A 2ED8A 4NQDE 4X9HA 4BQ9A 3GI8L 2X40A 5FLVA 4HX1B 1EH9A 4PW9A 2QPUA 1GKEA 4JDZA 1S8JA 5ETZA 4TUOA 4U1NB 2OYLA 2I20A 4WNSA 2Y36L 1FHNA 5IQLA 1EJOH 1MPAL 1NAMA 5GRXG 1QATA 2WVVB 2EC9U 1RHHA 4GMSL 2OMZB 2VXVH 4CMHB 1FH5H 4AUJA 2IAMB 4BXSV 2WZ0A 5FS5A 2XWCA 6PAZA 1BBJB 5C70A 4MAYD 5TQ0L 2VXUL 3HE6D 4FJZA 5D7LB 2VCOA 1T7YA 1EHKB 2FJGA 3UTTE 3MTRA 1BM3H 1M3JA 4OCXL 2G60L 5M94B 4KUZL 1ML0A 1ADWA 4KVCL 4Q58C 3RKDC 4JG1H 1WZKA 1FVEA 5KG9A 1NCTA 3MCKA 4DPBX 2CM5A 3IGAA 3SDYL 4Y5YC 4U3SB 2I32A 4YL9A 4RA3A 4D0BB 2R2HB 4HK3J 3FQYA 4BFJA 3IB4A 4P59H 2WPGA 1R3KA 4WHCA 3GK8L 1DVSA 4PMFA 2DTSA 1QSVA 2XQBH 1A6VH 4ACTA 3RHWF 1UA3A 3FO1B 3EJZD 3NJXA 4Y4FC 3MN8A 3QUMA 4Z7QF 4KI1A 4YGVA 1KB5H 3EYUH 4X6CB 3L48A 3NJKA 4IKJA 3BLBA 2MHAB 5E8DL 3W1ZA 5B34A 2QR0A 2HRGA 3F12A 4LLMA 1FAKT 4RWYH 4AL8L 1W0VB 1M9SA 4JG5A 2EDEA 4H0HB 1YDPA 3BIBX 2P80A 3ZKND 3KYOA 5T1JA 4NUGH 5CILH 2APXA 1F00I 1UZ6F 1Q1JH 4YSAA 1G7IB 4X0NA 3RUGB 2J5WA 2ZCHL 4PYHA 3IEAA 5AYTA 4FFWC 2VXSL 1IIKA 4XE0A 5SX5H 5F1IB 1I7RB 2H3NB 4F57H 4JG0H 4LLUA 4X7SH 3HLAB 4FX5A 4QIDA 2Y1AA 2IQ9L 3ZYZA 3LKOA 2AQTA 2KUTA 4QXTB 5HYSB 4KDWA 2NOYA 1FLTX 1ZT4B 5ACMA 4MNQA 4PJDF 1QRKA 1XGQA 1JS4A 3LZFH 1DDTA 4O9HH 4QHMA 3VD1A 1J1PH 3DV4B 3O6FA 5JNYA 5JPNC 1SYSB 3AT0A 3BPLB 5K59E 1I7UB 2CKNA 1AMXA 4KMLB 5I0VA 4FMKA 2IXQB 5GPRA 2MCMA 3DJ9A 3KM2A 3TN0C 3HI5L 3ULUF 2ZSVB 3FSOA 3UTPE 3ULUD 4L1SA 1F97A 3HHSA 2Z4QB 5HI5C 4R7XA 1TPXC 2UWEA 3QWRD 4Y2LA 5DS2A 4C83A 1MCDA 1WTLA 5HD8C 4RBPK 2V3EA 5E6SB 3CK0L 1FNGA 2WNWA 5K69A 4J3WA 4I1NB 1GGUA 4X4ZA 1ZLVK 1XL4A 1HEZA 3DX7B 3KLQA 3PJLA 3GJFK 4TQ8A 5FUCE 4IBSA 3WDJA 2CHNA 4L8BA 5TD4A 2SEBB 4KV5F 4OQTH 1RZ8B 1XGZA 3IGUA 3TV3H 4AG4L 4YHNA 2ZXWB 4DAJA 5BS0B 3EGSB 4YXLL 1FGNL 3QNYA 3WIIL 4DH2A 1MCFA 3SHSA 2IG2H 2PKDA 2ZCLL 3QPKA 4ONOA 2CKBA 4GAYB 3TIEA 2UY7A 4OGYL 4Z76B 2UX7A 1UXLA 1C1EL 1A1MB 4XN5A 3GBNH 1VFUA 4JO2H 3RZCC 4E0RA 2W80C 4HCGA 2PXYA 3SPJA 2P47B 5FW8A 3BYYA 1BEXA 5GS1A 3S34H 5HGBA 2E59A 1TDQA 2BRRL 4K0OA 8FABB 3ARFC 3ESVF 3KM1A 4Q6YA 5DRWA 1KPUB 2CU9A 5J6HB 5DJZB 4XMVA 4FL4B 3KL5A 1HKFA 2A4ZA 2DD8L 5I71B 3GMMA 3AG2B 5CLZA 5IBUB 3ARDD 1JMZA 3MV7B 1N7ML 4FA6A 3S48A 1NGPL 1U8IA 3HTLX 3NA9L 3K0YA 2YRLA 4X5RA 3T0WA 2VR3A 2XLLA 4YDJB 2DQGL 1YEFL 2CALA 1GA2A 3T8XA 3FUDA 3ARGA 2WXRA 5D7JB 1BVLB 3T9WA 1GTNA 1CL7I 1JVOA 3S35H 2VZVA 3K46A 2IALA 1A0QL 5FYLD 3WBDA 4P2RE 2FJUB 4GAGH 4F7TA 2FO1A 2VM9A 2VMJA 4NZTH 3BAEH 1U3JA 2VT4A 1LO3H 1Y0LA 4P5MA 3WL9B 2VDML 5JA9A 4DCQA 3N1QC 2NXYD 4NIKB 1IGIH 2WBKA 1J05A 3N6YA 1KELL 4XNUH 1OTUC 1XSOA 3BVNA 2CZNA 3H56A 4QJ3B 3R4DA 5FV1L 1IE4A 2BIOA 3FFDB 4DVBA 1J0YA 1F11B 3X3BA 1NGZA 3MJWA 4H25B 4EN3A 1JGUL 4XBPB 4A37A 1CLZL 1WH0A 1A6UH 5D7EA 1IAKB 3NIFB 4YX2H 2QVMA 2Y04A 4EQ2A 5D70H 3L5IA 5LDUA 3HANA 3SPIA 1AQKH 1AQHA 5F0PB 1OLLA 4PJAA 5ANME 1QFWL 3B6SA 4IRSC 3IFNL 3A6CL 1UYWH 5C09A 5KBLA 3ROOA 4MYWB 2H2SC 3VXPB 5DMGC 3O4OB 2X4NA 3V0WH 4PBXA 4ZXBC 2I5YH 5FYJH 5BVPL 1MHPH 2DQHH 3R06A 2A9DA 3OAZK 2FUQA 3EH3B 3L3JA 4FZEH 1RP9A 4MMXA 4ZPTB 3V4UH 3I6SA 1ZGLM 2CDGA 2PABA 3LD8B 3Q1SL 4K9JA 3NCEB 2P5EE 5C0CA 4X7DC 4O2FA 1MWOA 1ID5I 3RL2A 1MG2C 3UP6A 5AAPA 5KUKA 3OGOE 4N5UA 1U8LB 3B34A 1XGYH 5DHYA 5J3HD 1FN4A 2XPZA 1EEZB 3OGCA 2I25N 2KQMA 4GEJA 4TYUA 2YD6A 5DDHB 4M7ZB 3TYFB 4HH9B 3IN2A 2VLKE 5HJDA 1MJ7H 3RDTD 3WOVA 4CVUA 1B2WL 2DMKA 1A6ZB 2BOBB 4XBEH 1N4XL 1A3QA 2EDJA 2FT7A 3L17A 4J3OG 1HINH 3HB3D 3KWWA 5DD6A 4JHAH 5KJRH 3B5GA 4PJ9A 5B35A 3BRFA 1OE1A 3LZLA 2Z31B 4PWIA 3QPQD 3DIDA 4X50A 5B3JF 5DVMA 3BEVA 4AKQA 3ARBA 1G7MA 3UTQB 3ZBMA 5IHLB 4RSVA 2XDHA 2X4TB 2GTZB 3VFPB 5J57B 1NIAA 1JHLH 2BOLA 2ZUXA 3WEBA 1MCSA 4LMQI 3T1FA 3SDXE 4CC4A 2CBQA 3SDCB 4K7PH 2VM4A 1PS3A 3CHOA 4G8EB 4QRPE 1H5BB 1I53A 2ILLA 3G7TA 4G6MH 1T7WA 3CSGA 5C6WH 1K2DA 2CO6B 3FU7A 4H0GA 2X4QB 2WINB 4O2CB 3ARPA 1HSAA 1HOCA 4F7MB 2ZX7A 4HXAH 3IJYB 2Y1YA 1YEIH 3CHSA 3KW8A 2D8KA 3A24A 4Z7WF 2ATPA 5EUOF 4OZFA 3ABZA 4AC2A 4L3EA 2XXCB 1BAGA 4E9YA 1LEKB 2BWDA 1B90A 1G5AA 2IH9A 1ETB1 4NHUA 3CFMA 4ABUA 1UD3A 2ERJC 3MUHL 3JQOB 3PWPB 3R1GH 2BNQE 1SJHA 4ZD3L 5KYUA 1MW2A 3KG5A 2HTLD 2E9WA 4XNZC 3VQLA 4ZUSA 4RWHA 1BREA 1CGXA 5L4FA 1VADA 1BJ1J 4TRPH 1QSFD 3IMTA 4JQXC 4XWOD 4B97A 1S8DA 3L3IB 3FF8A 4I4WA 2N1KA 1AOHA 2X4OA 3DSFH 3A4DA 3D0AA 4CADB 2OCFD 4A04A 2YD8A 2QKSA 4I1RA 1W8NA 2GJ6A 3FDWA 1DE4A 4IIQB 4EDXB 3P4NB 2P52A 3WUZA 3ROLA 3AUWB 2FYVA 3V0VB 1KTCA 1DQDH 5JTWA 4N0FA 1KBVA 1DJXA 4JO1L 3QUKA 2J55A 3POCA 3A22A 3OM3B 4LARL 3UJIH 4PVBA 5E8OA 1M7UA 3MLXL 3V6ZA 2OSLB 1I8KA 5B6VA 3KE0A 1FZJA 3E2HB 1HSBB 1NFDA 1K3IA 4H26B 4JKLA 5K9KB 1OGTB 4F93B 1ZHLB 2F7IA 3FB6A 2NSQA 2LU3A 4R8WH 1JNJA 4OD3L 5KTEL 4NZUL 4BZ1L 2R2CA 2XV6B 5I17B 5ABDE 4YS4A 1KFAH 2WXHA 3WAJA 3KS0J 1E4JA 1HN1A 3BHBB 3F6JA 2J73A 3FOMB 1MRCH 5JJNA 2C1OA 3FUKA 1CD1A 2BSSB 3VJ6B 4Y9BA 3A67H 5AZDA 2WKOF 2FQGA 3M88A 4PTTA 5F89A 3IETB 2XN1A 1CDUA 2FX9H 3HKFA 1MCCA 3QDME 4J3OC 2H2PC 2NRDA 4LU5L 5FYJE 3QEQD 2MSPA 4JFZH 1IAIM 4KZEL 2WC7A 5K9JL 1S5IL 4APXB 2WQXA 2CGRH 4G5ZL 5DD3H 1K4CB 1FLRL 1SQMA 4WUUD 4NP4H 2CUAA 4UIMA 1RUQH 3NABL 4KWUA 4DP5X 2EJ1A 2C9QA 4DKAA 3DPDA 1L4IA 5A8EA 2GJJA 4JE0A 1EEUA 5DRNA 2WMPA 4Z7VB 4AGLA 4WCYL 5GQBA 3NFPA 5FW6A 3ZTNL 2YCWA 4IU3A 3ETBF 5A16B 3CPLB 1F4XL 3GXUB 3SBQA 5AW5B 5E08L 3OG6B 2AJUL 4LHQB 2Z7WA 3U6RB 3HI1B 3NACH 4JFDE 4JM0A 4LVHB 3HAEB 4JM4H 4BSWB 4Y2OA 2JKIS 1Q5JA 4IKIA 3T08A 4JFUA 3D2UB 3DVGB 5DVLA 5TE6H 1QTSA 2YRZA 3ZU8A 3T09A 1I9RL 3K80A 4NRYB 2YK1L 2OJZH 3UDWC 4YHPB 1I1YA 2VDRH 4M02A 3ARYA 3CFEB 3HPLA 1MNNA 4C54A 1J5OH 1S3KH 2VKXA 4R26H 3HRZA 2X4SB 5SWSB 3D39B 1BYNA 2VDLH 1UG9A 2VDNH 4JDEB 4JO4L 4H8HA 4ALAC 3ZE0E 2VRQA 3QBTB 4G7SB 3SZ6A 4JFHD 4BEZA 4M8QA 1P9MC 3U82B 1MFBL 5IVXA 3V9FA 3I2CH 1BD2D 1UD5A 3QIWA 5DD5L 3ML9A 1YPZB 3OG4B 5E9DD 3B9VA 1JMXA 3PXOA 2VISA 1IC7L 3RVWD 1I1FA 1K5NA 2HKFL 2ITCA 2RFXB 2VMCA 4P4KA 1DJWA 3HZMB 4QIRA 1DO6A 4H2AA 3EHBD 4FNLL 3CVIH 4U6TA 3VGDA 1WLHA 3LNDA 2ROXA 2CA4A 4ISVA 4MLSA 1FNHA 2WWKO 2AT9A 1GU8A 2YZ1A 5HHOD 4BK5A 3JTTA 4WFGD 4FQJH 4PV1C 5EU6B 1JXJA 3D7PA 1MHEB 4PJ5B 4M1GH 3B43A 3PCYA 4UCFA 2BLFA 4BWBA 4ZMXA 3CLFH 3I9IA 3MV11 3P0VH 4B41A 4YDMA 4F2ME 3S88H 2FBOJ 3ME0A 1AD9A 2DKUA 1B3JA 3PL6D 1FE8H 4H7VA 1Q0EA 1KCLA 3I9AA 3TVMD 1JJUA 4RMUA 3KWXA 4QRYA 2XWTB 4YHKL 5HDQL 1MFCH 3DX2A 1ZVSB 1R47A 4HIPA 4I18A 4UB0H 3WNMA 3O9WD 4N8VA 5AAMA 3EJYC 4GSDH 4HH8A 4JZNB 4A6YB 5E56A 1J0JA 1M71A 2J4WL 5FIEA 1CD9B 4OD1H 5E8EA 2ZWKA 1DQQA 3V0JA 4TVUA 1SY6A 5KJ4A 2ZYIA 4HGWB 4LLVA 3MBXH 4DWHA 4MDIB 1CXLA 3NJLA 4ZQKA 1I75A 2YCZA 3ZT7A 4ZBJA 3PHSA 4MBSA 1BM7A 4X9GA 4GG6E 1PZUB 3MRLA 3MXWH 3GKZA 4CSTA 4XO8A 5IUCA 4WDIB 3U30B 5FYLL 1ETZB 3GMLB 3TL5A 5IIEA 1T22A 3TESA 1WGVA 3A6BL 1FG2A 4FJ6A 3S36X 1MLBA 2FBJH 4OF6A 1DANU 5CGTA 1DQIA 3BPLC 4D0CA 2EUWA 3TO4B 4HEPG 3BN9D 3SE4C 3ABKB 1A3RL 4Y4HB 5H37H 2OXHA 2VN5A 5ALCH 2ZJSH 1L5GB 3GSXB 3HI6H 4K94C 1KBKA 3TBYB 4A7QA 2VDPH 1X7SA 3COCA 5FR3A 5DYOB 2C4FU 3DDFA 4M6NL 5HHVH 3WXVH 1O6SA 5CBAB 2A73B 4E41D 2ICWI 4PJXE 5AW0B 4WWKD 2NW2B 1UCQA 4KY2A 2BVTA 2X2JA 2YOAA 2VDQL 1ZA6A 3EZJB 1CB4A 5E4AA 2CA3A 4NUJB 1OSZA 2GSGB 4W9FC 4MD5A 4JZOB 4Y9HA 1RIHH 2A77L 4H40A 4H1LH 1CDJA 4OJYA 5AENA 3VW7A 1BW8A 3LRSA 2Y5QA 2FWLB 3ES6B 2ZWZA 1UKSA 3FFCE 3UG9A 3QFJB 4RBPH 3RTQD 1XF1A 5F1KC 5IHUH 2FQEA 4CA4A 1QKZH 4ZMTA 3W11C 1DYZA 2X1OA 3R7RA 3ZE1E 5L9DL 1VFOA 5JR1L 1G1YA 4KDTA 5GGQL 4MXQD 2EIEA 4UQEA 2V5RA 2IV8A 2NY1D 2XPYA 1SOQA 3AMKA 5FX3A 3PP4H 4TNVK 1NC2A 1YN6A 3GTNA 4LHUD 4KU1A 4FYSA 2A74B 3QNZA 3SOBH 2FX7L 5DUML 3IJ8A 5G5DA 2Y7OA 1D5IH 32C2B 4FXTA 4KJWC 4S1RL 4LXFA 2QSQA 2WV3A 5H4YA 5G2AA 4O51A 2KKQA 3S7GA 5E99L 4OQ1A 1B6DA 3H6JA 5DS1A 1IAII 1PG7L 3MUY1 4ZUVA 4OZGF 1FFQA 4I2XE 1F8TH 2Y07L 3H3BC 4IHOB 4FL4C 3TLRA 4AZ8B 3D0LB 1D7DA 5G28A 5H35B 1OSPH 1F41A 4XWGH 2ESVB 1FWXA 4MAYA 5TK2A 1UT2A 3H9SE 4BFBD 2WSDA 2G75A 1K72A 3HE6A 3VNYA 4JY5L 3IJ7A 1XAUA 1A3ZA 3FJTA 5JXED 3IDJA 2VZTA 3IWUA 4R97B 1U8JA 2ZP0T 1CLOL 3BO8B 3KPSB 1BMWA 3SIKA 2D7PA 3WE6B 5D7JC 1EJ8A 4N0RA 1JWUB 1A6PA 3IDMB 2PYED 2EEBA 1NANI 2YHGA 2OZ4A 1QI3A 3F5WA 2O6PA 3LNHA 5HHXL 1UXSA 4FQ2H 1XX9C 5CD3B 2E47A 4B9IA 1HXYB 3DK2A 4U6XA 1R3JB 5ABAA 5IREA 3UZEC 4HMDA 4AIOA 1XTLA 4IOSD 1LD9B 2WXLA 3INUH 4XMWA 3C5SB 1TLMA 4OIIH 2YDVA 3BX7C 5CZRA 2V37A 3RWGA 4OM0L 5G2NA 4O5LH 2XTJB 3W9EB 2OMXA 3SYPA 3GMOA 1B3IA 4M43H 4MD0A 3E9TA 4L4VB 4OLYL 5K9OB 5KVFH 4IRZL 4YNYB 3WSQL 3RA7L 1MFDH 5EG6C 3NDYE 2A6IA 5T3ZH 1HL8A 4YHLH 5DWPA 2XXMB 2R8SH 2FBRA 1XB3A 3TZVA 3UEZA 2AI0H 4QXWA 1RZIA 3O4OC 5D1ZI 3N1PC 1TNNA 4KHTH 3QWOB 4A7UA 3CBRA 3RVVC 2DIAA 3BH8A 3QJFB 5DRXA 2A3TA 3NAAH 5HDBF 4QLWA 4XMTA 2XNAB 3LD8C 1UQSB 1MF2L 3ZMEA 4ADGA 2Y23A 4MJHA 1BV8A 4R90L 1HKLH 5SWZB 4K7FB 5J13B 2WBJB 1UWEH 4P46D 3WE1A 4HYTB 5TE4H 2R69H 5C08E 3OAZH 4IDJL 4KTYA 4W9DC 1Q72L 4M7ZC 1AE6H 1QHJA 3CZUB 5FM8A 5KN5A 4PJIA 3QIBC 2YJLA 3L3KA 4GJTB 2KSBA 4BA0A 2YQGA 1KGIA 1T0PB 3PDOB 3PWLB 3KNBA 1JPEA 5C0DB 2E75C 3QWRA 1ZANL 4NENA 3SSGA 2FWUA 3QC5X 5AOJA 3WNIA 3ZKXB 4AT6B 3EJUA 3GBDA 4JFYB 1V8HA 3RVXC 3TTSA 1IBGH 4PJ8D 3ALPA 2Z31C 1ACYL 3GJEB 1PYWA 1NMAH 4UNUA 1XSJA 1MAMH 2EIZA 4WNQA 2AV1A 2F54B 3U7WH 4YSCA 3GSNB 2EE0A 4RCAA 1G1KA 3QDJB 1T20B 2ED6A 5J6GB 2OMVB 3SDCC 2B1HL 4BM7A 4WJ5B 1H5BC 3HAEG 1S78D 2K45A 2A99A 1IX2A 2F74A 2EUVA 3LS4H 3KR3L 3GLZA 3LEYH 4RISL 4ZUWB 3OKDA 5T33H 2XN9E 4F58H 5EN0A 4ALAH 1VGKA 1IJNA 2R4RH 3ARED 4QHNB 2COQA 5GIRB 1KN2H 4W9ZA 2IPTH 3C87A 1G9NH 3CZFB 2Q20A 1IGYB 2X6BA 2O1AA 3MRRB 2QLVB 4JZJB 3OAUL 5A2JH 1KACB 4F8QA 1JERA 2GFBB 3AJ7A 3I9GL 1KEML 3UG4A 3BDYL 3IMSA 4AGMA 5DHVA 2QELA 4M4RB 1OIOA 4NX0A 4YDKH 4L48A 3AU1A 5I6NA 5J7CC 3PNWA 2ADGB 1N6VA 5ISZE 1A7QL 4BKTC 3VD9A 1J8HB 3DJZA 3DO4A 3PV7A 2BC4B 2APTA 3K2UH 5E4OA 5I66A 4PS3A 3V4PH 4LL1A 5J1AA 4LPUA 3VGEA 4IIQC 1BWMA 4DGVH 4V1DE 4Y2DB 4OZIB 1UWFA 1AFVH 4IGBB 1JPSL 1D5XB 2VO8A 4FOMA 3TJEL 3ZDYE 2KZBA 1E27A 4BRVA 4ETQA 4S10A 1NOLA 1MUJA 12E8L 1TITA 5DZ9A 5AEAA 5CFHA 3E2HC 3PQYB 2A0LD 4W9LC 4X4KA 5E94B 4N0YL 4JQVC 1QM8A 2F5AL 1GCFA 1NAKL 3DSNA 4WW2F 2FH8A 3CFKB 3VI4F 3ZL1A 3W5NA 5IB2A 1E9OB 2DM4A 1XSKA 4GG8B 4NQUA 2R2EB 5E2VL 1Q4NX 3QUZB 1YAIA 2P8MA 3N44B 1IAIH 1M05A 3IWVA 4KKCD 3FN0H 5DHEA 3SKJL 4Q6IC 4KC3B 3UXFA 1UENA 1L3NA 2MQCA 1NCAH 2XETA 2NLJB 2YPLB 3DXAB 3MNWA 3QFGA 5F9AC 1TJHH 3PJNA 3E1ZA 2NXZD 3OLDA 2W07A 5T3ZE 3SDDB 4K94H 2X4RA 3ARUA 2AV7B 4L37A 4Z7OB 4OLVL 4PRHE 2QQNL 5F6IB 1INEL 4OT1H 3Q48A 3VW3L 1Q9LB 2JTYA 4PJCB 3VX1A 1Y18A 5AVSB 4I0PD 2Y06L 1QVOA 2WTPA 5ITFB 5IJDC 3T0BA 2I21A 3K4DA 4I77L 3V0IA 5AW4B 1R3IH 1FYTD 4NM4L 1NANH 4D9RE 3PGCB 1Z9LA 1I8UA 3VG0H 2BCKB 1TZAA 3T2NH 3QEUA 3DPBB 1H6UA 1A7PH 5L4JA 1BQHA 1FBKA 4NQEB 4WZ9A 2KLRA 3UEQA 4J39A 1U3YA 4F8NA 4JGUA 4XVOA 4XX1G 4LEBA 3RDTA 4FKEA 4X6EB 4AYSA 4J3TA 3Q8EA 1T1WA 3I85A 2XZAL 2XV0A 4XPFL 2VW6A 2G3NA 4YH6A 4E36A 5I5IA 2FEJA 2YGPA 1U2YA 5CAYB 4AH2A 3JWNG 2GQHA 4PS8A 1DLFH 3QEHB 4JR9H 3FU3A 5EFIA 3BXNA 2G0LA 1GPOH 2B3IA 2F1EA 3NCJL 5F3BB 1R24B 1RUKH 2VZUA 3LMJH 4LCCC 1RJZB 2LQRA 1TO4A 3T2OA 1NCBH 2VR5A 2QTEA 3TWYA 5IEKA 2VC2B 3Q9QA 4LRNL 4PRID 1CFVH 1A3LH 3U4BH 4E9XA 2I9LA 1XF4B 5I8KL 3PHAA 2CO7B 5IOKA 1ULVA 5F9WB 3VGFA 4N8PA 4ZFZB 3SJVB 2IANB 2D2CC 2V2WB 4P23B 2OR9H 3DURA 4GKLA 5HHMD 2J8HA 1U6AH 4ZUUA 4K3DL 4WW1B 4I3SH 3J2PA 2YUWA 1RK0A 3MKGA 4PRDB 1ZRUA 1HHGB 4Z5RA 4KKQA 3TIDA 1U30A 3F6LA 3U2IA 5IEHB 4BGLA 4UQCA 2YAEA 5FYKU 5EUOA 3WKMH 2AEQH 2Z35A 3K7UA 1EX0A 4ENEC 1QNZH 2BVPA 1T2JA 4WI5A 4EE2A 3CZSA 1LVEA 1HU8A 1E4XI 3ETTA 5B7FA 1ZVNA 3P30L 4R4BB 4BCZA 3KPTA 5D1QC 4RZCB 1HJBC 4TLUA 3B5HA 3ARXA 1UB5B 2GSIB 4MYPA 4IRZA 3G5XB 4TL5A 1X5IA 1X5KA 4XXCC 4U31A 5A2AA 2SODB 1MRDL 4N87A 1NCWH 5K9QI 3LKNB 2CIKA 1DJGA 1QSFA 3QK0A 3SGDI 4PJ7A 1BEYL 1XCTA 3R7QA 4GBXB 4PJHB 2YXFA 3CDFA 1HYRC 4ZW5A 2B77A 3VXRE 4JANB 5FUOH 1HNGA 2A7BA 3O3AA 3TBTB 4YBLB 3VTTA 3B2DC 3HAPA 4PJEF 1I8LC 5DLLA 5CJQL 1QWHA 3SKOA 3UIZA 5IESH 4NCC1 1P7KB 1QFWI 4PGBB 3E3QC 4QPEA 1HYSD 5KZCB 5DJ6A 4JPVL 1AANA 5E24E 5EIQA 3CVHL 3DROA 2HJFB 5IBTL 2C3WA 1ZVYA 3N41B 1GC1C 3W82A 1FL6A 5D5MF 4F37F 2NR6C 5ENWA 5ID1B 2CBPA 3C2SA 1CBVL 3TCTA 1H8SA 3KW7A 1QKOA 3GRGA 4PP1C 1EDQA 1S9YA 4N8UA 4X8JB 3RUGE 3V4VL 2QFRA 5A2IH 1VKXA 4EZLA 3CGTA 3ZL4H 1CGVA 1DO5A 3UG3A 4PGEB 4HIJB 4J4PD 3TO4C 35C8L 2X87A 2F7RA 1SOKA 5C6TH 1PNDA 3E0GA 5JORB 3IRCA 3CSPA 3L5XH 4TQIA 5CINL 3SPCA 5KANI 1XR9B 3U2SB 2IPKA 2EDWA 4DQAA 1L0YA 4XCYA 4BUGA 5BR2A 1CIDA 3VFNA 4JRYD 3OLEA 3F6IA 3CQFA 3Q3GA 2ZCZA 4PTUB 3LIUA 5B22A 3E8VA 2YR3A 3D52A 3VDCA 1KG0A 3ULVF 4JFFD 3B8YA 3HR5A 3VXSE 3Q1EA 2CXGA 4ZFOL 1F42A 1GJUA 4NPKA 2G0KA 4QKXB 3ULVD 1HHHA 4PY7B 2WKOA 4K2UL 4K5NA 2JB5L 2FSEA 5F7EL 3G6JF 3K4ZA 2P8PB 4AV5A 1L9TA 4HJGB 3JWNC 4LRIC 2VJXA 1TETH 3QEQA 4X7EC 3MV9B 2J1KA 3NP3A 4DGYH 5HYQB 2GKIA 4FYRA 5GS0D 2Y2WA 1USQA 4P9HL 2E46A 3CU7A 5DVPA 1ZLUK 4WUUA 2EO9A 2EINB 5T1MA 3B2VH 4QF1A 3FCTB 3LVEA 4FLQA 4KTEL 3OKEB 3BD4A 5CEXA 2Q1EA 4JB9H 1MJ8H 5KYYB 4OAWB 1PFCA 3LH8A 3RU8L 2QFPA 3MR9B 4NQCD 3QDGB 3K2IA 3VWJB 2V7HB 4DTGH 1P69B 1WCBB 2UVEA 5G55A 3BUDA 5EPMB 4G70B 2QQKL 4NKIL 4L9DA 3GIVB 5GGRY 3QZWB 3OD3A 4HW6A 5LCVA 4QI3A 5A1AA 1G6RB 3QPXH 4QRSB 5G4MA 2I24N 2HJKB 5KVDL 2JCWA 4HULB 2OJEB 4XN9A 3BPOB 4RMVA 3UTVA 3SD5A 2FQFA 1BXVA 3B7TA 3BH4A 3JBG7 5B1JC 4M1DL 1J86A 2XQYA 1N8ZA 3KBFA 4Y16D 2BVOB 1U3ZA 2R2BA 5EH1A 5KVGL 1OF2B 2Z92B 4R97C 4CVXB 3U9PH 4AQ1A 15C8H 2ZONA 1BD2A 3VI3B 4GFXA 4X9FA 3REWB 2V3FA 1FVDA 1HH9A 1WQVT 5E9DA 4JQIL 4ONHA 2CLZB 4A55A 1TFPA 3LIZA 5C97A 2D4FA 1KNOA 3VXME 4AEIH 2IWFA 2OJ1A 3SPVA 3MOQA 3MV7E 1BQLL 3EDFA 3BSZL 1S7QB 2ZSWB 3EOAA 1Y07A 5T5FL 3VXNA 1CQKA 3DIVA 4Y1AB 1MXDA 4UQDA 1XGTB 3RBSA 5MP6H 3MLYL 3JV6B 5I75B 4FXKA 3CAPA 4O2EA 1FUNA 1T1YB 1U8CB 3CDZB 3QCTL 3NIGF 1KCKA 1R33A 5HHOA 4GT0A 1OAKL 5HVGB 1UACH 3G5YB 3TF4A 4WI2A 5F7BA 3HE7B 1OO2A 2OCCB 4JLRB 3B3IA 5JXAH 3G5ZA 4PLKD 5E8NB 2ARJB 3HMWH 4IHBA 4UT9L 2DYPB 2LFEA 3P9WB 3TT3L 2XTJC 4Z7NB 1QO3B 2BFVH 1N59A 3OSVA 4G6JL 1LO4L 4LLYA 4NO5B 3IKKA 3A6OA 2X1WL 4PJGE 3F62A 5K93A 1IKNC 4K3EL 5EOCL 5T8IA 1XGPA 5L4IA 1YMHA 2WXJA 2YPVL 2H6PB 2GAZA 4NC1C 3FB5B 4ABVA 4FQ1H 5I18H 5EULV 5DR5H 1T03L 2XIBA 4P5TD 5D4IA 5CUSL 4AX3A 3MNDA 3O9WA 3MLRL 3WS3B 3HNSH 3K71B 3W39A 2FEEL 3CNKA 4R0LA 5CGMA 25C8L 3MRQB 2JAFA 4O02H 3KJ6A 3RY6C 3GEWB 4JFED 3ZRCC 1MHCB 4OW6A 3NIFE 3REVB 1T0NB 2ATKA 4KDVA 3V5DB 1DUYB 1KB3A 4LSDA 4YXKL 3VGAA 2VQ1A 1KBGH 1CYXA 4C47A 4HKBA 1AGFB 3KBHE 2BMKB 3EYQC 3K8LA 4HS6A 5E2JA 4ZG1A 5BXFB 5IB1A 1WAAE 3KYNB 5F7DA 4KQ0A 3ARZA 5J13C 1LO2H 2WBJC 5LJYH 4P07A 3GRWH 4LEXH 1AS7A 1KLGB 2ZXGA 3HZVB 2OP4L 1P1ZA 2MPVA 3MJGX 4WHDA 1LTXA 2FX8L 3X1FA 1KIRA 3IMUA 5FGRA 3L9RB 4ZMZA 4OB5L 1BSIA 5DZJA 2RGSA 5E5MB 2FGWH 1JP5A 5DSCA 5AYQA 1SJMA 3MRFA 1S51A 2IFFH 1E4XH 2YGVA 3MLSL 2EUZA 1MI5A 1OF0A 4TUOB 4JDZB 5FHBL 2VLRD 2F1AA 3OPZL 5EHFA 3Q0HA 1NAMB 1C5BL 3EDKA 4TLKA 5AW8B 4DGIL 4WWKA 3MLZH 4CL7A 1CF8L 4QRRB 5AVQB 3EOTL 2K3TA 4DZ8B 3D25A 3C08L 3VFRA 4FLRA 5DWUH 1OT2A 1LDPH 5ADOH 4KUCF 3SGDH 3V0FA 3EJCA 2FJGB 1MW3A 1Q0XH 1EEYA 2H32A 4KUCD 5FFLA 2F53D 1GR7A 1G9ML 1GSMA 3VA6A 2IGFL 3FT0A 4FQCL 4J23A 2C9AA 5BOPA 5JQ6L 2NMSA 2J88H 1DQML 3VH8G 1QSEE 2EXTA 3RTQA 1FVEB 2Q2EB 4JPIA 1J1XL 5KG9B 1CTOA 1KGYE 2CBTA 4DKLA 3IGAB 2CK0L 5IQNA 1U3HC 5DYFA 2JNZA 1R3KB 3Q8FA 2UUDK 4HGMA 4M48H 3WJLA 4YPJA 4E9RA 5FFGA 5D72L 4LHUA 1TU2A 5GSVB 5CEYA 4YFLF 4QRQA 5JDJA 2Z4TA 4ZT1A 3QUMB 1FL5B 4FLHA 1AQDA 4XO3A 4YGVB 5AKTA 4OCSL 1Z9SB 5E7BA 4JZJC 1W6WA 1UM5H 1ES0A 3ZZQA 4KK8C 2KI6A 4LSUH 2LNLA 1ZPLA 3W2DH 2AKRA 2NX5B 2QR0B 2Y7QA 1UFGA 3FUHA 3F12B 5LAPA 1MFAH 1RFDL 4Y19B 4PCKA 1QPXA 3FTWA 4OZGA 1TMQA 2QJDA 2R0KH 2XOTA 3P02A 3KYOB 1MFNA 1I7ZA 4HFUH 1IKFL 1YVLA 2ICES 4HDIA 4Q52A 2WNGA 1YYML 4HS8L 1MAKA 1LWHA 1Z5LA 4GW1A 5JXEA 2VJ8A 3I02A 3PWPE 3D18A 4LLUB 4GUOA 4I9WD 4WI0A 4KTGA 3E9UA 1W8OA 3LKOB 4TULH 4M7LT 4EBQH 5HY9B 4HG4K 2DQFB 5AD0A 4GEIA 3CIAA 4Y2DC 3WD5H 3GMQA 4MNQB 4IGBC 4DN4H 1XGQB 1FO0A 4QHMB 1TJIL 2DQIH 3H4HA 3O6FB 4UMSA 5JNYB 2APFA 1MAJA 1VEOA 2PLTA 4MA3A 1IJ9A 3T3PB 4A6YH 1BF2A 1QRND 4MD4A 4C58B 5BV7L 2EKSB 4IOSA 5BW7C 2FECI 4X6BA 2HVBA 1YMMD 3ZYIA 2JH2A 1GC1H 1I9IH 5F21B 1GSKA 4U2YA 1FL3A 2UWEB 3ZPDA 1T1ZA 4ZMLA 4C83B 1FFNB 4X6FA 5DT1L 1MVUA 3MO1A 4HWBL 3UACA 4U05A 3BQUD 4ZFOA 5I1CH 1M0LA 1HEZB 3BOVA 1S8LA 1KYDA 1CI5A 4L8BB 1OAZL 4AYGA 1EO5A 4UILL 3I9PA 5HHNA 4AIEA 2AQNA 5KYNA 3VXTA 1FDLL 3H9ZA 4P5SA 3PJSA 3QNYB 5F6IC 1WZMA 2EH7L 4WHYG 4HJTA 3S3CB 1SHSA 1SN0A 2JWYA 1U8KA 4XAKE 1H9DA 1L7TH 5LN4A 2VMDA 4OZ4A 4LFHG 5EU7C 2H9GA 5MHSD 2UY7B 4GXVH 4FADA 4J1UA 4DN3L 1PLGL 4P46A 1ND0A 2YPKA 4KX7A 4E0RB 3DLQR 2YAPA 3GEFA 4GRWB 1N64L 1BHGA 1DBBH 3UTYA 1PZ5A 2PXYB 5DS8A 4EJ1C 4ONGH 3X14A 4Z78A 1I9JH 1FF5A 4NZDA 5GHWL 5HGBB 1IMHC 1JD7A 1D5ZA 4M6AA 3RBGA 2LVEA 5C07B 4UZUA 5DRWB 1E9PA 1FHGA 1ACZA 4HPOH 3V7MA 1NZRA 1RJLA 3GMMB 2J1XA 4J6IA 3VGHA 4LSVH 1ZEAH 4Z7VE 3GHBH 4JPWH 5FUZH 2NNXA 4XOBA 1EUUA 1YNKH 2AJVL 1W72L 4UIKL 5EZOH 3D06A 1WHOA 1U8IB 1TN5A 1PLAA 3Q2WA 1J0ZA 1MFEH 5DEGA 5H94A 4Y4KA 5BRQA 5ERWA 4XMKL 43C9B 3T8XB 2EYRA 2JELH 3US1A 4G43A 2BHZA 4JQIA 1CFBA 3ARGB 3CHPA 3HFML 4ZRGA 3RL1A 4N90E 1YEEH 3ULVL 2IALB 4KLYA 4JO8A 1T3FA 3FK3A 5F9WC 3BSZA 4ZS6C 5T5FA 4F7TB 1ORSA 5C0BD 8PAZA 4R7VA 2M1KA 5E5UB 4P23C 2GABA 1Y0LB 1XF2A 2ZD0A 3T4AA 1W0WA 5SWSE 2W1NA 5JZ7C 3QQ9D 3EJSA 4DKEH 3II2A 1J05B 1O9VA 1CGTA 4LB8A 3AREA 2DBLH 5ITBH 3BVNB 3I6LD 2PPAA 3WMSA 1XF5A 4DVBB 1FNSH 5IF0A 1DQJA 3RIFF 3K6FA 2NQ3A 4EN3B 1MG3C 1CFSA 4RMBA 1ASQA 1QFOA 3SODB 4MQ7A 4UT9A 3C2AL 3P0YL 1YPZE 1HT6A 1DQLL 1K3ZA 3TJPA 5BVJA 5AOKA 3C5ZD 3QQ4A 2DJ4A 1SDAB 2DBJA 4DP6X 1IC1A 2ZNXA 1YEHL 2WOYA 2IH8A 4PJAB 1BZDA 1ZS8A 4EI6A 1MCJA 3B6SB 4JFQB 1JHKH 1IGTA 4LCYA 4NDMA 1KT2A 5C09B 3ROOB 1TQBB 1INQB 4CMMA 2W0PA 3D33A 4LT7A 4GBXC 4QO1A 3G08A 4DPAX 2G4EA 3TA3D 4YBLC 5IW1A 3AVEA 5AVVB 5D1QE 2Q8AH 3R06B 4BEIA 2IADB 4YXHH 3PY9A 3MODL 1IQWH 4MMXB 1DN0B 1OTTC 4UINL 2CDGB 3JZ7A 2CH8A 4N6RA 5C0CB 3V2WA 1A22B 3UADA 4ILDA 4O2FB 3RL2B 4XMXA 5EC1A 3MLPA 2WVSA 5DHYB 1FN4B 2QQLH 4OLEA 3CUPB 4AYEC 3QHTC 1YJDC 2UXGA 5IROD 5C7ZA 2IC2A 2X2YA 4UT7H 3OKYA 5DZNA 5BRZD 1A47A 4HIXL 1FZMA 2MOVA 1H3GA 5CCKL 5IB4B 3PQRA 1WWBX 2AEWA 3ESUF 3KWWB 5DD6B 3QCUL 4LQFH 4W4NA 4ADIA 1CFNA 1S53A 3FRPB 4OGQC 1L6XA 5I1AB 5ICYA 2HFGL 3WU1A 5IGXL 1CLYH 2VXQH 2I1XA 1TSHA 3BEVB 3UMTA 3ARBB 4G6AD 3LRGA