2QPEB

An unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
166
structure length
166
Chain Sequence
b'DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
source organism Thermus thermophilus
publication title An unexpected outcome of surface engineering an integral membrane protein: improved crystallization of cytochrome ba(3) from Thermus thermophilus.
pubmed doi rcsb
total genus 40
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2qpeB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2qpeB02
3COCA 1A8ZA 4KOBA 4FBZA 2XV2A 3ZPQA 2GC4C 3AM6A 1A4CA 4WKXA 1N68A 5I6KA 3S3DB 3DQBA 1WA2X 2IDTA 5AZUA 3ZDWA 3VGAA 1XB3A 2BZ7A 3AYMA 3QJVB 5AHYA 1BRXA 1IC0A 3UONA 3QQXA 2VM4A 5A7EA 4GP8B 1CWQA 4HAKA 2QT6A 2I7SA 1DYZA 1PXRA 4LDLA 5AX1A 5G2AA 1A4AA 5IY5B 1GYCA 2IH9A 2KSAA 3HASA 2X72A 4JQ6A 1X9UA 4A2DA 3UZCA 1DZ0A 1KBVA 1OCCB 1W8EA 4JR8A 1UATA 1ZPUA 2R7EB 4L0PB 4YVNA 1RCYA 4UG2A 1AZBA 2GB2A 4CSPA 4GYBA 4G72B 3FPXA 3S8GB 5G54A 4A68A 1HZXA 2J4YA 1FWXA 3SN6R 3UG9A 2PCFA 4EF3A 9PCYA 2CBPA 3GYRA 2GC7C 5G36A 3KW8A 4FPDA 2XWZA 3OAXA 5G2CA 4AMJA 3NT0A 3BQVA 3HAPA 3ZX1A 3UGEA 1J9TA 3TBBA 1AG6A 4JKNA 3ERXA 2YAPA 3S8FB 3OMAB 5TGZA 4KNTA 3NSBA 3FYIB 3UTWA 5H2KA 4QIDA 4N4WA 2X88A 3ABLB 2Y04A 1M56B 1C8SA 1JGJA 4G71B 2Z55A 1YLBB 2FT6A 2Y02A 5B6VA 1JZEA 1WA0X 3NP4A 3CZUB 4BWTA 3NJJA 3QPKA 1M0MA 3H4FA 4KO9A 2W8CA 2P80D 3PDSA 5H2MA 2AANA 3T6WA 3QJUB 3OMIB 5AKRA 3PCYA 1PLAA 3T45A 1KDIA 1CURA 2CAKA 4A66A 4CSZA 1Q5JA 1XJIA 1V54B 2AZUA 3QJTB 4DJHA 4GP5B 1ET5A 1AZRA 3GDCA 1F88A 2FT7A 3FU7B 2XLLA 3NSYA 1BXVA 1JV7A 1AAJA 2GHZA 2XUWA 3NP3A 1MG3C 1KCWA 4G7SB 1H2SA 4GPOA 4NC3A 3OE0A 4PAZA 2DYRB 4E9YA 1E30A 2ZZLA 3NYAA 2MRYA 5B1BB 1A3ZA 1AACA 4MFHA 3ABMB 3VI0A 4FA7B 3RZEA 2YAMA 4BWBA 3FQYA 2IDQA 2W88A 1FBBA 3TBCA 1E5YA 3TA4D 4YSOA 5ANHA 1L9HA 2YAFA 4DP5X 1QHQA 5G53A 4UAHA 5H2IA 3WI9A 1AS6A 1U19A 5KKHA 1BQKA 4PCYA 1ZDQA 2FQDA 1CYXA 3IBOA 1NDTA 1IW9A 1OV8A 1JZJA 1IBZA 1ZIAA 1NWOA 2HRGA 4RH4A 5G2DA 5ITCA 1SF3A 1GS6X 3WNJA 2N0MA 1M9WA 5B1JA 1WA1X 2VM3A 1X0K1 2OV0A 3OE6A 1QHJA 4GRVA 3V2YA 1FBKA 4DKLA 4HHGA 4BXSV 1KG8A 2YAHA 2VSMB 2R7EA 2WO2B 2FT8A 2XXFA 3PWHA 3D12B 1PLBA 2AVFA 1R2NA 1KG9A 5B34A 1OF0A 1ZV2A 4P5RA 3REYA 1KGYE 1L9OA 7PCYA 4HYJA 2OCCB 3V2WA 4IB4A 3VVKA 4BDVB 1C8RA 5B1AB 4JKVA 1PZCA 1SDDB 3CVBA 2Y00A 3QBLA 6PAZA 1EZLA 2B08A 3X3BA 2EIMB 3SBPA 4E9TA 1XMEB 1X0SA 4BXVA 5A45A 1ETJA 3QDCA 3VHZA 1JZFA 3D4SA 5H2JA 3FQ1A 3SQRA 4BWUA 1JXFA 2QPDB 4HCIA 4WTQA 1SJMA 2JFCA 3DDLA 3X1EA 5H2NA 4LDOA 1PF3A 4A67A 1ET7A 1GS8A 1GSKA 1SDDA 1GS7A 1JXGA 3JTBA 3ZPRA 3KW7A 4WW3A 4QRYA 4Y9HA 3NJMA 1NIAA 1AZCA 2JAGA 5A44A 3ABKB 1A65A 4YSEA 4GXFA 1R84A 4KLYA 2YQBA 2BW5A 3FS9A 5B35A 3UZAA 3PBLA 2TSBA 2L6XA 3WNIA 1EHKB 2EIJB 3WKPA 5B7FA 3QBIA 5AWZA 4HCFA 4F2FA 3X2QB 3PPSA 1F4ZA 1KBWA 2IWKA 3DTUB 5AFAA 5C1MA 5H2PA 1OE1A 2J56A 4N8UA 3WG7B 2GBAA 3BVDB 1E67A 2XV0A 1AR1B 1NPJA 1UAZA 1AANA 2EINB 1P8UA 1L9TA 1BM1A 3PLYA 1JZHA 2LLNA 4F7KA 1OCOB 1SFHA 2FNWA 1BXAA 3HARA 3NS0A 1S52A 2I85A 1V10A 1MZYA 3ZBMA 2Y69B 2BWDA 1RZQA 3L45A 1IW6A 5G28A 2IWEA 1TEFA 2OJ1A 5B3SB 2G87A 2WJKA 3ODUA 3QAPA 2UX6A 1BRDA 5DHGA 1JZIA 2XX0A 1XIOA 4DP9X 4DPBX 4N4YB 2DV6A 2JKWA 4UF7C 2BRDA 4YSRA 3HAOA 1GR7A 2NRDA 2VMJA 2VSKB 2VW4A 2PEDA 2BP8A 2BP8B 1AZUA 3IE9A 1MGYA 2PPDA 4WAVA 1W6LA 4ENZA 5J7AA 3UADA 1E0PA 5H2LA 3PXLA 4AI7A 2KS9A 3NJGA 4YSSA 3GXUB 1NPNA 3X1FA 1CUOA 2ZONA 1WS7A 4X31A 2I35A 1L9QA 4E9VA 4OV0A 1CYWA 1X9RA 2UX7A 4DP2X 1MG2C 1KCBA 3T6XA 3NSDA 1TEGA 1BQRA 4BEZA 3C9LA 2Q5BA 3NYKA 4K9JA 1FFTB 4A2FA 3AZUA 5B6ZA 2PPFA 2FJSA 1ASQA 4X32A 1J5DA 3VG9A 4MQSA 3HB3B 4PXFA 1URIA 1F50A 1PY0A 3QJQB 3ZIYA 5B0WA 3FU8A 1RKRA 3UTVA 3MBVA 3FPYA 5AHZA 2F93A 4A4MA 4KO6A 3A7KA 1M0KA 5I26A 4E9XA 4NERA 1VGOA 3FSAA 1PAZA 3NJNA 5B6WA 1IXFA 2I20A 4XTNA 1QNIA 2VW6A 4XTLA 2FTAA 3NJKA 4X4KA 3CODA 4A2EA 5H2OA 3NSCA 4KO7A 1J9QA 4GY4A 2HZHA 3OE9A 2BWIA 1S8LA 2UXGA 1FA4A 4AMIA 1T5KA 4GBRA 3PAVA 1NIDA 1F56A 1E5ZA 1KMEA 5ITEA 2CCWA 2M3GA 1BAWA 1XB8A 2XXGA 2IWFA 4BV0A 3CDZB 3WIAA 3FSVA 2J5WA 3HANA 4M4RB 5I5MA 5B2NA 3P0GA 5A8EA 5B6YA 1JERA 3IEAA 4YL4A 6PCYA 3NY9A 2I21A 4YSDA 1PMYA 3NSFA 3HEIB 1BRRA 3AW5A 1GU8A 1PCSA 2FQFA 3CAPA 4YSAA 3UTYA 4MQTA 4X1HA 2XVBA 3X1NA 4YSCA 2LNLA 2HRHA 2BP0B 2BP0A 2H3XC 5LDUA 3OE8A 3UAAA 4DAJA 5TK4A 2DWSA 2UXFA 1TN0A 2NTUA 1HFUA 1XB6A 2YXWA 3NJIA 1DZEA 1C3WA 1NINA 2YAQA 1ADWA 4E9SA 2PP8A 4AX3A 1JFPA 1QLEB 4QI1A 4N6HA 4XT3A 3MX0B 4K5YA 1IKOP 2R4SA 5B6XA 3DKHA 5ETZA 3NJLA 3OD3A 2Y01A 1NTDA 2CJ3A 3X1BA 1L9SA 4AKOA 1NIEA 1AZNA 2PPCA 5B7MA 3C9MA 1KDJA 2YDVA 4G70B 3ASOB 2JAFA 4G7RB 3UACA 3QBGA 2BW4A 2FQEA 3NJHA 4P5SA 5F7AA 4W1TA 1NZRA 1WS8A 2GIMA 2VW7A 4KNUA 3PQRA 5B7EA 3SBQA 5I6LA 1S54A 3FYEB 4UHRA 1J9RA 3HAQA 1GZMA 1H68A 1BYOA 2QPEB 1NIBA 1WAEA 2CALA 1J9SA 4TXVB 4W9ZA 5I6OA 3AG1B 3AY2A 2H5UA 5JJEA 2YCZA 2DWTA 1CC3A 4Q8BA 2PPEA 1GUEA 2YAOA 1LN6A 2HX8A 4QKTA 1BQ5A 2DY2A 3ZEVA 3H4HA 2YARA 1S8JA 2I7OA 1PY6A 3EH5B 4G7QB 4HCGA 3FSWA 3QJRB 2YCWA 2AFNA 2IH8A 3SBRA 1JZGA 5EN0A 2HX9A 2XU9A 4AKPA 1VJMA 4DP6X 2QDVA 4HWLA 5PCYA 2ZWNA 3S3CB 3H56A 3CG8A 3EH3B 2WO3B 4BWWA 5AX0A 2YDOA 2PLTA 2X87A 3RFMA 3PXOA 3JT2A 1W6WA 5DYSA 1MZZA 1SHWA 2J55A 3C75A 2XYBA 2Y03A 2FWLB 2IAAC 1V55B 1QKOA 1TN5A 2NTWA 5DHHA 3WQJA 3DIVA 1O0AA 3OQRA 5F7BA 4BK5C 4JHVA 3UAEA 3X1GA 4BVNA 4JHUA 2CUAA 1ZDSA 5I6MA 1I53A 1JVLA 1NWPA 1GW0A 1S53A 5H2HA 3QJSB 2XX1A 2YAEA 3T6VA 1KV7A 1AS7A 3N2JA 2ZXWB 1OOWA 2HLEB 3NJFA 4HYXA 4Q89A 3G5WA 2RACA 5JJJA 1NICA 2PP7A 4DP1X 1VLXA 4AKQA 4FAAB 3CVDA 1P8IA 1ZIBA 1ASPA 2WSDA 5E9NA 4MD1A 3VW7A 1A4BA 1JVOA 4YSPA 7PAZA 2DYSB 1AOZA 1HAWA 4BUOA 1UCQA 3ABGA 5BR2A 2Q9OA 1IBYA 1RZPA 8PAZA 2Z73A 2XV3A 5EHFA 5TK2A 5B1JC 1OCRB 4F2EA 1ID2A 3FQ2A 4GYCA 5BR5A 2GI0A 2YCYA 1NIFA 5LWEA 3UABA 4M3HA 3ABWA 5FJGA 3NY8A 2I1XA 1SHXA 3CVCA 1PLCA 5PAZA 1TU2A 5JJNA 1IUZA 2IDUA 3ASNB 4HIPA 3OM3B 4XXJA 2WJLA 3EMLA 4PXKA 1N70A 3AG3B 1AG0A 1QM8A 3AG2B 2QDWA 2B3IA 1Q5IA 2P80A 5I6NA 4A2GA 1E12A 2UXTA 3V9CA 1ET8A 4EA3A 4E9QA 2VT4A 1KYAA 4HZ1A 2JXMA 1GY1A 4ZK8A 4DPCX 2YCXA 1BEXA 2ZFEA 2YXVA 1PZAA 3S3BB 4IARA 2R4RA 3IN2A 2HPYA 3IN0A 2EI4A 4EJ4A 1P8HA 1L9RA 1ILSA 2PCYA 4A2HA 5F8UA 2J57A 4EIYA 4L35A 4AZUA 2IDSA 5D4IA 2BO0A 4XT1A 4J4QA 3UTXA 2BZCA 1JOIA 3EH4B 2EILB 1HAUA 2EIKB 4XTOA 1ILUA 2VN3A 5I5JA 4DP0X 3AYNA 1SFDA 3PAUA 3QAKA 5B1KA 2Y1AA 1B3IA 4KNFA 4E9RA 1JV6A 2A3TA 1BYPA 3N55A 1ASOA 4DP7X 1M0LA 4YSTA 4TL3A 1AT9A 5I5IA 2RH1A 2ZOOA 2H47C 4HHWA 1QKPA 1X0I1 3U25A 4YSUA 1GY2A 4HALA 1MDAA 2PPAA 2GSMB 5AZDA 3TASA 2ZIYA 1J5CA 4YVUA 2KSBA 1PZBA 3EHBB 3KJ6A 2AZAA 4NB7A 3V9EA 3CDZA 4IAQA 4MBSA 4DPAX 4E9WA 1PNDA 2KSYA 3MBWB 4DP8X 4BEYA 3FU7A 3T6ZA 4YSQA 4L6RA 2PP9A 1OCZB 1PXSA 4KO5A 3QBKA 2FQGA 4KNSA 2UXVA 4NAJA 2IDFA 3AG4B 2BHFA 2TSAA 1S51A 4UANA 3FU9A 1L9PA 2HX7A 1L0MA 4DP4X 5D4HA 1E65A 3TU6A 3WKQA 1OE3A 3T71A 3RYMA 1AIZA 4KOCA 4BDVA 1OE2A 5I28A 4QLWA 1KGBA 1JXDA 3FT0A 1PNCA 1TKWA 1AS8A 5FC9A 1AQ8A 4LDEA 3EF4A 2AT9A 3FSZA 3X3CA 5D4JA 1AP9A 2E86A 4MD2A 1SF5A 2HXAA 1BXUA 2F95A 2MTAA 1M57B 3OMNB 5I6PA 3T9WA 1SNRA 1R1CA 4GP4B 3PAZA
chains in the Genus database with same CATH superfamily
4UMSA 2FUTA 3OKLA 4Y19D 3BGAA 5HHPB 2AXHA 3UFIA 2E7LC 1MW3A 1CGWA 2Z31A 3EYSH 4HCRL 4NCC1 5KVGE 1OM3H 2F5BL 2GKIA 3PFUA 1F1DA 5DSCB 1PY9A 1TSRA 1WFNA 2QKIA 4Y5YA 5DC2A 5HHME 4BFJA 1CXFA 3L3IB 3O4LA 4H1LB 4ZD3L 3WMPA 4Z3FA 2VC2H 4U1KB 3MRJB 5FOBB 2I7SA 5F9OL 3M1OA 2CG9X 3G6JF 1GTNA 1FDLL 3HG2A 2ADYA 1USZA 1G7JA 2IAMC 5MEQB 5DGRA 2R7EB 4JR8A 1A6PA 1ZPUA 5F7LB 5D1ZD 1FFNA 5DJ8A 3MNWA 5B3NA 4YHIA 4WEMB 4Q4IA 1GGCL 3DWTA 3SN6R 3PP3H 4JRFA 4M1GL 4O58L 3U7YH 9PCYA 3VGFA 4U6VH 3KW8A 3PQYB 4LSSL 5LCVH 1CFQB 1LE5B 4X5RA 1KB5H 3QFJB 5I75C 1YNKH 4GW5B 3D7PA 1DQLL 2UY6B 1MUJA 4PQXA 3OMAB 3C08H 4DTGH 1IGCL 3BD4A 4UZUA 3UBHA 4GJTB 3H9SE 4CSTA 5EPMB 3RL2A 5H8DA 5KSAB 5B6VA 2FJUB 1XF3B 4FQ2H 3T0EB 3OAUH 3IS0X 1EX0A 5J1TC 4NUJB 2WIIB 3GDBA 5DO2D 5D7HA 5FB8B 1F45A 4IEFB 5B1CA 4X6CF 4QHNB 2WXFA 5JHDB 4DUVA 2ZCHL 2BY3A 4DKFL 3C60B 3L6FA 2FUQA 2VITA 3AJ7A 1RU9L 4FQXC 2AQNA 1SLWA 2R69L 3MRLA 4IBTA 4WY7L 5I18L 1SOXA 1CFSB 2BSRB 1MN4A 5K59F 3OE0A 1MJUL 4PBXA 5B1BB 5EU4B 4BKTC 3ABMB 1EEYB 1WGOA 2W92A 3RZEA 1M2VA 1KIQA 2ZXQA 4YHZH 5SWSD 3NPSB 2W88A 3P11H 1EJOH 2DKSA 3JV4A 3U79A 4YSOA 5JIIA 3ZYIA 3OGOE 1MCKA 1VFOA 5H2IA 1ZJBA 4CGUB 4IIQA 1UA6L 3A24A 3BYTA 4NSKB 3DROB 5CS7A 2JJTA 5T8IA 3ILPA 4DZBB 4PJBE 4WU5A 3MPCA 1AHWC 2DQIL 1BMZA 1BZOA 1QPXA 2AXGB 4WO4A 5TE7H 3LIZH 3CSYB 4F93B 2VDLH 2XSKA 2XFXA 3S0PA 2NXYB 2QSQA 4GW1B 1KXQE 5K9OA 1O75A 4P23B 4V2BA 4WI0B 5BRZA 1F97A 2X4RB 3MBEC 2AI0H 2E3VA 3NVQA 2D03L 1S7VA 2DQTL 4Z23A 4BFIA 5EIIG 4JS7A 4DN4H 3LEVL 5DK3A 4XP1H 4DQOL 3LD8C 3A6CH 5E03A 1MWAH 4AZ8A 1RK1A 3GRBA 4JFVA 4EIBA 5IOKA 3FN0H 1SBSH 3QUZA 4PRDA 1SJMA 4O00A 2WUBL 3VU1A 4L0ZA 1X5GA 3D2TA 3DRQA 4IGBA 3OKLB 2B1AL 2ZWLT 4NQDA 2HLFD 1YRKA 4NQDB 4N26A 1JXGA 3H85A 3MJWA 1NDMB 1SM3L 4Y4FB 5DDHB 3VYNA 2E9IA 1A14L 1EO7A 2PW1B 1UJ3B 4GQPH 4R26L 4WSGA 4LOFA 4CRPA 4NO3A 1EHKB 4NQED 4HXAL 1OQXA 1H3PL 5IQ7H 3BQUC 4FN0A 5DF0A 4TSAL 3FOMB 1TZIB 3ZO0A 4LESA 2WANA 1E67A 1K8IA 1B88A 2V8MA 4XMXA 1NPJA 3AGWA 2CMRL 2ADIA 2XN9A 4EPSA 1PW3A 2IAMD 4N2HA 1BXAA 4IDJL 5GGQH 5AW7B 1B2WH 1ZHBB 3U2JA 5GHWL 3DJ9A 3O2WL 3SE4A 4ONHA 1P4IH 4S2SA 5AVWB 3TJEL 3L7FB 4KXAA 4JUSA 5KYNA 1XZ0A 3NEOA 4EDWL 2VXVH 2UX6A 3ULUF 3SPIA 1MW1A 4BFEA 3SE3A 3QC6X 4UWQB 4WEEA 1F2XK 2HVKA 3TTYA 3SKMA 3QUXC 5DJXB 2XBDA 5DJXA 5E7FA 1XH3B 4D9LH 1B9KA 4IRSD 4AE1A 3RVVD 4Z0XA 2IH1A 3QHZH 3BP4B 1S46A 3BD5A 1KB9K 4OGQC 4CC0A 1WS7A 1JPFB 4TVUA 1HDMA 3MUUA 1U41A 2H4EA 1LO5B 4BQ6A 5HYFA 2BFVL 1KXQA 4UUJA 5B38G 4ANKA 4EN3D 2MCPL 3GFUA 2VAAB 3DSNB 2IH3A 3QIBC 4PJCF 3WN6A 5BRZE 5IOPB 1U8CB 2I32A 1P5UC 5DEFB 4MRBA 3QDGB 3ARQA 4H5SB 3JYCA 3WIFA 2P1YA 4QUOA 1TQBB 1BZ9B 2A83B 2VDML 4OT1L 4LASH 4U6HA 3WE6B 4B9ZA 43CAB 1X7QA 3MA9L 3GLZA 4WFGE 3K4DA 1WFMA 3C2AH 5SX5H 1BBJB 3P3SA 4KY2A 4BFNA 5BV7H 3QXVA 1CT8B 2HJLB 1KTLA 4DW2L 2E7DA 2ITEA 3ZN6A 4PH8A 2DQGH 3U7WH 5EU7E 3I3EA 3PWJA 4R0LB 4D9LL 5B6WA 5T33H 5GGSY 3F7YA 2JWYA 2OTUA 3MUY1 5MEPA 4BSVA 1QEWA 4M61B 5ANMB 5DZVA 5L4FA 1D3CA 2YK1H 1T4WA 3HUJE 4DKFH 1S9XB 5E4AA 3IDNA 5KJRH 3PAVA 2Y23A 2MHAA 1M53A 5IB1A 1E5ZA 5CJ8A 5DUPL 5ITEA 1KFAH 5HYIA 1XGTA 1OAKL 1S4IA 3QEGH 2JB5L 3F7PC 4A6YL 2K9FB 5HYEA 1HSBA 3BFOA 3LV3A 4YPGB 1OSPH 1Q1JL 4IOSA 4RBPK 1G7HB 3G08B 4R3SA 2EE3A 2O5XH 5HHOE 4UB0L 4ZYKA 1N2RB 4RISH 5T3XD 4JFHE 1S7VB 3VD5A 2RMNA 3VM5A 1AMXA 5IWLC 5FK9A 4W9JC 3UAAA 4DAJA 4PBDA 1UJTA 4KKQA 1FO0H 2UXFA 4XMPH 2OJZH 3O8XC 3S35L 1DZEA 2ICEC 4Y4FA 5C0CA 3LH2H 3L9YA 1QFUL 4BFFA 4ZW5A 3CN3A 1S7UB 5KAQG 4OW6A 4P2RD 3QK0A 3TNMB 2ESVB 1KGCD 2HCZX 1G1YA 2X1WL 2Z7YA 3IJ9A 1CK0L 5HGDA 4L3CA 5DFWH 2DTML 5I1DB 1BQHA 4HKZA 3EDEA 2XZAL 3TXAA 2XRAH 4G7RB 1U3HC 4M93C 4AMKH 3HI5H 1BQLH 4WQOA 2YEZA 2P5EB 5F7FA 5IM7B 1JGLL 2JTDA 3QG6A 3CLEL 2F0CA 1GGIL 3UIZA 1MHPH 4LL4A 3ARFC 4XXDB 5JQIB 4JM0A 1X7TA 5EO9A 5I1AB 1WVZA 4HJGA 3MV8E 5LCVA 2OAAA 1S8DA 3E7JA 4N85A 3IKCA 4Q8BA 1NOAA 1GUEA 4OFVA 3LNHA 1OM3L 1E0OB 1NUFA 1Q9OA 2FL5B 4JM2A 1S3KL 4QPEA 2QMJA 4EI6A 2I7OA 2X9WA 1X5LA 1PY6A 3HC4L 4HLZH 1VGKB 4NXSA 4K4KA 5GS0C 1YEGH 2UYLB 3BJ91 4MJHA 3SYPA 5B39A 3GHEL 3QO0A 1K3IA 4N2BA 5IMLA 4DETA 3MLYL 1BZEA 1IL1A 5TTRA 5D1ZC 4LGSB 2ZKXA 2WWKT 2XOTA 4G8GE 5BV7B 3W82A 2AKRB 4R97C 2CA4A 1Q1PA 3C75A 4N6RB 2G4EA 3P69A 1DBJL 1Z5LA 3HG3A 1XAKA 2ARWA 3VXUD 2ZQKA 4U1JB 4U1JA 1XZ0B 3LZRA 5AUMB 4U1IB 3OF6D 2EYSB 5JYLA 3FT2B 3HE7C 4ZFOA 4Y19E 3VXME 3ZK0A 5KBLA 3GSVA 4NQCB 2YBRA 1DQJA 4BJLA 3HMWL 3CVDA 4LO9A 3R8QA 1N0LB 4I89A 3ARSA 5IQ9A 3VW7A 4PBWD 3RY5A 5E56A 5D2LA 4PB0H 2GI7A 4OJCA 1HNGA 2GIXA 4J2QA 4L29A 3CN0A 4F2EA 3O0RL 1DLFL 1U92B 2GG1A 2F53D 3HZ3A 2YCYA 5BOZG 1N5YH 3MGOA 4QAWA 2YKLL 1U8IB 2B1AH 2I27N 4NO0B 1FI8C 1C5BH 4XBGA 5PAZA 3GLAA 5IZ7A 2WXMA 4KTDL 2QKIB 4R4BB 4U05A 3JV5A 4PJEA 3MYJA 5CN1A 4ADGA 5E95B 2OMVA 3RTLA 2CUHA 4JPWH 3KWTA 4ATWA 3AT8A 5JO5B 4JJOA 5D93B 3HC3L 2YPLD 3DYPA 3GTVA 3PJNA 4P2RB 1UD8A 3FQUA 4JY4B 1NCIA 2BY0A 1E6OH 3NSXA 4UZSA 5CJ5A 1A9EB 3ILQC 1HILB 4Y5VA 1ILSA 1DBAL 1CF8H 3DURB 4R97B 2Q10A 2P24A 4UOZA 3BEVB 4EXKA 1ZT7B 4P2QD 5LQBL 2BVYA 4N2AA 4DP0X 3ARBD 3V5DA 2BIPA 4M43H 2H0PA 4NUMA 3B7TA 4PS7A 1URZA 5AZEH 4LVNC 1JV6A 2RA1A 2DS4A 3D0LB 1WWAX 3DDFA 4WWNA 3VXRB 4H2CA 1X0I1 1NAMA 3BZEA 1I8AA 4MB1A 4R2GD 3NSJA 1M7UA 4G5AA 5FO8A 3EHBB 1FL6A 2HPOA 2CE6A 3QR0A 1D9KA 1I3UA 5JA9A 2J12B 5GGVL 4ZOEA 1IIKA 3RUGB 1PNDA 3MBWB 4P07A 2YPKA 2NLJB 1ZLSL 4PY7B 5I1AA 2WQSA 1XF1A 4E42A 4JZOA 3HG1D 5DVKA 4TNWF 2UXVA 4BEIA 1YEIH 1KNOB 3S36L 1E4HA 1CLZH 1AVAA 2GSIA 4FG6D 1YN7B 3WIHH 2WOBA 1N0XL 1GSMA 4UM8A 2CD0A 3I02B 2WO4A 3LPFA 1RU9H 3TN0C 1HYSD 3DRTB 3OKKB 4UM9A 2N59A 1M42A 5TFSH 1W0YT 4WHCA 3VXMA 3US0A 4RX4D 3DV6B 3UJIH 2GAZB 2XN2A 3T3PB 2NMSA 2YWYA 1CLYL 5ETUA 4G9FD 2ZG3A 4W81A 4FNLL 1M57B 4J3OG 1X7SA 3HG4A 5DJ0B 1FNLA 3RILA 1MW0A 2EAEA 2H26A 3UZVB 1OT1A 5F7EL 2K70A 1KYFA 4Y1AB 5CJOH 4PRBA 4NQSB 1I1FA 3SY6A 1D7DA 1JGDA 2DYPD 5D7IF 2Z34A 3KWVA 1NMAH 4FXKA 5D7JB 2QSCL 2V8LA 3INOA 3IWUA 3GM8A 3F7VA 3V5HB 3T65A 1GGIH 4FG4A 3S5ZA 1UM4L 3LKQA 1F00I 5DT1L 3KPRA 3WEXA 4UU9A 2ZCKH 4ZFFA 4QRTB 4X6DB 5HDQL 2DBJA 2VERN 3QUYB 5TPWH 2HWZL 1GYCA 4OCXH 5ADPH 2QGCA 3E2HC 3X17A 2AP2A 4FFYH 3RWFB 4XCYA 4UB0H 5CSBA 3ZL4L 2W9DL 1AI1L 5C0ND 3DVNB 2Q2EB 3S8GB 3F7LA 4M7JH 3VB8A 3BWZA 5CIPB 3NESA 4ZZFA 3QHFH 2F8XC 2E46A 3LH2L 5DQDH 5KBNC 5GS2H 4OLXH 3CN4A 3T4YB 4MXWH 5J9PA 2A4CA 2EDKA 1CGXA 1QBAA 3DOSA 3TBBA 1YMHB 1A14H 5H2KA 3IDJA 1W72A 4RMWA 4HZLA 1M56B 1GZPB 3OJVC 4GKZB 4MDJB 4S1DC 2D0HA 3DETC 2JNZA 1P5UB 5CHNB 3PGDB 4DWHA 1JK8B 3OTTA 4P49A 3EOTH 5IROC 4QXUH 3PDSA 1H9DA 1YN6A 2MOQA 5AVRB 3PNWB 1JNNL 5D5MB 5CEZE 4WHDA 4Y4FD 1LTXA 4CSZA 5F3HA 4I77L 4M6NL 3ZW3A 3L3GA 5F96L 5ESQA 5AAMA 2HKHL 4JFFD 3GDCA 4FQLL 5H37G 2WY3B 3SDAC 1F6FB 2CCVA 4PJBA 4DVBA 4OD3H 1AAJA 2OK0H 4HHAA 4PJ9B 3RWEB 4N90D 4FQXB 4FXLA 5KVDL 1I3RA 4PRDB 3K1KC 5DRXA 1RPQA 4XNAA 1OD7A 3DA0A 4EVNB 2CGZA 4BWBA 5DUJA 2XG4B 2B5IC 3RX8A 3FO1A 4LEEA 4ZMAT 5ANHA 1JPTL 1PEWA 3L7FA 1QHQA 5G53A 3DUUA 5D5ME 5J13C 3GUTA 4APQB 2VR8A 1J0KA 2FQDA 5GGVY 1BWWA 2LFEA 1IBZA 2JI3A 5GSRA 1G9MC 5ILTL 2D7TH 2ZCHH 2WVTA 2IF7A 2EDQA 3HVNA 4KV5E 5EBLA 3VRLE 2WSPA 1QFWI 2NY4D 4Y16B 4AC4A 4UM9B 3JZYA 5F0LB 1UTDA 1H3TA 1TQBC 2YPKB 1VACA 2DEXX 5GJSH 1FC1A 3SPGA 3CHSA 3CGTA 3WUZA 1CFTA 4L3EA 3HPLA 4WTZG 4AGQA 1CD9B 4I3RL 2G75A 5EORH 1I1AC 3DVGB 4YBQC 1OF0A 5KTEH 4XX1E 3QIBB 1LXMA 1IIIA 4ERSL 2F7QA 5K1JA 3N1MC 5JQHC 3GPSA 3OHXA 3MBWA 2F15A 4XZ4A 3RKPA 1CG9B 5BOPA 5I16B 3LKPB 1I9IH 2W0LA 4PV9B 5CF3A 3O45A 2EECA 3HNSL 4XC1H 5LBSA 1MY7A 3CC5A 3DXAE 4YO0B 4OZFH 5GS3A 3DDLA 4MA1C 2M8XA 1YEDB 3R06B 3TN0D 5IB4A 2ZZUT 2PYED 4DEPB 1CS6A 4Y1AA 4Z7NE 2EH7L 3FQXB 3FO9A 3GS0A 4L4TE 2ZD0A 2FSEA 1WAPA 1KLGB 4QRYA 2Q8BH 3S3SA 1ZAGA 3ZRSA 2YBGA 4XPTH 2XV6B 2CZNA 4ZMNA 3RVUC 5T3ZH 1CQYA 5B7FA 4YHNA 4I0PA 4RMSA 4HU2A 3MYZA 1M1XB 4DN4L 1NL0H 4I18B 2UUDK 5MENE 1OPOA 3GMRB 1E4KC 4ZUUA 4N22A 4LGPB 4K9EL 1I1CA 2XWTB 4XP6H 3ARBC 3NABL 4P5TB 3ZHLA 4YZWA 5ABZA 2IWEA 1TEFA 2OR7A 2X89D 2A9CA 1TJIL 3PWNB 4ZSOE 4D8PB 4AJYV 3K7UA 4PWFA 4YHYB 5EB9A 4YZFE 2WBKA 4PJ5E 5E8NA 2BS8A 3RWJA 5EN3A 1U3NA 5CLZA 1WBYB 1YNTA 2PEDA 3BAJA 5CR8A 1YYCA 5HHQA 3A67H 1BFSA 1G5AA 3NEEA 4ONGH 1FRGH 4QHKJ 5EUOB 4JG5A 4RFEB 1HINH 1T0NB 1E0PA 2BNQD 4FI8A 1RUML 1VFAA 2Z3FA 3QJHA 4RZCA 2I9TB 3G9VA 4OZ4A 5A40E 4ZTEA 3EDKA 2VOTA 1QLRB 5EH1A 3WFEH 1KCBA 3FKUS 2B2XH 2ZYRA 1RSFA 4K94L 2EDDA 5DZOA 4NQTA 5TQ2L 4U1HB 1ORQB 4OI8A 3IMUA 2FJSA 3SY0A 1S7QA 1DQTA 4KAQL 4PXFA 3BP5A 1EIBA 4NO2A 2ICES 3P3YA 4MAYC 1OAUL 3B7SA 2GVYA 4HIEB 1F4YL 4X5XA 4ZAKA 3WY2A 3QDAA 3WSQH 4LLVB 2YUVA 4EVNA 1X5AA 2BRRH 3JSSA 3VSTA 3BUYA 3DXAA 3NJNA 5DJAB 3QI9B 4OI7A 1MCPH 4JFZL 3RWEA 2X6MA 4Z7UB 2EXYD 1GAFH 3NSCA 5D2LF 4LU5L 4N2KA 4ODUB 5C0DB 1JDCA 3P2BA 5IEHA 2XWRA 3CWGA 4S1QH 3RX9A 3KCPB 1P7QA 4E5XB 5EBMA 2JLPA 4APXA 3QEHA 1OT2A 3QEHB 2CCWA 1CB4A 3HCVA 4HJGB 3U9UB 4TQEL 1ZA3B 2J4WH 5I0DA 4J5VA 4F91B 5TF1L 3JT0A 3T0BA 3KWWA 1GGTA 4M7JL 4JFSA 2ROYA 3VXUB 2DEYX 3IEAA 1UUNA 4HYTB 2VLLA 3EJSA 3ZPDA 3ALPA 1E9PB 2X4OB 4KKCD 3F7QA 1AI1H 1BRRA 4JO8A 2ZOKB 3QUML 2DJUA 4Y4HB 5MP6H 1JHKL 5CEYB 3D39B 2HPTA 4AL8L 4WHTB 3QZLA 3MJ7B 3VMOA 4MLSA 2JK5A 2VWEC 5B39G 1I1AA 1J5OH 5LDUA 5BVPH 1EJ6A 4YC2C 5D7IA 1KTDB 4MJ5B 2YAQA 4GMTL 1I7UB 3UAJA 2X2HA 1ACCA 5ID0A 1QLEB 5H4YA 3GMMA 4AXWA 2CJ3A 1TSHA 1VEMA 3BHBB 3U1QA 4L48A 3S37H 2NZ1A 5MEOB 3UJJH 3A22A 4D94A 2LU5A 4PRIE 4YQXH 1PX8A 3DHJA 4MNHA 4LLWA 3ZT7A 2N01B 3Q8CA 2VR6A 4JRYD 4XB8A 2G60H 5F89B 2QR0B 2OYPA 5DFTA 4XP1L 1NCBH 3HA0A 3JVGC 3TEZA 1T03L 4FYSA 5DRZB 2H5UA 4EBQH 2WCGA 5MEND 1VKXA 1N6QH 3CMGA 3IJHA 1HXYB 1T4KA 1BQ5A 4RGND 3VFGH 1NCJA 4FADA 3KR3H 1J8RA 2G2RA 2G2RB 5E5MA 2J88L 3SBRA 2VUKA 5EN0A 1YMMB 1I7TB 5E08L 4YBLC 5IVXE 4APQD 1BA9A 4JK0D 5C0FB 3VGAB 3F7KA 4UMGA 1KWKA 4MAUH 3WNOA 5AX0A 5CR1A 4K15A 1KIPB 4RMVA 1JPSL 2FX8L 5C3IA 5CEZL 4JDZA 1SHWA 2DM7A 2HKFH 3ECWA 4QCIA 4YE4L 1T2XA 3QEQE 1TN5A 1Y18B 4IK7A 5JIQA 5HD8D 1XWVA 5CSGA 2W59A 2NW2B 3S36H 4KMTH 5HVHB 4N1HB 2DWXA 5GHWH 4I13B 2V3FA 3ZMNA 2A9AA 2VR9A 4QI3A 3AU0A 1S3KH 3SOBL 3CCHB 4UIMB 2DMCA 3HZMA 3V4VA 3L08A 5DD3L 1UGKA 2ODIA 1HYSC 4Q89A 5E51A 4XXCC 1VLXA 2AXFA 5L7XH 5CLWA 1P8IA 2WSDA 3HBQA 2FECI 3MJ9H 4YSPA 3E1F1 5TGBB 2DYSB 3KXFD 1JF6A 4OLVH 2YPLE 5D7KD 3ULUC 2Z73A 3WL9A 2XN1A 2HTKC 2X70B 4L0YA 3B2UC 4FQ2L 4AC2A 5C0EB 4UILH 2A99A 4XXDA 1CXIA 1RV6X 2COQA 5KBKA 2DLFL 5IBUG 1UFGA 3DX7A 4RCAA 2RCSH 3MBEA 1FDLH 3JV6A 4PCKA 1WCBA 2B59A 3ULVL 3IJ8A 4NENB 4YDVA 1PGRB 5F9JB 4NP4H 3UG4A 3I85A 1PZSA 4ZK8A 3OZ9H 3KPLB 1UCBH 1BVKA 2L4OA 3GMNB 3S3BB 1AJ7H 2DB8A 2IO5A 5BVJB 2EADA 3S4SB 4QY8B 4ANWA 2WKOA 5ICZB 4CKQA 2WOYA 4N2LA 4QJ3B 1NC4D 5F1IA 5F1IB 3V52H 5AOLA 4OV5A 1JOIA 4KQ4H 4DW2H 4Z95L 1MRCH 3NDZE 4JRYB 3M1CA 4U1SA 2XHNA 3KPPA 5B1KA 1JZ5A 3SKMB 2AJXL 2NY5H 2X0VA 1NFDA 3UTPD 4K07A 1SGKA 3MLVH 5T3ZD 2Y0SA 1U0QA 2X53A 5D93C 3CFKB 5F0PB 4L37A 5HHNA 5I19L 1JNLL 2DI8A 3ZDZB 2B0SH 2PPAA 3KMDA 2GJZA 4LLWB 2E0PA 4FTVD 3V0HA 2ZT9C 1KN4H 2XTLA 3EOYG 1ZXKA 5IHUL 1ZVSB 4UQ3B 4ODHL 2F5AL 5CJBA 5ALBH 4G7YH 4WJG3 3PGFL 1PXSA 2F6AA 4WUUD 3SJVA 2VE6A 3UMNA 3ARVA 3LNGA 3HJ0A 5I23A 5E2TH 5ALCL 5FCUH 1FIGL 5TDPA 2QELA 3MV8B 1JHLL 1Z5LB 1OE3A 4XTRD 2OK0L 3D09A 5I17B 2VDNH 4E5XG 1UH2A 3O6FA 2QGEA 1LDSA 2E7CA 4JM2D 3ZT6A 43CAA 3WV0A 4ZI8A 4GKNA 3FB5A 3KLHC 2PYEB 1MI5B 2OMTB 5FYKE 3L4ZA 2D4FA 1KCSH 4Y1SA 1D5RA 2WUCH 4N20A 4R8WH 5KUMA 3FUMA 3P30H 4MNGE 3AM6A 3MLXH 4IRZH 3WFZA 3SPVB 2KLRA 3D3VD 5EIIA 4IKJA 4PGEB 2F8OA 5KANI 1N8ZB 5F8RC 2EC8A 1RJLB 3HVDA 1IEAB 1FFNB 5GZOA 3VDBA 1TQVA 1WZMA 1SJXA 5EU5B 3UONA 3KH3A 3QQXA 2DF3A 3MJ8A 4HXBH 5BO1L 3S9DB 4HAKA 1OAYH 5GZND 3MV7E 5EF0A 1XGQB 1CVRA 1P4IL 1DBMH 3ENEA 3EHBC 4F7MB 3HRZB 2J5LB 3AM8C 4NKOB 1FFOB 4AVHA 3EG9B 2QSTA 2VIRA 4ISVA 5B8CA 2WSKA 5DVPA 3GBLA 1GKOA 4ZO6A 3QYMA 3QULB 3O3BB 3N41B 1AGCB 1N18A 3ARFD 3OC5A 3ZTJH 5F7HA 1FWXA 3LSOA 1DVFD 3GMOB 2CBPA 5G4NA 5EPMA 5T1MA 3RL2B 3SE8H 3QYNA 4BZ2A 3RWHB 4GPVA 3LKPA 4B9IA 4NUGL 2IBGA 4PWKA 4PWHA 2YS4A 3FU3A 3MNWB 4OM1H 1M05B 1M7IA 1QSFD 3KPOB 4M93B 1XGRB 4TLSA 1N2RA 3WBDA 3IFOA 1T1YA 4H20L 4OFKA 1QFHA 1ZK9A 4I48B 4PBVC 3TBTA 4KQ3L 3QPXL 1OK0A 1BIHA 3EO9H 3FFCE 1BGXH 3NJJA 4L3EB 3RB5A 4F24A 3H4FA 5CSZB 1TTBA 3ZDYF 5ADPL 3EGXA 3V0JA 4TSCH 5DDHA 1Z9SB 3IFPB 4QO1B 2CAKA 3BQUB 3EGSB 4ZPVA 2ESVA 3HC2A 1WV7T 3SZ6A 4U31A 4I0KA 1NGYA 1TNNA 1WD9A 3H42L 3NSYA 2GHZA 4QXTA 2X9XA 5HI5C 1SJEA 1I9JL 1RFDH 3QUZC 4XODA 4GPOA 1KCRL 4LHUD 4JKKA 3HW7A 1UGNA 2Q76A 3HR5B 3NYAA 1A0QH 4B60A 4JFTA 4LCCA 3G6DL 5F7WC 2BNQE 3BSGA 5IVNA 3TBCA 2YD9A 4FKHA 5C2UB 2EH8L 3A67L 4XNQB 5JA8B 1E6JL 3HNVH 5KKHA 4LIQE 3DX6A 1LP9F 2TRHA 4FXKC 4LBEA 4DERA 5JPMC 5L8KB 1XF2B 3IDMB 3IDYC 2HT3D 3GLEA 3P2TA 4JY5H 4F5CA 5IHLB 5G2DA 5EZLA 4XH2A 4LE8A 1HU8A 2GUYA 2N0MA 3U4BH 2WBJB 4JRWA 2DQEL 3KLKA 2ATKA 3HG1B 2KPNA 3HG1A 1IAKB 1XL4A 2HN7A 4YE0A 2VSMB 1RIHL 4KHTH 3BKML 3AS0A 3QIUA 2YPVH 1MCBA 4DZBA 5I1GH 1BFVL 2Z7UA 3SDXE 2BNQB 3SGJC 4JR9H 3CX2A 1NCHA 3GJFB 2XQBH 4CJ1A 4NP9A 4UU9B 1JP5A 1RZJL 1BOGA 3R1GH 3QIBD 1DO6A 3UO1L 1WWWX 3VGDA 2ERJB 1LDPL 4CC4C 5D7JD 3K6DA 3F7RA 5DRNB 5AW3B 1SLVA 4UV4L 1ESOA 4L5FH 2ITCA 4X80H 5HYSA 3ARDB 2VLRE 3L3GB 1YYLL 3BIKB 4LDOA 1WT5C 1QNZH 4HS6B 5HHPA 4KXBA 3W5MA 1DJSA 2XQYA 4P5KB 3RKDD 2HVJB 4G1MB 4XP9H 1A65A 3QI9D 1OAKH 3OZ9L 5B35A 4X6BB 1NMCB 4HZLB 3QBIA 2EEBA 3P0VH 3SPJA 2DIJA 1YCSA 1KTRL 2APTA 4F8PA 1JJUA 3SYAA 4OCWH 3WJMB 3C5ZA 4P57B 2ZP8A 4K5PA 5C6WH 4CSSA 2HP4A 1QRNE 2WQUA 1RERA 3L5JA 2Y5EA 3ZE1E 4DK3A 1MZYA 4MCYB 5DJDB 3CLFH 1H5BB 5CCKH 2JXMB 5DRWA 2YEQA 4TKWA 1T0MA 3QORB 4U33A 2WZ0A 2UUDH 1N7ML 2RTTA 2XKUA 3L3KA 4G5ZL 1BQHG 1BPLB 3EDDA 4N2NA 2ZSVA 1HYRC 2IBZY 2VW4A 4ZSOB 2D0FA 3GXDA 2BP8A 2BP8B 4FEIA 1LE9B 3IE9A 3V0WH 4KI5E 3VFNB 2XIIA 3MRHA 4HT1L 2MSPA 3PXLA 1EJOL 4CAGA 1MCIA 4PP2A 1G7MA 3PGFH 2CK0H 5F9WB 8CGTA 3HG1E 1J0YA 1WFOA 3MODL 1T89C 1CYWA 2ZXBA 5ECGA 1MQ8A 4X8JA 4YO0A 4CC1A 3VD1A 1O7DC 2KYIA 3BDYL 4QRPE 3RFZC 3WFDL 1FH5H 2NY1C 3KL0A 1CL7I 2OXGB 2A77L 2VLJE 1LMIA 3BSZA 3VI3B 4AENA 4PLKC 3C9NA 4AQ8A 1QUPA 4U1MA 5FECB 1XGUA 3GMLB 4FQIH 1IM3D 4GAGH 3CZSA 3DBXA 3NFSH 2P8PA 3HE6D 1BF5A 3LRLA 4M03A 3IBEA 3CSTA 2OMBA 5C0BA 4ZW8A 3P2DA 1EEZB 3DV6A 4Y4KB 3SO5A 3QISA 2EDWA 4YPGA 4N0YH 3RI5F 1TO4A 3PWPD 3SGJA 5JIHA 5AD0B 4KJYB 1S5HA 3TA3C 1JV2A 3HRPA 4K8RH 1ICTA 4GUOA 5F9DC 3HMXH 4PJXB 3T4AB 1BAWA 3I75B 1XB8A 4HC1L 2ERJC 3ARDD 3UX9B 4Q9CA 2GJ6D 3R4RA 1RUQH 3WE1A 2HH0H 1IILE 2JCCB 2JCCA 4LBEB 1FL3A 4NQDE 3CPUA 3V0VA 5AG9A 4U6TA 1U33A 2NYYD 3LYRA 1ZLWK 3KLAB 4WJ5A 1P53A 4Y1TA 2O93L 3K80A 4QJ4B 2CGRL 2K0RA 4FP8L 3FW6A 1BOGB 3P0YL 5CD5D 2X0WA 1MOEA 2B4CL 3ARBA 1LYQA 3UPAA 1DE4B 4F8QA 3CDCA 3GS7A 2XTJC 4KUZH 4QF1B 4XPBH 2WQRA 4KRLB 2YK1L 3OR6B 4N6HA 3ARZA 4PB9L 2DQDL 3EJCA 4POUB 5L4JA 2FEEL 1U8MA 2WXGA 1OB0A 1E8WA 1QW8A 1YEHL 2LU4A 2P48B 4PJAA 5KSVA 1D9KD 4R7LA 3PGDA 5CHNA 1BFVH 4WI9A 3RWCA 1S8DB 4JO5A 1LL1A 3K91A 1UWGL 4IIQC 5DRNA 4EE2A 2XXMB 2OSLA 5EC2B 5IVXA 4PI0A 4PVNA 4HUNB 2Q0ZX 1FZJB 1AKJA 3QNZA 1MWAL 2QGBA 1YECL 4X4YB 1MFDH 2CALA 4JRXA 2HT2D 4LKCA 3QWRA 1EO8H 3MTRA 5F88B 3AG1B 3IXAB 4QRPA 2VDKH 2YCZA 3K1DA 2DWTA 5C7ZA 2ZSWB 4WDIB 1ROWA 4N1CA 4EIUA 4XPFL 2VLJA 5DD0H 1LVEA 4JQXA 5ICZA 3HZVA 4JFYA 3RQ3A 1DBBH 1IGIL 2KZBA 2YARA 1O6VA 4HA1A 1VDGA 2CO7B 4TUKH 4W9KC 3I9IA 1KPUA 1JZ2A 4GBXD 1QBLH 4Q58C 2WLIA 3MRFB 4MGXA 5FUCE 3IKCB 4IOFD 2R2BB 4K5NA 3ZR5A 1XH2A 4NKIL 5J1AB 3D0AA 5G2NA 4XOBA 3LZFL 1TQCB 4OY9A 3TV3L 4JY5L 3L2NA 1WT5A 5H4ZA 3IB4A 1JGLH 1G6RH 3OQRA 3G6AA 4N25A 1O0AA 4E9LA 5EZOH 3GBNL 2XVKA 1XF4A 4Z7IA 5C6TH 4F57L 2WGXA 4AENB 5HDBB 4NM8H 3O3AB 4FHJA 2L7QA 1AGFB 3P0GB 2J2ZA 4KK6D 4DGYH 2P7TB 4WI2A 3TBSA 2BNUA 4XCCH 4L29B 1RZKH 3GHBL 2JCCE 4AG4H 4BKSC 2VABA 1IVLA 5IJBC 1EJFA 5A2JH 3V4VH 1U8IA 4CUCA 1YAIA 1Q72L 4KZEH 3QQ3A 5EF2A 4D7PA 3TFKC 3RTQC 1H6FA 4IKLA 1DJGA 5I8OH 3ABGA 3GSRB 4OJAA 1HE7A 5GS0L 4NM4L 2D3VA 4Q6YA 1EO5A 3EYQD 3FT4B 4JQVC 1VA9A 3BLPX 5HYQA 2J6EH 5D1QC 5IQ9B 2WYZA 1JWSB 2XZCL 3SO3C 1SHXA 4G7VL 2VE6B 4JEGB 1YQVH 5FYJH 4PGEA 2FH8A 4HBCL 3ZGIA 2H45A 3D87B 4OCXL 2MJWA 3BN9D 3EDFA 1WZAA 2B3IA 1OAYL 1GRWA 4DUXA 2H0JA 4E9QA 1RPUA 3HLKA 4KXDA 4AJVA 2ZX8A 4RFNC 1JXKA 3AUVA 4JG1L 1E3ZA 5C09E 2EIBA 2PTUA 3O3EA 5DJ6B 1PZAA 3BVXA 3EJZD 4HGWB 1ZE3C 3IN0A 1CGVA 2FWOA 4Y7OC 4JFUA 3N1QC 4JKPH 1JUFA 2FBJH 4QNPF 4KJWD 3FRUB 4GEJA 3NG5A 2MPVA 4UILL 1KCLA 4H8VA 3UGXA 3O0RH 1G4MA 5C0IA 1SFDA 4ZODA 4AGMA 1FE8L 2F19L 4XVSL 2P46B 1MFAL 1MJ8H 1CDYA 2JIXA 5IB3B 2DMHA 3LIZL 2X7LB 5JPNC 4YDMA 3G5XA 1N8ZA 3FB8B 1W72L 3US9A 1UC6A 1KB9J 1ADQH 4V11A 2D7MA 3H9SA 3ZTCC 3N9GH 1U95A 5K39B 3GEFA 2IAMB 1NBYA 3KVPA 3V9EA 2AI0L 1HXMB 4IYKA 4MBSA 4FTVB 4LPWA 4NRYB 2W9EH 4X9IA 4A7TA 1R3LB 4P99A 4DAGH 3ZHKA 2M83A 1D5MA 5IHWA 3GHEH 5HBBA 3PDDA 5H94A 3CZGA 1OAXL 2VXQL 1FGNH 3K6FA 1MCJA 2E27L 4NNXB 4EI5D 5LBVA 1P2CA 1TQSA 3O2DL 1NGZA 5EZOL 1F4WL 3CIQA 3K5SA 4L3ED 1MCDA 3FCBA 5CMAB 3WKQA 2EEFA 4XP5H 3PY9A 4QLWA 2YRZA 4HUUA 5L2JA 1TKWA 2L0DA 5H2BB 5J6HA 2A77H 2FLRT 2OL3B 5IW1B 2AT9A 3O8XB 4QXTB 2Z6FA 3A6BL 3IS1X 3RNKA 2VR3A 1W0WB 3D18A 1YMME 4NO2B 1S7UA 4OJFH 4R2GB 2GFBB 3CN1A 3IFOB 3R18A 4MJ6A 5DZAA 1ZHBA 1KF9B 2XZAH 3T08A 1PQZB 5EWIL 1MFEH 4KX8A 4UDUB 2PYEE 4RZKA 3HCVB 1MLBB 5JUEL 3U9UA 4POYA 1BZ8A 4M4RA 2LABA 1RUKH 1NL0L 1M3IA 1MJJB 1CICB 1TT6A 1TQWA 1WE5A 4JVWA 5AHYA 2JJVA 3ILDA 3VDCA 1WBZA 2V37A 4JREC 2IVFC 1I8LA 2CO7A 2VM4A 1CWQA 4MA1B 2QT6A 1GW6A 5AAWC 4GINA 1SJEB 2WLIB 5I0YA 5B38B 5C0BD 5F9WC 2MTPA 1WITA 4DOHE 4I9XA 1NUDA 1GIGH 5CD3A 4F7PB 2X4OA 3FO0L 3RL1A 2FSDA 2PXYD 3II2A 4I85A 4YDIL 4QHPA 1XVSA 3M1BB 3VWJA 5ICYA 1R33A 4UNTA 2GC7C 5D9SA 4XPBL 4U6YA 2C4FU 1IKNC 1SXAA 3NUKA 3QDGA 4PRHA 1T66D 4HOZA 2QQNL 3EOAA 4BH8B 4XMLH 2YN3A 4N2DA 4JPQA 1MFVA 3BSHA 4LP5A 1TITA 4G8FA 5K9JL 2PKDA 2DQUH 4DKEL 4IBYA 1UB6B 1U6AH 3PHOA 4OFQA 4YBLB 1QVOA 1GGBH 3PGCA 4EOWL 4IMKA 2Y02A 4HG4J 4LIQL 4KO9A 5LBGA 4RWYH 2QQQA 4HKJA 5CWSA 4JDEA 3QWNA 4DGUA 2R0WH 3CXFA 3DTXA 4JFXB 3MI6A 1PJWA 2GK0A 3S48A 1Q72H 4KZEL 3WKNA 3G5YB 3F58L 4OZGA 2DQJH 2XN9E 3FU7B 3QUMB 4Y2LA 2FEDC 4FFZH 1VKXB 5C3LD 1IJNA 5DU7A 4AQ1C 5EZIL 5JMRA 4JAMA 1AACA 3MLRH 3MRRB 1KIQB 3FQYA 3NZ8A 3VQMA 2J43A 1FBBA 3BVUA 1KOAA 3Q2CA 4OTXH 3OF6A 4NNPH 2O5NA 1MCWM 3SPHA 5E00A 5L9DL 2FR4A 1AD0A 1MWOA 2DAVA 4OD1L 4GW1A 5EG6C 5I71B 3INUH 1NWOA 1RMFL 1UWEL 2YFNA 3U1SH 3T3PE 4XGZB 5ITCA 3N41F 1E5AA 1T7XA 4WO4B 3V0IA 5FYKL 3TBYA 4TTDC 3MLYH 2O6DA 4GRVA 4KNQA 4KPHL 2VDOH 2WXRA 2R7EA 4Y4HC 3FO2B 4PSPA 3MRGB 2X0UA 4MD5A 5LQBH 1RZJC 2KERA 1TQCC 1TFHA 5EZIH 3AXLB 2G5BB 3V2WA 1NCUA 5DD1H 3CQFA 5T1KB 3T8VA 4ZNEA 1CBVL 3DPBA 1NGQL 1JNLH 3X3FL 5C08A 5F44A 1CGTA 1EZLA 4K2UH 4R5TA 4ORGA 1CICA 2BMKB 4OAWA 5DK0B 4BWUA 2OSYA 4GAYA 4PRHE 4OQ1A 5HTSA 4MHHI 5C92A 2PXYB 4OBRA 1PY4A 4L3CB 4M1DH 1GS7A 2JKLA 3MREA 1QRNA 4Y4KA 4PP1D 3BRFA 5DTFA 1NKOA 5K9JH 4Y9HA 2PWGA 1WIUA 2NSQA 1L0YA 1J9CT 4Z7UA 3DUSB 2YQBA 4C8XA 4IEFA 4JG1H 2R29A 5BRPA 4G6FB 2AEQH 3Q8FA 4JG9A 1G7IB 4ZX4A 2V2WA 3UROR 3KYMB 3REWB 5DS1A 4F58H 5FM5M 1DEEA 3BPOC 5C0GB 4QTIL 1NGQH 1MRDH 2OFQA 3KAAA 1CD8A 4ICWA 2J56A 3DOIA 4AV5A 4IBVA 4KTDH 2H8PA 3PWNA 3VSVA 1G94A 4D8PA 4Q7DA 1AR1B 4GOSA 1B9ZA 1E7UA 1TZGL 5JOPE 3F3HA 3DGGA 2FNWA 1AQKL 4KDVA 1HZHH 5DGQA 5EWIH 1S52A 1KCSL 1KY6A 2X4SB 4A6YH 3WN5C 1CQKA 4OZHB 5F7DB 2NUPA 3L4XA 4OZHF 4BRJA 1TEYA 4F7CA 5LXGL 1BPVA 1IW6A 3S5LA 2JJUA 4YR6B 5GGSB 4QDGA 2XVGA 5D8JH 5DHGA 1GZHA 4DN3H 3UP1A 1KXVA 1OPGH 4DZ8B 4IRSB 1FBIL 1PCXA 2VSKB 1Z5HA 4ZFGH 1X5XA 4XCCL 4HS8H 4KZCA 5J7AA 5E8OA 2VC2B 1WICA 3JV0A 2IPTH 1J87A 1QI3A 1QQDA 3AB0C 4DGIH 3LN5A 4NZTL 2UX7A 5E2VH 1OZUA 4NUJA 1FG9C 4XPFH 2X10A 5K1VA 5J4MA 5SX5K 1TLKA 1P69B 3BVNA 3A6BH 5E1AA 4CBZA 5GRYA 4AQEB 4ZW6A 4RGOH 3D4ZA 4G8GD 3QIUB 5C8JA 1LO4L 1TJIH 5A2LH 2P3YA 4MZRA 4WENB 1HH9A 1URIA 1VGEL 3FTSA 3L9BA 5C0AE 4BZ1L 2PWFA 4K55A 1F3RB 3MRIA 1S78C 4I4WA 4KKNA 5HYJD 4XMZA 2R83A 3FSAA 4HT1H 1P5UA 3HE6B 1FRGL 3QEUA 2ZUTA 2XG5A 5DJZB 5C0NC 3RFZB 3D3VE 3SGEH 2V9RA 5H2OA 1H0DA 3H3BC 1J9QA 4FTDA 3V8CA 3STZB 2D9QB 2WQVA 4JN2A 3TBVA 1RH8A 2CKBB 2MQCA 5HYSB 3RNQA 3MFGB 4WU5B 1BJMA 4Y4HA 4XCNB 1YA5A 4PJFF 3QWOA 5C71A 3HKZA 2M3GA 4MD0A 5DRWB 3FSVA 2YOAA 1RSYA 4Y19A 4H7VA 5F93C 1N67A 2BJMH 2ZUQB 5I8KL 5TJWK 4KQ4L 5CP3H 2ADGA 2DYPA 1YEKL 4XAWL 3P0GA 3HLAB 5DURB 2DTMH 5ERWB 4BUGA 2G2NA 4ECNA 3AW5A 5BS0A 3R4DA 1GU8A 2NTFB 5EBMB 1BW8A 2XG4A 4NI6A 2HWZH 1KBKA 2M2DA 2V2XA 3AFLA 3DRTA 4F8LA 2BP0A 4OFDA 5JZ7C 3UTPE 4ONFH 15C8H 2I9LB 1CGUA 3MKGA 4AIEA 1AZVA 3RPIB 3FB6A 5F6IC 3ZT5A 2VLKB 2H6UA 4HBCH 4L9LA 1Z9SA 2R4SA 4FULA 1Y6KR 5CJQH 1LO3H 4YDJA 3I9AA 4NQSA 4OV6F 2YPVL 2CJUH 3M7FB 2ED7A 3QDJA 5HGBB 4HULB 5AW5B 1BZQK 1YYML 3WN5A 4RETB 5HPMA 4EKJA 1WFUA 4U3HA 4QHMB 1Z9PA 3QDMD 1LDPH 3HB3D 4M5ZL 2CO6B 1TR7A 4WV1A 2FIKB 4RRPM 4P4RB 1MFUA 4LCYB 5JUEH 3IK2A 3ZUCA 1HIMH 3MLXL 2NQCA 1NLDH 1JXJA 4IRZL 1LK3L 4L8SB 4NNYA 4OGZA 5JHBA 1I75A 4TNEA 3BH9B 3BH9A 4OCNC 3PIQB 1MKFA 5IF0A 2CIIB 3BZDA 1BG9A 5IJVA 1TQTA 5DWUL 1HCVA 2ZWNA 3EGDB 4IS6B 2IEPA 5I18H 2YDOA 4ZZKA 4BIKA 3FT2A 3INUL 1RK0A 2IPUG 1W8NA 1YECH 3OL2A 2X4SA 2DDQL 5DHHA 3LRSB 5C0BB 5F7BA 3BZFB 3RAJH 3DYOA 1DQDL 2AJUL 5KANG 2CUAA 1K5NB 1JVLA 5DS8B 1HKFA 4I18A 1GW0A 1A66A 1HZHL 5CKGA 1IGIH 3RZWA 4URTB 2FIRT 3GXTA 5HY9B 4KZDL 3QW9A 1JFQH 3VQ2C 2RACA 5JJJA 1OGAE 5CIPA 1K4CA 1XR8B 5ESQB 1JZDC 4XTRC 1SVCP 1FNEA 1IAKA 3CZFB 4OGYL 1C5DA 2DWDA 1G0YR 4OUUB 4NQQA 4OUUA 5DD5H 5DJZA 1AOZA 5DUML 2C4XA 2EDTA 2GUOB 4X9BA 2VQTA 3HFML 5EU6D 4ZBJA 3WNLA 2ITCB 4AUYA 2PNDA 2DQFB 3N06B 4X7TA 3V9FA 5HYJE 5KVEE 4UCFA 2QV4A 1IAMA 4ADIA 3D34A 4X98A 3RY6A 2W95A 3PXJA 3IMWA 4M5YH 4GUPA 1DBML 1QFUH 3AG2B 3Q2WA 4P4KD 2QDWA 2FE0A 1Q5IA 5IP4A 1FO0L 1XMWA 1R6VA 2WJ7A 5INDB 5DHYA 1JMZA 1BEXA 1HE8A 3KNBA 1B3JA 1SM3H 1VACB 2RHEA 3WKMH 1JF1A 1TMQA 1N8OE 1FAIH 3CFIC 4MB4A 3ZHFA 5KSUB 4AZUA 2WQ8A 4XT1A 3UTXA 3LIUA 3QS3A 1SBBA 5F9JA 5I5JA 4P0DA 4LLMA 5IVZB 4EN2A 2W0KA 2BINA 3LRMA 3OKNB 4XBMA 2H9GB 4L4VD 4B3VA 2YA0A 2VSCA 4G80A 1E43A 4TL3A 1AT9A 1EEQA 4U1NA 1A9EA 4HUVB 4YC2B 2RH1A 1X6LA 4C59B 3WU1A 3DGDA 4N5ED 5CEXB 5DJYA 3KD4A 3C5JB 2BC4B 3C12A 5KVDE 2OSXA 2ZIYA 4YVUA 2FD6L 4PUBH 2DI7A 2P8LA 2E8ZA 3IGAB 3SOTA 3W0WE 5E24E 1IAIM 2JJWA 2FJHA 3RDJA 1YEGL 4FXGA 2IPTL 4F7PA 1XEUA 3ZL1A 1L9PA 3EFOB 3GQFA 5CBAA 3VWJC 4M1CC 4JFXA 3RVWC 1S5IL 3UJTH 3EH1A 5CEZH 3OKYA 2AEOA 3DECA 3FUFA 4PGCB 2OMUB 1JZ8A 1AQ8A 4NWTH 1IKFH 4JPVH 3HZYA 2VLJD 3AC0A 3GZPA 3CH1A 2QVKA 2X4TB 2YSSB 2CM5A 1HI6A 3DJZA 4WNJA 5TDPB 5LB1A 1RJLA 5E6IB 1ZVYA 5EEXA 1U8NA 4GP4B 3COCA 1QPKA 4WFGD 4MSWB 2Z4QA 1U8HB 5K69A 4FBZA 2XPGA 1QZ1A 4AIZB 4E41B 1T7VA 4Z77A 5KW9H 3DMMB 2ZOLA 5IW6A 2AK4B 3VGAA 3B2PA 4W70A 3GSQA 3O6LL 1UQSB 1R5IB 4QTIH 1A4KA 1BZ7A 2QFPA 3BP6B 3HJEA 2AJZB 1HQ4B 1NLBH 2OMYB 4TLUA 5A7EA 1Q9LB 2KLTA 3L1GA 4JE4B 4N6RA 3UPCA 4J6IA 4R0LA 3LKSA 3NN8B 5I1HL 1ZGLB 1L7TH 1X9UA 3HC0A 1FHGA 3MRGA 2LTQC 1W8EA 3ZTNH 2KMWA 3T0VA 1AZZC 2LVCA 2IMMA 1P1ZA 2X09A 3FH8A 3MLTA 2H1LM 4GYBA 3FPXA 3IAPA 1AHMA 5IT2L 4F7EB 2EUVA 4PM1A 4QRSA 5G36A 1KFAL 5KVFL 2ZOWA 1AO7D 1JYXA 2CUMA 3QJFB 5KYWA 1J48A 2Z1KA 1BXXA 1EWHA 2RBLA 3A6CL 3L9EA 5TQ0H 4JQXC 4ODTL 3WTXA 3LEVH 5IUSA 5LG6A 4J1UA 2X88A 4PJGB 1NCCH 2Y04A 2ZKHL 3H3KA 4I9WD 1SMDA 4UQCA 1WEJH 5E1HB 1W9XA 2GBVA 1R5WA 1KJ2A 4XB7A 4NM8L 1L7TL 3QR2A 2K6YA 4FS0A 3W0WA 4AK2A 5J57B 4Z78B 2PW1A 4OCRH 1DJWA 2IFGA 5I15H 4YDLB 5CFAA 5EOCH 2VC2L 3UAJD 1D5XB 2AZUA 3VYPA 3WS6C 5DCCA 4PV8B 4ZUVB 3ZDZE 4K8RD 3KPLA 2VDRH 2B77A 4ONHB 5DFVD 3TEYA 1BEYL 4UOQA 2ID5A 1S5IH 1P7HL 4U3SB 5LGYA 4PYGA 3TIEA 4PJGE 4L9LC 1MPAL 2XN9B 3VA2C 2Y5TA 2ICEA 1DHKA 4GAYB 3T2OA 2BC4A 5LVEA 3B6SB 4OJEH 2CHNA 3QO1B 3WFHA 1JBJA 4OUOA 3V6ZB 1JPGA 4HIHB 4XP4H 4TVPD 4HLZG 2J44A 2H9GA 2F1EA 3H2QA 1D6EB 3T3PF 3VGEA 4AYDC 1G1CA 1FBIH 5J1AA 4XT1C 1IW9A 1UJ3A 3D0VA 5D71L 4OCLC 3X12B 5TFSL 1EGJL 2HRGA 1H8SA 3VXTA 3ZZ1A 2W1NA 3PL6D 5LGKA 4NGHH 4C4KT 3AWFA 2OV0A 2VABB 2R8SH 4ETQA 1KG8A 4HIIA 1I1AB 2X05A 4QTHB 3MLZH 4P48A 3ROOA 1AGFA 4JKMA 5KS9A 4TTGA 4PTUA 1I4FB 4ONGL 4E2OA 3GIVB 2ZOKA 4M8QA 3BSZL 2O6FA 3VGAC 1YN7A 4G8FB 3VXMD 4KTGA 3VVKA 4EIGB 4PW9A 1PZCA 2H2PC 4LSVH 5T1KD 2E7LA 3CFQA 5CILH 3LXAA 5EU6B 3X3BA 2Z4TA 4PJDE 1TNMA 3MCYA 1R0AH 5ACZA 2IGFH 1DVTA 2WN3A 5JHAA 1JZFA 3K2MC 1P6FA 3QUXB 5AOKA 1IGFH 5H35A 4PVMA 1A02N 5DLML 4FABH 4AEHL 4EUPA 1C16A 1SDDA 4CC4A 1Q94A 3NCXA 4G59C 3CFMA 4NC1E 3CJJA 2G4GA 5E6UB 4D9RE 3FBKA 5DA0B 1QFOA 4YFEA 1JVKA 3LKOB 3FMGL 3ZGHA 4F1SA 1YNKL 3ATDA 4WFFD 1KTLB 1NFAA 1UVQA 3UYRL 1MREL 4QD2E 4AQAB 5A3IC 4AK1A 1Q9LA 3QFJE 5CP3A 3EYFA 1TTGA 3WNMA 4IKKA 2NW2A 2CGRH 2CQVA 2NW3B 4JRXD 2ZKYA 2EINB 4MNHB 5F0JB 4NZRL 1MAJA 3D4YA 2VB5A 3HARA 1LP9E 5JO5A 5AL8A 1XSIA 2ZCLH 1HEZB 2IV8A 1BFTA 5EU3A 2XZQL 3H7BA 3AREC 4GW4A 1EZSA 4IBWA 4IK6A 2H6OA 5DYFA 2ZICA 5BO1H 2XX0A 3FUJA 1P1ZB 3TCXA 2H1PL 3GSNB 1UACL 3HAOA 4GS7B 4OGXL 1H15B 3RWJB 5CGTA 1U2HA 2DL2A 4XZUB 4BFGA 4AG4L 4ODBD 5D1ZB 4N8VG 5DD3H 5C0EA 1JCKA 4WAVA 1JPTH 2YZ1A 2DKMA 4UYQA 3ZMRA 3GUFA 5H94B 1J7VR 1W91A 2ZUUA 1KZYA 1NPNA 3G5ZB 5CINL 3QXTA 5CJXA 1J1OL 4XNYH 1MJ7H 3HBPA 3RJOA 3L4CA 3X14B 4B41A 1NANI 4DP2X 2YD1A 3ARYA 3HTLX 3P4NA 2HFFA 3C6SB 3D3VA 4QYOA 4W6XB 5ESAA 3NYKA 2Q5BA 1A64A 4NQVB 1BD2B 4DFIA 2FX9L 3BD3A 1IBDA 5CLYA 5D1XB 2WCPA 4X32A 1MLBA 3PV7A 5D8JL 3ET9F 1NMBL 3NAAH 3VG9A 5GZOD 1D6EA 3QS2A 1IGML 1TZIA 4MAYB 3DX7B 4YN3A 3W39A 5T1LA 3E0GA 1KTJA 5C0DA 2PCXA 2GFBA 2NY4C 4A4MA 1XTLA 3A7KA 4FI7A 3B6SA 3KCWA 5GGQL 3MLWH 1GGBL 3B3IB 4U2ZA 1NFIB 3V6OE 3RG1C 2C1PB 3Q05A 3GO1L 1QSEE 4MKMA 1INQB 2PW2A 3U0WH 2PWHA 1M4KA 4LLDA 3SHSA 3B9KD 4TV3A 4PJIE 1KELL 2KZ1B 2L3BA 2CO6A 4BV0A 3CDZB 1MFAH 1MJ8L 2VLRA 3FFOA 1OAQL 4M4RB 3T8XB 4Y5XC 4MXQC 3MBEB 1ZANL 3T1FA 3PAYA 2ZXAA 4Z7OF 1IM9D 3VXSD 2WN2A 4KROC 4R7DA 2WGNB 4I2XB 3T2PA 3UTYA 5E1QA 1L0PA 3X1NA 1OY3B 1OGTB 1QSEB 4JJ5B 4J3OD 2X4NB 1RHHB 1WFIA 5EDSA 4O2FB 2GUOA 4JQIA 1YSOA 2WB7A 3TTSA 5ID0B 3KGTA 5C0RL 4XT3A 4O58H 1T0PB 5ETZA 4FMKA 4RLDA 2DIAA 3OGCA 1FPTL 4LSTL 4HLEA 1J18A 1XCTA 4TNFA 4D9RD 3VX0A 2VH5H 4B95C 2P5WD 1CLOL 4KI5F 4PI2A 1L5GA 2QADD 4FQJH 2GABA 1KLFB 4YX2H 3E3QC 2W80C 3IDJB 2K3TA 2NPLX 1UD4A 3BLBA 4L3EE 4OJFL 2YFOA 2YOCA 3SBQA 3EAKA 5DHMC 3VAEA 1ZT1B 5AQ0A 2GEEA 1P84K 1KGUA 1ZTXH 4YBHA 1CDBA 2PN5A 3O6ML 4JFFE 1HJBC 1G0XA 8FABB 3WIFB 1L3NA 3FB7A 3U9WA 2XN9D 1FN4A 3MRBB 3RUGE 4F7TB 2YUZA 4F2ME 3ZKSD 3P9MA 5F3HB 1P7KA 4ABWA 3T77B 1GZHC 5I1LB 2CK0L 2IQ9H 1FYTB 3QJRB 5C6TL 3VD4A 4XR8C 1RZFH 4LGRB 4CILA 5HPOA 5A6MA 4Y16A 3IM1A 3QXDB 5KVDH 1IGTA 5FYLL 3S3CB 1DVYA 4HWNA 1RFDL 2X4PB 1J0ZA 3QG7L 3KM2A 4BWWA 2PLTA 1OGAD 2CDEB 1A7PH 1CT8A 4IW4C 4FOMA 3MRJA 5I66A 4G8IB 4G8IA 1AQDA 1JTPA 1F4WH 4QHKI 1TZHA 4YNYA 4ZX6A 4G42A 1I53A 4KTEH 2VDKB 2WM0A 4FXGB 5C0BE 4GG8A 2BIHA 2R0KL 1KN4L 4X6FA 1GYVA 1T22B 2HLEB 1PDKB 3U4EB 1T6VN 3NJFA 2CUIA 5DO8A 3O11A 3MFFB 3VXQB 1AO7B 5KVGH 3GI8H 5J6GA 4MJIB 3KXFB 5F97E 3PL6A 4PGBB 4B9GA 1UKTA 1ZTMA 2VM9A 4C47A 3VWJD 3TNNB 4YLCA 4LLUA 4NP4L 2W91A 3Q5TA 5DJCA 4BUOA 4UI2A 2VYRE 1B4JH 3QT2A 1ZRUA 2DH2A 4ZSOA 1REIA 1XIWC 4YDZA 2RB8A 1PIGA 2EC9U 4GYCA 5AVZB 1NIFA 3C5ZD 1G9NL 2NTSP 4ABVA 4E42B 3MZTA 1IC7H 2QZ5A 2MOGA 3DBSA 5C0GA 1QSED 1RK1B 1UQSA 3VMPA 3A4DA 1I9EA 5E4IA 1SYVB 2AK4D 3ASWA 3HNSH 4LSQH 4NPJA 2FJFB 2OMNA 3J7HA 2GEQA 4LLDB 5EOCJ 3L3OC 3BAXA 3LN9A 5I8EB 1W8OA 2Z8WC 5AW9B 1AR2A 3DHMA 4K94C 1WO2A 2YCXA 1N10A 4I8DA 3V4VL 4ABQA 1AIFA 4KC3B 2V4LA 4YDIH 3ARXA 2C1PA 1DL7H 1SJVA 3KJ4C 4KVCL 2X4NA 3RY4A 4IOIA 2LVEA 1T6BX 2X38A 3MNDA 4IRJB 3P1VA 5LBSH 1DQQB 1ID5I 4D0CA 3TV8A 1FVCA 1ILUA 2X1OA 5IQLA 43C9B 1XX9C 5HYSG 5ENWB 1B3IA 3OWRA 2F74A 5GIRB 4S1RL 4GSDL 3N55A 1ASOA 1IQWL 4W6WB 3VI4B 2P47B 3BZ5A 3CXHK 4HSAC 4NGHL 3VI4F 3RWGA 1JYWA 1XF2A 4XN7A 4HIQA 2Y3NA 3FHAA 3UO8B 5CP7B 3VVVA 3IYLW 2X6VA 5INCB 2OBGA 2F8VA 2ZJSL 32C2B 5HGGS 4ACPA 2BNRE 1O5DT 4P5TA 4M6OH 4WWKD 3U6XA 5L4MA 2R1WB 2R1WA 2I25N 1C08A 1OCZB 2PP9A 2UZXB 3LN5B 5E23A 2F9BT 1L0MA 1E65A 1M6OA 2AERT 4GIAA 1UB5A 3T71A 3FL7A 1OE2A 5DMIL 4GQ9L 1K8DA 3FT0A 4A7QA 2XKSA 2XQYG 4V1DD 2FX8H 3BCFA 3LPPA 3DOHA 4HLJA 1X5FA 3L5WA 1A6AB 1KIUA 3CX5J 2VN4A 2BPBA 4MTMA 1BXUA 1ZS8B 2AEIT 3VGHA 1QR1B 1ZHNB 1X5JA 4N2IA 1RULL 1A8ZA 3ARDA 3TT1L 2XV2A 3FONA 5I74C 3IJEA 5EBLB 4EQ2A 2GC4C 3OHXC 4YGVB 3P9LB 1WRFA 3P9LA 3Q1SH 1MVYA 5HDLA 2AV1A 4JM4L 4E41D 1XD0A 1RJZB 3KPSD 4NQCE 1N4XL 3AS2A 3O9WC 1KBBA 2Z91A 4QRQA 3VRLF 2A6DA 3CZEA 4JN2B 3SBWC 3TBVB 3HE7A 1FYTA 5BUPA 3FQTB 4MXWL 4GP8B 1MH5A 2X2IA 4KQ0A 3ZKND 2DLEA 3SDXA 5AX1A 3HE6A 1CFQA 4K3GA 1TF4A 3TBWA 3EJPA 1KBVA 4FQXA 4YVNA 4LEXH 1C5BL 1MHHB 2G75B 4X4ME 3QPXH 2P42B 1V27A 3SBWA 2B4CC 4QXGH 5DJ8B 3ZMEA 4H20H 1DL7L 3FCSA 3H2WA 1HZXA 1KJMB 3PP4H 4KX7A 4U1LB 4XX1G 4AM0Q 3CFDB 4EF3A 3QEGL 1EGJA 1M2OA 5J0BA 1QVOB 3PGCB 4J3SA 2N7AA 3KXFA 3VFVB 2IGFL 1T0MB 3QORA 2ED8A 3VI3A 5CZKA 5EU6A 2I9LA 3HHMA 4M7ZB 4PLJD 1KGCE 1WQVT 4N3TA 3POHA 1J1XL 2A9ML 2X4UB 2X4UA 4AVJA 4R4FH 5JW3H 2FDBP 1CR9L 1NBVH 3QEQA 2WQWA 4XPGL 1WA0X 2R0KH 1IU1A 1RURH 3LQAH 3RFRA 1JGUH 4YMPA 3KL3A 4AIXA 1AXSA 2CU9A 3PCYA 3O6KL 4IRJA 1CURA 1BREA 4LCIL 3CVHH 1V5JA 2ZCKL 4Z0BL 5DD6A 1ET5A 1AZRA 2DM3A 4OGYH 4FYTA 3LZNA 1XH0A 3S2CA 3VXRE 2Q6WB 1F4XL 2W0FA 3V6OC 3A4FA 4HS3A 4ZXBC 2HFGH 2ZZLA 1HNFA 5ALCH 5FCUL 1FGNL 3WS6A 2XVLA 3QAQA 4X6EA 4TNVF 5FW6A 3BT2H 4QRTA 5DHDA 3M8OH 1QHOA 4JRYA 4U1SB 5KS9E 4HJUA 2X2JA 4JNXA 5MEPB 3WXVH 1OGAB 1U19A 2OZNA 2YGNA 1XF5B 3NIGB 4HV8B 3SN6N 1HHGA 1SRDA 3F7VB 3IMBA 4CVZB 4J12A 1S9XA 4DGWC 4LQFL 1JE6A 4NI3A 3UBXI 3WNJA 3CN2A 4TF4A 1N7MH 1WFTA 1YMMA 4Z1PA 3QXUA 4PY8I 3IGFA 4PJCB 4WUUA 3VG0L 3UC0L 4HGWA 1N0LA 1D5MB 2NXZC 2WNWA 4HWEL 4WRLA 3EOTL 2FT8A 3CE1A 2WXKA 5JDSA 3DX2A 3JWNH 2QPSA 5DK0A 4Y1AE 1NGZB 1N19A 3GWJA 4L4TA 3WHXA 4J1UB 1K4DA 3QUYA 4Q52A 3RGVC 2AJYL 4JN1H 2R0LL 3UTSB 5C0RH 4M8RA 4NOFA 2X7LA 1KTBA 1YJDC 2C34A 4X9YA 2X4QA 4GRLB 4LCWA 4MQSB 4IHOA 4XMPL 3WHE1 1IMHC 2J5LC 1NFDE 2MQ0A 4M29A 3GBMH 3DOSB 1RK7A 5A45A 3CZLA 2VN5A 1A47A 4UT6L 2QPDB 1OB1B 3IMTA 4ZXBA 4HETA 1GPOL 4KH9A 5EU6E 5B4MD 3X1EA 4RFOH 2OMTA 2VZTA 1MAML 5C2BL 1CFBA 4CNIB 3IVKA 3JTBA 4BV1A 4POZC 3GXNA 4XN1A 1F6AA 2JAGA 1OAQH 3RFZA 2CHZA 4HKBB 3OZKA 4PRPA 3VRJB 1AQHA 2G9KA 4OV5B 1G7QA 5DI8A 5I74B 1PS3A 2PYFB 1QBBA 3ESPA 4HCFA 5IJCC 4NWUH 4BD4A 1GC1C 1PJ9A 3RIFF 5FF6A 5IHZB 1JYNA 2R0LH 3NK4A 3WG7B 4AQ1A 3CSPA 5FYJL 3BKJH 3H9SD 5TE6L 2D03H 4Z9KB 5JHLL 2APBA 1UAZA 4FC3E 5LJYH 2DW5A 4YDVB 1DVFA 4JDVB 4KJPC 2PETA 1GPOH 1T20B 4APXB 3BC9A 1AFVH 1KCKA 2VXUL 3BHBA 1DDHB 3QNXA 4P3CH 4Z0XB 1MEXL 3O81A 1AYOA 5FO7A 2OCFD 1HHKA 4AM0B 4ODUA 1QUNA 1R3HA 4KKBC 1R75A 1IGYA 1ES0A 1MNUH 3LHAA 5IQNA 1DJXA 3GSRA 1CDUA 1KENL 4UAOB 1FH5L 1K2DA 3UPRA 1H8LA 3K81A 1HJCA 1WJ3A 4W9LC 3I9GL 3CAFA 1CDGA 4MMXC 4Y9FA 5FHAH 2EDHA 1HVXA 2NOYA 4NCDA 4J3XA 3IGKA 3U6XS 1KFGA 2EEDA 4BE6A 2VLLB 2ZONA 4NQXB 4WUUE 4PLOB 3UC0H 1NUGA 1ZTXE 4OV0A 4EJ1C 4LFHG 1RJYB 2WYIA 4RSVA 4N8PA 2JV6A 2YEZB 2WJ5A 3KBEA 5F89A 1D5BA 2OX5B 5D9SB 3GKWL 2D8KA 5DEFA 3B5TA 3RI5K 5ISZB 3GI9L 3FSOA 1J5DA 1WTGT 2APFA 4PJIA 2VDOB 1OW0C 5FYLH 1MFNA 3CHXA 3FT9A 4RDBA 3WIHL 1F50A 1AXSB 4N2EA 3TJEH 4F33B 4WHYH 3WTVA 1M0KA 1E27A 3MGOB 4WSKA 2ICWB 3KR3L 4NERA 3CFJA 1YNTF 4TTDD 4U3CA 4YXKL 1HEHC 5D2NA 4Y5YC 1LD9B 1N6QL 3T3MF 1IXFA 2FB4H 4X4KA 1JGEB 2GIYA 3K4ZA 4J7RA 4U2YA 5FUOL 1WISA 3FRUA 4PJIF 2BWIA 3OXRA 4DKTA 3G08A 5H35B 4GBRA 2ZXCA 5SWZE 1M2VB 4GRLC 5I1IL 5F7UA 1NIDA 1F56A 4ONFL 5E0FA 3V2AR 5E5UB 1HXMA 3SDDA 2PMZA 1YG9A 1L6XA 3MNMA 3AWGA 1TVBA 1MY5A 2O5XL 2H3NB 3NH7L 4IHOB 5FHBL 3S37L 1EEYA 3MX0A 2JJTC 1UKSA 2A2QT 4Z7NB 3NZ8B 5TE6H 4BFRA 1K4DB 4HGKC 4GRMB 3O41A 2W38A 4I2XE 2LHAA 4PJ8C 5JDSB 2D2OA 4AEIL 4B9CA 3TF4A 1P2CB 2G5RA 1QASA 1S3RA 4JFFA 4QRUA 1Y07A 1R3IH 4OFIA 7PCYA 1U30A 5ITFB 2PPCA 3BPOB 3OHMB 4GW4B 4FTVA 4NRYA 2X1PA 3QCVL 4V2CB 1IC5L 3C9MA 2FK9A 1MLCA 2WLMA 3DJSA 1DLFH 1P4UA 5DEGA 3CVHA 4PR5A 1HC1A 2NCMA 2JAFA 4ZFQA 2O5YL 3WDIA 2QV2A 2VDPH 4YFLF 3K2IA 2ADIB 4PGDB 3VGGA 4BZYA 1ZVHA 2ZXEB 2YD0A 1ZWIA 3G6JB 4X7FC 3T0WA 4WSJA 3EJUA 2FRGP 3V0GA 1J0IA 1IRAY 5I6OA 1JPSH 2UZIL 1G7JB 5MEQA 4Y9BA 1MWAB 1G9MH 1F6AB 1LN6A 1VB9A 3Q1SL 3T2NL 4G6KL 5KW9L 4X0KA 3HOGA 4DGIL 1C8QA 4I0PC 5AVQB 3IKKA 2YQ2A 2AJVH 2XU9A 5JPNB 4HH8A 4GQZA 2BOCA 1KB3A 2XJKA 1XBRA 4M6OL 2XQYK 5AW8B 3BAEL 1PX3A 3IFNH 2X87A 4HIXH 1TYEB 3CU1A 4PJ6A 2J2ZB 2NDFA 5AOMA 3L3IA 1MDTA 4WI7A 2VRKA 1JNHA 3X3GH 2BCMA 1V55B 3S5LG 1YYMH 3BAYA 4H1LH 4UINH 1JPGB 1BQLL 4HIHA 3GTTA 2YD4A 3FOLB 4B53A 2WHVA 2ZCLL 3MOBL 1KCUH 2GJJA 2V5SA 2F5AH 2IXQA 3TYFB 5DC4B 1DQQA 4RAUA 4YHLH 4NZRH 3ZKMC 1HDMB 1BD2E 1I4FA 4HAFA 4TSBL 5GZOC 1R46A 2QHRH 4L8BB 4TVSa 4AYGA 1RJYA 4HH9A 4N0UA 5IOPA 1VFBB 3BO8B 1YEDA 2J73A 3IETA 3NQIA 2ZPKL 3L3JA 5D1QB 3WGUB 4X0NA 5D7IB 4D3CH 3II1A 4XOEA 4BSVB 1Y6NR 2P7TA 5TK2A 4K73A 4NFDA 1YC8A 1JGUL 2NXZD 1XT5A 1V7NL 2V3DA 4BQ8A 1SJHB 5EZPA 5IMKA 1OHZA 3C60C 5TDOB 5C2BH 4OJDH 1JAEA 4H8WC 1EHNA 4XXJA 2WJLA 1AGDB 2AJ3A 1HSBB 4LCWD 1NCNA 4HUMB 5E8DL 4ELKB 3WLBA 4O5LH 3BDXA 4XCNA 3TX4A 2VT4A 2IANA 3B8SA 4RMRA 3ZL2A 4QXVA 1HEZA 1QMUA 1D6VH 3HI6H 2Y7LA 1T83C 3VUAA 4NKQB 4GI8A 1MHHA 1QEWB 4M61A 5ANMA 3RWFA 1I3GL 1X9LA 3NCJH 2BO0A 4E9SA 3F85A 3NFPA 3FO1B 4K3HA 3LXBA 3CHOA 4AQAA 5CZXC 4RAHA 4UYPA 4YNYB 5A2KH 4F15C 3MA9H 3QUKA 4XVUD 2OTWB 4XNXL 5I5IA 1ZEAH 2WQAA 4OZHE 1ZA6A 3EFOA 2JELH 2Q7AA 1I1RA 4M3KB 5IFJB 4QHLA 1U8OA 1U8OB 3BAEH 2KSBA 4CKVX 2IAMA 3ALXA 4Z8FH 5IB2A 5E2UL 4DGVL 3DRQB 2YKKA 3QXDA 4Z3TA 2P5WB 3MUZ1 5IK3B 3UTZA 2BSSB 4AYEC 1NGYB 5AVXB 3MACH 5FA4A 1JDAA 4JZJC 3G5XB 3UTOA 5BXFA 5K33A 4C56E 1KCVL 2JKSA 4UANA 4W9HC 5E6IA 2HX7A 1CDIA 1SXBA 1WBYA 1RZIB 5L0QB 4KOCA 5KUKA 1FL5B 3BI9X 3GKWH 5E1GA