2QPEB

An unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unexpected outcome of surface engineering an integral membrane protein: improved crystallization of cytochrome ba(3) from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 40
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2qpeB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2qpeB02
2FWLB 2BP8A 2GC7C 3COCA 1AZBA 2DV6A 4AI7A 5ANHA 4GY4A 2YQBA 4BV0A 1A4CA 1NIFA 5AHYA 2BW5A 5EHFA 2BWIA 2B3IA 3ZEVA 3X2QB 4MD2A 2CBPA 5B6WA 4BDVA 1FBBA 4DP5X 5C1MA 5AFAA 4Q89A 1NPJA 3V9CA 4MQSA 3CVCA 4HCIA 1J5CA 5TGZA 8PAZA 1SF3A 4YVUA 2VM3A 1IW9A 7PCYA 2FT7A 1S54A 1E30A 1KCWA 1CC3A 1CWQA 4HCGA 2CCWA 2AT9A 4PXKA 1C8RA 3QJTB 1DZ0A 1HZXA 3PAUA 2YDVA 3NY9A 2W8CA 1E12A 5G2AA 1ZIBA 4G7RB 1M56B 2L6XA 5B0WA 1KDJA 2WSDA 4WW3A 5F8UA 3QJSB 5LWEA 1BYOA 1WS8A 3PCYA 2AVFA 3JTBA 4YSCA 4HWLA 1X0I1 4G7SB 5G2CA 1F56A 1VLXA 1PZBA 2GHZA 1M0KA 4HYXA 2VSMB 1JXFA 3NJHA 4W1TA 3NSYA 4KNSA 1CYWA 1MG2C 4G7QB 1UATA 2YAQA 3VHZA 2KSYA 3UG9A 1PNDA 4MFHA 1U19A 4UANA 3UACA 1BRRA 3AG2B 1S8JA 3X1FA 4FAAB 1RKRA 2M3GA 1E0PA 4UF7C 2N0MA 4YL4A 2ZOOA 1KYAA 3QBIA 5H2JA 3TBCA 1OE3A 2TSAA 4YSEA 1MDAA 5G53A 1JFPA 3CG8A 1S51A 2PPEA 3JT2A 5PAZA 4BXSV 2XV0A 3C9LA 3X3BA 1ZDQA 3S3CB 1GY2A 3RYMA 3QPKA 5I6MA 2HZHA 1AP9A 2Q9OA 3NJLA 4BXVA 5TK4A 2YAFA 3AG3B 1PLAA 3CDZB 3WNIA 3NY8A 1KMEA 3HASA 3HB3B 1AANA 4E9TA 1AG6A 1GS7A 1PZCA 1AACA 4MBSA 2J55A 4Y9HA 4DP0X 1JZHA 1L9OA 2LNLA 3GYRA 3OMNB 5I5MA 2FJSA 1A4AA 2PPAA 3UTXA 5B1BB 3D12B 3QJVB 4NB7A 1SFHA 3FSZA 4KNUA 1XB8A 1TEGA 2YCZA 2Y04A 2FT8A 3OQRA 4L35A 5KKHA 4JR8A 1QNIA 2IDFA 4KLYA 1ASQA 1GY1A 1AS7A 5BR5A 3NT0A 2I35A 2F95A 1L9QA 2RACA 4XTNA 5A45A 2P80D 4BEZA 1NIAA 2J56A 3FQYA 3FU7A 3FU9A 1OE1A 1J9TA 5I28A 5FJGA 1AZNA 1AG0A 3TU6A 5PCYA 4XTLA 1JZFA 3T6ZA 3QBLA 3MX0B 3QDCA 2PP8A 5G28A 2BP8B 2YAEA 1ZV2A 3A7KA 3VW7A 3FU8A 3T6VA 3FQ2A 3NJGA 3C9MA 5B7FA 1JVOA 4DPAX 1BRXA 3CODA 3QAKA 2J57A 4F2EA 2G87A 2ZXWB 3SN6R 4L0PB 4BWUA 2FQFA 3DIVA 5F7AA 2EINB 1MZZA 3NSCA 4G72B 5B6YA 5A44A 5BR2A 1XB3A 2VMJA 1V54B 4NAJA 1AR1B 2VW4A 1PZAA 1X0K1 5H2MA 4JHVA 1AAJA 1GUEA 5ETZA 3S8FB 3X1EA 1H68A 3PQRA 2HRHA 5B1JA 3ERXA 4QRYA 5B35A 3EH4B 3H4HA 1MG3C 3OAXA 2JAGA 2DYRB 3UZAA 5I5IA 4XT1A 4E9RA 2B08A 1PF3A 5AZDA 5I6KA 1OCZB 3UAEA 1BRDA 4DPCX 3RFMA 1AZRA 3HARA 1BYPA 4DP4X 3NS0A 1WS7A 2PP9A 3VGAA 1GSKA 1Q5IA 4N4WA 1QLEB 2UX6A 3FSWA 4KNFA 5H2OA 1JOIA 2BP0A 1XMEB 3WG7B 3V2YA 1GS8A 2IDUA 1NIEA 2Y1AA 1PY0A 3ZBMA 2X87A 4AKPA 2YCXA 3OE8A 2PCYA 4A2FA 1AIZA 2YAOA 1GYCA 2CUAA 3ABMB 1JVLA 1ZDSA 1N68A 1P8UA 4FPDA 3ABWA 4HAKA 2BRDA 4LDOA 1X9RA 3KW7A 4YSOA 3UGEA 3KJ6A 1M9WA 2NRDA 3NP3A 3IN0A 4DP8X 2NTUA 3OE0A 5B7EA 1UCQA 4JKVA 3S8GB 1L9PA 2XLLA 3GDCA 4GBRA 1IUZA 4DP2X 1SF5A 4TXVB 3ZIYA 3AYMA 2OJ1A 5E9NA 1J5DA 3SBRA 1J9QA 3HAOA 1FBKA 1TKWA 4DPBX 1SHXA 4KO9A 3QBGA 4AMIA 3G5WA 4XXJA 1A65A 1RCYA 2ZONA 3FQ1A 3OE9A 4P5RA 4PXFA 2AZUA 4HALA 4DP7X 2DY2A 3PXOA 1JZEA 4L6RA 5B34A 5H2KA 1KV7A 4LDLA 1NWOA 2GBAA 2HX7A 3AG1B 1WA2X 2RH1A 1HAWA 5F7BA 1A3ZA 4BK5C 4BWTA 1W6LA 3VI0A 1TU2A 5EN0A 5H2LA 4A4MA 1ETJA 4E9QA 2UXTA 4FBZA 4GPOA 3S3DB 3OMIB 1PLCA 3WKQA 3U25A 5B6VA 1IC0A 4YSQA 2QPDB 5AWZA 1GS6X 3MBWB 5D4HA 5TK2A 2XV2A 1BXUA 3HANA 5G54A 2AZAA 4A2GA 2W88A 3S3BB 3IEAA 4A2HA 4CSZA 4A2EA 4F7KA 2CJ3A 1KDIA 2DWTA 1HAUA 2XYBA 1ILUA 1GU8A 4PCYA 2XXGA 5H2IA 1PXRA 4KO5A 4G70B 3OD3A 4WAVA 4GYBA 1M57B 4N6HA 5B7MA 2R4RA 2ZZLA 3QJRB 1PY6A 4LDEA 2FQGA 1A8ZA 1QHQA 4EJ4A 2QT6A 1OOWA 4UHRA 3FYIB 2AFNA 1JXGA 3FS9A 1QKPA 1ILSA 3QBKA 1JZJA 3ABKB 1PMYA 2F93A 3NJMA 1AZUA 2BW4A 4YSTA 4AKOA 4GYCA 3CAPA 1SNRA 3VVKA 2HX8A 1HFUA 3MBVA 4RH4A 3ZPQA 3IBOA 3SBQA 3T71A 4IAQA 5JJEA 1NDTA 2BHFA 3ZX1A 1URIA 1SDDB 2R7EB 6PAZA 1OE2A 3FSVA 1IBYA 1KGYE 3RZEA 3T6XA 2BO0A 2I20A 4AX3A 7PAZA 1FA4A 1AZCA 2Y03A 1PNCA 2MTAA 3WNJA 1I53A 4DP6X 4YSAA 4GP5B 2IDTA 5H2NA 3VG9A 2E86A 1BQRA 1MGYA 4MD1A 2GB2A 4X1HA 5AX1A 2DWSA 2GIMA 3IE9A 3T9WA 2IDQA 3N55A 4K5YA 1ADWA 3AG4B 4KO7A 2YXWA 4HYJA 4BWWA 1BXVA 1IXFA 1VJMA 4XT3A 1UAZA 3L45A 1TN5A 4GP4B 1F88A 5G2DA 2PPFA 2EI4A 1KCBA 1YLBB 2FNWA 3EHBB 1S53A 1ASOA 3FU7B 1Q5JA 3CZUB 3NSFA 1AT9A 3OMAB 1PXSA 1XB6A 1KG9A 2GC4C 2IAAC 2PP7A 3NJFA 2HPYA 2IDSA 1KBVA 3QAPA 1DZEA 2UXVA 2VW7A 1WAEA 3N2JA 2WO3B 3NJJA 4EA3A 2I7SA 1E5YA 3TBBA 4XTOA 1P8HA 3D4SA 3PAVA 3AW5A 5I26A 3ZDWA 1L0MA 2YDOA 2ZIYA 3REYA 1PAZA 2QDWA 1BM1A 3HEIB 5I6PA 3AY2A 3UAAA 5ITCA 2EIMB 4QKTA 2BWDA 3TA4D 4ENZA 2H47C 3ASOB 3ABLB 4WTQA 1IKOP 2YAPA 3SBPA 2WJKA 2KSAA 5I5JA 3AM6A 3DDLA 1KBWA 3T45A 3NYAA 2XV3A 1F50A 4IARA 2Y00A 5AKRA 1PLBA 2IWEA 4HHGA 3V2WA 2YXVA 2VW6A 2HXAA 1JXDA 2JKWA 1EZLA 1FFTB 4NC3A 3X1BA 2VM4A 5DHHA 1CURA 1JV6A 2CAKA 2WO2B 1NIDA 3V9EA 2QPEB 3ZPRA 1JZIA 1SHWA 1WA1X 4BVNA 3TASA 3UADA 1AS8A 1X9UA 1BQ5A 1W6WA 2IH9A 1R1CA 2IWKA 2FQEA 2HX9A 1J9RA 2XUWA 2VSKB 4AZUA 2OV0A 3PPSA 1NICA 2WJLA 3X1GA 1PCSA 2HLEB 3CVBA 4GRVA 4KO6A 2KS9A 3C75A 3WKPA 5JJJA 5B1KA 2UXFA 4DP1X 2PPDA 5D4JA 3CVDA 4X4KA 1T5KA 3X1NA 1NTDA 5B6XA 2DYSB 2PPCA 3UONA 2ZFEA 5H2PA 2UX7A 2YARA 2PLTA 4PAZA 2P80A 2R4SA 5A8EA 1C8SA 5JJNA 1NPNA 3NJNA 3SQRA 4G71B 3ABGA 1WA0X 1OV8A 4X31A 2JXMA 1A4BA 2Y69B 5I6LA 4EF3A 5H2HA 1QHJA 3H4FA 5B2NA 5D4IA 2YCWA 5B6ZA 2BZ7A 4HHWA 6PCYA 3NSBA 1JZGA 3AZUA 4BDVB 1AOZA 3ODUA 4BWBA 1LN6A 5AX0A 3IN2A 4GXFA 2BP0B 1CYXA 1N70A 3ASNB 3H56A 2QDVA 1V55B 2XU9A 2Q5BA 4UAHA 1SDDA 2R7EA 3NJIA 4BUOA 4DAJA 3EH3B 4A68A 3KW8A 2X72A 2Z55A 3OE6A 4TL3A 2X88A 3QJQB 4KNTA 3QJUB 1E67A 4CSPA 4KOCA 3WI9A 1V10A 1S52A 4JQ6A 3NJKA 4HCFA 5DHGA 2YAHA 3BQVA 3FPYA 4DP9X 1AS6A 2A3TA 1GW0A 4WKXA 4FA7B 1IBZA 4MQTA 2AANA 2TSBA 2EIKB 2JAFA 3HAPA 1L9SA 1F4ZA 4AMJA 3NP4A 4A67A 1NWPA 1AQ8A 1XIOA 4A2DA 5LDUA 2I7OA 4BEYA 4QIDA 4EIYA 1SFDA 2HRGA 2ZWNA 3OM3B 3PLYA 4IB4A 4UG2A 3AYNA 3DQBA 3UZCA 1ET7A 2GSMB 2XX1A 3DTUB 2UXGA 4J4QA 3FYEB 1S8LA 1BAWA 2J4YA 3NSDA 4YSSA 1J9SA 2GI0A 1NIBA 4P5SA 5I6NA 5IY5B 1H2SA 2JFCA 2H3XC 1BQKA 3HAQA 1OCCB 1ZIAA 4KOBA 1SJMA 4E9SA 2EIJB 3UTYA 4F2FA 1TN0A 3X3CA 3PBLA 4GP8B 4K9JA 5G36A 2I85A 3NYKA 5B3SB 9PCYA 4HZ1A 4N8UA 1FWXA 1TEFA 3FT0A 5ITEA 1RZPA 2FTAA 4JKNA 1P8IA 2XVBA 2IH8A 3PDSA 3FPXA 3PAZA 3UTVA 2XXFA 2NTWA 4A66A 3P0GA 2OCCB 4JHUA 5B1AB 2FT6A 4M3HA 2MRYA 1VGOA 1ZPUA 1M0MA 4YSUA 3PWHA 1L9TA 4YSRA 1GR7A 1NZRA 4ZK8A 5DYSA 1B3IA 1BXAA 2PEDA 1OF0A 1ET8A 1ET5A 4W9ZA 1R2NA 4YSDA 1R84A 3QQXA 1MZYA 1L9HA 2CALA 4E9XA 3EH5B 2FQDA 1RZQA 1JV7A 1XJIA 4YSPA 2LLNA 2KSBA 1QM8A 1BEXA 1OCRB 2BZCA 4HIPA 2Y02A 2PCFA 3UABA 4QLWA 1W8EA 1E65A 4M4RB 1C3WA 3EMLA 1JERA 5J7AA 4DJHA 2VN3A 2XWZA 3FSAA 4NERA 4YVNA 4QI1A 4E9VA 1JGJA 4DKLA 3WQJA 3DKHA 1M0LA 1IW6A 4AKQA 2XX0A 1ASPA 4E9YA 1KGBA 2J5WA 3CDZA 1EHKB 2I21A 2IWFA 1CUOA 1NINA 3EF4A 2Z73A 2YCYA 1L9RA 4OV0A 2YAMA 1OCOB 1DYZA 3BVDB 3GXUB 3PXLA 5AZUA 3T6WA 2H5UA 3UTWA 3WIAA 2EILB 5AHZA 4X32A 1E5ZA 1ID2A 5B1JC 2VT4A 4Q8BA 1GZMA 2Y01A 1QKOA 4E9WA 5A7EA 1X0SA 2I1XA 4N4YB 5FC9A 1O0AA 5I6OA 1KG8A
chains in the Genus database with same CATH superfamily
1WJ3A 4GQQA 6CGTA 1GZHC 3COCA 3CSYA 4Y1AB 1AZBA 2CJTA 1OAQL 1Q38A 2OXHA 3EOAA 3MODH 5ANHA 4GRMB 1HHHA 4D3CL 4BE6A 4ODWB 3VW3H 3SOBL 3VRIB 3JWNE 1HTYA 1NC4A 1J5CA 2J8UF 3DX8A 4EN3D 2R0ZH 2RB8A 5L7XH 1FVEB 1A6PA 1EHAA 2EIDA 2P5ED 5BVPL 3VACA 2J12B 1I3UA 4KVCL 5F88A 3MUUA 2CRZA 2VDPL 3B1UA 4OB5L 1CFQB 4ONOA 1YDPA 2YA0A 4WKZA 5C0JB 5B0WA 2O6DA 5C92A 2AV7B 5CZVH 1AJ7H 1DVFB 1KJVB 3ARRA 3QG7L 4GSXA 4ODXA 4YSCA 4GRLA 5FM5M 5I2IA 2EDMA 3JYCA 2J6EH 4MCMA 4KNSA 2FJFA 5C70A 2OMXA 4PIRF 4OLWH 3TJEL 1BRRA 3IDYB 1C9SA 3LNIA 3VXPB 4YXLH 2AJVH 2N0MA 1HHIA 2HCZX 5DJ6A 4XOAA 1T66C 2F54A 3NFPA 4BHUI 5K9KA 2CLRB 1U3NA 2PPEA 1VGEL 2XV0A 1V3JA 4NJAL 5HHXH 3K6OA 4Z95L 5I6MA 3FONB 3HKFA 2O5ZH 3HZMB 4BXVA 5KVEL 1WFTA 5FO8A 3EF7A 1DBAL 4XI5C 1GS7A 1HDMA 2X2YA 5D8JH 4DGIH 4XVUD 4HWEL 4X9HA 2LNLA 5FHBH 3QNZB 1LILA 2X7LB 4M7LH 4B60A 1FZKB 3LKPA 3MLRH 1YNLL 5EUOF 1CO1A 3HZKA 3PXHA 4U7KA 3D3VD 3APFA 4KBPA 2BLFA 2OZ4L 3EGDA 1UB5A 1T3FB 4WY7L 4E9LA 2WVSA 3HA0A 3A5VA 2XBDA 5KSVA 2HPOA 1AHWC 2H9GB 2ADYA 3JWNG 1BQUA 1W72L 5FS5A 2A6JA 5M95B 3ZZQA 1OAXL 1RUAH 2F74B 1UD6A 3KWTA 4WUKL 1DJXA 1DN0A 4Z7OB 1JYVA 2KLRA 2WWNA 4AVIA 1U3HB 4LSUH 3MX0B 2OSLB 2UZIH 4ZW3A 1YNKL 1DO5A 3V6FB 3ZMEA 1OGAB 2BVTA 4FQXC 3VFWB 4JUSA 1I8KA 1WBYA 5GJTH 3FQ2A 5BRZD 4C8XA 3MJ7A 3BQUB 1XIWC 4BFBD 4XP6L 4F9PC 2FL5B 2CO1A 1IM3B 1E4WH 4XN2A 2H3NB 5C1MB 1NGXB 4K8RL 5J57B 3F85A 1I1AB 1UZ6F 4X7DC 1EWHA 3D4ZA 4NN7C 3VD7A 1P5UB 2X53A 4NKDB 5BR2A 3BP5A 3QHTC 1UACH 3CFBB 4JE4B 4P48A 5FWQA 4OV6F 1C5CH 4JHVA 4UV4H 3LZQA 1JPSH 4N2AA 4LEOA 5B1JA 4PY7A 3NA9L 3SSGA 1JNHB 4ENED 2YKLL 2ATPB 1PF3A 2HUHA 4TQIA 2R0KH 3L3HA 3ZHFA 1ZT7A 4BSJA 2WLIA 3BIKB 5GGVY 5SWSB 3D2TA 4Z1PA 1BF8A 3TESA 3I9IA 1JOIA 2BP0A 3CZKA 5EF0A 3N43F 2Y4SA 5DD1L 2WIIB 5HGDA 3BKJH 2OXHB 3T0WA 1NH6A 3VTAA 2E7BA 5I66B 2VB5A 5JIKA 1ZS8A 4TVSa 5GS3A 1I9RL 1JPTL 4EAEA 4ENEC 4JFDD 4X8JA 2ZICA 3RX8A 4OLYH 1T66D 2KLSA 3KLDA 1GGYA 2FIKB 2VZ1A 3IN0A 4IGBD 4DP8X 2XIIA 5DS2A 2CO6A 1SJVA 4AQAA 4MCNA 1EO8H 4P9HC 4DP2X 5CFHA 2MOVA 1DFBH 3WAJA 5AENA 3IJHB 1L3WA 3EYUL 3FH7A 2YJQA 2BSRA 3KL3A 3MRNB 4LOUC 3FB5A 3DK2A 4PV9A 3UGXA 2JTYA 3PG2A 4P8QA 5IJKA 2Z34A 3GB7A 2EDQA 3QI9D 3H1ZA 4APXA 5E8EA 3VI0A 3UTSD 5D1ZD 5EN0A 5ANMA 4X5WA 4LT7A 2NLJA 5I1IH 3U9PL 4N85A 3V7AE 3FAWA 1QPKA 5EUOE 2BXYA 1TQSA 4KX8A 1ZLUK 2X0WA 2IPUG 2XV2A 1RHHA 3DPDA 1ONQB 2ZP9A 1QLFB 3K2UH 3FCTA 4JK0D 1HXYA 1IBBA 4HIIA 4ZNCD 4AVKA 2YEZB 5AKSA 2NQCA 3U2IA 2HG5A 1S8DB 4GW4A 3G6AA 4J8QA 3O3DA 5FHAL 5ACZA 1OAKH 3FTSA 2R4RA 4WIQA 5BW7A 3GUTB 3EXLA 2KZ1B 5DD3L 5EZOH 2OQJB 2R51A 1IKNC 4R5XA 1YUHA 1H3VA 4R90L 3ELQA 5F7HA 5EBLB 3GTNA 1W0YT 4OIAA 3TBVA 4FQ2L 5EZJB 3NDZE 4KJYA 4GMSL 4OY9A 4W9GC 3PWPE 5IHZA 3RG1C 2G60L 2Z1KA 3GF8A 3SBQA 5JJEA 3NA9H 3UTTD 2E27H 2DDQH 1SN5A 4O4YL 3RZEA 2IBGA 2XA8L 4LKXA 1DVFD 4H25A 3SE4A 1R47A 4JRYD 4GP5B 5L88H 1CFBA 4X9YA 5F7FA 3HUJE 5FA3B 2ZCKL 3HE6A 2EXWD 5ABZA 1XGUA 2GIMA 5C9JA 4XPAH 5CEXA 5J11C 1AFVL 3EYVB 4HS6B 4R4NC 3AG4B 1Y1UA 4P0DA 5E03A 1DLFL 4XT3A 3L45A 3L3DB 4TSBL 5KYUB 5DK2A 4CU8A 3NCCB 3FO2A 2A73B 1TQVA 3KYKH 3QP3A 1MRFL 5J3HC 3Q13A 3QUMB 2V17H 3FT9A 4I48A 5CEZE 5IQ9B 2IAAC 2H1XA 4ZS7H 4P99A 3LKRA 1IEAB 2PO6A 1ED3B 1WAEA 3CZFA 1Y6KR 2X44D 5AZ2L 4XN4A 4PRID 2ADJB 4M5TA 4OH2A 5DRWB 4JS7A 1QHPA 4JFOB 3EIFA 5HXMA 4RRPM 1ZS8B 2B59B 4J23A 2QVKA 1O7SA 3IFNL 3TA4D 2VXQL 3LDBB 4ZQKB 3DUSA 3F2LA 3VFOB 3OXRA 2KSAA 2MPAH 1DJIA 5KVGE 1LO2L 3QS2A 1CDHA 5DI8B 4O2CB 1MCWM 2NY2C 4N0UE 5TE4L 1UACL 3EBHA 2BC4B 3TGXA 3I6GB 4Y4KC 2VW6A 4K71C 4XP5L 1HI6B 2XN9A 3QR0A 5E8NB 2VN5A 3L08A 5JHDE 2EIBA 4F7MB 3PNWA 4JFEE 5FEBA 4DAGH 1JV6A 4KXAA 3CX5J 3K0YA 4KU1A 3V0GA 2WO2B 4JFDB 2YGQA 3BAJA 2B16A 3BZ4A 3RDTD 1KB5H 1XF4A 1K85A 1CI5A 1WZ1H 3GRWH 3TYFB 3TIDB 2D0FA 3KPQB 5I1LB 4P04A 5EU6A 1QUNA 2B5IC 2VLRD 4C54A 3MRRB 3PWVB 4HUUA 4IOIA 3BIKA 2J6EL 1PL3A 1CXIA 2ZKHH 5B6XA 2WUBH 4NM8H 3UONA 4A04A 2H32A 1NDMA 2BVQA 4Y4HC 4AUUA 4PY7B 3KXFE 2OJEB 3BLKA 2NMSA 2G2NA 4F20A 4HIHA 5D7IB 5I6LA 3TEWA 1BZ9B 3PU7A 3IKCA 3BGMA 3KL5A 4D7BA 3P1VA 1P0SE 3BYTA 4UT6A 1N70A 3IFLL 1GOGA 3MTXA 1CICA 2DIJA 2FWOA 1HYSD 1Y1DA 4ISVB 5CSGA 2ZD0A 1P7HL 1IGTB 2NSMA 3SDCB 5EIIA 2CXGA 2QVFB 3L3OA 4PGZA 1KPUB 5DUJA 2F7QA 1NEUA 1OAQH 3MODL 4QXUL 4FFYH 4UILL 4H1LH 1CZ8H 1MLBB 2A3TA 4KKLD 6FABH 4YC2B 1Q90A 1Q72H 1TJXA 5ADPH 5IVXB 1QSZA 3LKSA 1IEBB 5K9QI 2GJ6A 4AMJA 1LHZA 2OM5A 4YDKH 2LABA 2JVUA 3WEOA 4N9GB 3WBDA 1HQRB 2P42B 1ERNA 3T1WA 4P5KA 5L8KB 1E9OB 1T89A 3V0JA 5IROD 1S7WA 3UZCA 2DWEB 3KLLA 3I3BA 4RGMC 4YSSA 2J88H 5DD6B 1JZ6A 4JG9A 3HI1B 3THMH 4I87A 4KFMA 4HK3J 4NZTH 1CFSB 4MDIA 1MCBA 4NRZA 5E1IA 5FYKD 3HAEH 4MCZA 5B3SB 4DTGL 5E6IC 2PWHA 3QNYB 2R1YA 2E9IA 5L6YL 5CZXC 4C56A 2O30A 2R0WH 3GMRB 4XI5D 2NY6D 2R8SL 4RIRB 4I3RL 4L9LA 3PP4L 1SEBB 5E5LA 2BNRD 4JVUA 3MV9E 1H15A 3LRGA 4YWGL 2J72A 3EJTA 1QKZH 1KFAH 1YDPB 5EBWB 3EZ8A 1RERA 5IMOB 2WCGA 2PEDA 5ALBL 1D9KD 2ZF9A 4L1TA 1CFNA 1I9IL 2J6WA 1P6AB 2IXQA 5E6ID 2IOOA 3OKKB 4RGNC 1O75A 3Q6FA 4KK9D 4ZTOH 3GRGA 3V2AR 1E28B 3ULAB 3L4VA 3T2QA 3UBFA 1QRND 5H37H 4WHCA 4CMHB 3ARFA 3CBRA 4KY1L 1XGZA 2AQNA 1TG8A 2Q76A 1LDPH 1OPOA 5MEOA 4FXKA 1C3WA 1XGQA 5C7ZA 4AQ1C 3EMLA 4LDCA 4ZS6D 1FORH 3BP6A 3PJNA 2P8PB 2VR4A 2B7DT 3T8VA 1N3NA 1Q0EA 4JDVA 4IQHA 4U6YB 1NPUA 2Y1ZA 1NC4B 3DIFA 5AYTA 3AY4C 3SO3B 3V8CA 4U1GC 3R19A 3MYJB 2ICWB 2O6PA 4NZDA 4LAQH 3MMEB 2QJDA 2EDDA 2V9QA 4KQ4L 5AZUA 1CD8A 3CHQA 4N0CD 3LHPH 5FYKU 4LO9A 1AC0A 2XQ0A 3BEWA 3D51A 1JPFB 3T1FA 5GJTL 1II4E 2W9LA 4KMLB 1LO3L 1DANU 4JGUA 4WUUE 5JOFB 2V5TA 3LS5H 1RIUH 2I9TB 2H2SC 1MCIA 4FNRA 1UOVA 3DX9B 5D93B 3VMNA 3DURB 3QAZB 4N68A 4R7VA 2AAVA 4FQ1L 3X2QB 5I15L 4NXSA 3ZEVA 3PDDA 4NJ9L 3CJJA 3GM0A 1NCCL 3LKRB 4N9GA 1G5GA 1JI2A 2CG9X 3FO9A 4HCIA 1QTPA 1OZTG 3ILQC 2C7FA 3C5ZA 1F4WH 4QHMB 4NBXB 1OEZW 2YIHA 4R5TA 1ROCA 2X28A 3BN9C 3OJDA 5HVGB 1E4HA 4MNQD 3WGVB 4S11A 3S37H 1ZTXH 2C1OA 3E9TA 3W5NA 3RURA 3CVIH 5DFVC 5LWEA 2EE9A 3PCYA 2AVFA 5DC2A 3AWFA 4NZRL 3SE3C 1A9BA 4R7DB 5DTFB 5FOBB 5HDQL 2XNAA 3NJHA 4W1TA 3NSYA 4PWIA 3BAEH 4X6CF 3IKCB 3APNA 5AD0B 1UATA 1RZJH 5INCB 3R18A 4NO3B 4PGJA 1WPCA 1IAIM 1WBXA 3NIGF 5C6PB 4OCYH 2P9RA 4JRXB 3HZ3A 1JPTH 3MLTB 4LSQH 3GI8H 1FL3B 5D2LE 4MJ6B 1GOFA 4XXDA 1ZV9A 1RJLB 5HYEA 3JT2A 1QW8A 4BXSV 4F7PB 3B9KC 4D0CB 3IMUA 2HZHA 3FB6A 1NGQL 3QUXA 3PWVA 1EVUA 1KLFA 4HUUB 1KCRH 2QEJA 3FU6A 3UL4A 3IFOB 5IB5B 1ZSHA 3JT0A 1UKQA 2YZ8A 1QQDA 4P2OA 4ZFOB 3ZGIA 1ACYL 2XY2A 4S1SL 5GRUH 4K3JL 1AFVH 1XAKA 1LO0H 3GNML 1F5WA 4G7YH 1GIGH 5D71H 1YPZF 4LPVA 1SFHA 2DLFL 2VR9A 1T83C 4OCXL 4PY8J 1OP9A 4NWTH 4HC1L 1VHPA 2BNUB 3EJCA 2XN9B 5E8NA 1FGVH 3RNQA 5D2LA 3BKYH 1EXHA 2XJKA 2Y06H 2XQBH 1QFUH 1ZLDA 3JV5A 3KLQA 3L1FA 1O6SA 4GI6A 3N50A 2A6KB 2CGYA 2JCWA 3CCHA 3TONA 2GT9B 1AZNA 1ZVHA 3FT2B 4GI9A 1IC7H 1Q0XH 4YC2C 2EUWA 1WAAE 4TNGA 3Q05A 1B90A 3VW7A 3FXIC 1P5VB 1A6WL 4P46D 1PFCA 5IP4A 5GSVA 2QPFA 1EFXB 1DQTA 1PKQE 2WINA 3BAWA 5F7NC 3ZT5A 3S36L 3EJSA 3MNZA 3VM7A 5H94B 4A63A 5LN8A 1IBGL 4L0YA 3CIAA 4B0MM 4NQXA 3VFGL 2XG4B 4JHAL 3R8QA 3VRJA 2VW4A 3ESVF 4PWJA 4CAGA 3ZE1F 2I9TA 3PP4H 2KQMA 3SGKC 4E36A 1GUEA 2IPUK 3S8FB 3DX3A 1JGDB 2YD8A 3JYBA 3RUGB 2O93L 4IDJL 4HG4K 5B35A 3EH4B 3KMDA 3OAXA 1GGIH 2PXYA 1EBPA 3BX7C 4KC3B 1CE6B 4M7LT 2EAEA 4DPCX 3U6RB 4OZGF 3I02A 2X9ZA 1WAAA 3BMVA 3CK0H 2DQCH 3S6CA 4HIEB 4POYA 3GSOB 1YVLA 1N8ZA 3T6QC 2NY0C 3M45A 5C0GB 5MEPA 2B9AA 2WQXA 1EDHA 3DYPA 4UIMA 3O3EA 5CUSL 4AKPA 2WYHA 1D5BB 4S10A 2CUAA 2C9QA 3NCFB 4P9HL 4XXDB 3BRGC 4YHLH 2J8UB 3NCYP 3D34A 4ZUUA 1EHLL 1OGSA 1RIHL 5E1GA 1PX8A 3UG3A 1ZANH 3CFQA 3ZHLA 5EV7A 1CFNB 4ZO9A 4G6AC 4ZUWA 5BXFB 3P0VL 4EMZA 5I19L 2I69A 2R56H 4PRBA 1RJLA 1SHXA 4KO9A 2X2UA 2ZONA 1CF8L 2D7TH 3WOVA 2VQUA 3Q9QA 1DBJH 2E76C 5EUKB 4DFHA 3JUZA 4PPTA 4F8LA 3HMXA 3T4AA 1ZSDB 4F58L 4FABL 5AD0A 3VXTA 2YPVH 3FL7A 5F3HB 1QFOA 3TZVA 5K59F 1E50A 3HE6B 1CIUA 3C5XA 4OD2B 5IMMB 4GS7B 3G08A 1BMZA 4XE5B 4CDHA 4XP5H 3WKQA 4OSUH 2BOLA 3DOSB 5BZWA 1NFDE 1YN6B 3ORJA 3SYAA 5HYQA 2ID5A 4HLEA 3SN6N 2E74C 2IGTA 3Q2LA 3A67H 4A2EA 4NQDD 4KK5D 4PRIB 3SDXA 1R9FA 4GW1A 5J13B 1D7CA 4PM1A 2EKSB 4Y4KB 3MLTA 4JKKA 3QIWC 5FV2A 1G4MA 4MA1C 4PCSA 5CR1A 1HYRC 1NBVH 1B0GA 4JPKH 4L4TB 1L7IH 1TKWB 4OUUA 3VG9B 3QUHA 5HDQH 4XXWC 4CL7A 3TXAA 3DYOA 1BP3B 3W38A 4PS4L 4W81A 4K23L 1N19A 2ZXDA 1U2HA 5B3JE 3MV9D 4TSCL 3U30B 1VPOH 1A8ZA 3PWLA 1IBGH 4IBSA 2QT6A 4K8RD 1OOWA 3RKDD 1QNZL 3UAJC 2E7MA 4K9EL 1YEEL 3VWKD 2E9BA 4BSVA 1A0QL 3MV7D 4HXBL 4M8QB 2ARJB 1SNRA 2VZUA 2BY1A 4D94A 5AG8A 5GGRB 3ZE1E 4IAQA 1HXYB 1SHMA 4AYBA 2X6VA 1XGYL 4FKKA 2VZ3A 3BDYL 1YEIL 1NL0L 2BZDA 3FSVA 4QHNA 1J5OL 3VDBA 3AU1B 2YMTA 1U58A 3O4OC 4ORZC 5IV2A 2MTAA 4HZLB 1A7OH 5FX3A 3NZHL 4AENA 5I1HH 3HC3H 2QLYA 1GHFL 1YC8A 5JHDA 1JWSB 4QYAA 4ZFQA 5JXAH 4FMKA 4F7TB 3VXOA 2EDJA 2YD6A 4YAQB 5J11B 3VXMD 2H32B 2X3AA 1VJMA 1IL1B 4IIQB 4OJDH 2ODIA 4J3OG 4QXWA 2KZBA 1MH5B 2V37A 1S53A 3MVSA 5HHQA 4FRWA 1ZY9A 3HI5L 1FVEA 3MRRA 1NOAA 3D39E 1WUNT 1KG9A 3V7AG 4OZGB 2GFBA 4E41D 2OSWA 5E4OA 4F8QA 4Y5XA 4LP8A 4N2FA 4NGHL 1HZLA 2YFOA 3CSYB 3O81A 4J3OH 4HLJA 1D6EA 3HG1A 3WENA 4UI2A 1A6WH 4B53A 2XZCL 3L7FB 5GGQL 4BH7A 1TQTA 1ZT4A 5DFTA 4X5PA 5FW7A 3EO9H 5IQNA 4JKMA 1BOGB 5E5RB 5J6GA 2WBJA 4GLRH 4PV8B 3UZEC 2OSXA 5E2TH 3OZ9H 2F8IA 4TKWA 5DHXB 2OR9L 3MXWH 4U1MB 2R0WL 1QSFE 1QFPA 3LD8C 4XP1H 1OPGH 5E9DB 5TDNA 3WUWB 5JLZA 5I1JH 2F5AH 3RIAF 1RZGA 4KQ0A 2NX5D 2HXAA 2OL3A 4PRNB 1QR1A 4LKCA 1NBYA 5IJVA 2VIRA 4GW1B 4ZOBA 3RE0A 3X3FL 5A2IH 3ZPRA 3TO4B 1I7UA 4KZDH 1IGCL 2FH8A 3VDCA 4Z7VB 5ICZB 1T1XA 3MV8B 4N28A 1YN6A 4RMBA 1XH3B 1H19A 4OCWL 3QJFA 5AW1B 8FABA 3LN5B 2NY5L 2DBJA 3A24A 4NZRH 5AL8A 4U0QB 4QRBA 2DQGL 4IKNA 4JM4H 5GRJH 1DEEA 2OMVA 3L4CA 4FFVC 4GAJL 3ES6A 4LASL 3H9YA 4RAUB 2A4ZA 5DA0B 1UH3A 4N0UA 3ML8A 4M1CD 3FZUC 4P4RB 3C9NA 4OKVB 3LJ3A 2CUHA 3NTCL 2F18A 2MQGA 2YPVA 5IVXF 3A0OA 2OJEA 4L4TE 3WELA 1T2XA 1UT1A 2DIAA 5IEHB 1JJUA 5KVDH 2JXMA 3SZKC 4NN6B 2VLKE 1QHJA 2X9YA 3CLEH 4PJCE 4BUHA 1NAML 4DSYA 4HHWA 4O2FB 3ULUF 3WNMA 3PHQB 5L88L 3FN0L 1WAPA 4XBGA 3QXAA 4BUOA 4PLOB 1FE8H 1VZHA 1T1XB 4KRPC 3NZSA 4Z18A 2GJPA 4NS0A 4NQUA 3RFRA 3IDXH 1MRCH 3ZQ9A 3MUHL 4XCFH 2HFGH 1N5YL 1NDMB 2BVQB 3SYQA 4JQ6A 1UJ3C 1LO4H 1JK9B 4KI5D 1KENH 2NXYD 4LCWB 4UTAA 5DJ8B 1FI8C 3V0WH 5E9DD 2YC1A 4P3CH 3B9KD 4UQ9A 5CCGE 5AVRB 1NWPA 1AKJB 1E42A 1Q0YH 1SZNA 1OP3H 4JO8A 4HUKB 2ZXCA 3V52H 4PJ5D 4EIYA 2IJ0C 3TYGH 1H0DA 3U9UA 4ALAL 4S2SA 1WIUA 3MCLL 1FNEA 4GQ9L 1D5IH 1BAWA 3D18B 3NFPB 5BVJB 2H3XC 2MWCA 4JR9H 4KOBA 1BAGA 1HZKA 1J5HA 5F9AC 1I3GH 4ZMXA 2P1YA 3CE1A 4WO4B 3OAZK 3FMGH 4ORGB 1EIBA 4ZXBD 3E3QC 5H94A 2XVBA 1J8RA 3AU0A 4JM0A 1AI1H 3BPLC 1ZS2A 2Z93A 4KUCD 5E8DL 5D2NC 5ECJE 2MRYA 2OXGB 3OAYH 2YOCA 2LTQB 1IJNA 3CH8A 4M48L 1L9TA 1GR7A 4E41B 4DUWA 5EU5B 1JD7A 1DQLL 2OAAA 5F7MC 2W92A 1MVFA 2XRAL 5AQ0A 2X89A 4ONHB 5K39A 5SWZE 4EUPH 2AEPL 3ARED 4UV7H 3OAUL 3BGAA 1J0JA 1MVUB 4P4KB 1K2DB 3RPBA 4ZXBA 1THCA 4HIPA 4YEFA 1KPRA 1LO0L 2XDHA 5D1QC 1YMHA 1AQDB 3UYRH 2QHLA 3ARGC 4RMUA 2WIIA 4LPYA 3FSAA 4XPBL 5HGDB 3N1GC 1IFRA 3HUJA 4UQ2B 3IDJA 5CZRA 4AKQA 4ZFOA 2XX0A 3V0VB 4ODHL 4WI8A 5A6LA 1JXJA 4M9OA 3KNBB 2N56A 4N2KA 3T0EE 3GO1H 4MXVF 1ZGLA 1PG7L 4PJ5B 2HLAA 4JFPA 1RI8A 1W72H 2QKIA 2VR3A 5C07D 1ZT7B 3GXUB 5DMGC 4JFSA 3UTWA 3SKNA 4MMXC 3WIAA 3UDWC 4P49A 2YSSA 2DQMA 2VT4A 4N2IA 1P4IL 3EFDL 2NT1A 3E6FB 1O0AA 4EI0A 3U7WL 4XO8A 2Q7YB 1U8QB 4CNIB 3CSGA 5E2JA 3B2MA 4G9DA 1QTYT 4Y9GA 2P7TB 3GLDA 4G6MH 3DDFA 3IU4H 3DC0A 4GY4A 4M6NL 4YE4H 1A4CA 2P46B 3B1TA 3QWOB 1OTTD 4OFYD 4J39A 3ZJAA 4MD2A 3L5WB 3C2AL 4KKRA 4PLKD 1GKEA 1MIEL 3RUGE 3I9GL 3MLSH 1J18A 1C12B 2Y7QA 4MDRA 5TGZA 1KXVC 4NSKB 5C0FB 5IOKA 2FT7A 4RDQG 4IDJH 3P4NB 2X4RB 4MZ2A 3BKML 2R1WB 4LCWE 3OPZH 4ELMF 1HZXA 3KYNA 4OLXL 4NQEA 3NABH 2RMNA 1BQHA 2X70B 4MSWB 2B3RA 1CG9B 2BSTA 4WV1C 1ZCRA 3DO3A 1A3RH 1G7IA 2VDNH 3VNYA 1PDKA 1DUYA 5JIQA 4QRRA 1VLXA 3R0NA 4ZG1A 4U1NB 5KBMA 2JQZA 3UEZA 1RJZB 2P5WB 2WWMC 3M1OA 4AGLA 2X6UA 1VPOL 3IM1A 5T3XH 3VFRB 5DQ9A 3WLBB 3T8XA 3LZRA 5IF0B 1TQUA 3ZUCA 3N43B 4AT6A 3AB0B 4OIFA 3C5SB 1RIHH 5D96B 5ICYA 3R4DA 4YSEA 1B2WL 2WCSA 5HJBA 5AAMA 4FLHA 3TS8A 3PWUB 1V7NL 2IO5A 3O6KL 4MMYA 4G7VL 3ZRFC 1FFPB 4ORGA 3SPCA 3OX8A 5DUBA 5TK4A 3AG3B 3VI4A 1L6ZA 2OI9B 1WFOA 1HHJB 4UIKL 4M4PA 4YXHH 3CU1A 3JSSA 3D7PA 2WB7A 3I3EA 1NSNH 3RWJA 3VD3A 4N87A 5K39B 3GBEA 4E0RA 4XCFL 1N5YH 2NYYD 2PXYB 3A6OA 4RMRA 2FJSA 2ZG2A 3U4AA 5SWQA 4GG6A 4QOKB 2RGSA 3IDMB 2VDLH 4ELKA 1NBQA 2XG4A 4KNQA 4FZ8H 1IX2A 3FQYA 2AQTA 4K5MA 4L18A 1P1ZB 4OQTA 1HE7A 3H9HA 3PFUA 3RY6C 2WQUA 4IOFC 2PTUA 1DL7L 3UP6A 5CAYB 3B43A 3GTVA 4JO5A 4LRNH 4EJ1C 3VJ6A 3I9AA 4QAWA 3MRKB 4CVZA 2EDRA 3T2NH 5C0EA 3NMEA 3O45A 3L4YA 1FFOB 4N6QA 1GMEA 4XBGB 1W15A 3EW3B 3LS5L 3JWOH 2QV4A 1OALA 3W56A 4C56B 1CFVH 3LXAA 1WLHA 4GBXC 5GS0C 4WDIA 2MPAL 2X4PA 2X41A 1QRNE 4PS7A 1OAUL 2OULB 3OPUA 1OM3H 2E0PA 4WO4A 1AR1B 4K94H 4MVBC 4Y1AA 1DFXA 3QQDB 4KQ3H 4PW9A 4PMEA 3DBXA 1H68A 4H8VA 2J43A 3D18A 5GGTL 2CLZB 2F9BT 5I5IA 2CDFB 4Z7WF 1G9MH 1S7WB 1YEGH 5AZDA 5I6XC 2KZKA 3S37L 4FQIL 5EFIA 3VYPA 1AZRA 1BYPA 1VERA 3HE7B 4GRWB 3U4BH 2A74A 5E1HB 2VDNL 2E5EA 4I89A 1Q5IA 5AW0B 1QLEB 3I85A 5H2OA 5I30L 4R4BB 1QTSA 5D1QD 3V2YA 3MA7A 3QRBA 4JM4L 4AW4A 4NLAA 1N4XL 2R69L 1NIEA 4W9LC 4BQCA 2ZUYA 2WLHA 4A2FA 3GBML 2W07A 5CNHA 4X9GA 3W11D 1RIVH 5ABDE 5IM7A 3P11H 1J12A 3NACL 1X9RA 3KJ6A 2NRDA 4LFHG 2V2WA 3KYMB 3T65B 3G08B 1KBPA 3WNLA 1UT9A 3LOWA 3HZVB 5J5EA 5TFSL 2H9GA 5CWSA 1AD0A 3DV6B 3KPOB 4I85A 5CO1A 1MRDH 2YGVA 4Y5YC 4ODTH 5C09A 2KPWA 3AADB 4YDLC 1WK0A 3U7WH 2HKAA 2C9UA 2ZYHA 2WOBA 3LN4A 3Q9PA 4PJ8B 2DKUA 4DGWC 3ILDA 3LQZA 4DQAA 4FFZL 3NN8B 4M56A 1KUMA 1Q4NX 4I1RA 2FIRT 4OF8A 2H1PL 3ZY7A 1TU2A 2UUDH 5EO1B 2JJUA 5H2LA 5H35B 2E3VA 2PYFB 1CMOA 1QUNB 4WI3A 3F5WA 3R4RA 1KSRA 1RZKC 3NJVA 4M7KH 4PQXA 4XHQA 3S96A 5AOIA 3VD2A 3HC2A 1BFVL 4QEGA 5B6VA 1HNGA 5C0ND 1MJ8L 1IILE 3MBWB 4QOKA 4QUOA 2IBZX 1G7MB 1XD0A 2WXGA 3SDAD 3ALXA 1SBSL 5C08B 3ROLA 4Z0XB 3WE1A 5CEZD 1MFDH 3T3PB 5C7XL 5DA4A 4U3XA 1VACB 2X2HA 3DMMD 3VI3F 5FK9A 3GRWA 3US9A 4UDTA 4G70B 5C09E 1FLRH 1RZGB 3BAYA 4MWFA 2X38A 3QUXC 4N6HA 2H0FA 1TTFA 1O0VA 3ZRSA 4PS3A 4FL4B 1VENA 1YPZE 2WOYA 2VJXA 1RZJL 4R26H 2UVEA 1Q9WB 1QHQA 5BZDB 2R4SH 1SYVA 1I1YA 3FYIB 4G6KH 2KLTA 2COQA 2AFNA 2NW2B 4L4VE 4WWOA 1OM3L 4MAUH 4UTBH 2NOYA 4JFUA 5CFAA 4JFWA 2N1TE 3DJZA 1IFHL 1ORSB 2DTML 2ARJA 4I1PA 2L7QA 5IUCA 4RH4A 3IBOA 3MLXH 3RZCD 4PREB 2AK1H 2VDMH 3F6LA 3QWRD 4DUVA 1U91A 1IT9L 1DQLH 2ERJC 1MWAH 3WMQA 1HCYA 4QXTA 4EBQL 4OZGA 3MREA 2V2XA 4FERA 1G94A 4H8WC 4FQPA 2WJ7A 3IAQA 5HD8D 2E7DA 1BQRA 2L7JA 4LLMA 2NY1D 1JSYA 2W59A 4HH9B 1P84J 3L4WA 4MZRA 1S9YA 1CB4A 3HI6L 4JLRA 2WGXA 1UASA 3O8XC 1OQXA 4MMZC 2XXMB 2NW3B 3NA4A 1BXVA 1A7RH 2R0LH 4V33A 3CC1A 3MRCA 1MCHA 2B20A 3OGCB 2AJ3A 4RMTA 3G5VA 4XMUA 1E90A 1F4YH 2GY7B 3QIUB 2WP3O 4FFYA 1XGUB 3LPOA 4IGBB 1AR2A 2NY7H 2IDSA 5E8PA 1WQVT 3QAPA 1S78D 2R1YB 1U58B 1BECA 4H25B 5EU7E 2QADB 1G7QB 3AC0A 2P5EB 1I4FA 4LCCB 4XPTL 4HK0A 2EZ0C 5HVFB 5F8QC 4OZGE 4QDGA 4K8RC 3H9SE 1EVTC 2CIIA 4OVUA 2QDWA 3ARFC 1R0AH 4WCYL 1MF2L 3RWHB 3PQYA 3QHZH 4P59H 4F37K 3HS0C 3PRZA 3ATEA 4OZ4B 3BPNC 4LSSH 3WJMB 4PBVC 5EDXA 1V3KA 5BS0A 3S3SA 2YRPA 3S5LA 2Y7SA 1Z3RA 3FF8A 2O6CA 2D73A 4XCNA 5D7LD 2ADGA 1J1PL 4R7NA 2LFEA 3QZNA 3E8UH 1IAII 4CGTA 5B4MD 1W72A 2HLFD 4A2MA 3K8KA 2EYRB 3GSRA 1L0XA 4NT6B 4OTXH 4FG0A 4R3SB 4D9RE 3PABB 3BLBA 5KS9A 1X9UA 1KPRB 3EDEA 2FQEA 2NY6C 2ZCHH 4XZUA 1NICA 4LEEA 1NJ9A 1R5WA 2VR6A 3RIFK 3WUWG 4L1DA 2FR4B 3TVMB 4UCFA 1FNSL 3N41F 4YDVA 4HBQA 1VIWA 3LB6C 4PGEA 4MA3A 4HJTA 4FQCH 1FYHB 3MN8A 1UA6L 2VN6A 3B2PA 3CLWA 3I6LD 2KHAA 4FFWD 5FUOL 4QYOB 1FH2A 4JHZA 5DMGD 2J7LA 3T0XA 2IF7A 1NLDH 1UQSB 1XR9A 4K7FB 2B1OA 2FGZA 1L9NA 1ZA3A 2BZ7A 3NSBA 5HHXL 1NUGA 4S1RL 3NJIA 5FGCB 3G5XA 1OARL 3QH3A 4KMTH 4C57C 3BVUA 4LVHC 3STZA 4XPAL 3K6IA 1AP2B 2CO4A 3E1F1 3Q5TA 4CSPA 4KRPB 2DZEA 5DHGA 5CHNB 1T7WA 3F7VA 3EUUA 3HS0A 1BJMA 3SPHA 1JS4A 4GEJA 1K2DA 5DHYB 1MI5B 2BHUA 3I6GA 3NP4A 2ICES 4K7PL 5I1CH 5ENWB 1DVYA 3SDXF 5MENB 5KZCB 2JQAA 3CUPA 3STLB 4GFTB 3ZTJG 4DKFH 3QXTA 5FYLE 4E41A 1KN2L 2W95A 5GQBA 2A9DA 3SCMA 2K6YA 1OGAE 5FO7A 3T0BA 4HKBB 3CFCL 4AM0Q 4OGXH 3SZ6A 1YECL 3BEVB 2PYEA 1NFDA 4BFEA 3B9DA 1I8UA 1QATA 2XFXB 4PLKC 4YGAB 2PW1B 1XL4A 3DX2A 3T0EA 2PYFA 2P5EE 3VSUA 3QUXB 5JA9A 2GK2A 3ZTJH 5B39B 4QF1B 2H3NA 1DBMH 3DSFL 4G8EA 3AUWB 2FK9A 5D2LB 4DHLA 1IAKB 1GZQA 2VRAA 1KNOA 4DVBA 3P0GA 4ETQA 5IR1A 2GYSA 3MV11 5GGTA 1RK1B 3MPCA 4MB1A 1ZEAH 5D7HA 5KYWB 5KG9B 5KYYB 3QDJD 3ZDYB 4OF3A 1Q1PA 1YEIH 3UTTA 3KGTA 5DD0H 1KB5L 3UPCA 2WHVA 2LVEA 3IJYA 1ET8A 1EV2E 3AROA 2RIKA 4E41E 4F3FB 5FO2A 5C0FA 7FABL 3MGTA 4NRZB 4WF7A 4ZUVA 1I85C 3C8KB 1TCRB 2DOCA 1I9EA 4ODUA 2UY6A 1U4EA 3ECUA 4GEIA 2OJZL 3QI9C 3G5YB 1SDYA 2Y07H 4G9DB 2IAMC 2YA1A 5TPWL 2MQ3A 2ZTBA 4LARH 2H0EA 5FM5O 1GCFA 1T03L 1WD9A 4EIBA 3TBVB 2ADGB 2B1AL 4R7NB 4UYQA 1QFUL 3KR3H 2I21A 1B0IA 2NX5E 5HBBA 1RZJC 3OL2A 1INQA 3ZGHA 2IAND 3BVDB 4R4FH 4HOXA 2KT6A 1XWVA 3UTZB 5KBNC 5ESAA 4LSUL 4CC0A 4HJSA 2VLJD 2CLRA 1YA5A 1WS8A 4Q9QL 4JFYA 3RWEA 1S5HA 4P3WA 2DQIL 5I82A 4HJ1A 4YHOL 1X9LA 5KWYC 1JHTB 5DEFB 3V4UH 5L9DH 4RNRB 1HCZA 2NXZC 5FA4B 3QC6X 3VB9A 1SJEB 4N22A 4WU5A 1ZLWH 2CBPA 1HSBB 3RGVC 2OMUA 1LJMA 1XGPB 3PUCA 3BSZL 4Y2LA 1AO7E 5E8PB 3U36A 4N2OA 4UNIA 3NIDB 5EUOB 3IJ8A 4XN9A 1RAMA 5E4EB 3EJYD 3GSXB 1IW9A 4QIRA 3PJLA 2D3JA 2B4CC 4KRNA 3HS9A 1IBFA 2WLMA 4D9LL 3QJTB 3GMNB 1IL1A 4FX5A 2ADIA 4L2LA 2JKIS 3T3PF 3PHOB 3OQ3B 4G7RB 2X1PA 1KDJA 4LKCB 5E24E 2VDRL 4WW2F 4Y16C 2JELL 2FHCA 1KV3A 2AJXL 5EOQL 5JW3H 2H32H 5DUPL 1NCOA 5A7EA 5FECB 5BRZB 1PZBA 3QCTH 1M0KA 1WCBA 4HZLA 1G7LA 1T1WA 2NXYC 5JR1L 1U8PB 4FQCL 5F1SA 3DXAB 3GEFA 4M7JL 2HFEA 3FRPG 1ECYA 1Z3GL 2RBLA 5CP7B 3B5TA 4YL9A 4BSVB 2GQHA 1JFPA 2WYTA 2XPZA 3GMRA 3AREA 3K74B 2FD6L 3RL1A 3EO1B 5IREA 4WW1B 5B1CA 4MCYB 1G7PA 2P4AB 2MFNA 2QZ5A 3VVWA 3KLAB 4WSKA 3NCWA 3CDZB 3FTUA 3Q2VA 4L4TA 4AH2B 3QXDB 3VQ1C 1KJMB 4V1DB 5T3ZD 5KSBE 1PZCA 1UOLA 4DP0X 3A6CL 5FFOA 3LN9A 3VFNB 3GYRA 1IRAY 3O11B 3OWRA 5DEGA 4JFOA 4APQB 1A4AA 1CR9L 3SDXB 3T8XB 3QZLA 3AFLA 2WLKA 4MKTA 3L6FA 1Q94B 1XCQB 3MBWA 2YXFA 3OQRA 1MY7A 4ERSL 3V7MA 4LVNC 3FTWA 1PLGL 4XTNA 4P46A 3GMLA 3QO0B 4PRPB 5H37G 3HE7D 3K4AA 3QUZB 2CBQA 4DKFL 1RH8A 2HH0L 2AKRA 4YHIA 4DVRH 1ES0A 4G59C 4BUGA 1I9JL 4K0OA 4XCEB 3T6ZA 2DWYA 1OAZL 5EWIH 4UOQA 3R0MA 5E2VL 3HN3A 2QGBA 4ZX6A 2XN1A 5MERA 5FYJL 5IB3A 1XVSA 4YHOH 5JXED 4KITB 4PIBA 4F2EA 3FQXA 4DF9A 4RAUA 3U36B 3JWNH 3BSZA 5EH1A 3SPGA 4B3EA 1JDDA 2FQFA 4ONGL 4HYTB 3U0TA 2CHZA 5B6YA 4QHKJ 4K9EH 2VMJA 4G8GD 4XAKE 1EGJL 5AW7B 4C56E 1V7MH 4BQ6A 1UD2A 1FNGA 4QRTB 5HHOA 5IBUG 1H6FA 2ADFH 3L9RB 3SDDA 4QRYA 1LP9E 5T3XD 2DYRB 4OQ1A 4E9RA 1FYTE 1MWAL 3OR6A 1CYGA 1OCZB 1RULL 1E5UI 3O2WH 3QQ4A 3MRFB 4OLVL 1TJHH 5CJBA 3V0AC 1U8LA 43C9B 2BINA 5JW5A 4JRYB 4BHUA 4KNFA 3QCTL 4CN4A 1XGTA 3PP3H 3P3YA 3ZBMA 3NSJA 2Y1AA 1PY0A 3VFSB 2PCYA 2YAOA 5GGUA 4BH8A 4LARL 3IGKA 5KBLA 1CDBA 2IANE 3QUYA 3VG0H 2QQLL 5IESH 5I76B 3UBXB 4B3VA 4ETQB 3J8F7 3RPKA 1RUKL 3RQ3A 4MBOA 4ELME 3KXFD 1UCQA 4UZGA 2XLLA 5F9OH 1SF5A 2FHFA 1BIIA 1QMUA 5JQIB 2OJ1A 2P48B 1J5DA 1EZVX 1QWNA 4WWKA 5D7JA 5C0RL 1CBVH 3TM6A 1Y0LA 5DO2C 2ZX9A 4JFFE 1RCYA 1E7VA 4H20H 4LQFL 2VQ4A 3MLVH 1U8HB 2DY2A 1ADQH 3N42B 1DQKA 5DMJB 1JRHI 2BSEA 5H2KA 2X12A 5BJTA 1OP4A 3HHRB 4FQ1H 5F7BA 4I9WD 3V0EA 4G8EB 3X11A 5EEYA 1LD9B 5T33H 5KJ4A 5ESVA 1EZSA 1N8ZB 3S5ZA 4Z7NE 3DOHA 5TE4H 1EH9A 1O6SB 3HMWL 5DLMH 3WHE1 1O6VA 4TN9A 5CD3A 1FFNA 5HHMB 3CV5A 3T4AC 3B8SA 1HSBA 1S7SA 3TYFA 4H8PA 3I2CH 3L17A 5BVJA 3DHPA 4G1EA 4XO3A 4A2GA 1UKSA 5FDYA 3LNFA 1WZMA 4U3SB 1VEOA 4JFDA 3W37A 4PCYA 1H0DB 3ZKSD 2E7HA 4G8IB 5H2IA 5IHHA 4YDIH 3RP1A 1QBLH 1CT8A 2IQ9L 3JVGC 4IS6A 4GKZA 4K5OA 3QE5A 3VFRA 2Q3AA 4FG6C 2BNQE 1FNSH 1SLVA 4HLZG 4O2CA 1FC2D 2WLIB 5DJ2B 4Z3JA 4UTAL 5CLWA 1JZJA 5GSVB 3NJMA 1NCDL 1UXWB 5CGTA 4KHXL 2RQ8A 3WY2A 3HBZA 2DMKA 4NOFA 1SEQH 3P54A 5J1AA 2CO3A 4YZFF 5DJAA 4L5FE 3GMOA 3WLBA 1AO7B 2BOBB 2G2PA 4GXUN 4M1GL 1ND0B 3P4NA 3BAIA 2JI2A 3OSVA 3FH5A 4EN3C 3OAUH 2CRIA 4AZ8A 5AB9A 4XAWL 3FN0H 4AEIL 1VA9A 2WKGA 4LNRA 3H3KA 1ACCA 4QRQB 4RMVA 3ZL2A 4X7TB 3PABA 5KBPA 1W9XA 4QRFA 4AV4A 2PPFA 4NWTL 4W6XB 3M17A 4EKJA 4MNGE 2IMMA 4JRYE 2FR4A 4QCIA 3PWNA 2Y7NA 2JI3A 5T1LB 43C9A 2XOTA 3FTXA 4ANWA 2OX5B 1DZEA 1XH3A 3N2JA 3AB0C 2XHNA 4OFQA 1SVBA 4ZPVB 4JKLA 4ZXBC 1GVIA 4N0YH 4EI5B 3ETSA 1L0PA 5DVLA 3O11A 5DEGB 1Z7JA 3EDDA 3QCVL 5E2VH 3O2DA 2X1OA 4L1SA 3MROB 2AABH 2E4FA 1PIFA 4B9GA 2VXTH 1A6AA 1IAIH 3H9SB 3Q44A 4EOWL 5BMFL 2YAPA 1FRGL 1YMHB 2IWGA 1E8WA 1UCBH 4WFHE 3R06A 5I5JA 4EO5A 1KBWA 3E80A 5FDWA 1M71A 3F3HA 3C2AH 2NTFA 5T3ZL 3U4EB 4X5QA 1FZMA 4OZHA 3PJSA 2EH8L 4UT9L 2P47B 5GSRB 2F53A 3QI9A 3A22A 2IPKB 1S46A 1S9VB 4OSUL 3G7TA 4DW2L 4X8JB 2C5DC 3EJZD 3IJYB 1QWHA 4IMKC 4YK4C 4KJWD 4HIIB 1HOCA 4K3GA 2VDPH 1E8ZA 5GGVH 1IV8A 4OFVA 4ZT1A 3TASA 1A1MB 1FCCA 4AQOA 5DYFA 4DETA 2HT4D 3S34H 1KNOB 1LE5A 2FX7L 4M3KB 2WJLA 4RZKA 5E5MA 3X1GA 4FMVA 1M3JA 3KH4A 4ODXB 1PPIA 3EFOA 2JJSA 2DJMA 1H8SA 4WTZG 1YEJH 3DJ9A 4PJ9B 4D8OA 2YWZA 2KDYA 4NCC1 5HPMA 4J3XA 4X8XA 4XC1H 3GEWB 3PDOA 4MJIA 1ZLVH 5ISZE 5D6DA 1EHLH 1HT6A 5B38B 3FQUA 1GYWA 2VDOH 5DQJA 5D4IA 1UZ6E 1OL0A 1BREA 4GUOA 2XA8H 2DPKA 4I77H 4LHJB 5B38G 2ZXQA 3VQMA 4QO1B 2FIKA 1JHTA 1JXKA 4HDIA 2R7EA 3FRPB 3LRSA 4L3AA 4UAHA 3SPIA 4JZJB 3WEAA 1QBMH 5D1XD 3OE6A 4TL3A 3MRFA 1A3QA 4GKOA 2YBRB 2O5YL 3AT8A 1JWUA 3HG4A 3P0YL 2YAHA 3ZW3A 2DLFH 4GAGH 3HPLB 3MRIA 4FXTA 4U4BA 4YBQD 4NO5A 5CD5D 2J20A 1IE5A 2I60H 2BIIA 3UYPB 4YNYA 1ZA6A 2M26A 1CD0A 2EYSA 3JTTB 1F6AB 1TU2B 4YOKA 4KZEL 3O3UN 2BK8A 2QBWA 3PLYA 3W11C 2GSMB 4OLXH 4P3DB 3RZCB 4HWZA 3NUKA 4BGDA 4DUXA 3VCLB 2PO6D 2QKSA 1QVOB 5EF3A 3HAQA 4P59L 4XH2A 4M93B 2NZ9D 1IIKA 2E8YA 4NKIH 4O02A 4K9JA 4GSUA 4H88L 3FN9A 4TSAL 4XP4L 1PZ2A 1L0YA 4FQJH 3NJXA 1N59B 4IRZH 3H85A 1NEZB 1LEIB 2OTPA 4XWGL 1HCFX 3WO4C 3HZYB 3WFCL 4YDJB 4P2RD 5JHLH 4QWWC 1MLCB 3QEQA 4KXZH 5E6ZA 1TJMA 1YMMB 3LN4B 1EHXA 4FKHA 1OTUD 1EAOA 1JPSL 4NQCE 3RVTC 1M05B 5IHLB 3ESUF 1B2WH 1HH9A 5BV7B 3O6ML 4I3SL 4JQVC 1NCTA 4AGPA 2Z4TA 2O5ZL 3MA7B 4HH9A 3SY6A 1KYOJ 1R2NA 3HZVA 3MRMA 4IBLT 4H26A 4KHTL 5MP6H 3VFTA 4E9XA 3H9SD 2XXCB 2LLNA 4Z7OF 1I8LC 1TO4A 2BZCA 2Y6SD 4RX4A 3IMBA 1SOXA 4AJYV 1DLFH 4K7PX 1ZLUH 3C8HA 5D1ZB 3MRDB 3RL1B 1F1DA 5A2KH 4F5CA 1BVNP 4Z0BL 3SYOA 4XXWA 2JI1A 4NNPH 2A9MH 2C3XA 5LBVA 5IG7A 3VXUE 3RVWD 1MRFH 3QEQE 1WYJA 1M0LA 1ASPA 1UYWL 1Q9OA 1IGMH 3BKCL 2YFNA 2E7LC 1QZNA 4IBTA 4JO1H 1S7QB 1A3LL 1J8SA 3ULVF 2ZWSA 3J7HA 2NQDA 1XTMA 5CJQH 3ILEA 1U33A 4U7SA 1I9JH 3AWEA 2K8MA 5E9AA 4OLZL 4KAQH 4TLKA 3V0DA 2XT1B 1BW8A 1MF2H 3K6DA 3MJ9H 5C0JA 3BP4B 3DTXB 2E6JA 4J3UA 4LVOB 3JWOL 2YK1L 1HWGB 5EEVA 4A6YH 1A6UL 1DVZA 2B3IA 1TJIL 5HD8C 5EEUA 1IEAA 1NUDA 3MV9B 3HUJF 3AAZA 3WY3A 4EI5C 3ZZSA 2W65B 5ICUA 3QDJE 5KAQG 4G8GB 4WJ5A 3BEVA 5H35A 2MNJB 2AV7A 3S3PA 4PBWD 4ZMTA 1U8IB 3PF2A 4Y88A 4W9EC 5F1IA 2CQVA 2F7OA 3CFJB 3ARBC 4IRJD 4JL2A 1C16A 1KGXA 3CDYA 1WZ1L 1BVLA 4K3HA 1TTAA 3UJJH 1RSFA 1YY9D 1ZKAA 2FJUB 3ARDD 3MUY1 2MMXA 1OP5K 3T3MF 4F27A 5I30H 3LH9A 1PYWA 5T8IA 4AQ8A 1AD0B 3MBED 2Y5TA 3HAEA 3O4LD 5T1JA 5HYJA 2KSYA 3UG9A 5H2BB 4K5NA 3UO8B 4HJ0D 3QA3A 3C6LA 1H5BA 4RLDA 4UF7C 1QASA 4YHLL 1UD3A 4Y16D 2UZYA 1PIGA 3GQFA 5H2JA 4F7EB 3FTZA 3DXAE 4G8FB 2TSAA 3WAKA 4LRIC 2F53B 1E4XH 2ED9A 2JKXA 5PAZA 2FDBP 2ODHA 3X3BA 2MNUA 3SOTA 1SBBA 3PWLB 2QR0B 2DLHA 5E99H 4BA0A 3DRQA 2FO4A 2AK4E 4XC3L 1INEL 2J4WL 1PDKB 1B0GB 1EUTA 3HB3B 3RTLA 1YEKH 1BD2B 5DHMC 4E9TA 4NUPA 2X2JA 5JQHC 1R5VA 4JPWH 1DBJL 4R7LA 1T6VN 2CIIB 2NXZD 1I8IA 1MCSA 2QELA 1YNTF 5JZ7D 3HR5B 1HL9A 1XB8A 5IROC 1USZA 2FT8A 2C7UA 2IDFA 4PJFA 4P57B 3WIHH 5BR5A 1G4RA 2GVYA 2WC7A 3D39B 5EU3A 5B22A 1F4AA 4KK6D 5IMKA 3VFVA 3H7BA 5A2JH 4CJ1A 3NCMA 2AJZB 1WWBX 3SKUD 3IMWA 1QYGL 3N0PB 5LNEA 4AL8C 5HGBA 2XTJD 3D09A 1WEJH 4NQTA 4BFIA 2EO9A 4HAGA 1WIOA 5E0QA 3SDCD 3ZK0A 2EYRA 5G28A 4X7SH 4Q9CA 1YYML 3NBNA 3S4SG 5I16A 2EEDA 3NQIA 3QBTB 2NQ3A 4HWZB 4JO2L 3VAEA 1BBDH 2N59A 3SKNB 4QAMB 1CLYL 1KJ3H 2YRLA 3T77B 3MREB 1X7TA 1BWWA 1CVRA 1ZGLP 1YEFH 3ZE0E 3FUNA 4G72B 5T3ZH 3WJMA 1ZGLB 1AO7A 2BOBA 4XODA 5E8DH 4AE0A 5E23A 3MRGA 3C8DA 1AAJA 1KZQA 5I0ZA 1NC4D 3WXVH 3QS3A 4I5BA 1KB5A 3QVAA 3ESOA 1CICD 4UU9B 4OCSL 3RX7A 5DVOA 1AQDA 4HK0B 3V6OE 1XGRB 4AGQA 1EEZA 2NPLX 3DDGA 1Z9SB 4RQQA 5SWZA 3ZYIA 1P5UC 3IAPA 3QQDA 1XZ0A 3A21A 4AK1A 3S37X 4F9LA 2FLBT 1S7XA 1NDGA 1LDSA 5AVXB 1GSKA 2APFA 3TBTB 3O8XB 5JXEA 2XTJB 1BA9A 5EO0A 1TTRA 5TE7L 3AQXA 5AEAA 3BLPX 4GAJH 3GK8H 3LZPA 2OMWB 4HWBA 3GB7B 1ZMYA 4HUWB 1U3HC 2N1KA 4OCYL 1ZDSA 2OSYA 3KPRA 2AXFA 3I3DA 1BFOB 3L95A 5IMLA 3AGVA 3NZ8A 5G5DB 4WLCA 3DVNB 4LLDB 4UYPA 4ZYKB 5CD3B 3BP5B 4Y4FD 4NWUH 4NJAH 4AYFA 1A6VL 3OB8A 1EEQA 4U2ZA 5HYJE 1MY5A 3PXJA 3CMOL 4TRPH 1J9QA 3HAOA 3IU3A 4PJEB 5IBLC 1DDHA 3TWYA 2HP4A 4P5RA 1H15B 4AQZA 4JE0A 3WS6A 5DJCA 5IWLC 1B9KA 5I5RA 2HFGL 2HSIA 1CR9H 2LHAA 3AQZA 3I6KA 1T20B 3DHMA 3AGWA 2QV2A 4M8UA 5IZ7A 3V55A 4MQXD 4KJQC 3D3VB 4OCXH 4XNAA 5FGBC 5BNXD 1ETJA 1S7QA 5D70L 3VA2C 1IC1A 4X4XA 3GS4A 4IU3B 2F58H 2NYZA 4RISL 3SKJL 1IC0A 4QPEA 4MA7H 5HHPA 1GS6X 1QEXA 4NEHB 3KPSB 4KK6C 4HFUH 4LCWA 2I9LB 2CJ3A 1KDIA 2CD0A 4NOBA 4DWHA 4LSRL 2DM7A 4YUEL 3VX1A 1ILUA 5EWIL 3NPSB 2W60A 1UEYA 1KIPB 4PSPA 3THML 3X12A 1FQ9C 3MV8D 4X9FA 5GRXG 3L4TA 5KSBF 1DEDA 1YECH 3B3IA 4JO2H 4N8VA 4NO3A 4JRXE 1JHLL 5JR1H 2KKQA 4TSAH 1JNJA 1MFUA 3BAKA 4WFEE 4PLJD 2VRQA 1JXGA 3VH8A 3WSQL 1KYUA 4CDGC 4RGMB 5E0FA 1SN2A 3MBXL 5D5MF 2C1OB 1OSZB 4PWHA 3MZTA 3FCTB 2BMKB 4UB0L 5KN5B 3TZVD 2L04A 1GC1L 1NCUA 5CWSB 2Y03A 2ICWJ 2IVFC 1HK6A 2CMRL 4DP6X 1MCQA 1E43A 2DI9A 3VFVB 4O02H 1JF6A 1S6NA 5IMKB 1KJVA 4FEMA 4P5TA 4IJ3C 1MCOH 5I9QC 3QEQD 3ZE2B 4B9YA 4PRHB 1N18A 1IZKA 3SEPA 5CUSH 1J1XL 4LDLB 1CFQA 5LXVA 1ZHBB 3NK4A 4GP4B 1F88A 2OMZB 4N8VG 1U8QA 3IF1B 3RB7A 2FNWA 2DM4A 2BY0A 1M3IA 2I60L 2Z7YA 1Q5JA 3NSFA 2NW2A 2Y06L 4L4VD 3V5DB 4RWYL 5BUPA 1E27B 2QL1A 4JANB 3HE7A 3VRIA 5IW3A 5AW2B 3NFSL 4F8PA 4RFEB 1WEJL 3D4SA 4PGDB 1FNAA 1L0MA 2QQKL 1I1FB 4UQ2A 3HEIB 1F0LA 5HI4C 4X6EB 3DVIA 4PW3A 3VWJB 3MLVL 2BWDA 4Z78B 2AQ3A 3ASOB 3ABLB 4H88H 4LVEA 2WJKA 2DKSA 4XNBA 5FLVA 5HYJB 2BXZA 4PJ7E 3AM6A 2N7AA 2YGOA 3T45A 3D0VA 5F89B 4N0CC 4BELD 2WTRA 3RGBA 3S96B 4CBPA 2R59A 4GRLB 5I2IB 4XB8A 2YXVA 4Y1AE 3BPOB 3WXVL 5CP7A 1KJ2H 3X17A 3ZMNA 4A7VA 4QHKI 1MJ8H 4L2YA 3Q6GL 1KBGH 3BP7A 5JIDA 2FYVA 1NFKA 4JRWA 3OPZL 4BQBA 3K2UL 1QP1A 4FG2A 4POZD 5EIIG 1FUNA 1YRKA 2R0KL 4HPOL 1X7QA 2VDRB 5DCCA 2PO6B 2Q2LA 3SE6A 1MSPA 2B0SL 5T1KD 3HG1D 4KO6A 4XVTH 5F72S 3MRJB 1K6QH 4Y4HA 4XBPA 4FDWA 5E6RB 3CVDA 4EPSA 3HOGA 2X6MA 2YQ3A 2CA4A 5EZOL 4HIXH 3VO0A 1PS3A 2XACC 4AQEA 3PPEA 2W9DH 4G6KL 4OZHE 2PLTA 2VN7A 4S1DD 1KG0B 1QO3B 2BIPA 1S5HB 4PJAA 1JWSA 4PS8A 4OFPA 2CBMA 1IGML 2X40A 4X98A 3K72A 3H4FA 4GW5B 1WDAA 5IV2B 2JTDA 1JZGA 2OMUB 3DO4A 1E9OA 2X2IA 1EAQA 4ODBD 4C83A 4I1NB 1A66A 5IQLA 2QDVA 1JYXA 4AITA 4XNQA 3ZKNC 5DZVA 2YPLB 4DKTA 3JWDC 1R3LB 3KW8A 4LQFH 1E6JL 3C5SA 1KIPA 2KERA 3X12B 4XPGH 3FK3A 3H53A 4GQPH 1V10A 3O6FA 1PD0A 4W9IC 3V4LA 4DP9X 1AS6A 5I15H 3L1OL 5E56A 2OL3H 1CLOH 2QKIB 4P5TB 4MS8D 3Q8EA 1UJ3A 2WWOA 1GCYA 2JKNA 3TO4C 3L3JB 4GLRI 1PLGH 4ZX5A 2OFQA 5BVPH 4P23A 5F2FA 4Y4KA 1IBHA 4WZ9A 3MV8E 3NCEB 5C2UB 3LIUA 4LLUA 3TCTA 3ZDXE 5IB3B 2HKHL 4YBQC 5CD5C 2R1WA 2WD0A 4X5LA 5DJCB 1FVCA 1BVKB 3P3UA 4UM9D 2LE9A 3DMMA 1U8KA 1IQWL 2OLDA 2XPGB 1SXBA 2CGRL 3BZ5A 3EYQC 4R96B 5K93A 2IFFH 4XCEA 4ABVA 1DDHB 4F33B 4FFZA 4CILA 1A4JA 1CGSL 2HT2D 5IMMA 1QRNB 2J6EA 1JDCA 4HFWB 4JKNA 1MJJB 2JNZA 3LNHA 5MI0C 4IMLB 3I6KB 4JJOA 2PYEB 4U3HA 3ZL1A 1J1PH 3ETBJ 4ZUUB 5GRVL 4UTCA 3KPNA 3QJZA 2FT6A 3FB5B 5TD4A 4LF3B 1PFOA 2JCCE 4DAGL 1RUMH 1I7UB 4ZI8A 3ZMRA 4OTXL 3OKNB 4G6JL 1H3WM 3U0WL 1XF2B 3JBG7 1U6AH 1DQQA 1BVNT 2NY5C 3MNWB 4LMQE 3UC0L 4XOBA 2VC2H 4V1DE 5CLZA 3I75B 3OX8B 1S7XB 2VLLB 1GHFH 5LGHH 1CT8B 1D6VL 1LQSR 3AU1A 5IHUH 5KOMC 2EE2A 1VFBB 1JGEA 2OCJA 2OMNA 2KPNA 3FFCB 4M9PA 2H41A 4JFQB 2P44B 4QI1A 4E9VA 5B3NA 4FMFA 2IOIA 1MCPL 4MJIE 4PGCB 5HVHC 1E3ZA 4GKSB 2VDOB 3NACH 4HWUA 4K07A 2J5WA 1MCNA 4XNMA 1ZK9A 4NQXB 3GKWH 2YCYA 4NQSA 1QYGH 4ZFZB 3SDAA 3VM5A 1M7UA 5IB4A 3VFPB 2BHZA 4PWFA 5DURD 5KW9H 4MNQB 3GJFK 3O9WC 5T1KB 1BZ8A 3H9SA 1GZMA 1W80A 1QKOA 5ICYB 4B6ZA 5EZLB 2XZCH 3Q8BA 5GGQH 1ZHNB 4UT6L 5I6OA 3QW9A 5L2KB 2OMZA 5DVKA 4OJYA 3Q06A 4ZMYA 2JJTC 1KYFA 4EI5A 5I1AB 4P2OC 1Z66A 2XWCA 5EHFA 2BCKA 5T3ZE 4A7TA 2RJMA 1UH4A 5C1MA 1NGWA 4AVJA 2BSDA 4UM8B 1ZA3B 2DEWX 3V9CA 4HHAB 3ZE2E 5J13C 3H7BB 4KQ3L 4I0PC 1XEUA 1F3DJ 3D6GA 4FQLL 1KCWA 1GYVA 3FUDA 5FA4A 1A1MA 2AT9A 3I2CL 4LCVA 1YPZA 1ZGLM 3IMTA 1TUPA 1KMGA 1I85A 3VXSD 2YDVA 5E4AA 1G9NH 4UBDC 1KN2H 2OTWA 3CIQA 3FB8A 2Z4QB 4R97C 2NY2B 3VWKC 5KS9E 3T0EC 3OHXA 4ACPA 3CWGA 1VADA 5IIEB 5KJ7E 3MUGB 1RUQL 4YHML 4HYXA 1R4XA 3L2MA 3WU1A 3MV8A 4YXKL 4PG2A 1BGXL 2WUBL 4NM8L 4JX0A 5DJ8A 1E3XA 3FCSB 3O9WB 4U1SB 3AG2B 4UTAH 3PL6C 2H2PC 5EU4B 2CZNA 3QBIA 1GGTA 1YEDA 2ZAIA 1UXSA 1DBKL 1ZEAL 4R9HA 5FYJU 1UXWA 1W0VB 3S88L 2BIQA 1CDUA 4FZEH 2C9RA 5HHVH 1RUKH 5FKAA 1NAMH 3IAGC 2H8PA 2OQJA 2JCCF 3PV7A 3O6LL 2EO1A 5KVFH 3JTSA 1HEJC 2B1HH 3QDMA 4P4KA 3FQXB 4Z7UF 3K72B 5F7WC 3TH2T 1B0WA 5LXGH 4NENA 1KMEA 3O3DB 2EUXA 3HASA 2R2HA 4ABQA 2Z0UA 2A4EA 1AACA 4UWQB 4WI9A 1DQJA 1KYOK 5DJYA 4J3OF 5IQMA 1MCFA 5C97A 2BPBA 1UM6L 2MSPA 1H5BB 4PJDF 3BUIA 3TC9A 2GJRA 1I8IB 3QGVA 3K8MA 3WFZA 4MJJA 4X7TA 1UTDA 4J8RA 2E7LA 3QR1A 3V6OC 2P24B 5AB0A 4LLMB 4WEMB 5DUMH 3ZQXA 2F58L 4RISH 2V17L 3QARA 4NO2A 3RVTD 4X5WB 4IGBA 4XBEL 4DIXA 4DESA 1ZVNA 3KGRA 3SD2A 1A3LH 3QNXB 4I9XA 1NCAL 2WQ8A 1Q94A 3K2KA 1SPDA 1X5GA 2AK4A 3IDNB 1JZ7A 3JZ7A 5EZIL 3VX0A 1BFOA 3FUMA 3L95B 2XWTB 2VWEC 2YXMA 5B3JF 1I1RA 3DSNB 3SKOB 3VDAA 4RA3A 1IVTA 1OAKL 4XZ4A 1FNEB 5F9JB 1A14L 1E5AA 1RIUL 1B4RA 3QAKA 3ARUA 4OM0H 2I07B 3U0PB 4H5SB 3GSWB 5EO0B 4YGVB 5TF1H 3DO7A 1TTUA 3U2JA 3AS2A 1QSFA 1G9EA 4NAJA 3BIBX 4JCLA 1XSJA 4MMZA 3VRLF 1C5BL 1A7NL 4CSSA 1N0LB 3O6FD 3QDJA 4DW2H 1XZWA 4OJFH 4OFYA 3ZE0B 2AXWA 3Q0HA 4TNWF 2VDML 4G9FE 5C0CE 4CRPA 1AMXA 2CBOA 4O4YH 2R29A 3L7EA 1VFUA 1RJYB 3MCG1 4EUPB 4M43L 3S98A 5D7JD 1EDYA 1RD6A 2PTTA 5LBSL 2UX6A 5GJSH 3QORA 4HS3A 4L37B 4NQCA 1ADQA 2CM6A 2F0CA 4IEFA 4F93B 1OT4A 3IDGA 5D7SL 4H44C 3UCRA 4HXAH 4L8SA 4OGAD 1ZJAA 4YDNA 2VLKD 2APXA 2FATL 3FUIA 4LOEA 3ABMB 2AJVL 5DRNA 4J4PC 1F97A 3IGUA 4KUCF 1TQCC 5I6XB 3MX0A 1JZ2A 3C9NB 1N7MH 4GSDL 3OKOA 4ODHH 4P9ML 3NP3A 3H6AA 1KPVB 1L5GA 3QO1B 3FUHA 4F8TA 4YDVB 4MRBA 3KPSD 3LEXA 2GT9A 4GINA 2ZPKL 3QYNA 4S1RH 5IMOA 4XP9L 2VISA 3RDTB 4MQXC 1UB5B 2D3VA 4AMIA 4WAFA 4XXJA 4X99A 2ARWA 4KMTL 1CTMA 5DWPA 1KIUA 1XIWD 1LO3H 3D85B 3GINA 3QHZL 3EFFA 4JKPH 4HWEH 2Q10A 1KT2A 3BE1L 3TVMD 4ZMZA 3K2MC 2PCFB 1W6LA 2OL3L 3JTTA 1TZGH 3C5ZB 2VDQH 3KPRE 1BEYH 4LCCC 5CILL 3VFTB 5EN2A 2WLJA 1UGKA 4MDJB 1DVSA 3MI6A 1T6WA 3LKSB 5F9WB 2NNCA 2QPDB 1XR8B 4HU8A 1EEUA 4A1RA 1QVOA 3BXNA 4L29A 1BPLB 1CE1H 1AMYA 2QSCL 1EMTH 4JN2A 1RZ7L 3RWCB 2WBWB 1HAUA 2WGNB 4Y9EA 2MHAA 2VABB 4LLWB 5IBTL 5FO8B 3TA3A 2RFXB 4JM2B 3U83A 3TV3L 4F3FA 2VXVL 4PRHD 3MYJA 4XNDA 5EFIB 1CL7L 3AT9A 2EADA 3AQDA 1A25A 4R2GB 5C0DA 1UD4A 1JAEA 3OKEA 3R1GL 5J56B 4BFOA 3M8OH 5BOZG 4IOFD 3GXPA 1OP5H 4LPXA 1IKFH 4DGVL 4UOW1 1BZDA 3NZUA 4W68A 3B34A 4ZPTB 3D2UA 1XGQB 4MD0B 4KXCA 4YWGH 5GGTH 3VRLE 3ZRCC 2PTVA 5C6TH 1PSKH 3FT4B 3ULUE 1H3PH 2V2TA 1BFTA 4AX3A 3GHBL 1XCTB 1AZCA 4RDQF 5EORL 3ZT6A 1V3MA 1JCKA 2CSPA 1NFDB 4KKAD 3NZ8B 5D8JL 2B9BA 3T9WA 4LAJH 3N55A 4BSWA 4GG6B 4LEBA 4JJHA 1CIDA 2YXWA 1AQMA 1GIGL 5D71L 2MQ0A 3CFMA 4RGNB 3U46A 3LRHA 5DFWH 5CSBA 3ZE0F 3QZOA 5KAQF 3B6SA 4IEFB 5HI4D 5DC4B 2ZJSL 4Y5XC 1UYWH 2ZAHA 1DVQA 2X5PA 5DHYA 4Z5RA 4NRYB 4PB0H 4PGBB 1F6FB 4H5SA 5F9OL 1SY6L 4JPVL 4Q9RL 3SE9L 1L6PA 4M1DL 1TSRA 2ZOLA 3CFEA 2ZIYA 5IJKC 1EXUB 4U6VH 2B59A 1HNYA 3HI1A 3MJ9L 1WTGT 1RUPH 3II2A 5J89A 1PQZB 1T1ZA 3NSXA 5JYLA 4NENB 4CKVX 5DJXB 4Z0XA 43CAB 5GS0H 4J28A 4ZPVA 4ONFH 4TULH 3NPSC 4NHCL 3DDLA 5DO8A 1FFPA 2H1PH 5L6YH 3VW3L 2AEIT 3MQIA 4G11A 5AKRA 2O1AA 1X5YA 3I9GH 3MLSL 5T1LA 2XIDA 4KKNA 1W0VA 5I73B 2FECL 4HS8H 2XWDA 2OZNA 4Y5YA 4ES9A 3N04A 4M61B 2VDQB 3TL5A 1G7HA 2XY1A 4G6JH 5J4MA 4JO3H 2CDEA 5DVNA 1BQ5A 1F41A 1KTKE 4HV8A 5KTEH 2R2HB 4FP8H 5ITFA 5DQDL 1KZYA 2HLEB 5HI5C 3D1MC 2VL4A 1PZ5B 4G82A 4FTVA 2R2BA 4XXCC 1M71B 3FN3A 4LKXB 5DD1H 1HH6A 4O5LH 5A16A 3HR5A 2FATH 1MCEA 3H54A 1REIA 2AQRA 2HKFH 4P9HH 3OF6D 2QQLH 3B8YA 3GT6A 1HL8A 2ICEC 3W9EA 5CEXB 4WNSA 4NQED 5EU4A 4QHMA 2HVJB 3ARBA 4G42B 1EJ6A 1JV2B 2ZP8A 4P2QE 4EF3A 2DYPD 1OLLA 2F1EA 4P2RE 5ESAB 3BI9X 4KI1A 2IADA 2WKLA 5DF0A 2A2QT 2CK2A 2VLME 1T0PB 4LAQL 2MH4A 5T1MA 4XCCH 3GBLA 5T5FL 1L6XA 2HYMA 4AQ8C 3RI5F 3QK0A 5DSCA 1RVFH 2VO5A 4DAJA 3I02B 3QEHA 4GBXB 3QJQB 5AZEL 3U4KA 3K81A 4F7CB 1S7UA 1KEMH 4LSDA 3AXLA 1QSFD 2FLMA 3LEYH 3OHXC 1MJUH 3NJKA 3O0RL 4Y1AD 1ONQA 5AVTB 4KTEL 5C8JB 1G6RH 3MMEA 1K8DB 4HC1H 1N0LA 3FJTA 3QDJB 1TCRA 1L9SA 4K15A 3T5WA 1MI5A 4Y1TA 1HU8A 4MA8H 4ZS7L 3W1ZA 4A2DA 5ADOL 1HXKA 5DI8A 2HFFA 2X4OB 3VYOA 1SGKA 4UG2A 1RZ7H 5I1AA 2H2PD 1ET7A 1JN6A 2RALA 5EU5A 3LXBA 1CDGA 3ARGB 5KYXA 4QHPA 4P5SA 1IC7L 1Q0XL 1W0WA 3C08H 5CGYD 5F3BB 1ZHNA 2JFCA 1AD9B 3D4YA 4R2GC 2GK0A 1S4IA 5IBTH 1OGPA 5I71C 3QG7H 1NCNA 4E9SA 1L7IL 3FOLB 1MAML 4X4MA 2ATAA 3FQNB 1BBDL 3VXSA 2I85A 3U1PA 3FT3B 5DRZB 4BM7A 5A3ID 1Z6JT 1JGLL 1WHOA 5F7DB 3WJJC 3TN0D 5C6WH 3OAYK 4FLQA 3DV4B 1D9KC 1DQMH 1EJOH 3UTVA 3IWVA 3ULSA 2F5AL 5IMLB 4OZIB 4HIQA 3MJ8A 3L5HA 4Y1SA 5SWQB 1ZPUA 1Z0MA 1NZRA 1TQCB 4IBWA 1FYTB 3TBYA 3MAWA 1NANH 2KYIA 2DB8A 4WEBH 1OF0A 2HFFB 5KVFL 5E8OB 1F3DH 4TTGA 4ZFZA 3SDAB 4LIQL 1OTTC 1AXTH 5FA3A 1R5WB 2VDKL 1FDLL