2QPEB

An unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unexpected outcome of surface engineering an integral membrane protein: improved crystallization of cytochrome ba(3) from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 40
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2qpeB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2qpeB02
2Z55A 5D4HA 4L35A 4DPBX 2DWTA 1JZJA 3DQBA 1JZFA 1TKWA 1ZV2A 1AZUA 3PBLA 1L9OA 1JZIA 5KKHA 5JJJA 1SJMA 1WA1X 1CYWA 2Q5BA 4F7KA 1KMEA 5DYSA 4MQSA 1N68A 1BRXA 5FC9A 3EH5B 5H2HA 1ASQA 3C9LA 2PP7A 4E9QA 2WSDA 4P5RA 5AX0A 2G87A 5B7FA 2R4SA 4HCGA 3SBQA 1OF0A 1L9PA 5AHYA 2EILB 4QRYA 1JV7A 4OV0A 4YVUA 2QPDB 1KCBA 1E5YA 4A2DA 1P8UA 1L9QA 1X0I1 3A7KA 4MBSA 1JZEA 3GYRA 1A8ZA 5TK2A 3ZPQA 3VGAA 1DZ0A 2XLLA 4EIYA 3BQVA 4KOCA 4LDLA 1PAZA 1WS8A 5I6MA 3VI0A 2YXWA 2ZIYA 3TBCA 3C75A 4UF7C 1UAZA 4E9YA 1H2SA 2I35A 2YCYA 5H2OA 1KBWA 4DP1X 4JHUA 1BAWA 1W6LA 1WA0X 2XYBA 3T6WA 5E9NA 3ABGA 2JAFA 3CODA 3T45A 5LWEA 3PWHA 1NIAA 2JAGA 1PZAA 4G71B 2X88A 4MFHA 2VN3A 5B1KA 5A7EA 2LLNA 3SQRA 2I21A 2HX8A 3UADA 4JQ6A 1BEXA 1AZBA 1NIEA 1V54B 1XIOA 1M56B 3OE0A 1MG2C 3CDZB 3PAZA 4N8UA 1KDIA 3QJVB 1MZZA 4HCFA 2H3XC 2PPFA 4UAHA 4FA7B 5LDUA 4BUOA 3T6VA 3FU8A 5H2IA 3FPXA 3UZAA 1H68A 3OQRA 1TU2A 3FPYA 4YSDA 2ZFEA 5I28A 4FAAB 1XB8A 2HPYA 2YAPA 2UXVA 4PCYA 1AAJA 4E9XA 5B0WA 3T6XA 2I85A 1E5ZA 2XV0A 1NPNA 2XX1A 4DP4X 4IB4A 2BP0A 3D12B 4AKQA 3X1GA 2QT6A 3OE9A 3CVDA 3U25A 8PAZA 2KSAA 3S8GB 2BP8B 2ZWNA 3HB3B 4FBZA 1J9QA 1GS8A 2VSMB 3CVCA 3V9EA 3IE9A 2E86A 2GB2A 2B08A 3FU7A 1HZXA 1QKOA 4N4WA 1SFHA 3FSWA 2YARA 1EZLA 3NJNA 1BQRA 5H2MA 7PCYA 3UTWA 3H4FA 1ZPUA 2XWZA 3TU6A 1XB6A 3D4SA 1ADWA 1TEGA 1IBZA 3AM6A 4HYXA 4IARA 2LNLA 2YCXA 1PLBA 2PPCA 1HAWA 4DP7X 5AFAA 1MG3C 2IDFA 2I1XA 4P5SA 4F2FA 4K9JA 5EN0A 3WQJA 4DP9X 3ABMB 1M0MA 5AWZA 3FU9A 3ASNB 3UACA 3ZIYA 4DP8X 3AYMA 5B3SB 4L0PB 4CSZA 2GC7C 1PNDA 5H2NA 5G28A 1AG6A 3NY8A 1DYZA 1ETJA 2IDUA 3CVBA 3PDSA 2PP8A 1PF3A 1GZMA 4HCIA 2HRGA 1L0MA 1KDJA 4BEZA 2FT8A 2IH9A 2FWLB 5F7AA 1S8JA 3UTXA 1YLBB 2HRHA 1ID2A 4KNUA 1KCWA 4DP6X 3AY2A 1AG0A 3NJIA 1ASOA 2J56A 2XX0A 1TEFA 2UX7A 1NICA 5H2LA 4F2EA 4X1HA 4NAJA 3FSZA 5BR2A 2BP8A 3AG3B 3QBIA 3RYMA 5IY5B 1F88A 1QKPA 4YSAA 2GI0A 1AOZA 1NPJA 5I26A 4GPOA 1CYXA 3MX0B 4NC3A 3ZEVA 3FSAA 4ENZA 2NTUA 1AT9A 2AANA 5G36A 3IN2A 4GYCA 1SDDA 5H2KA 4PXKA 5FJGA 3IN0A 3S3CB 1R2NA 3PCYA 4BWWA 4E9SA 5B6ZA 1ET8A 1TN5A 1JVLA 3AG1B 1OCRB 4G72B 1IBYA 3MBWB 1A4CA 5I5MA 2GBAA 2FT6A 3UGEA 1AS6A 1I53A 3TA4D 4QIDA 1BRDA 2YDOA 4GBRA 1BYOA 1AACA 1M9WA 1QNIA 2DYSB 4FPDA 5ITEA 2N0MA 2PLTA 3NYKA 1BM1A 3BVDB 4YSTA 2UXFA 3N2JA 1URIA 1Q5IA 1ILSA 1SDDB 2BP0B 4YSRA 2CCWA 6PAZA 6PCYA 4GRVA 2XUWA 4PXFA 2CAKA 4E9RA 3VVKA 5I6LA 3NSCA 1S8LA 3FT0A 3FQ2A 2XV2A 2BRDA 1AZNA 5B7EA 2VM3A 2XXGA 4HHWA 1BXUA 2BWIA 4A68A 5DHGA 3QBGA 5B6YA 2UXGA 1M0LA 4AKPA 5I5IA 2UX6A 1J5DA 2WO2B 4IAQA 4A2HA 1J5CA 2IDQA 2GHZA 1NTDA 4HHGA 4A67A 3NJGA 2R7EB 1JVOA 1EHKB 2VW4A 5I6KA 4KOBA 3CDZA 4YSCA 2TSAA 1PLCA 3N55A 2DWSA 1J9TA 3AG2B 3DKHA 1BQKA 3DIVA 1GS6X 1JZGA 2PPEA 1JV6A 2WJLA 1JERA 1SNRA 1PNCA 2VM4A 3OMIB 1OCCB 3VW7A 1SHXA 1PY6A 1NINA 2IWKA 4GY4A 2ZXWB 3QJQB 2GIMA 2IH8A 2W8CA 3HAPA 1W8EA 4L6RA 1NIBA 3X1BA 1BYPA 3V2WA 5B35A 5AKRA 1CUOA 4XTNA 2IAAC 4AMJA 1BRRA 3UZCA 5B6XA 5B6WA 3REYA 3S3BB 1KG9A 1AS8A 1AR1B 3HAQA 2HX9A 4EA3A 1OV8A 4AKOA 3PLYA 4KO9A 3TBBA 4UG2A 1PY0A 4UANA 4TL3A 1OE2A 3T9WA 2EI4A 4XT3A 1KV7A 1R84A 2FT7A 3NSYA 1IKOP 2R4RA 3NSFA 4E9TA 4DJHA 2Y03A 4AMIA 2HZHA 4G70B 3MBVA 1JZHA 3X1FA 3P0GA 3QAKA 1MGYA 1GW0A 1GS7A 5G2AA 3KW8A 1AP9A 1AQ8A 3FQ1A 3X1EA 1N70A 1ET7A 2PPAA 4LDOA 4K5YA 2AZUA 1L9HA 1NWOA 1SFDA 2R7EA 2YAFA 4YVNA 5ANHA 3ZX1A 4KO6A 2Y1AA 4YSOA 3QBLA 2BZ7A 2YAEA 3WNIA 1PLAA 1PZBA 4G7RB 3ODUA 2GC4C 4E9VA 3PAVA 3X3BA 1VJMA 3VHZA 2JKWA 1OCZB 1KGBA 2DYRB 5TGZA 2PPDA 3T71A 4HZ1A 5J7AA 4DP0X 5B1AB 1E30A 1X0SA 1S52A 1V55B 5AZUA 1J9SA 5G2CA 1PMYA 3PAUA 4BWUA 3FU7B 1VLXA 4M3HA 1ZDQA 4KNFA 4YSSA 4BXVA 1QM8A 2FQGA 3AYNA 3ASOB 3QAPA 3QJUB 2CALA 3QQXA 1SF5A 4E9WA 4A2FA 1F50A 2AT9A 4N4YB 1XJIA 3UTVA 3ZPRA 5AHZA 5BR5A 1BQ5A 2AVFA 2AZAA 3NJFA 5TK4A 4KLYA 3X3CA 2EINB 1XB3A 2PEDA 2YAHA 3EHBB 4BWBA 5B6VA 2A3TA 1AS7A 5B34A 2EIMB 4YSQA 4X31A 4JKNA 1NZRA 1JOIA 1ASPA 2ZOOA 1JFPA 4WW3A 4HALA 1FFTB 3QDCA 4GYBA 5D4JA 2KSYA 2RACA 4AZUA 4N6HA 1E67A 1FBKA 3UG9A 4AI7A 1GUEA 1W6WA 2HLEB 1T5KA 2FQFA 3ZDWA 1IUZA 1O0AA 1OE3A 5PAZA 2I7OA 3IEAA 2IDSA 2BO0A 2FNWA 4G7SB 1RCYA 3WIAA 4A2EA 2DV6A 2VMJA 3AZUA 2IWFA 4JHVA 4NB7A 4XTOA 2VT4A 3UONA 4BV0A 2Y02A 2VW7A 3PQRA 4WTQA 2FJSA 4GP5B 1PCSA 4MQTA 3SBRA 2B3IA 2DY2A 4BWTA 3WKQA 1V10A 3AG4B 2L6XA 5G54A 4EF3A 4A2GA 3NS0A 3UTYA 3EH4B 3X2QB 4QI1A 2TSBA 4BDVB 1KG8A 3CAPA 1X9RA 1AZCA 3JT2A 4DPCX 2M3GA 2BW4A 4BEYA 2MRYA 1LN6A 1S53A 3OD3A 2YQBA 3HAOA 1ET5A 1FBBA 1P8HA 1R1CA 3PXLA 1KYAA 1VGOA 5I6OA 5JJNA 2QDVA 2J57A 2OJ1A 3NT0A 5B1BB 3OMNB 1ZIBA 4QLWA 5AX1A 1F56A 4HYJA 3FS9A 3UAEA 1F4ZA 5PCYA 4BVNA 1WS7A 2VW6A 4WAVA 1OCOB 3H56A 2JXMA 2HXAA 4AX3A 7PAZA 4W1TA 1X0K1 2BHFA 3WG7B 2Z73A 3KW7A 4YSPA 3UAAA 3ABWA 3FYEB 2J4YA 3SN6R 3EF4A 4HWLA 1JXGA 3FSVA 3L45A 4CSPA 3CZUB 4GXFA 5I6PA 2F93A 3ABLB 3S3DB 5D4IA 1TN0A 1JGJA 5ITCA 1OE1A 1E65A 4LDEA 1A4AA 1E12A 2Y04A 3TASA 1QHQA 2Y69B 1PZCA 4MD2A 2WO3B 1UCQA 2HX7A 4YSEA 3OMAB 3WNJA 3QJRB 5G53A 3QJTB 5B1JA 1GYCA 3VG9A 3NYAA 3ERXA 4JKVA 4G7QB 1OOWA 1JXFA 3HASA 2CJ3A 1QHJA 1Q5JA 3EH3B 2XVBA 2PCFA 3EMLA 3OM3B 3OAXA 2IWEA 1S51A 5B2NA 2W88A 4BDVA 2XV3A 1IW6A 1A65A 5I6NA 2NTWA 1HAUA 2YAOA 3NP3A 1J9RA 2YXVA 4NERA 3UABA 2FTAA 2BW5A 2MTAA 1L9SA 1NWPA 4KO5A 1UATA 4PAZA 4Q89A 2KS9A 1RZQA 2EIJB 3GDCA 4EJ4A 5DHHA 1WA2X 1PXRA 1ILUA 4ZK8A 4DP5X 1AANA 2WJKA 2X72A 3FQYA 4DP2X 2PP9A 3GXUB 1A3ZA 2ZONA 4X4KA 2I20A 2PCYA 2AFNA 3NP4A 3OE8A 3HARA 2Y01A 1L9TA 2H47C 9PCYA 2FQEA 2OCCB 1P8IA 2KSBA 3HANA 3WI9A 2F95A 3WKPA 1B3IA 4X32A 2CBPA 2H5UA 1ZDSA 5B1JC 2YCZA 2QPEB 2NRDA 1BXVA 4JR8A 2CUAA 1KGYE 4KO7A 3NSBA 1MZYA 3S8FB 2YAQA 1E0PA 3DTUB 4Q8BA 1DZEA 3QBKA 4RH4A 1CURA 5C1MA 3COCA 4QKTA 1GU8A 3IBOA 3OE6A 1S54A 3ZBMA 4KNTA 1GY1A 5B7MA 2GSMB 4A66A 1MDAA 4YSUA 3NJJA 5EHFA 2YDVA 5I5JA 2BZCA 5JJEA 2J55A 1GR7A 2IDTA 1C8RA 1NIDA 1XMEB 4XT1A 1CWQA 2JFCA 3CG8A 2YAMA 3QPKA 3PXOA 3C9MA 1NIFA 1IC0A 2OV0A 4DPAX 1M0KA 1JXDA 5F7BA 3DDLA 4DAJA 1GY2A 1AZRA 1RKRA 3NSDA 4UHRA 2VSKB 2ZZLA 1FA4A 1IW9A 1X9UA 1C3WA 1FWXA 4GP4B 2P80A 4BXSV 2XXFA 4MD1A 3QJSB 4YL4A 1GSKA 4DKLA 3SBPA 3T6ZA 3KJ6A 5H2PA 5AZDA 5A45A 3RZEA 1AIZA 1RZPA 4HIPA 2J5WA 5A44A 2FQDA 1NDTA 3NJKA 1HFUA 3PPSA 1SHWA 1BXAA 1PXSA 2I7SA 2BWDA 3AW5A 4J4QA 2XU9A 2YCWA 3ABKB 3H4HA 4XXJA 3V2YA 3NJLA 4BK5C 1IXFA 4A4MA 4XTLA 1ZIAA 2RH1A 2UXTA 2QDWA 4TXVB 5F8UA 3FYIB 1QLEB 5G2DA 2P80D 3HEIB 3NJMA 4W9ZA 3NY9A 5ETZA 1C8SA 1M57B 1CC3A 3X1NA 1WAEA 3JTBA 4HAKA 1U19A 3V9CA 1L9RA 4KNSA 4M4RB 1A4BA 3RFMA 2Y00A 4Y9HA 1KBVA 2EIKB 5A8EA 3G5WA 3NJHA 2X87A 4WKXA 1SF3A 2Q9OA 5H2JA 4GP8B
chains in the Genus database with same CATH superfamily
2VAJA 5D4HA 1F11A 4JN1L 2BS9A 4E5XB 2G4EA 2FHFA 4LLAA 5ACZB 4XO3A 1ZV2A 2KI6A 5J12C 3K2UH 4OLWH 4JVWA 4QEGA 5F89A 4LCCC 3QT2A 2NLJB 1CYWA 4LIQH 5IMKB 1AH1A 1UVQB 4JFXA 5I1LB 5BZDB 1A9EB 3A6OA 4RNRA 4PMFA 3LS4H 1M4KA 4AL8H 1LWJA 5C0CA 4HIJB 1FZKA 5DR5L 5C0JA 1TZIA 3O6FC 4Z3HA 3FQNA 1M1SA 2IBZY 3LD8B 1RAMA 4YDMA 3BKCH 2CKNA 4N2FA 1GZHA 3AGWA 3DDFA 4KJQC 4DGIH 4YBLB 4NPYB 2PW2B 5I1HL 4KOCA 4HKBB 5J1AA 2ARWA 2ADGA 4HLEA 1MCQA 5GGQL 3T3MB 3Q7JA 5EEYA 3D39D 3SPVA 5GS0C 4NUGH 1LVEA 1KBWA 1T1WA 2WKLA 1KJ2H 1NEZB 2ITCB 4OM0L 4IMLA 1IGIL 1QACA 4LSUH 2YK1L 2BMKA 4TTDC 4ZOEA 2NY7L 5D6CA 1S9XB 3WFCH 4KK9C 4JVPA 1GXEA 1KMGA 5E6IA 2IDCA 1RK0B 1IT9L 2DD8L 1OOAA 4MNHA 3OE0A 3VGGA 3QDJA 4HW6A 3IK2A 4EDWH 2YD6A 3AADB 1E8YA 4JZJC 3RVXC 4FLSA 5D7JD 4NUJB 5DUBB 3UZAA 4KKRA 4EIGB 43CAA 1VENA 2A9CA 1OD7A 1X6NA 3RWIA 3VRIA 4N0FA 2UXVA 4E9XA 1OF2B 1OTSD 2XN9D 2XI9A 4MJJA 4XVJH 2JIXB 3ZE2F 2B1OA 1NAKH 3GI9H 2JV6A 4K9EL 2XX1A 1FNAA 1DQJA 3IJYA 2VLRD 4KK5D 2NUPB 2NR6D 3SYQA 2CG9X 1AQDA 3D52A 1FAIL 3WSQH 2KSAA 1RJYA 1DBKH 1XR8B 2VXQA 1TJGL 3GEFA 5TF0A 4R3SB 3L17A 4Z3TA 1YEFH 2VUYA 3SE3C 2E86A 4K3JH 2DJMA 2EIEA 4XP1L 3HG1A 2I07A 4NZUL 5I1DB 1QKOA 3L9RA 5H2MA 5J57B 3ARFA 1QRNE 7PCYA 1VCAA 5IQNA 1YCSA 1KTCA 3ECVA 3GHEL 4XO9A 2D73A 4E5XA 4UOJA 1ADWA 2XC8A 1A6VL 3P4MA 2PPCA 3APMA 1F4WH 3G5YA 5F9OH 3ARDD 2OMZB 4HUWA 4KQ0A 1ZY9A 5DJDB 2CA4A 5L4MA 1GJIA 4L1BA 5DD1H 2OMUA 4NQED 4FNSA 1XT5A 2L7UA 4RNRB 1QZ1A 3AYMA 2OL3A 2VZSA 4P07A 1RHHA 4NP9A 3HRZB 2GK0B 2OULB 3CVBA 1QASA 3W11C 1RLWA 2IDUA 4M5ZL 1GZMA 3NZSA 1A1MB 2HKHH 1XGRA 1Q72L 3GB7A 2ICWB 4NKMB 3VI3E 1X7QA 3ZUNC 1WISA 5AKVA 4DP6X 1ED3A 1FDLL 3JUZA 4P5TB 4UM9D 1TEFA 4FA6A 4JQVA 1ZLSH 2B1AL 5H2LA 4HG4K 1S4IA 5FECA 5IR1A 5F9WC 2Z64C 1I7ZA 2GIYA 1XGUB 4BCYA 5T33L 5C08A 2Q8AH 3N3EA 4G8EA 4ZUVA 5JHDB 1XF3A 2YGOA 3IMRA 4JRXA 1NGWB 3IS1X 1KZYA 2WP3O 3L4WA 3QZWB 3HE7B 3WAKA 1QSVA 3CK0H 1GPOH 4H2CA 3L5WB 3GKZA 4LZKA 1EZVY 1M3IA 1C9SA 3FB7A 1YY9C 1BQSA 1NBYB 3NCFB 1X3DA 4X50A 3JWNH 1PY9A 1KCVH 4P4KB 3AG1B 3HHSB 1OCRB 1T7YA 5IMMA 5BOZG 1DVXA 4R8WL 3DGGA 3ZXAC 4FFZL 1H8OA 2F5BL 3MJ9A 1CICA 4YQXL 2L7EA 1AACA 1PYWB 4W9IC 4HEME 3N6YA 3NYKA 3NIFE 4PD4J 3LKQB 1XZWA 4Z76A 4D3CL 2C9PA 3SGKA 6PAZA 4D8OA 3GUFA 4AQAB 2G2PA 3N1GC 4B6ZA 1T0MB 3N06B 4D0CA 1NMAL 1EVTC 4U6VH 2WPGA 3DUSB 4JFZH 4GRWH 3HN5A 5A2FA 4NX0A 4P2OA 2CO7A 2CIKB 5KYYA 4PJ8B 3D2UD 2NY0D 5GIRB 2EDBA 2R4SH 4AKPA 5KYUA 2UX6A 4PJHB 5EFIA 4A2HA 2AV7A 5L9DH 1M1XB 1MFDH 4IKLA 3NJGA 4HWBA 4XCEA 1FL3B 4OCWL 3QUYB 5C0AA 1F3JA 1MFBH 4GW5B 4JFEB 1JWSA 4MJ6A 4BJLA 4BHUI 5IFHH 4TQPA 2DWSA 1M7DA 2B7DT 4ESKA 4HH9B 4RFNC 2JI2A 1Z3RA 1I1AA 4MNGA 5LGHH 4AIZB 5EIIA 3CBRA 1QRNB 4BELD 1TJIH 3US0A 1NIBA 1BYPA 1M05A 2Y5QA 5HHQA 3TC9A 1OT4A 3DHUA 1FH2A 2AAAA 3LNGA 1H6FA 5B6XA 1SQ2N 1TYRA 2IADB 2Y2WA 3J27A 3FN9A 4L4VA 4XMLL 4NENB 2QGBA 1NMBH 2SEBA 3DK0A 3F5WB 4PJGE 3PLYA 3TBBA 1QMUA 1RZFL 2JIXD 4JR9L 4DAGH 3LKNA 4PJAA 3FTYA 2FJHA 4FCAA 3TN0A 4WW1B 2FT7A 4JO8A 1MRCH 2VLRB 5MENB 5DQ9A 3N42F 1YHPA 2WINA 3GJFA 3TGXA 2DQIL 3UJJH 1HH6B 5IHWA 1CDUA 5BW7C 4X6FB 3ZE0B 1WAAE 3MJ9L 3LXUX 3GDBA 5E1QA 3BAEH 4I18B 1KELH 2ITEA 3FFCD 4DQOL 2YEZB 4LGRB 5CNHA 1V7NH 1U2YA 5DJ2B 1NWOA 4GAJL 3UO1L 1GOGA 5TTRA 4PJIE 5AL0A 4LOUD 1X5KA 4LQFL 4LOUC 1QA9A 5T1MB 4FERA 1PQZA 3LIZH 5AAWC 1NC4A 5D1QB 3ARDB 4O2EB 4B53A 4PLNC 1PMYA 5KBNC 4BWUA 1UG9A 1HQRA 1VLXA 2MHAA 3WHE0 2FSEB 4JFVA 5EO9B 3II3A 2LLLA 4V2BA 2XWXA 1P7QD 3KJ6L 1XAKA 4JG9A 5DHYA 1T22B 2VLME 1AZVA 2IQAB 2AVFA 5DHMC 5FYLE 1WWAX 2BNRB 3S34L 1MXGA 3QUZD 2XG4B 2F18A 3RU8L 4PVBA 4LCUB 4U1NB 1BMWA 4X31A 1J12A 1DBBH 4OT1L 1JFPA 1KBPA 4E41B 4HALA 3DX6B 4MCNA 5KS9F 2D8KA 3UFIA 3NZ8B 3V5DB 5FO9A 2OBGA 4X7TA 3RPIB 3NEOA 2DQJH 1N0XH 1XH0A 4X6CE 1W6WA 4DO5A 2JKIS 1HWHB 3ALWA 1E42A 2G2NA 2CM5A 1AGDB 3SY6A 1O0AA 4MNGB 4NQDD 4URTB 1TZGH 2CR6A 2NTFA 2ZAIA 2XT1B 4F7MA 2DQDH 4HZLA 4WHYH 5L6YH 3TV3H 2MEJB 4WTZA 3WKMH 2X1OA 1YPZE 3WKQA 2ZXBA 3CLWA 4NPKA 1NCWH 3AG4B 2GTZA 3O45B 4WI5A 2VLLA 1Z0NA 3LH9A 1H3GA 1Z5LB 3V6ZA 4LSDA 2FJHB 2JJVA 5K1VA 3QPXL 3BIBX 4BHUA 1BOGA 4EUPA 2CDFB 3E8UH 4YLCA 4PG9A 1BW8A 3GPSA 4BSVA 4NLAA 1VFOA 1V05A 1BEYH 1E5UI 2H1PH 4DZ8B 2JJSA 1DLHB 1J86A 1K4CA 1ZSDB 1JPGB 2CLRA 2PXYA 5F7WC 1IBDA 4F5CE 1U6AL 1Z66A 4XZUA 4AIZA 5JPMB 2NW2B 3CZFA 3Q5YA 1L0XA 2CM6A 2IV9A 3S4SB 3U1SL 3WNOA 4I77L 3W37A 4LHJB 2F93A 4OD3L 1JGJA 1U91A 4S1QH 3OKMB 2I69A 1MWAH 3TN0D 2BCKA 4LLWB 4GRLD 1JFQL 5F96L 4Y16C 1D5XB 1YEHH 4WDIB 7CGTA 3E7JA 2NY5C 5FKAB 3N1FC 3ZYOA 5B1JA 2QVKA 4WSKA 2X6VA 4LSRH 5D2LE 2NCMA 3O6FB 3EMLA 4XZ4A 3Q13A 3BFOA 5MEQA 1S51A 4LF3A 1MXDA 4BDVA 4NERA 4M8QB 1KACB 2W81C 3D25B 4CU8A 1F3DH 4I18A 3W11D 1FL3A 5D5ME 4AM0Q 4AGQA 2B4CL 3KGTA 2V7NA 4TLTA 4F9LA 1AANA 3EHBD 4Z7OE 3VXOB 3MOBL 3VM7A 4KI1A 2XY2A 2VDLL 1QO3B 5DQDH 4ZD3H 3IM1A 1U58A 4YPGA 2ZPKH 4NGHL 2XPZA 4IBYA 3QHFL 3HG2A 3LSOA 3KLLA 4HD9A 1WFMA 5ICYA 2H1LM 4FP8H 4JN2B 2BS71 2LU7A 2AHIA 2YUXA 4HUXB 2H0PA 4IBVA 3VA6A 3HZKA 1T6BX 2AQSA 2YMOA 2VJ0A 4ABUA 3P40A 3T4YA 5ICZA 2Y5EA 4OZFA 1URZA 3PHOA 1E8ZA 5F8RC 4WHTA 4LOFA 3O45A 3W0WD 1CS6A 5MENA 4M6OH 4NCC2 1OAQH 2IBBA 4PIBA 3HG4A 3BW9A 1HIML 4QI3A 4UT6A 1HCZA 2R27A 3CVIL 1DHKA 4HF5L 4HJJL 4KHTH 1KTDA 5BOPA 4PB0H 5EEUA 4DERA 4DCQA 1R3JA 5I73C 4C56B 1MWAB 3KPOB 2KL6A 2YLHA 2OV0A 1S7UB 3MLVL 3BDYH 3VDAA 4O4YL 3VGAB 4LCYA 4UHRA 1GZPA 3D4ZA 4J6RL 4TSBL 2CUIA 4FQHA 2XXFA 1FVEA 3QJSB 1G7HA 2P8LA 4KXBA 1FCGA 4PR5A 3IXAA 3VSVA 2FAUA 4EE2A 1E43A 5CGBA 3QC6X 2N7AA 1IXFA 5HTSA 3TZVC 5J4MA 4ZXBD 1OAXH 1NKOA 3SJVA 1AGCB 1J8HB 4ACPA 4HWZA 4QOKD 2HFEA 3OF6A 1W0VB 2WP3T 2AJUL 5GXBB 1HT6A 1WAEA 3K7UA 5C7XH 3SPGA 1W8OA 2P5WD 4XNXL 5EA0H 3B7SA 2X87A 2Q1EA 3PL6D 3QIBB 4IEFA 4IU2B 4N1EA 3RUGB 5TDOB 5ID0A 2Q9OA 2RJMA 1INQB 5BV7H 2BFGA 1JZJA 4U3SB 4JM2A 3DRQB 1PSKL 4PSRA 2ZWSA 3HG1D 4QYOA 4BBWA 5KKHA 3REVA 5JJJA 1XIWD 3MGOB 4XBGB 3WE6B 4ANWA 1N6VA 4X4XA 1KMEA 5FUOH 2ORBL 3KPSE 1SPDA 3TYFA 2P26A 2NNRA 4LLUB 2VXTH 1DUZA 4MX7B 4E9QA 2FEDC 4N90E 4FQPA 1YEEH 1WIOA 4YHNB 3INUH 5HPMB 2UZXA 3VXRA 3V55A 4A2DA 4F58L 3LQMA 4OFDA 1D5IL 2XLLA 1VACA 5GS1C 3WGUB 3V6ZB 3QULB 3SY0B 5AQ0A 1ZHBA 2X0UA 3G6AA 1FFOA 4J1UB 2WWKO 3DXAB 3OAZH 4J3BA 2APSA 3E1F1 4WJ5B 1RU9H 2BCMA 2A9BA 4KMQA 4QRSB 3VGBA 1F4YL 3T6WA 5LWEA 1OTUD 3NZUA 1E50A 1HHKB 1RIUL 4QRUA 1JPTH 3BWSA 1XD1A 2V3DA 1T5XA 5ELIA 5T5NF 4KPHL 4UT6H 2R15A 4JRYE 4XBEL 4YHIB 4FQQB 1DO6A 3ZQWA 1BPVA 3J7HA 2QQNL 3UCQA 4L1LA 4OGQC 1C08B 1A7QL 2ZCHH 4KV5F 4Q6IA 4U33A 4X0NA 3OKMA 3DX9B 5CU5A 3UTTB 4B95C 1S46A 2EABA 4HUMB 5KSAC 1ONQA 2C1OB 2ZSWB 3A21A 3ARPA 3TT1H 4EOWL 5JHDA 1IAII 1NGYB 5E5MB 3FN3A 4HSCX 4ZUTA 2BP0A 1U8IA 2EDHA 3NJVA 4M6AA 1ZKAA 3FO1A 1OK0A 2QVTA 3TL5A 3HI1B 3QJXA 1CLYH 4KWUA 1VFMA 1OP5H 2ZXEB 3BD3A 4M3JA 2F5AL 2O5XL 3GMQA 3Q1SH 5CN1A 5DRXB 1Q38A 4AIEA 4JVUA 4KZEL 3D5OF 1FBIL 4JE4B 4PBXA 2GB2A 3KM2A 5MI0C 1HQRB 1I1CA 2MHAB 5LG1A 2IAMA 4ODVL 3BAIA 5EIVA 5L2JB 1AY1H 1DSFH 3AAZB 3BT0A 2J6EH 1OGPA 3TU6A 1KEMH 3BZ4B 3MCLH 4R4FL 5C9JA 3AM6A 4HOZA 1RPKA 5EOTB 2CLVA 4GPVA 4OAWB 1MG3C 2IDFA 3WEAA 1ML0A 2GAZB 5MEOB 4AY0A 5IB1A 3AITA 1I8KA 4UUJA 1ETZB 3ABMB 4EEEA 3SEPA 5SWSE 2AK4B 3HS0B 3H9SE 1I9RL 1HN1A 5GGTA 5KSUB 4G6KL 3QIWB 4ODTL 1TR7A 4PVNA 4ZW6A 2ZCLL 3GHEH 4OKVA 4EXKA 3HB3D 2ICWJ 4XPFL 2H7WA 1PF3A 3L3IB 2J4WH 5KSBB 3DMMC 1BMZA 3UTXA 2E27L 1YO4A 3MACL 1G94A 3U4EA 3ZKND 1EO7A 2EXYD 2NY2D 2P8PA 5F0MB 2C1PA 4OLZL 4OLYH 4DVRH 1MCIA 3K2UL 3CC5B 4ZMXA 1J8HD 3CX5K 1HQ4A 1E9PB 2NY7H 3KJ4B 3OR7B 3R0MA 4P23D 4ZAKC 5GGVH 5ID0B 4NWUH 4M8RA 1XHHA 2NY1C 2BRRL 5E2VH 4D0BA 4L0YA 1R6VA 4YDJA 5C0CE 3QCTH 4KQ3L 1EGJA 1PPIA 4P23A 4R4NC 1YDPB 4LCYB 3ZZSA 2VLRE 1I31A 1ZVHA 1J8RA 4GH7B 4LXFA 4LLYB 5D1ZC 1TQBC 5FV2A 1BVNT 1RJZB 1U92B 2E74C 4BWWA 3ZUCA 5DUPH 4FE9A 1BAGA 2VQTA 3FB5A 3M1OA 5A2LH 2AERT 3DK2A 3ETBJ 3UC0L 4PJBF 5TQ2L 1KLFA 2QKIB 3K2MC 5GGQH 4PRDB 4APXA 2FWSA 5MP6L 3B83A 2YDOA 4XXDA 4MKMA 1PG7L 1BJ1H 1ERNA 1I4FB 1KB9J 4PJDB 1N6QH 4X4MA 4W9FC 2BP0B 4HU2A 1M53A 3QB7C 3ELQA 2VZTA 4U1JA 1KPRB 3JZYA 2DD8H 2GQHA 1HNYA 3BPLC 2QVFB 5B7EA 3P73B 2XXGA 4JKPL 4ES9A 2C5DC 1BQHB 3MOQA 3QBGA 2BCKB 4LLWA 4ZAKD 2VRQA 3PWUB 5I1GL 4I0PB 4IAQA 2XICA 1NTDA 4L2YA 5E6RB 2QHLA 5CJQH 2F15A 3RIKA 1EHKB 2VJ8A 1PVHA 5AZ2H 5CEYA 3WE6A 3NDYE 4MA1B 2AJVL 1QABA 3VFTB 3WFDL 4L5FL 5BUPA 1SM3L 4TKWA 4FGMA 1GW6A 4N5EC 1JYVA 2QSVA 1I8KB 5AAPA 4OGAC 4PJXF 1Q94B 5GRWA 1XCQB 4OCWH 4IMLB 3L3GB 1AGEA 3WOVA 3E0GA 2WLZA 4R7DB 5C0FB 1AR1B 3L3OC 1I3GL 1B2YA 3H53A 5SWZE 4RFEB 4PLKD 4DF9A 3V0VA 1RP9A 4JDZB 1W0WB 1WBZB 3M7FB 5AUMA 3L8QA 1NANI 5E99H 3SJVE 2EH7H 1MFCL 3NSYA 3L4YA 3RL1B 1N3NA 3T3PB 3N50A 5CCJA 4CC4A 5JDSA 4QRSA 1AO7D 1G0YR 1EV2E 4FKHA 4TUUA 4AMIA 3C5ZC 3MBVA 3KLQA 3MNDA 1YNLL 3LKOA 1GS7A 4FYSA 5C1MB 4XP6L 3SE4A 3T09A 3VRJA 4OD2B 3JV4B 1OHZA 3EYSL 1T21B 4KO6A 1XWVA 1J1PL 4ACTA 1EZVX 1JYWA 3QBLA 2VXQL 1CK0H 1NDGB 3FU3A 4UUJB 3DX9A 4P46B 1GVIA 2YOAA 5HI3D 1DFBH 1DANT 1KFAH 1JHKL 2W65A 2K78A 1V55B 3NK3A 2CDFA 3PWLB 4KGJA 2I07B 3DYOA 4M3HA 1WZMA 4L05A 4LVNB 1WUNT 2FQGA 3AYNA 1XEUA 2MQCA 3QQXA 3BPNB 5J6HB 4HMDA 3TJHD 4OIIH 4XC1L 4IRZH 2X53A 1P5UC 4YN3A 2PXYB 4Y8AA 3BFWA 4EI5A 1YEWA 3S7GA 3UIYA 3V0FA 5JQHC 4XR8C 3AWFA 2P43B 4X7SL 5D1XA 4DVBB 4NJAH 2YD2A 2WGNB 3OKOB 2CDGB 2R0ZL 5GJTL 4AIXA 3W3BA 3B9VA 5E9DA 2X4SB 2DQCH 1WT5C 4P23B 4N6HA 2PO6D 1HILB 5LGHL 2Z93A 4X6DF 2B0SH 3C6SB 3MROA 2D7OA 4NM8H 2VITB 5KBPA 2IDSA 4MQXD 1B4JL 2Z31A 4RAUB 1MVUB 1VPOH 2FIKA 2ID5A 3SDDD 2Y02A 1N8OE 4XGZB 2JKLA 3U30B 1DVQA 1E3FA 5T1KB 4X9HA 1FQ9C 1EXUA 2Z31D 1OSZB 3P11L 1AGEB 3GBML 3WEMA 3VFGH 1A9BB 1MCPL 4YDLC 1GAFH 2DQ6A 4Q52A 2ZKYA 3UPCA 3LY6A 4HPYH 3FFCE 3EH4B 4U1MB 4YBQD 3O3EB 4NQCA 5AW2B 2X12A 1NM9A 2XWBB 4FX5A 4U1GC 4ABVA 1L0QA 1RIHH 1BPLB 1EZSA 3HAOA 1A3LL 3PXLA 4BA0A 5EF3A 2EXWC 4PGJA 3Q3GB 1HE8A 3IGUA 4QLWA 3WFBL 3W0WB 3MUJA 5DJ0B 3JVFC 5E8NA 3ARTA 4XX1E 3RIAK 2JXMA 4F15C 3T4YB 2D7TH 1BSIA 3JWDL 2HUEA 4DPRA 1TNMA 3MRPB 1JGLL 2B1HH 5HJ3A 4B3EA 3K46A 4WJ5A 3FYEB 4HGWB 5LXGL 1KXHA 1LLAA 3BISA 3CZUB 3ESOA 4A63A 2WWOA 2D2CC 2O5ZL 4PJ8A 1HS6A 2DQIH 3H9YA 4DS7E 4RFEA 2VDNB 5DJXB 3S34H 1LEKA 3K2IA 3QDGB 2BNQA 5A40E 5KANI 3OJDB 4FC3E 4JY5H 1WZLA 2QQLL 5EU4A 5HYSA 5BVJB 1F4XH 3B9KB 3VGHA 1HSAB 3N41B 5EOQH 5GZNA 1IW6A 1A65A 1AZZC 2YAOA 5B39G 4ZXBA 5KJ7E 5I15L 2FGWH 1O5PA 4GUCA 5TDNA 3QUMA 4B41A 4YXHL 3LIZL 2PKDA 5DHHA 5DS2A 4X6EB 3W56A 1ILUA 2B3RA 2DZEA 3QUXD 1T1ZA 5EZJB 3RGVD 2WJKA 4R5XA 2WLMA 2YRLA 3Q43A 4DTGH 3P4NB 3CDFA 5CAYB 3FUEA 4LPYA 3OE8A 2BH0A 2Q7YB 9PCYA 3TT3H 4ZPTA 1WITA 4XT1C 5J1SC 1T20B 4X32A 4U49A 3EKCA 3F6IA 4XOCA 3VD5A 1FZKB 1CDYA 3FF8A 3SYOA 3GUTB 3LPFA 4P46D 5C8JB 4NRYA 1MI5D 5DK3A 3B5GA 1SEBB 1IKNC 3FQTB 4XNUH 3MV7A 3DHPA 4LSTH 4M5TA 4XOAA 5I0YA 1OT1A 1VJSA 4MYWB 3TYFB 5MERB 1AHKA 3RWEB 1A02N 1NC4B 4OH2A 3BI9X 3MBEA 2WBKA 3D1MC 1FAIH 4YEEA 3WSQL 3A4EA 4L48A 5LXVA 1KWKA 4RMWA 1U33A 3V52H 4KKCD 1JPSL 1U93B 1FA4A 1LK2A 3P4MB 5JLZB 1X9UA 1D9KB 2PUQT 5DC2A 4G43A 5JXEC 3ROOA 3ULVL 3T6ZA 4S1QL 3UTQB 5C0CB 4C58B 5DXWA 1VGEH 4F8LA 1RZPA 2BOBB 4CMHB 4DK3A 4J4PC 5EBLA 2OR7A 3QDME 4XXJA 3EAKA 5CHNB 3T2PA 1UM6H 1YQVL 2DJSA 4EIUA 2QDWA 2ENJA 5F8UA 4HK3J 4JG0L 3X12B 4ZX3A 2X1PA 2ICWA 3IVKB 2X0VA 4PJAE 3KLAB 3M17B 3ARBA 3M07A 2XWRA 4H1LB 2WZAA 4HQQH 1C8SA 4L4VD 4QTFA 1ESOA 4FRWA 5JZ7C 4JNXA 1AKJA 3NCYP 1JUFB 4WFFE 4XN1A 4AQEB 4UQBA 2LFEA 1Q72H 1SF3A 3DURA 1MNUH 2YLKA 5EOCH 5JOEA 1DJWA 2XWTA 4ODHH 3SJVD 4HWNA 3NGBB 5E1AA 4P2CG 4MJIA 3KWVA 1JFQH 1R24A 2DMCA 3C60C 5F96H 2ITDA 2WNXA 4Y4HA 3MRPA 2NZ1A 3MV8D 2A1WH 3C5ZB 4HJ0D 2NY4B 1SJXA 3SDDA 5JR1L 2PWDA 2WC7A 3F00A 4QAMB 1HH6A 2KC0A 4MJID 4GO8A 4P9HL 5F97E 4PJ5E 5I8KL 2ZSVB 2LU3A 3MV8A 5M7QA 4F2MA 2F1BA 3A5VA 1RIVH 4RMBA 4NQQA 1UKSA 2WUBL 3A7KA 4FQLL 4AENA 3ZT7A 1YYML 2EDYA 3U2IA 4L1DA 4WHDA 3FH5A 2DTML 3RBSA 2O61A 5IHLB 2FB4L 4R7NB 4M7LH 4UF7C 4E5XG 3ARUA 1UAZA 4Z3GA 2FR4B 2YCYA 5H2OA 4NKIL 1GYAA 3NFPB 3OZ9L 1YN7A 5GGRB 3PAYA 5F1KC 3WNLA 3ZDYE 5DMKB 2FYYB 2X88A 5HJDA 1DDHA 1OSPH 1DVFA 3PFUA 1ODAA 3B2MA 3ECBA 4HSQA 4JAMA 2EEXA 4A2LA 3RKPA 1JWSB 1G9NL 3FHEA 2DKUA 3FJTA 1LP9A 2WM0A 4X9YA 4ZUUA 5GRVK 5IWLA 1CGWA 4ODSH 5K5YA 3DIFB 2GK2A 2YGQA 3LKSA 3FRPB 4FAAB 2EEDA 1MFBL 5DHXB 5IFHL 1OWWA 1BF2A 1XSJA 1FI8C 2FK9A 5TPWL 4G5ZH 3T6XA 4BUQA 3WEBA 1RUQH 2D0GA 1NCCH 5C0RL 3OSVA 1KGJA 3RWGA 4KDWA 3C6LC 2WZ5A 4LP8A 4A7UA 3QQ4B 2G3XA 3KWUA 1FL5A 5IQ7H 5FUCC 4PH8A 2BHZA 1L7TH 4OJAA 1RURL 4S10A 1CGUA 4AEHH 3GJFB 4N22A 4HK0A 2JK5B 2D0FA 1CXKA 1A2YA 1Q9WB 4N4WA 1F3DJ 4RISH 5AOMA 2K7PA 3WXWH 4U6XA 2X7LB 4U1SA 3GMNA 1OGTA 4IGBD 3D4SA 4O02B 4HPOL 1KN4H 2A77L 4KZEH 3CDGB 5HHOE 2DMBA 1ZD6A 1HHGA 3H9HA 4N6RA 4I87A 4CC0A 1A3RH 5LLIC 1IC5H 1KGXA 4EIBA 5LJYH 4XXWC 1MJ7H 2XA3A 1Q0YH 1A47A 5C2BH 4DQOH 3G6JF 1T04A 4MMXC 1KTKE 4RAHA 1DUYA 4KTDH 5DVLA 5TD4A 5HYEA 3OHXB 1RQ5A 4QCIB 1W80A 1ETJA 3PWVB 4MXVE 4BFNA 5HDQH 1NQBA 4M9OA 1KDJA 2BJML 4IHBA 1QFWL 3QRFM 1FV1B 4JHWL 2BHYA 3ZDYF 1R46A 3TYGL 1HDMA 3U6XS 5I0VA 1O0VA 4KJPC 4XN8A 4Z0BH 2WINB 5AVUB 4F2EA 3FSZA 3O6KH 1HYSD 1YUHA 4CDHA 3B2UC 4JO2L 4A7QA 4HVBA 3NCJH 4MCZA 1AR1D 1MLCA 1QQDB 3RTQB 3H55A 5C92A 1IM3D 2JNZA 5E8EB 3BEVA 5F7FA 1U8CA 2ZKHH 3SQBB 1N26A 2ATPB 3SPHA 3V6FA 3ATEA 4JRLA 2IC2A 3BAKA 1OARH 2IALB 1AT9A 5KVEE 4HOMA 5G36A 3O3EA 3DECA 4NQCB 1SDDA 5H2KA 4ZNEA 4Q97A 1AD9A 4PXKA 1KZQA 1MPAH 5BZXA 1UEYA 2IOIA 2DPKA 1JVLA 5FCSH 4G72B 5F21B 2NX5A 4M43H 1WBXB 4CU7A 1I53A 3DPDA 3F8UB 4I4WB 4FPDA 1U0QA 4JMNA 3MBXL 4R2GD 3T0EC 1EJOL 3QEHA 2EXTA 4PJIB 1RP8A 5GGUA 1KYOK 2BINA 5F44A 5BRZD 3IRPX 4LCUA 3DJTA 4HLZH 3SDAB 5K9KA 4HHWA 1AXSB 1IFGA 3OAUL 4FQ1L 2R1XA 2OSLA 3QQDA 4HIEB 2WXFA 3HI5H 4LEOA 2IDQA 4EJ1C 1RULH 1S7VB 1ZOXA 3QDJD 15C8H 5AVZB 3QDMD 2AI0H 3L5HA 3SDCC 3ULUF 1MJ8H 1FJ1B 1RUPL 1ZS8B 4YHKL 1A6WH 2NSQA 5LAXB 5J6HA 3SIKA 1PNCA 2QADB 4QR7A 3SDXA 2Z92A 3SE9H 3IXTB 2BZDA 5ECJE 1F18A 3HAPA 1TCMA 1YNKL 2OPCA 1O6SB 4L1SA 5AALA 3X1BA 2NNCA 2A4ZA 1BCIA 3MLXL 3RPBA 2KZKA 3HC4L 4LSQH 5K93A 3REYA 1XXFC 4F3FA 4LCIL 1INDH 2PYFB 1G7QB 1UH2A 4WDIA 5I0WA 4EA3A 2Q7YA 1JXKA 3WFDH 3LHPH 1JV2B 3GSUA 3H0TB 3RVTC 1N10A 3U30C 5ISZD 4I77H 1BBDH 1R84A 3DJSA 4FQXB 2CLZA 3VXPA 1C5CH 3N40P 3BKYH 2O26U 4XN9A 5I24A 2AQ2A 2JJWA 1ZA3A 4M7KL 1ZE3H 3LJ3A 5K1JA 2A6IA 3K71B 4IK7A 2G4GA 4QWWC 4JE0A 3F64A 1ZJBA 4W93A 5AVSB 4MXQC 4MZRA 1CLZL 2MNJB 5BV7C 2VZOA 1B2WH 1E28A 3HR6A 5I5RA 4OV5B 3ODUA 4XO8A 1UUNA 4N8PA 4UTAL 1AE6L 1KGBA 3IPBA 5D72H 5CD5D 2R29H 4KUZH 1IBGL 4O02L 2H26A 4D9QE 5KBMA 1LO2H 4XPTH 4BXVA 1EDHA 3WFHB 3R1GH 5TQ0H 3VFUB 3F7PC 4CMHC 1FGNH 1FV1A 3MRLB 1FO0B 2Z4QB 4K3HA 2F74A 3HI6H 1R3KB 4LLUA 2G9HA 1GMIA 2ICEA 3BP7A 5IJVB 5G5DA 2DBLL 4WW2C 4QRPD 4W4OA 3IDXL 1U8QB 1ND0A 3D51A 2ADJB 5T8IA 2XJLA 5TE6L 5I1IL 3V0HA 1HKLH 4M1CC 3UJIL 3ZKXB 5EUKA 5C0GA 4WWID 2V6HA 4H0GA 4XC1H 3QBTB 4AI7A 3CDGA 3IDGA 4IQHA 1Y0LB 3BVNA 1MF2L 4U4IA 4KROD 3RY6C 1LO0L 4FI8A 2CK0L 4HUNB 3QNXB 1I3RA 1RZIA 2IH3B 1TPXB 5DYOB 2DV6A 3OHXA 4LCCA 3VWKB 5GSRB 4ZFQA 1XF1A 5AW1B 3PQRA 5CUSL 2R8SL 2Y7MA 3WTXA 3KPPA 4ZSOE 4XP4H 2YPVL 4KKQA 4UDTA 4G42B 2NT1A 2ITDB 5G54A 1G7QA 5JIDA 2MOVA 4XNAA 1BZ9B 1DL7L 1HKFA 3DOIA 4LK4A 4NIYE 2TSBA 4BDVB 1R5IB 1X9RA 2E7BA 3JT2A 4DPCX 4LL9A 2ZKXA 3R06B 1QQDA 3MV9B 4DZBA 5B8CB 4Y16D 5I6OA 4XMKL 5EBMB 4EI6A 5L0QB 4U3CA 3FAWA 4POZC 3K80A 3ET9F 3HCVB 1MCPH 4OW6A 4PRDA 1CG9A 4UU9B 5AX1A 4APXB 4FADA 1NGZB 1JE6A 3W81A 3QZMA 2J88H 2GBUA 5EBWA 3INOA 1G43A 4QHMA 2WXJA 2BSRA 2LW3A 2XRAH 3WG7B 3WUWA 4YSPA 4MA8L 1S9KC 4KKNA 3ABWA 1RVFH 2MFNA 2NX5B 3FK3A 2J4YA 4IRSB 5GGRA 3S3PA 4FLQA 5I6PA 3S3DB 3S2AA 3UTPE 1E65A 3NBNA 1L3NA 1TSHA 1ZHKA 5INCA 3TASA 2AABH 1MY5A 2YEVB 3NA9H 1NGQL 2WQAA 1FFQA 3QWNA 5C6TH 2OYPA 4GSDH 3FQXA 4ETQB 4URKA 4WUUD 2WQSA 3TFBA 4M5SA 4JFSA 4NKQB 4OAWA 1SUHA 1F58L 3ULSB 3ERXA 1F13A 4WFHD 2KH2B 1A6PA 1SMAA 2ILLA 3CFQA 3Q6GH 1X9QA 3MJ8A 1EWHA 3WEXB 4Q2ZA 1MUJA 4G7YH 4KY1L 1QSEA 4KTEL 4FTVA 2XV3A 5IJVA 3THML 1KGCE 1A25A 2HA1A 3KCPA 1D5IH 3QDMA 2W9LA 2Y1ZA 4Q89A 1OP3K 1JMXA 4KK8C 4O9HL 5DJAA 3U4BH 3BSZL 5CMAB 2FJFB 3BAJA 5F7LB 5K9OB 3HE6A 1T80A 1OIOA 4ELME 1NCBH 1COBA 4HXAL 4YS4A 1L9TA 4LSUL 1D7FA 3CU1A 3JTSB 3RDTC 2J1WA 5LO7A 3S88L 4G6AC 5T5FL 2GUOA 1RIUH 3BIKB 1OGAA 2WXNA 3V4VA 2D9CA 3WY3A 3CFBB 4WY7L 5KTEH 3HOGA 1TENA 3ZMNA 3ULUH 3WKNA 3COCA 3K4AA 1GU8A 3E80A 3N1MC 4QKTA 3GLEA 4X8JA 5BQDA 1VGKA 4Z7QE 3O41A 4LDOB 4MJIB 3UGUA 4TVPE 1QSFD 1AOHA 4JFXB 4AMWA 3SGDH 3OPZH 3WS6C 4BZYA 3FC8A 3K72A 5E94A 1U8OB 4U2ZA 3U7YH 1H9DA 3DX3A 4R96B 3WHXA 4BZ2A 1C8RA 1NIDA 3VJ6A 5I8OL 2BY1A 1CLYL 2VLJA 3AACA 5CD5C 1C8QA 1ZVNA 4GSQA 1I82A 1MHPL 4V2CB 2WQUA 3UERA 1K8IB 4L8SA 5EDXA 3QORC 5A7BA 1YEKL 2QKSA 4Z7UA 4J3WA 2WCGA 3ZRFC 1RPQA 4YL4A 2OMBA 4AXWA 4Y9GA 1TIUA 4P3DA 5D7SL 5DJZA 5AZDA 3PGDA 3V6BR 3QUKA 4GAYA 1WUZA 4JPSA 4C83B 1AHWA 3NJLA 3ARSA 4P2RB 1SXSA 3Q5TA 3VX0A 4Y5YA 5HVGB 3TLRA 4HCRH 5HYJE 1BAFL 5AYUL 4EN3B 3K5SA 1CLOH 8FABA 3ZGHA 5JHLH 1EEZA 1JGDA 3MRHB 3SZ6A 1U3NA 3TPKA 4OCXL 1A7BA 2FGWL 2K4WA 5EU6D 5J7CC 1L9RA 3CFDB 2HFGH 5D93C 1CN4A 2HLFC 5B3JF 2DICA 1B3JA 5LXGH 1MCOH 4W9EC 1TFPA 2XZQL 5EN2B 3UZQB 4LKXA 1WSST 3CSBA 4PP1C 3GZKA 1BX2A 2BSCA 1KENL 4DKEH 5BS0E 1E0OB 3KPSB 4Q9BA 3I9IA 4RGOH 2NXYD 3U0TA 3MUUA 4MQSA 3KHQA 3X13A 3VWKA 1SLUA 3C6EA 4OLEA 5DJ6B 3SDCB 5JHLA 4OCLC 2OAAA 1GPOL 3LNFA 3QH3A 4C54A 1P1ZB 2WWNA 3BPNC 4RAVB 4BKLB 2F8OA 3EJYC 4NKOB 4HWBL 3ZKQD 3WUZA 4MBSA 4AM0A 3FQXB 3CFBA 4HFUH 1QBLH 5GISH 1HOEA 3VG9B 2RBLA 5IUCA 3D08A 5K9JH 4LESA 3O0RL 4WEBL 3TBCA 1M7IB 1NCIA 4UBDD 2I35A 4DP1X 4WV1A 3T0EB 1U3ZA 2Q0ZX 4JHBA 1LO3L 4J2XA 3GSWB 2WVTA 1BG1A 5I17B 3S5YA 5A7EA 4CA4A 2RR3A 3ZDYB 4O5LH 1JPSH 3STBA 3NCWA 4BZ2H 2BSSB 5BW7A 3DUHA 3ZHLA 3DSFL 3FRPG 4R4BB 4AEEA 3MO1A 2ZWKA 2PCXA 3HAEH 1HXKA 3FAXA 3MRGB 5IHHA 3RJQB 3GRWL 3U2SA 3I3EA 2F53A 4J5VA 5BVPH 4F7CB 3C8KA 5E9DB 3L81A 5C86A 4QO1A 4S2SB 2WLKA 5I18L 1PDKB 3OF6D 4FOMA 1NKRA 4NQCD 3L9BA 4NOFA 5SWSB 2IG2L 3LVTA 4JRXB 2FBOJ 4JY4B 2ARJB 3OE9A 3PDOA 5IQOA 5FA3A 2VDMB 1BIHA 5CM1A 4Q0XL 5IM7B 2VLKD 1KIRA 1VEMA 4YMPA 4N28A 1KGCD 2IGLA 2OA9A 5LGJA 3FSWA 4Z18A 1C7SA 2CBOA 4L4VE 3NRPA 2WQXA 1QFPA 2XWZA 4P3WA 1MQ8A 3BESR 1XB6A 4NZRL 3PHAA 1YMMB 4NC0B 4IARA 1DJYA 1SJVA 4MJ4A 4AITA 5AFAA 4S1SL 3IJSB 2W59A 1ND0B 2YUZA 3QA3B 4Q9QH 1CD1B 2Z8RA 1PG7W 5C3TA 4LKCB 4YLQT 1D2PA 4AEFA 4MMZB 4TF4A 3H3KA 3QH3B 3IGLA 5DDHB 4ILDA 4HCIA 4BM7A 1L0MA 4FXTA 2YN5A 1S8JA 1OEZW 2JXMB 2NYYC 4TM9A 3GHBL 3SKMA 4EIZC 1IV8A 1BWWA 3WY1A 1D7DA 1ASOA 2AEOA 2XX0A 2FL5A 4WVRA 2KPWA 3GRWA 1UCBH 3N42B 4X1HA 4QRPE 4H1LG 5DCCA 1XF2B 3NCEB 5C0AE 5BR2A 2BP8A 3LDBC 4FYQA 4L4JA 4QHNA 5JIMA 4OGXL 4HS8L 4WUUE 5D2LF 3KJ6H 3OKOA 2FCBA 3VU1A 3MX0B 5J11B 4UDTB 4IGBC 4OGYH 5C08D 3QWRA 2Q10A 3S97C 1DBAH 2X05A 3ZE2B 4NN7C 1P4LB 2HWZL 1HINH 4XX5A 5AW5B 1EX0A 3CC1A 3WFEL 2JJSC 3QCUH 1VFUA 3GM0A 1UACL 3AS3A 3QR1A 3H7BA 4TS6A 3T2NL 2H4EA 1UT9A 3JWNC 5FFOA 4YHPB 4BSWB 4QY8A 4CMMB 5EF2A 2IPTL 2N59A 1OARL 4PQXA 3FTVA 4LGPB 4YSTA 1IEBA 4JB9L 1QWNA 4R4ND 1WBZA 2CO6B 5ENWA 5C08E 2ESVD 2CCWA 1ZTXL 1WWBX 3DBSA 3R19A 2DQDL 5C7ZA 4N26A 4RISL 1PZSA 3C8HA 5J3HC 3FT4B 3MRJA 4QTHB 1BIIB 1M0LA 1BZ7B 3D39B 1J5DA 5HBBA 5LGJB 1HHHB 3M46A 4M7ZC 3D69B 2YXMA 5DC4B 2VE6A 4JZOA 2M2DA 4ICWA 4Y4KC 3VI4B 2WLLA 3G6JE 3QHTC 5BRQA 2DKMA 3U7WH 3KXFA 3IKKA 5C0RH 2WJLA 3MNWA 1MUJB 4YDVA 1T22A 2VM4A 1OCCB 1SHXA 3OXRA 3SGEH 4WHCA 1I1FA 4J8RB 1IGML 3Q8EA 4NKOA 4RX4A 1SY6A 2RQEA 2ISDA 3L5JA 1C5BH 3CH1A 1BRRA 2YD4A 1T7XA 2Z7YA 2BSEA 2XWEA 4Z95L 1W72L 2ED9A 3VXUB 1YNTB 1ZPLA 2H2SD 4JFOB 2K6YA 3TA3B 1TITA 1X5GA 1NMCB 4XI5D 1I1AB 4JO2H 2ZAHA 5C09D 3EYOA 1INEH 3VXMD 1RJCA 5D8JH 1FN4B 1BM7A 2KYIA 2QPSA 3PGFL 4NNYB 2Y03A 5I17A 4XAWL 1JPFB 5CEZL 3EYVB 3QAKA 1OT2A 2ZUVA 3SGEI 1D5MA 5FYKH 2ZUWA 3FB8A 4MZ3A 4OLWL 1MCLA 3ARGD 3I50H 1KC5H 4Z7UE 3JTTA 1Z9LA 3OTTA 2Y1AA 3NUKA 4LU5L 3DUSA 1XGZA 1DDTA 3V0JA 5HDQL 2VDRL 4FNTA 2P5WA 2ZAGA 1ZVSB 4K0OA 4Y1AE 2X0WA 3GK8L 5EU3A 3VO0A 1RUKH 3O6ML 4FI6A 5J7AA 3ZN6A 2E8ZA 5DFVC 4NT6B 4BKSC 1IFHH 4WW2B 4FA8A 3GMMA 3MA7B 2IBZX 2P52A 4J27A 5EUOA 4FFWD 1CLZH 1ADQA 2NY5L 4JANB 3QJUB 3QDHA 5CJOL 1KN2L 1SJEB 2CGRL 5KVEL 2PNDA 2NT0A 3LQAH 3QQNA 2VLKA 1V27A 1ZHLA 2PCPA 3CFUA 3G3LA 4N2HA 3VX1A 1JHLL 1G4MA 3QDJE 2XQ0A 1GC1H 2X3BA 4XI5C 2AEWA 4ZTOH 3EO9H 5M95B 2A83A 2A3TA 5FB8A 4PJXB 2FH6A 4JKNA 4Z0XB 5FFLA 2C3GA 2VIRA 5I23A 3AM8C 1NBCA 3D87B 2C7FA 3LRKA 3MC0A 3LEXB 3P4OA 2RACA 2HKAA 3OPUA 2A6DB 4AZUA 4G1MA 1R0AH 2B4CC 3DVNA 3V4PB 2HJKA 4U6HB 2WVUA 2AJYH 1T5KA 2BNRA 1HXMA 4H8WH 3KMDA 2XKSA 1OE3A 4FHBD 1EJOH 4JM2C 1RJLA 3IEAA 3WIAA 2DM2A 1S9YA 1TZAA 4B27A 3DGCR 2ZX9A 4HUUA 1OL0A 4AC2A 1RUAL 1UZ6F 4FJZA 3OKLA 2VW7A 4EN3C 2J1XA 3BH4A 2ROXA 4NRYB 2ZCKL 3LAFA 2X1QA 2NW3A 2A9ML 2LE9A 2IGFL 3FQTA 4QAWA 1KEGL 2ALAA 2Y07L 4NIKB 4G9FD 3TA3A 3GI8L 3X2QB 1KG8A 1AZCA 3STZB 1G6RB 5KJRL 2AKRA 4ELMF 1QHPA 2K4AA 5IQLA 5CP7B 2J8UA 4PUBH 1MCHA 1NJ9A 1U91B 2J21A 5B1BB 4HUVB 1F4HA 1CVSC 4ZFOA 3FQWB 2MCAA 3P4NA 1KGWA 5PCYA 1OCOB 5FYLD 4N8CL 2FJUB 4FHKA 1INDL 3HR5B 3FTXA 2XTJC 3OV6A 1NCAH 1G9HA 2CH8A 2FWOA 3PHOB 4OLVL 5F9JA 5AVTB 2F1EA 2DQGH 3OXSB 4BGDA 3U6RB 4ONGL 1JXGA 2X2HA 1SN5A 3H42H 5AW3B 4UILH 1M42A 4F9PA 3BRGC 2L7QA 1TTBA 1WV7T 3NCYS 5MEPA 4WENB 3OMAB 3PWPA 1QEWB 4TVSa 4UIMA 2NTSP 5E00B 5TE4L 1VZGA 2R23A 4Y9EA 3WNPA 3FZUC 3F12A 3IGAB 1CICD 2VCOA 3GSVB 4M6NL 3INUL 5DS1A 3OAXA 5D6DA 4J7RA 4TUJA 4PJCF 1V3MA 1G0DA 4HZLB 2Q3ZA 3NP3A 1HHHA 2MTAA 1MFEH 1U2CA 3NACH 1UATA 2ZYSA 4CKVX 3PGDB 2D4FA 1DE4A 4CN4A 1YEDB 5BUAA 3BDXA 1AO7A 5LDSA 12E8H 2R0LH 4JGUA 3V4PA 2HJKB 4OZFB 3HUJB 2H47C 2VN5A 3PP4H 2JI1A 2ZIDA 2EXSA 4R0LA 1ZLUH 3THMH 3ZKMD 3WLWC 2DQEL 3AB0B 2EYSA 4IOIA 4NT6A 4XN2A 4LSSH 4BSVB 1I9JL 2NUTA 2QMJA 4J3VA 4MRCA 4FEMA 4PJIF 4ZW8A 2YPVH 3C5JA 3N9GH 3NSBA 3VQLA 1MZYA 5CILH 3S8FB 2VB5A 4KKLC 3P0YH 4LDCA 1HI6A 3H1ZA 1EFQA 1JF5A 1A7PH 4G7VL 3P0VL 2OLDA 3BC9A 4E68A 2F8VA 4I2XE 4XMPL 2F8IA 1YN6B 2FR4A 1FL5B 2NXZD 1RZ7L 4UQEA 2ZX7A 1KIUB 1UFGA 4I3SL 1U3HD 1H3VA 2D03H 4OZFG 2J55A 5HGBB 4R5VA 5LBSL 2ADIA 5IQ9A 3ZE0E 1EAOA 4BQ9A 3KPQB 2O5XH 3Q1SL 5I1DA 5IF0B 1I7RA 1JGUH 2OR9L 2PO6C 2ZYRA 5ALCL 2H6PB 2PN5A 5DWUH 5IHZB 1AGCA 1E9QB 3TWCH 3CPUA 1CF1A 1YEJL 5KS9E 2YPKB 4XNYH 2F74B 3KXFE 2GT9A 3F85A 3AGVA 1IVTA 1XVSA 1NEPA 1H0DB 2I25N 3U6RA 3D33A 1X5JA 5A45A 3QEQE 4HWUA 4XVTL 3PWJA 2VJXA 1ES0A 1GIGL 1HFUA 3QP3A 3A67H 4ERSH 2WBJB 3AW5A 1ZWIB 2H45A 3WN5B 4J3OG 2X3AA 3B3IB 3O9WA 1ZIAA 2OMWA 1P4LA 4ZS6C 3FYIB 3BUBA 4KRPB 4MAYD 4QHKJ 1X9LA 5FO2A 3EO1A 1I8MA 1F41A 1RY7B 3NGBC 1PY4A 3JTBA 4MGXA 1Z9MA 3UMTA 1HNFA 5AB2A 1N8ZB 1KBVA 2XRAL 4I48A 4XNQB 1E40A 4EXPX 1I8IB 4RESB 3C8KB 2NZ9D 3GWJA 3CXHK 5E8EA 4KFZC 1NCBL 3CMOL 4PP2B 4P3CH 4U2YA 5L8LB 3DQBA 5I74C 5JHLL 1J8HA 1QWHA 5IHUH 1NAMH 2QSCH 3TNNB 5I76A 3T8VA 2XIIA 2IPUG 1AD9B 4NSKA 1YG9A 2FX9L 2NY6C 4J1UA 2AJXL 2DKSA 3Q6GL 1K8DB 5L2KD 5DHDA 2QPDB 4KTEH 1E5YA 1FGVH 1UKTA 3R18A 2L4OA 2WXQA 3DARA 4QYOB 1YEGH 4YDIH 5TK2A 3VGAA 3AXHA 4H8VA 1VFAA 5IROD 2W60B 4TUKL 3O2DA 3ILDA 2FBJH 5D7LD 5T3ZH 4G6FD 1T6VN 3EDDA 5FK9B 1LO4H 1A21A 5MP6H 2Y36H 4RMUA 4J8RA 4MZ2A 4E9YA 1LD9A 5JXAL 4HDIA 1FL6A 1KIUA 1Q90A 1Z9PA 3MNZA 4HJ1A 3T45A 3PWHA 3TO2A 1N67A 4Z8FL 4KU1A 1H8NA 2XPGA 1G9NC 4BRVA 4N0UE 1BQLL 3CFCL 1SLVA 5CIPB 1EHAA 1MIML 3L1FA 4TNGA 2ESVE 1KSRA 3L3JB 3P9MA 5MHSD 3OAUH 1QUNB 4FQ1H 3O8XA 4BUOA 1NFDE 4J3UA 5H2IA 1T5WA 3FRUA 5D2LA 4NWTL 5D9SB 3DXAA 1E5BA 4H8QA 2NUTB 4FFVC 1HL4A 4DW2L 1XB8A 4MVBD 1MIEL 5F3HA 4H0HB 1IT9H 3VXSA 5AYUH 3BSZA 1NL0H 3OPZL 4FJYA 1T5XB 3TIEB 1CU4H 2A74A 2QT6A 4YHLL 2Z1PA 2X38A 1HDMB 1M71A 3POHA 1FNGA 1QI4A 4JUSA 5E9AA 3MREB 4L5FE 4OQTH 1PZ5B 4U6YB 3V9EA 2I5YL 2NCEA 4HZAA 5I18H 2QGCA 4APQD 2ATPA 1NEZA 1AQKL 1XO8A 2VWEE 1VCBC 1OGAB 1BVLB 4ZUTB 1ZPUA 4GG8B 5JHBA 4XE0A 4ZO7A 2NY1B 5HI4D 4CW1A 5FYKU 3I02B 3KLKA 4HT1L 2LNLA 3EYQD 3VDBA 5DVKA 4PS4H 1WT5A 1PS3A 1K5NA 1TQCC 3RZCA 4J28A 4PGDB 5CEZD 1T2QH 1QI5A 4PJXA 5EO0B 2Y72A 1P6WA 2VSDA 5C0BE 4I4WA 1I8UA 2FJGB 4AOFA 3KL0A 1HEHC 4HKJA 4ETYA 3RFZA 5E94B 4C8XA 5F8QC 1R3IH 2V7HB 2WY3B 3QGVA 3O3UN 1ZK5A 2HRGA 1LM8V 3WY4A 3DMMD 2VE6B 3D0LA 1A6TB 1AE6H 3IJYB 3ZE1B 1PZ2A 2CLZB 1K8IA 4JPQA 3C09C 4NZDA 1U8KB 1WIPA 5IW6B 1JRHL 4N1HB 4XPTL 1G7PA 5JYLA 5IY5B 4HLJA 2E5EA 2MJWA 1QR1B 4P3DB 3NTCL 4M5ZH 3GMLB 5TJWK 4AT6A 3ROLB 2E46A 1HOCA 3FL7A 3MOBH 2YZ1A 1IZKA 1D3CA 4Y2DA 5JHAA 2NTUA 4ZYKB 1IGFH 1VESA 1HCVA 3ARGC 1XGPB 5HP5A 4TLUA 4KX9A 3IMWA 3FFCA 4NC2B 3VH8A 4BH7B 4U7SA 1ET8A 1P6AB 3FRUB 1MW1A 5E6ID 1BYNA 2WBXA 1MHEB 5LG6A 2JLLA 3A6BL 2AJ3B 4FQJL 5J12B 5GSRA 1RZGA 1BYOA 2VM3A 5ISZA 5IVZA 1B6DA 3O6LL 2P48B 2A9NH 1B9KA 3KZ8A 5JNYB 1E8WA 4GUPB 2IF7A 1BZ9A 1E4XL 1EUTA 1PZDA 4U1IA 5JYMA 5E2JA 1N8ZA 4MXVF 1AR1C 4FNPA 2VDQL 2F5BH 3KYMB 2R8SH 5I2IB 5DHGA 5JW5A 1NEZG 2Z8SA 4YJZL 2JQZA 4R26H 2QADC 2QHRL 3O4LB 5IJKA 5JUEL 3D39E 1U3HC 2XTJB 2HAZA 2G60H 3PHSA 3UAJA 4Q9CA 1PLCA 2H32A 3AG2B 3CDCA 3F7YB 2EDNA 3EOTH 1J8KA 2W0LA 4HH8A 5I1LA 4HBCH 3CZSA 4N8VB 4GY4A 4O58L 3S37H 3E9TA 3ZTJH 3RL1A 1IO4C 5IB5B 4IRZA 4N8VG 5F6HI 3VFRB 1Q8MA 1QPPA 2JMRA 1Z9OA 1ZA6A 2PYEE 3CN2A 4ZQKA 2O6DA 1P0SE 2VN4A 2Z9TA 4BSJA 4Q4EA 3BCDA 4JJ5B 3RX5A 1KTBA 4OI7A 2BSSA 2WAHA 2EDTA 3LKQA 4ODUA 4Z76B 4EI0A 5IHBA 3QK0A 2NSXA 2Q8AL 1WAAF 4KH9A 4RZKA 4ZUSA 3SBWC 4RGNB 4ZTPL 4UV7H 2VLMD 3QUKB 3U0PA 1LE9A 4Z7NF 1TYJA 4FABH 5KYYB 1UENA 3H3BC 1T89A 3VFWA 4BIKA 3NCBB 4XGZA 1DBAL 5AG9A 3N5AA 5F0LB 3F7VB 4QHUA 4AMKL 1SFDA 2W0FB 3S98A 4JFFA 1AC6A 4PJ5D 1INEL 5AVXB 5FUOL 1BBJB 1D6EB 2BZ7A 3IFPB 2GY7B 3KS0H 5B8CC 2VOTA 2IBGA 4G9DA 1PZBA 5F1NA 3MJGX 1T03L 3U4BL 1J5HA 2JKWA 3U46B 5SWZA 3OGCA 4HZ1A 4AVIA 1OGSA 1QRNA 1UCBL 4IBTA 1BDYA 3I6KB 4DTGL 4A37A 2WKGA 3SQOH 4ZAKB 1JGEB 1IGCH 4NRXA 2E76C 1Z3GL 4A2FA 1IFRA 1RJYB 5HVWA 3F7LA 4X8JB 3QDJB 5EZOH 1MCWW 3GK8H 4KK9D 4XP9H 2BM3A 3WS3B 3BT2L 4P46A 1JTOA 3VXQA 2V4LA 1IFHL 1I85A 5EBMA 2CIKA 1E27B 5DJCA 5AEAA 2ZNXA 3NOIA 5D4JA 2EDKA 1KBGH 1GUEA 1FCCA 3MXVH 5DJ2A 5FUZH 4NFDA 1OP5K 4P2QE 2ODHA 1A66A 3KH4A 5F7KC 2P45B 5D1XB 5HHMD 5JDSB 4GAGL 1MLBB 2AQNA 1QBMH 2XQYG 2FNWA 4JO3L 4L3CB 2HVKB 1QFUH 1AHMA 4FQXD 1MKFA 2XQBL 2VT4A 1RUML 4OSUH 4Z95H 3ZDZF 1YAIA 4YHML 3MQIA 4WI8A 5E51A 1FG9C 3C60D 4Y5VA 1DVZA 2Y22A 1JNLH 2TRHA 4L2LA 3CZEA 4HFWB 3VTTA 1X5AA 2WN3A 3QXDA 5ALBL 2CPUA 5HGDA 4NAQA 5CGYC 3PL6A 1G4RA 4R90L 2MQGA 1LHZA 1F2XK 1B88A 3SKNA 4R0LB 4ZUVB 3S3SA 3ISRA 5LCVL 5EMYA 3MUY1 4A55A 1FBBA 3QUZA 1K85A 1KC5L 4IKNA 3OMNB 1ZIBA 4JFQB 5FPIA 4RETB 3WIHH 3I84A 4S1RL 1SEQL 1Q0XL 3T0EE 1M7DB 5TGBB 3PV6A 5A2CA 2VXVH 2VDQB 7PAZA 3HAEB 2E7MA 3MV7B 2D2OA 1FG2A 2OXHA 5IMMB 1C12B 3L45A 4NZ8A 1N6UA 4JRYD 1TN0A 1BEYL 1J87A 2NY5H 2WCSA 4LCWE 4LQ1A 3L5XH 2HB0A 3FT2B 4MD2A 2IWGA 4GIOA 4AVJA 1PKQB 2ENQA 2I60L 2VM9A 4BCXA 1G7JB 4AM0B 2JH2A 2JKSA 4JRWA 2YD5A 5DD6A 5D2LB 1ORSB 3RU8H 4C55A 2WXMA 3BZEB 5E4EC 2QVMA 2E7HA 3OR6B 1SRDA 2XFXA 4ZPTB 5E2UH 3U4AA 5FR3A 1RIVL 4LU5H 3NAAH 4MD5A 3W39B 2JB5H 4R7LA 1C5DB 4IMKC 4XNMA 3GSNH 3QR2A 4CJ1A 5EEZA 5J13C 5DZ9A 1BX2B 1J0ZA 3SKMB 4NN7B 1WFTA 4GNKB 4KKLD 1HYRC 3OC5A 5HDBB 1IIIA 5ACMA 2V8MA 1KXQA 5BO1H 1CBVL 1TZGL 5F1NB 2DI7A 1P8IA 3NMEA 5KW9H 1PQZB 5AW7B 3QO0A 2CBPA 2GBTA 2V3FA 1SQMA 2JF1A 3HS9A 1UHVA 3QXVA 1EEUA 1DVUA 1ZCRA 4D8PB 2B4CH 1K3IA 3T0AA 3CBJB 4JR8A 1NDMB 3RWEA 4FG4A 1IBHA 1UWXK 4JS7A 5ANME 3MBEB 4Y19A 3KPRE 1SZNA 1E5AA 1MREH 3BJ91 1EEZB 1F3JB 4GW5A 1QSZA 3WCYA 4JL2A 1YEIH 1ZHNA 4NGHH 5LBSA 1M3JA 2X6AA 1EHLH 3V6OA 4A66A 2X89A 2HPOA 3H7BB 2OL3B 3TO4A 4K7PH 4F24A 1RUQL 1UM4H 5EH1A 1KIRB 3AQZA 4YR6B 4LF3B 3O3AB 4ORZC 2HTLD 2LR4A 2H3NB 4IOSA 2QTEA 1UOLA 1W9XA 1TQCB 3VFOA 2BRQA 2YD9A 5BRZE 5ENWB 2IADA 3FUDA 1S9WA 3GLDA 3VA2C 4DPAX 4BK4A 3KVQA 4G9DB 5DT1H 2KMWA 3QDGD 3UYRH 2E9JA 4RA0C 1FZOA 1IIKA 3QDGE 2EE3A 4BFBD 1DJZA 3NIGE 3GSXA 3QUMB 1LWRA 1DQDH 5HHMB 1CWVA 4YHZH 1BXAA 4X7FC 1YN7B 2BWDA 2R1YB 1JGUL 2OR9H 2GUYA 3MGTA 4KZDH 4FTVD 3IDUA 3DV4B 3ZRSA 2CRYA 2RD0A 5BCAA 3KR3H 3WYRA 2WLYA 3DYMA 4M1GH 5DD6B 5SV3A 1R24B 4DESA 5DEJA 2APFA 4PJ7B 4NFBA 1EHNA 3BAYA 4ELMB 3T0EA 1GZHC 2GJ6B 5IFJA 3PWPE 3OZLA 2OSWA 1TU2B 1YNLH 3KYOA 1JGVL 1YMHA 4DK5A 3FRPA 4JHWH 4AYBA 5I16A 1JK8A 3MRFA 4G2AA 2GJZB 3D0VB 3GSNA 3HAEA 2C9XA 1CK0L 4AWJC 5IB2B 1WA1X 5CSZB 3EJPA 1S7QA 5DYSA 2EIZA 5AENA 1OW0A 3G6JA 4LSSL 1FN4A 1LTXA 4XBPB 5D7IE 1IARB 2ZKHL 2PP7A 2UZIH 4K3EH 1L9PA 3U0WL 3U6XA 3DURB 4P3CL 1TYEB 3UPRA 1E4XI 1KCBA 4CBPA 1JFHA 2ARJA 2Z8VC 3ESNA 4ZFFA 1NC4D 1LNUA 4IRZL 3OMZA 4EIYA 3PL6B 1D9KA 1V3JA 2P5WE 1QP1A 1F02I 1KGIA 4HV8A 3VI0A 4Y1AA 2ZOLB 4X7CC 1ZVSA 5EU3B 2AF2A 2DMHA 3BVVA 3VI4F 3JQOB 4QHNB 5LBSH 4ZRGA 3CFIC 3VI3F 1FIGH 1ZV9A 4F2MB 1FGVL 1LK3L 3BVWA 2JAFA 1KCUL 2XWDA 4JO1H 2VN3A 4DGIL 1U30A 3GMRB 3RFZB 1ZSDA 4NO0D 2Q2EB 3WFZA 2OJEA 5IOPB 3HBQA 1MG2C 4FZEL 3BE1H 1GGTA 4NM8L 2O61B 3FONB 4OV6F 4UAHA 2B8OT 3ARFC 1CGSH 2C4XA 3OQRA 4FQHB 2RCSL 3G08B 2LABA 1NGXA 3EFDH 5JW4M 3S35H 1EJ8A 3A24A 2C4FT 2ED6A 3QYMA 4GUOA 3E6HB 4GRLC 3QFJE 4CVXB 2WYIA 5B39B 1BLIA 4B0MB 3H2WA 1UM5H 1MJ8L 1IEBB 1OCWH 3CH1B 1IC7H 5HPMA 3AREA 1NPNA 1WTGT 4N2LA 3TTSA 2WIMA 4HPYL 5DK0B 1M9SA 4KJPD 3MLTB 5IJBC 2BP8B 1RJLB 3F65A 4AL8C 4GW1A 1JS4A 4WI6A 2VLKE 5DEZA 3HNSH 2V2XB 1C5BL 4WO4A 1IGYA 2OFQA 3MV8B 3BSGA 5DRZA 4LCIH 2XBZA 1RZJL 1SFHA 5T1LB 5F7MC 1DQML 1OTUC 2WO4A 1LE5A 4BKTC 4ZTEA 4C56A 4MHHG 1HE7A 4IBSA 3V8OA 3IKCA 1C5CL 3BKYL 3TIDB 2DLHA 3V7MA 2XN9A 3EJTA 5EIQA 4C56D 1UJ3A 2I1XA 3V9FA 3WQJA 1MFAL 3STLA 4KXDA 1P4BH 3ML9A 2VDNL 4Y1TA 3C09B 4NDMB 1I1RA 2JE8A 1X5HA 5CP3A 2N7SA 3HBPA 5TFSH 3NY8A 1S3KH 3IGFA 5ITBH 5HHPA 3GMMB 3SE3A 5L4JA 2CR0A 4L1TA 1ID2A 2F6AA 4JY5L 2X10A 3DSNA 1CICC 3BO8A 5L88H 1NAML 3C6LD 4GRMB 5FHAH 4ZBJA 3AG3B 2VH5L 5J3HD 4HKXA 2P46B 2OYMA 1C1EL 1NPUA 3NIFF 3HC3L 1CYXA 1MIMH 2A4EA 3FB8B 4PV9A 3ZHKA 2WOBA 5L2JA 4WUUA 1BVKA 3DO3A 2H6UA 2ERJB 5DFAA 5HI4C 1RZJC 2DBLH 3LXCA 4JPIB 1IGTB 4NKDB 3C87A 2AGJH 2W5PA 4JFYB 3KPTA 1VA9A 4TUKH 2BNUA 2JK5A 5CZVH 5E2VL 2Z0BA 1AGFA 3OQ3B 1T66D 2NY4D 4XWGH 5CBEB 4DZ8A 4U7MA 2B2XH 4M1DH 1F90H 2LAAA 1I1AC 4JANA 3DRTA 4QKXB 1A7NH 4OKVB 2HT2D 4GIPD 3V5HA 1LXMA 3N2JA 4WKZA 4HV8B 3B2DC 1J05B 4JFFB 3MI6A 4DGWC 1D2OA 3D2TA 4TVPL 3ZTNH 3A6CH 4FFVD 4FQJH 1AY1L 2XHNA 5AOJA 4A68A 2N7BA 2UXGA 2IGFH 5E1GA 5EC2B 2IAMB 4KVNL 5HHVL 1TXKA 3MCLL 1BFSA 1K8DA 2R69L 4GQRA 4H8PA 5JPMC 3GBEA 3QXTA 4PJ9D 3DBXA 4YSCA 1XR9A 3FCSB 4TNWK 1XTLA 5IB2A 3RVUD 3T2OA 1X6LA 3IDNA 1LEGA 1JZGA 3TBWA 5MEQB 2IGTA 4PWHA 4W9GC 3QJHA 1W91A 1AXSA 1YA5A 2GIMA 3J8F7 2DQTH 2IH8A 4PCKA 5AKRA 1USZA 3EFFA 4XTNA 2IAAC 3B9AA 1FRGH 1UD4A 4Y1AD 3S3BB 3MFFA 5IROC 2EC9U 1J1XL 1DBJL 3D09A 2AK4E 4DHLA 4XVSH 4A1RA 5AAWA 1P2CA 3ZU8A 4CGTA 3EGSA 4UG2A 4ZO9A 2CXKA 4TLSA 4TL3A 3U4EB 3CZJA 1F8TH 3UIZA 4X4XB 2C1PB 4OF5A 1L6XA 1ZT4B 1OK8A 3L9EA 2VL5A 4C4KO 4Z5RB 3BUIA 5GGTL 1IMHC 2B77A 3HZKB 1P84J 3BVUA 3BWUC 1Z5YD 2CMRL 3MRBB 4P2YA 4WIQA 1XL6A 1KTLB 4QRRA 2PPAA 3S5LB 4XNZB 1BVKB 3VFUA 3OB8A 4I5BA 2UUDH 5JMOC 4FNLL 4KZCA 1I8MB 5DS8A 4M4RA 4U3XA 4LT7A 2O30A 3HC0B 2H3NA 3ATAA 4M48H 1S52A 5A16B 1E2ZA 5IFAL 3FMGH 2XNAA 4OCMC 1WH0A 3SGDI 4YHOL 1B90A 3UAFA 4UINH 2CDEB 1DQQB 1QM8A 3PP4L 4YE0A 1IJNA 3K0WA 3MNMA 1ZT7A 4G6MH 5TE7L 3MTRA 3RWFA 3PHQB 1FYTA 1UCTA 2OZ4A 3ZPRA 3PV6B 5TK4A 3ULUD 1W0WA 4NQVA 1LL1A 1IGYB 1S7SB 4JRYB 5FGCB 3QIWC 1DBMH 1CT8A 1G0XA 1UWFA 3QNXA 1I3RB 5F1SA 5F7DA 2OMUB 4Z7WA 1AQHA 3G04B 5JXED 4OJYA 4K5LA 4QXGL 4WW3A 1OSPL 5TH2A 1YAZA 4UQ3A 1UASA 2KQNA 5IQ9B 2KSYA 3HFML 3IKCB 4X4YA 3HVNA 1MVYA 3P4LA 1H3XA 4I85A 4PJFE 3MTXA 4I3SH 1T21A 4AQOA 4KTGA 3TONA 3OWEA 3RY4A 3O6LH 1JPEA 3U7YL 5CIPH 1YYLL 3Q2NA 4GG6E 2OZ4H 3GGWB 2EYRB 4IDJL 4PJCB 1XH3B 2PXYC 4ONHB 4B3VA 1PFOA 1ES0B 3CUPB 4WTQA 4GP5B 5KVDL 1TO4A 1A1OA 2GJZA 3D0VA 3GSNB 2BS8A 5D7IF 3HPLB 4YO0A 2L6XA 4N2BA 1H5BC 3GSVA 3OHMB 5I9QB 1TT6A 3V0VB 5F7NC 3VE0B 1RURH 1IM3A 2PMZA 3HG5A 3A67L 3KYNA 4ERSL 1LP9F 3G5ZA 1KBBA 4TUOA 5GHWH 2Q3XA 3QO0B 5I1JH 3DX0A 4I48B 4P0DA 4HYTB 2QDVA 2J57A 4OJEH 2V2WA 1JNLL 3LPOA 2EDEA 1CFQB 5HGHA 1KTLA 2D3LA 2WOYA 3EO0A 3QYCA 3G7TA 4Y2LA 3H56A 3VFTA 3LPPA 4YZWA 3S36L 2CRMA 4F5CA 3TNNA 2DEWX 4I18C 2BNUB 2HT3D 1BZQK 4JO4L 1X44A 2ZOTA 1CGYA 2J71A 3BGAA 4WSJA 1Q9KB 2WQRA 1F6AA 3QUHA 1XGQA 2NNAB 2N0KA 2BVTA 2W65B 1JVKA 5ICUA 1TQSA 2DOCA 3OLGA 3A0OA 3MFFB 2Y04A 3QEQA 1NGZA 4P5MA 4UV7L 5C07B 2Y69B 3SGJC 4F80A 4GRWF 3EGXA 2WNGA 2Z34A 4OZHE 1BD2A 4P59L 2FX9H 5ESQB 2R2EB 4F91B 2AK1H 1B4RA 1OVZA 4K9EC 1QHJA 3EH3B 1NGXB 2EXYC 5F0JB 4OTXH 3CSYB 1K9TA 1OLLA 5HY9A 2E7LC 1YPZA 4QTIH 3TWYA 1P5UB 5KYWB 1U8HA 1JG9A 4LCVA 4PJFF 1D7BA 2MPAL 3B2XA 1FL6B 4OD1H 4PAZA 5FCUL 1UOVA 5T3XD 5I1HH 3X17A 1MCJA 4JREB 3OKNA 4ZK8A 4DP5X 4NZFA 1EXGA 1GCYA 2BC4B 2X6UA 4NQDA 5A1AA 1S7RB 5I76B 2ZONA 4GAGH 2KS0A 3GMQB 2GW5A 5DJ0A 1HILA 3V4UL 5JQ6H 1YUKB 3ALXA 3P2DA 3WEXA 5KBKA 1UD3A 1LO3H 3IU4H 3TJEL 4M43L 1J7VR 4G6AD 5B1JC 1MH5B 4HIHB 4AT6B 1A0QL 1NGWA 4JFDD 3RNKB 4D9LH 3MUGB 4TULH 5AAMC 2AEPL 4QOKA 3K1DA 4MQTB 3CFJB 1SUJA 2Y06H 1AIFA 3EOAB 4QXUH 2BXZA 2FX8L 2X2IA 5AKTA 1GY1A 3OX8A 1WDAA 4R5TA 1MIEH 3D4GA 3KPSA 3QUXB 3RGVB 4F9LC 2J25A 3EZ8A 4R3SA 4JDEB 3U2JA 4ES8A 3G6JB 1F2QA 2DIJA 1VIWA 1HSAA 4DEWA 3PV7A 4Z7OB 4D2NA 2H1PL 3OGCB 1Q0XH 3NG5A 4AYID 5HYFA 4O2EA 1ZGLP 1SJHB 5L9DL 2C3WA 4Y0GA 4G82A 3PXOA 4OSUL 3O2WL 1MWOA 3O3BB 4YHKH 5DD3H 5C9KA 1EHLL 4DAJA 4TQHA 3WNMA 3FT3B 4WNJA 5D2NE 1JGDB 3OGOE 1JZ3A 1CYGA 3RZEA 4HIPA 3BJLA 3HMXL 1X5LA 1I8LA 1A1OB 4GKSB 4KMTH 3UTSE 3F2LA 4QF1B 2O5NA 4KRNA 1KNOA 3FBKA 5GRXG 3WIHL 3DI2B 4YDKH 4ALAL 2E7CA 5A3IC 1R3LA 4KKAD 4D7PA 1A4BA 4FLRA 3GSNL 3L3OB 1F6LL 3IPEA 3GBNH 3I9PA 4RIRB 4X4YB 3HG0A 4XCYB 4X9GA 2FVNA 2DWTA 5DEGB 3KR3L 3MZGB