2QPFA

Crystal structure of mouse transthyretin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
116
Chain Sequence
SKPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human-Murine Transthyretin Heterotetramers Are Kinetically Stable and Non-amyloidogenic: A LESSON IN THE GENERATION OF TRANSGENIC MODELS OF DISEASES INVOLVING OLIGOMERIC PROTEINS.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Transthyretin
total genus 26
structure length 116
sequence length 117
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2qpfA00
5L4IA 2G4EA 1THCA 2H0JA 4TQ8A 4DERA 3A4DA 4TLKA 4PMFA 5L4FA 3IMTA 4N87A 3CN2A 4IK7A 3TFBA 1X7TA 3OZKA 1E3FA 3KGTA 5AKSA 5CN3A 4AC4A 4PMEA 5EN3A 5DWPA 4DESA 1RLBA 4WNJA 4IK6A 4TL4A 1IIIA 3HJ0A 2ROYA 4QYAA 5TTRA 3DO4A 1DVUA 4PVMA 4ACTA 3ESNA 4HIQA 4Y9FA 3CBRA 5FO2A 5IHHA 4HJTA 1DVXA 1Z7JA 1F86A 1TTCA 1ZD6A 2G2NA 3A4FA 4IKJA 5A6IA 4TQHA 2QGDA 4TQIA 2QELA 5JIMA 3DJZA 3A4EA 2B77A 5CLYA 1ICTA 4PWEA 1BZDA 1DVQA 1TLMA 2B15A 3CFNA 4TNGA 2G4GA 3IWVA 5CLXA 3GPSA 1SOQA 3U2IA 1SN0A 4TLSA 3D7PA 5JIDA 4Y9EA 3DIDA 5E4AA 4YDNA 5HJGA 1TTBA 3GRBA 1ETB1 1SN5A 2WQAA 1TSHA 2TRYA 3P3SA 4FI7A 2G3XA 2FLMA 3IMUA 3NESA 4TL5A 1OO2A 4WO0A 4Y9GA 3IMRA 1QWHA 3IPBA 3CN4A 2QGCA 5K1NA 2G5UA 3CXFA 2IGLA 3DJRA 4PWHA 4PWKA 3D2TA 5AYTA 1BMZA 4MRBA 5L4MA 4PWJA 1DVSA 2B16A 5L4JA 3IMWA 4FI6A 4IKKA 1DVZA 4HJUA 4HJSA 4I89A 4Y9CA 3GS4A 4L1TA 4DEUA 3DJSA 5CLZA 1TZ8A 2G3ZA 1E4HA 2NOYA 1F41A 3GLZA 3DK2A 1TFPA 5FW7A 2QGEA 2H0FA 4WNSA 3OZLA 2GABA 1TTAA 4KY2A 3P3UA 4Q14A 4AC2A 4D7BA 5AL8A 3NEEA 2F7IA 3NG5A 3IPEA 1Y1DA 1TYRA 5E4OA 4FI8A 1ETA1 4MRCA 1KGIA 4Y9BA 5AL0A 4ABUA 4DEWA 5CR1A 5AKTA 1DVYA 1DVTA 2ROXA 4ANKA 4IKIA 4YDMA 3CFQA 1SOKA 3U2JA 1GKEA 1QABA 4QRFA 1FH2A 1G1OA 3DK0A 4QXVA 4ABQA 4PM1A 1BM7A 3GS7A 4N86A 4L1SA 2H1XA 4TQPA 4TLUA 3SSGA 4PWGA 3BT0A 1SN2A 3KGUA 5EZPA 3W3BA 5JIQA 4HISA 2QPFA 1IJNA 3GRGA 1E5AA 3GS0A 3M1OA 3FC8A 3NEXA 3BSZA 4MASA 5E23A 1IIKA 3DGDA 1BZ8A 2G9KA 1BZEA 4TKWA 3QVAA 3IWUA 3P3RA 4I87A 3KGSA 2G2PA 3I9PA 2H0EA 3CN0A 4ABVA 1TTRA 1U21A 3I9AA 3Q1EA 3CFMA 4PVNA 4TNFA 4TNEA 1IE4A 2B14A 2F8IA 2GPZA 4I85A 5FW6A 2H4EA 5K1JA 1ZCRA 4PWFA 1THAA 3IMSA 3B56A 3ESPA 5CNHA 1GKOA 3IMVA 2TRHA 4N85A 4IKLA 1TT6A 3CN3A 3NEOA 4TM9A 1X7SA 4PVLA 4TLTA 3TCTA 3I9IA 5AKVA 1KGJA 3CFTA 4IIZA 4DETA 5FW8A 3ESOA 2FBRA 3P3TA 4PWIA 2PABA 4ABWA 2QGBA 5DEJA 5BOJA 2B9AA 3DJTA 3FCBA 2H6UA 5CM1A 1FHNA 3CN1A
chains in the Genus database with same CATH superfamily
4OZGA 5KYWA 3RY5A 1YNTB 2VW6A 1L7IL 3ZY7A 5EO1B 1G87A 1T1ZB 1LMIA 1VGEH 3FQ2A 1V7ML 4YHMH 5CO1A 3T4YA 4OFQA 1RZQA 1XIWD 3L3HA 4MNHB 4JB9L 2AC0A 1KXTB 3LEVH 4HLJA 1A6UL 1B0RA 1OCCB 1FPTH 5JPNC 3S88L 5HGAB 1ZTXE 3LNGA 1UH2A 3HC4L 4BJLA 4CBPA 1YN6A 2HLFC 1I1AC 1L3WA 3QXAB 4CMMA 3AZUA 2ADJB 4TVPD 5CINH 3NGBB 3OD3A 4H1LA 2EE3A 4JAMB 4IGBB 1UXMA 4JDTL 1G5AA 4MLIA 4Z0BL 1HHGB 1DQQB 3DKHA 2OZNA 4K07A 1ZWIB 3FT3B 5I30L 3QC5X 2Y7NA 4J1UA 4P2CG 1R4XA 4WFHD 4K23L 4OVUA 1KC5H 2ZSVB 3F8UB 3CDYA 3BUIA 3SYOA 4WTQA 1B3JA 1HNYA 4JVUA 1NIBA 5DQJB 2PYEB 4Q7DA 2BVYA 2YOAA 1AZUA 1WV7T 1MHEB 1DDHB 2VXUL 3KL5A 3VU1A 1AACA 3L1OL 5CXPA 3GJEA 4OD1H 4K55A 1AVAA 1D7FA 2Z7WA 5DUJA 3BP6B 5D7KE 4AWJC 5I76A 3NCEB 4FI8A 4XN7A 2V2WB 4PS3A 2RCSH 4HFUH 3PGFL 3EOAB 4JRXD 2V2XA 2BP3A 2VTFA 1SJEA 5TD4A 1ZMYA 1NKOA 2UWEF 3CSYB 5HYIA 1WAAA 4BSJA 1BFVL 2Z1KA 4ESKA 3RY6C 3K4ZA 3L48A 3WXWH 3DTXB 1ZHNA 5D7IE 4N20A 5AW7B 5DJ0B 3VXMD 2ESVE 4U1NA 2EIEA 4YDJA 1TPXB 1UKSA 3VMOA 1SJVA 1SXCA 3OG4B 1YEEH 4AZUA 4X0NA 4WQOA 3FUHA 4YEEA 1USQA 4OIFA 3NH7H 5C0JB 1G7JB 4L1LA 2P5EB 1I3RB 2D9CA 4GMTH 4L3EB 4HKJB 5JNYA 3KPOA 1RZGB 3IMVA 3O6FD 3TCTA 4JFSA 4KO7A 5A2FA 5ALCH 2DQUL 2AEQH 3NIGE 2YD8A 2RALA 1UKTA 4X8CA 1TITA 3JWNC 3L3HB 1E90A 3E6HA 3FCBA 3NSJA 3UDWA 5EC1A 1UWEH 1SVBA 4BZ2H 3ZT5A 2FLRT 5KVFH 4U6TA 2C1OB 4LOFA 5CCHE 3R06B 1QRND 4GO6B 1UD3A 2AVGA 1A2YA 1YYMH 5F8RC 4QXGH 1QHQA 4K71B 1U8KA 2AQ3A 4A2EA 3BESR 5E2TL 3MX0A 2BP8A 3MXVL 1IGJB 2J72A 4JFDB 4Y5XB 2EO9A 4P2QB 1OP9A 1WT5A 3EF4A 5T5FH 3G6AA 2DJ4A 4CNIB 2FSDA 1N8ZA 4ZMVA 1RCYA 3IU3B 3DBXB 4GAGH 4RMWA 1CICA 2C9UA 4EN3C 1SBSH 1SXNA 3EGSA 3N0PB 4O00A 5GGSA 4YSUA 4F33A 4FQ2L 4XXCA 4X6EA 1HSBB 1UEMA 1T3FA 3MHZA 3QUXD 3PWLA 2XQYK 3STZA 1P5UA 3GLAA 3N6YA 4A2GA 4HVBA 3PHQA 1I3VA 3JV0A 1D9KA 4L1SA 1AZBA 4Z3EA 2GIYA 4A63A 1H15B 3NP3A 5FGCB 4Z7VB 4AYDC 4LLMA 4CJ1A 3ULVE 1TZHA 2BY2A 4JN1H 3MOQA 5I8OH 3DHUA 1E5CA 4HSQA 4XO3A 1XCQA 5AVYB 4PJHB 2V2XB 1AHMA 4YVNA 1V3KA 4JW3A 2UZIH 3D3VB 1DTUA 4ZX3A 3GGWB 2K7PA 4FAAB 2E76C 1NJ9A 3QPXH 4IW4C 3ZL4H 3BZFA 1I4FA 2Y5TB 3TWCH 5DJ2A 1J0IA 2P8PA 5D7LB 4NRXB 3EXJA 1KGIA 3II3A 2N59A 2CALA 2W60B 5ERWB 4IOSA 3SB3A 2QBWA 1BQRA 3WIAA 2PP9A 5I17A 1C7TA 1EEYA 2DIJA 4JM2D 2J5LC 4FQ1L 4JN2A 3VNYA 1QABA 1I9JH 3DXAD 1JZIA 4MXQD 4YSPA 1EFXA 4M5ZH 2K4WA 4BUHA 2EIMB 3ZKMC 1XGTB 1R3JA 3IGAB 3C2AH 4KUZL 3J2PA 3Q3GB 4XP9L 2HLAB 1RZGA 1QVOB 3W3BA 1A22B 3B6SA 4K7PY 1PTZA 1OAYH 1XIWA 1BM3L 4XMXA 3FHEA 4XCCL 5IIEB 4S2SB 3ZE1E 5CCKH 1NBVL 5D4HA 4HBCL 5IHBA 3C5ZB 4MXQC 2B14A 4DF9A 1U8MA 2W0LA 4JFFE 2YA0A 3DX3A 3LN9A 1SDYA 2K3HA 4BIKA 5DTFB 4EPSA 4FG4A 3S37H 4Y5VB 3UP1A 4ZD3L 4ZTOH 3BPCB 4IIZA 5AG8A 2ZP0T 4KQ4L 1U8KB 1UUSA 2AZAA 3ZE1F 4Y5XA 5I73C 3DUUB 2NW3B 2JCWA 3SPIA 3SBQA 2EXWC 1A3QA 3VFOB 2G0KA 1U2YA 3UDWC 2FX7L 5KYUB 1J5HA 4P2RA 1FZOA 5D5MF 4C56D 4WGKA 5D4QA 1SGKA 3GIVB 3EYFB 4C4KO 1JN6B 1PL3A 2F19H 1PMYA 1BQHG 2IFFL 4LASH 4JPKH 3UJTH 3OAUH 1B0IA 3S7GA 3T2OA 4PS4H 4TUKL 1NC4B 2HRLA 4M5ZL 1NBVH 2XICA 4UILL 1S5HA 3VFTA 2VR9A 4UT9A 2NZ1A 1QLFA 3S5YA 1XH1A 2JLLA 5I6KA 3WJLC 1OGAD 2OMZA 2EP6A 2QV2A 3E3QC 1FNFA 3KWXA 5DJAB 1OAXL 4ZS6D 4KO5A 3QULA 4P23D 3KNBB 4Q0XH 4JFDD 1HH9B 2UZYA 2M2DA 4JNXA 3EDFA 4FTDA 3VQ2C 3SE6A 1BQLL 3WMQA 4QI3A 1TTBA 2YRLA 3P54A 2GJPA 5IREA 1S7VB 2JCCB 3IMUA 4L05A 1S9XA 3ILDA 1IKFL 4S0HA 4GO9A 5AYTA 2WLLA 4ISVA 5I8OL 4C47A 3H9SB 2PLTA 2LFEA 1L9QA 1MCQA 1Q0YL 2VISB 5KSAD 2ODIA 2WQSA 4DZBB 4AENA 3DC0A 1B3IA 3QDGD 4JHWL 5C7ZA 1REIA 5A7BA 1MF2H 4KTEH 4EJ1C 4AGNA 4EDXA 3Q43A 2W1NA 1A47A 3FQUB 2VE6B 4LU5H 3V5HA 4ETQB 4D2NA 4PYHA 3CFBB 5AL8A 3HBQA 3SQBA 4DPBX 4N22A 3MROA 1EK3A 4L2YA 3TEXA 4PJ9C 3KPSE 3FO0L 4OQTH 4D9LL 3WFEH 3PWVB 4L4JA 2AXGB 5F97E 5IW6B 5JORB 3BAXA 3IF1B 4YHOL 3HE6C 5C92A 3FTSA 3VFGL 3I6SA 5DRWA 4Y1TA 4MAYD 4TQPA 2P46B 3T71A 1GC1H 1A2YB 4P8QA 1G9NL 3FC8A 1NQBA 4JRLA 4AI7A 3FQWA 3B2DC 1GTNA 2A6DA 3U7WL 1Z3GH 2UWEA 3BUPA 3DBXA 1THAA 3TEUA 2R51A 4JQIA 43C9A 1HHKA 1XX9C 4XNZB 4UT9L 1H19A 3KWTA 1AP2A 3FN9A 2VDKB 4QRQB 4E42B 2QV4A 3NIFB 5E6YA 3QDJB 4F5CE 1YJDL 2MSPA 4I18A 4HJ1A 3RAJH 4BD4A 4DGYL 3L7EA 4KWUA 1OD9A 3CSTA 2IGFH 3Q6FB 4U1IA 5CIPB 5I6OA 1QYGL 1Z0NA 2NY6B 1GPOL 3QIBB 4G8GB 2DI9A 4IJ3C 1DHKA 5HHME 5DUMH 3ZDXF 1GMEA 4A1RA 4BK5A 1KCSH 2XN9E 2E6QA 1NCGA 1CD0A 2Q7NA 3BUTA 4Y19E 4BH7A 4OCXL 1DBBH 1X6LA 2CHNA 2YRBA 3MFFA 5A2CA 4XOCA 3GNML 3ARSA 1WFJA 5CSZB 5ISZA 3UEZA 3SKOB 1S78C 5CP3H 5BO1L 1UKQA 4HGWB 4YDKL 5DZAA 1N3NB 4EQ2A 4YJZL 3PGFH 4IU2B 1UXSA 3IPFA 2NY5L 3VXQB 4MNGE 3LRLA 4PJXB 2YC1B 2WP3O 1WAEA 3TBSA 1BZDA 1JGVH 3P2DA 4G43A 4YLQT 1EQWA 3QXDB 2PPCA 5IROD 2R8SL 4R26L 4H26A 3ILQD 1JHLH 5BVPL 4KH2A 4I9WE 4HHAB 5TFSH 2C3WA 3P4OA 2VE6A 4ETQA 3QQDA 1IT9H 2DWDB 3WSQH 3SQBB 3M17B 1T7YA 3F7LA 3AREC 2ICWJ 2A74A 3PU7A 4GKLA 4JZJA 4Z3GA 2IG2H 3QCVL 5I5RA 5GGTL 2XWXA 4Y9CA 3UX9B 3FAWA 4V1DD 3HOGA 3TH4T 4FE9A 3QH3B 4LLVB 2F08A 1A7RH 3PWVA 3GLZA 4PJ8C 5IW6A 2JQAA 4FF9A 5B39B 3BGAA 3J7HA 3DI2B 4MJ6B 1CFMA 4I0PD 3C09B 2J43A 3M7OA 2PTTB 4CGUB 4N0UB 3RI5F 3SCMA 2KERA 2R2EB 4XHJD 2WZPD 4JGUA 4F3FA 2Q9OA 5D72H 4P2OA 1TQBB 1I9IL 4A04A 1KB9J 3CFDB 1AGFA 2Q76B 3AW5A 3IDNA 3UOAB 1TOXA 1LK2A 2XNAA 4B9IA 1F4WH 3HE7D 4H0HB 3V9FA 1F2QA 4BFRA 1OSYA 1MCRA 2NTSP 3HE6A 4KROD 4TLUA 4NQEE 4KKQA 4ONOA 3EJZC 1JDCA 2OI9C 2QVMA 3BXNA 4QRQA 2APBA 2A99A 2X9XA 3MFGB 4LQFH 1NPJA 2ZWSA 3C6SB 3G5ZB 3VH8B 4X4YB 4Z3IA 4KK8D 1BZQK 2WSKA 4UV4H 4Z3TA 2FJFB 3WIHA 4UBDC 3WFHA 1KIQA 1X5AA 4M8UA 1PKQA 1GCYA 1XGPA 2AEPH 2DTML 2O5XL 4GQPH 3HMXH 2CPUA 4H44C 5D71H 3F00A 2H9GB 2NY3C 4ZUVB 1VZHA 4TSCH 1USZA 2IMMA 1L7IH 1ZT7A 2X6CA 3ZL4L 1U42A 4G7YL 3WHE0 1I7RB 1SEQL 1FL6A 1OB1B 3MOAL 2UZIL 3QRLA 1N26A 3PWPA 2X1PA 4X9YA 3RWGB 1AXTL 4BA8A 3DNKA 4OJCA 4RSYA 3HA0A 4JEGB 4W4OC 5HJDA 4MMXC 4IK6A 4JFED 1TZGL 2AV7A 2LR4A 3TIEA 3T2QA 2F7QA 2VXSL 4AQAA 3QIUD 4KX9A 5I9QC 3IGFA 1RJYA 3AROA 4N2LA 1R0AH 5GRVL 5IROA 3ARQA 5DRXA 1L5GB 1EUTA 1Z9SA 4FZEL 2F54B 4JM2C 4AXWA 3RWCA 4RGND 1OT2A 3OF6A 3PABA 4R4ND 5JUEL 1Z5LB 4GIOA 4ZO7A 5CJXC 2FH8A 4KTDL 2V5YA 2ODHA 2Y4SA 3MRIB 3QCUH 1MQKH 4KOBA 1VFBB 1HYSC 3ZZQA 4UUJA 1IAMA 1J7VR 2Y1VA 5EBLA 1HCFX 1PLGL 1N59B 4F2MB 5KSBF 4HMDA 5GQBA 3WE6B 5FPIA 4YX2L 3NCMA 4AK2A 3NUKA 2VIRA 3SY0A 4BELD 4ODHL 4XVUC 5I18H 3BZEA 3AG1B 1QKZL 1KBPA 2MOVA 3TA3C 1EDHA 2TSAA 4PJIA 4PCSA 3KLAB 1URZA 1KCKA 2A1WH 5HI3C 2Y6SD 5FOBB 1R17A 5CP7A 4OAWA 4W6XB 5K93A 2CO1A 5ESAA 3BZ5A 2EDLA 1DCLA 3ZTDC 1A1OA 4G42B 1IBFA 3GSNB 1LLAA 2BSEA 4JFTA 1V54B 3CFQA 2BFVL 2FIKB 3Q6FA 1L6PA 2IBZY 2VN3A 2X2HA 4QXUL 3VD3A 1YEWA 5IWLC 2ZXAA 1MXDA 4X9IA 3HMXL 4MX7A 1T03L 4PBDA 1AQKH 3VXSE 1Q9LB 4MMYB 3VXOB 4CSPA 2BHZA 1CO1A 5HHOD 5TDNA 1TF4A 4RZCA 1MREH 1KCBA 3IF1A 3LIZA 3C5ZD 3LZNA 2HWZL 4KMTH 2EJ1A 4AMXA 4DPRA 4JKLA 3V6FB 5C6TL 1QBLL 4HXAL 3BQVA 5T1LB 4JPVH 2G3NA 4PAZA 2PR4L 3ZQXA 3CPUA 4QWWC 4NUMA 4ZAKA 1BG9A 4FLRA 2DDQL 1UZGA 4X6CA 2YA1A 3VXUE 3FB5A 1NCDH 1QUPA 4ZFFA 2YMXH 2A9AA 4JRYA 2IVFC 1FHNA 5LLIC 3V6OE 5SWZB 3ZMEA 4AGOA 3PHOA 3QQDB 3C5SB 1ZLVK 5HDBE 3GRWH 5DEFA 1NIAA 3HN8A 3VFWB 1GOGA 3KGTA 1JGLH 3ARDC 4FXGA 1DSFL 4AC4A 4NAQA 1IGTA 1WD8A 3KH4A 4Y2DA 2X09A 5GGTH 1F1GA 3UTSE 4EZJA 4L29B 1YNTA 5F0LB 1FLRH 2DAVA 3FU7A 1AI1H 1QHOA 4PGJA 2VM3A 3LNEA 4HPYH 4A2DA 1S9VB 5J1AA 5DZJA 4G1EA 3IAQA 5E00A 1YLBB 3MUHL 2Z7ZA 5CJQH 4NUGL 5F0PB 2XTLA 2XWDA 2XQBH 3ARBA 1X5JA 3QA3B 2PWDA 4AH2A 3RTQB 1PFCA 3K6OA 4NQDE 3SBWA 3ARFD 1IC7L 5MENB 3H9YA 4YHPA 3TO2B 2WQAA 5L88H 4NXKA 3E8UH 4ORGB 5I0XA 4I1NB 4JFYB 5IF0A 5EO9A 1MWAL 3EYOA 1ZGLA 4PCTA 3JVGA 1JZ6A 1QRNB 1C8PA 3KH3A 4DGIL 1RUAH 4L9LA 2DD8L 4WTXA 3HUJF 5LBSL 3S5ZA 4U6VH 1Z2KA 2EABA 1VGKA 1EHLL 1LEGB 4YGAB 4B9PA 3MMEB 5B3NA 2AI0L 4O5LL 4RGMC 5LG1A 1RJCA 3GLEA 2BXYA 2ZSVA 3NEEA 4LCVA 5A3IC 1CD1B 4XP4H 3VWKA 2XXGA 1MCWM 2I9LA 1T0MB 2P52A 4YSRA 5EU4A 3AADB 1CDUA 1SMDA 1I85A 1H3VA 2ZX9A 4H8UA 2QSTA 3QRFM 3F01A 3MV7E 4EIBA 5JPMC 1L0YA 5DJCB 3QDHA 4EUPH 3TOPA 5KSAC 2ZUUA 4LCUA 2BVOB 3RX8A 2R56L 2BDNH 4NAMA 2JTYA 3Q9QA 4C8XA 3BRFA 4JDZA 1YEKH 3QZPA 4PJCA 3R19A 4LSSL 3G9VA 5EUOE 1JZ8A 3VGFA 5ESVB 4H5SA 4Q9CA 4KRMB 3S2CA 5AWNL 4ZPVB 4NP9A 3T3ME 4GUPA 3CSYA 1WS7A 4DN3H 5JYLA 1YYLL 3CDGB 3FQRA 2RHEA 1P9MA 4JO4H 4M6NH 1F42A 4YIQA 1RVFH 1NANH 1DJYA 2XBTA 3RDTA 4H1LH 1U92B 4QLRA 4LCWE 4Y1AD 4HULB 1HEHC 3O0LA 3IE4A 3SDCB 4NUPA 3PL6A 2E86A 5IMLB 5JIHA 1NMCC 2I9TA 2XWZA 3LXCA 1NBQA 2P48B 3GMLB 3L3DA 5GS1B 1YPZB 2E9JA 3K6FA 3BEVA 4Z7VA 3I02B 3QNZA 4HJJH 1JPSL 2PYFA 1OP3K 3WE6A 1SNRA 1YQVH 4GW4B 4BKLB 5BZDA 5C09D 4AGPA 4K7PL 5FYKU 5TGBA 1VZIA 2HX9A 4F2EA 2UV3A 5CUSL 4B5ZA 2A9ML 4NN5C 5MENA 1Q72L 2FIRT 5JZ7D 4QYOA 5IG7A 3IU4L 3PFQA 1Q9WB 3Q2LA 1MELA 2IOIA 2VXTH 5G4MA 3AB0B 2NT0A 3H9ZA 3QXWA 4JM2F 1XF3B 1UD4A 3RBSA 5B3SB 4NPJA 4F8NA 4OIIL 4PWEA 3W9EA 1DVFA 4HMEA 2HT4D 5E1HB 2K70A 2WXJA 5GZOA 4OY9A 1H6TA 2AJ3B 3BO8A 2YJQA 1GCFA 1BZOA 2FATH 2Z8RA 3IFLH 4UM9B 3S4SG 1J1OL 3FQUA 1SM3L 1OP5H 4P3DB 2QT6A 1D7CA 1I7TB 2FWOA 3AREB 5FO7A 3WAKA 2ZCLL 4JFOB 4LOEA 4O2FA 1PZ5B 2PETA 3UBGA 2UWEE 3EJYD 4OZFG 4PJAB 4LPXA 3ARPA 1BAGA 1MRFL 2H32B 3MLRH 3PNRB 5DFVC 1RUPH 2JKRM 5DTFA 1BG1A 1NEZG 4IHOB 5HHXL 5KTEL 5E5RB 3WL9A 1GGCL 3X11B 3IU4H 4TVPE 1WPCA 4YBQC 3RNQB 1A7NH 1TTFA 2MQ0A 4LHUB 4JANB 4FNLL 4WK0B 4NQDA 3D07A 1FNGA 4I77L 2WWMD 5AOIA 3MNMA 1G1OA 4E9SA 2ICWI 1G9MC 3C6LA 4P5MB 2DY2A 3PJSB 43C9B 4ILDA 1G7IA 2Y7SA 1SN2A 4M7KL 4X4XA 1D3CA 1FZKB 4Y19A 1JXGA 4M3HA 3N0AA 4ZT1A 1HU8A 3L54A 4YDLB 4JFFD 5ISZE 3EFOB 3I9AA 2FJHA 4ODXB 2A5UA 2WNGA 2XTJD 2EKSB 5IHUH 3BCFA 1BVLA 4PWFA 1JNLH 3N1GC 4NOFA 5C3LD 1F58H 3MRJA 3F2LA 2FBOJ 1YEFH 3CHRA 4AW7A 4PJ5B 3B6SB 1TJGH 4IRZL 1RIUH 3EJSA 1XH3B 1LD9A 3CD4A 3GSRB 2H8PA 3P4NA 3QZNA 2Y25A 3V4PA 1CTMA 3ZYIA 3D12B 2A9CA 3S4SA 1E5BA 5FIEA 3K6DA 3V0EA 3VX1A 3LZLA 3KLLA 3F58L 3LKSB 1RK1A 5IEHA 1FNLA 2QPEB 1UCBL 3NP4A 3PDOB 1Q9WA 1G4RA 2NY5C 4BFGA 3DX6B 4FDWA 4JKPL 3VXME 3OAWA 3PWJA 3ECBB 3WIIH 4CSTA 3TA3A 4IBTA 1CG9B 4EQ3A 4WI4A 4FXGC 5KJRH 3VXTA 4KJPD 5JPNA 5D7EA 3Q48A 4FL4B 3HG1E 5GSRB 2X4PA 5A6IA 1RUQL 3QQXA 5DUBA 3P9WB 3FTUA 2QGDA 3PDGA 5JIMA 1KB9K 5A2AA 5EU7C 3N42B 5L8JB 1H9DA 2M83A 3KYAA 4MCZB 5DC9B 3S48A 1F3JA 2Z1PA 3L95B 3FMGH 3U9UA 1U3ZA 3AS0A 4UV7L 4TPRH 1HXKA 1CE1L 2J20A 5JHDB 3JT2A 3X3FH 5I0ZA 1NGPL 1X5YA 1GGYA 1H8LA 2VLKE 2ZX8A 4BFIA 4QGTA 1MCDA 3MJGX 5I9QB 2A6JA 2ZJSH 3D18A 4IJ3B 2DLFL 4UV4L 1KDJA 1WAAF 5GRUH 4XNQB 4L1TA 4ZPVA 4Z0XA 4PJDB 4Y2DC 2BP5M 5KS9F 3TBYB 2BOLA 3NJJA 2H3XC 4NPKA 3C08H 1TLKA 2D3JA 3BKML 2R39A 3LPGA 3SCMD 3KXFA 1M42A 1F4WL 5DJ8B 1LWRA 2JB5H 3U0WH 3NIDB 1FLRL 4MRCA 3CQFA 3HFMH 1SXBA 1MCEA 4Q4EA 5F3HB 1L9RA 1HN1A 3AQXA 1MRCL 4R0LC 5DD5L 5F21B 1G7MB 1MF2L 1R34A 1A1NA 3S96A 3VD4A 4ZI8A 4OZHA 2BIIA 4Z7UF 5HJ3B 4KVNL 3OKOB 4JHBA 2C1PA 1IJNA 2PCPA 5D1XE 1T83A 1IKFH 1CD9B 5DD6A 2BY0A 3HC3L 3OKDA 1UEYA 4QHUA 5J12C 5L7XH 1DLFH 4WI9A 4M1CD 3BGFC 2CKBA 3KS0J 5HVHC 2PWFA 4U4BA 5I15H 4IU2A 5FCSH 4W9HC 3PNWB 5F2FA 3SPHA 1FVDA 3UPRB 2R69L 2VRKA 3N9GL 1JGUL 5DYFA 3W9EB 1K9TA 5C0GA 5JLZA 2E7LC 5CEYB 1TEYA 3LPOA 2VQ1A 4KX8A 1NAMH 2VZ3A 3VE0B 2O61A 2DQFB 2A4EA 1DDTA 3OAUL 2MNWA 4ZFOB 1J5OH 3RVXD 5DMKB 2O1AA 5KEZA 2F8XC 3QEHA 1CGYA 3AAZA 3WDIA 1T6WA 4M93C 3EH2A 2O6EA 2E8ZA 2R2HA 4QXUH 4FQQA 3EJQA 4QT5B 4XVOA 3OAYH 5MP6L 2APSA 2X6AA 3FB8B 1NLBL 5J57B 1BV8A 1I1FA 2JIXD 1BFOA 1CDIA 2WTPA 5BJTA 2XWTB 3O4LB 2UUDH 2YAEA 1TMCB 1KC5L 1II4E 3ZUCA 1GPOH 2XXFA 4NJ9L 4WIQA 3GJFH 4UDUB 3SPCA 3O9WB 4XNXL 4M1DH 2YAQA 1QG3A 5HHQB 4TS6A 3U1PA 2V2WA 3QFJD 3UAJD 4KXAA 5AYUL 2DJUA 4PREA 5H35B 2XCMC 2ICCA 4Q2ZB 1HHJA 3AITA 4U7KA 3SPGA 4DIXA 2ZP9A 3IPBA 4GKSA 4FOMA 3D9AL 3W39B 3FDWA 4Y19B 2ADJA 5GRUL 1W72B 4APQB 5JPMA 3G04B 4R83A 3MNWB 3T6WA 3D06A 5E0QA 4L4TA 4G8GE 1MHPL 2WVVB 4N0FB 4XMKH 3CC5A 3P30L 4G2AA 4MZ2A 2P5EA 4HHAA 2A4CA 5LAXB 2WO3B 4J1UB 2ZKHH 3ZYZA 3FULA 2BP0A 4AG4L 1F00I 4L8BB 3ARFC 2BOBA 1U8PB 5AZUA 5E8NA 3T0XA 2BZCA 1S9WB 4O4YH 3GI9L 3RWEB 4O02H 4X5XA 1LO4H 3RYMA 3H4HA 4FJYA 2VXSH 3LQAC 5I1HL 1F8TL 3C8DA 5L2KD 5C2BL 1E4XI 2IAMC 1PU0A 2Z7YA 4RISL 1XT5A 2FQEA 4HZ1A 5A7EA 2CHWA 4LB8A 1ZT4B 1XBRA 1XGQA 4Z7OB 2QHRL 5AVVB 2E9BA 3NSFA 1C5DA 2JMRA 2MJWA 1TFHA 4OSUL 1BZEA 1QEWB 3IBEA 1GZPB 4IRSD 3P1VA 4O02L 4AMKH 3F7VB 3PUCA 1T5XB 4IMLB 5DQDH 1MI5D 5K1JA 5BS0D 1HILB 43CAB 1KGCD 5JDJA 1VEOA 1RLWA 2F5BH 3GF8A 5CNHA 4HSCX 3RLSA 1PZSA 4RX4A 3T4AB 1LDSA 4F24A 3B2VL 1JXDA 1YY8B 1RIUL 3BIKB 3FQNA 4G6KL 1KSRA 3IS1X 3BSZH 3UERA 1F58L 4NT6A 1RK0A 4OV5A 4QHNA 3CHQA 5KJ7E 1KWGA 4AW4A 1D9KB 4ELMF 5ITBH 4KROC 1YC7A 3RP1A 4JL2A 2RQEA 4ONHB 4JG0H 4QNPF 2XPGA 4IU3A 1HHHB 1OCZB 4ELKB 5DYOB 1T7VA 4ICWA 3QO0A 3WENA 4PGBA 1BJMA 2JCCE 2Q6WB 2VO5A 3ARBB 4PJCF 2YBRB 5BXFA 2FQGA 1KPVA 2HB0A 3RZWA 4YNYA 2Z9TA 1IAIH 1DQIA 2J8UF 4X0KB 5AVTB 2FECI 2WLZA 3QEUB 5HD8C 3FUNA 1ID2A 3BVVA 4X9BA 4Z95H 3LPWA 4FQXB 3ZE0E 2G4GA 2GTQA 4LESA 4Z3JA 2UX7A 5FCUL 1WQVT 3BI9X 4KI5F 3PQYB 3OLEA 3VG9B 4K71C 4ZW8A 2EDEA 1MHCB 4Y16C 2C4FT 1DZ0A 4V11A 5LAXA 1UC6A 4WWNA 3L9BA 4R97C 3RJDA 4MJIB 4A38A 2FZ3A 3KBPA 1SYSB 1YAIA 2OMVB 4GG8B 3B2MA 2K9FB 1ORSA 2W80C 3EUUA 3RVTC 5KVGH 1KXHA 3PWLB 3DJSA 4H25B 2O6CA 1EA9C 1S5IL 2ZF9A 1HJBC 5TK4A 2BIQA 2P24A 3FL7A 4FFTA 3O8XC 2DQCH 4HC1L 4HUKB 5DC0A 5DHYA 2TSBA 1UOWA 2L3BA 2LTQB 2XHNA 3MV11 4NAJA 2GI0A 4OJAA 4UUJB 5F88B 2PO6C 4JKWA 1B4TA 4XPFH 2B1AL 1GIGH 4HS3B 4I48B 1PW3A 1NCWH 4MJHA 1Z5YD 1TQCC 5IVZB 3FB6B 4JFFB 4Q6IC 2QMKA 5DLLA 4GH7B 5K5YA 1VKXA 3F12B 2IAMA 4MA1B 5HPMB 1JCKA 5I6MA 5D2LA 4WU5B 2GT9B 3T4AA 3HC3H 4GBXA 1E28B 4WGWB 2WNKA 2C9RA 1ZY9A 4I18B 1BXXA 3GUTB 3LH8A 1DSYA 3M6DA 1NOAA 2WLYA 3LKRB 3TT3L 2YPLD 1OE3A 2PW2A 2WANA 3FO9B 3VXUD 1D5MA 3C60A 3QJUB 3WTVA 3QJZA 5ANMA 2IEPA 2OSXA 3D4GA 3KYNA 1TJMA 4ATWA 3MTRA 1JL8A 3AG2B 2VN4A 4J5VA 4HIPA 4QLWA 3ELQA 2IAND 3EYVA 3NOIA 4NKMB 4ORGA 5IVOA 4DN3L 2H0JA 5JYMA 1GSKA 4ES9A 5D2NA 5L4FA 1NGXA 1N3NA 2EIJB 4R4FH 2K8QA 4H20L 5ID0A 2ED8A 4UOW0 5IESH 5K9OB 2VJ8A 2G2RA 5GISH 4ERSH 3IKCA 4JG1H 5C0AE 1LXMA 1NGQH 4FA6A 4L4TB 2C3GA 4N0FA 4HWEL 3HEIB 4ZQTA 3K2IA 3K74B 3CC5B 4TSAH 4ORZC 3ZRCC 2CGZA 2KLRA 2V9QA 2WC7A 4UANA 4F58H 3PHOB 1SMAA 2CGRL 1ZWIA 5KSAB 4ADIA 3QDGB 2ADGB 5TF0A 2HVJB 2SEBB 3O0RL 1C5BL 3GIVA 2HX7A 1KB5H 4FFZL 3RGVA 5C0NC 1MCBA 5E8NB 5E8EB 5IV2B 1IAKB 3A4EA 4OZIF 4L5FH 3WS6C 5JA9A 5D4JA 1X5XA 1AD9B 2JKNA 1MIEL 4TNGA 5FHAH 1TQTA 1SOQA 2VXVH 3BAYA 3VXRA 3L13A 4X5WA 4B3EA 2ESVD 2AEWA 4MYWB 4P2QE 3PREA 1ETB1 2WV3A 3BUQA 5J1SC 1PLBA 3RWHB 3V6ZA 1A9BA 2VKXA 4PJCB 1DE4B 2CXKA 3DPDA 4ZOEA 1AKPA 2I60L 4U1KB 2WXHA 4POZD 1IILE 1RMFL 2R0KL 5AENA 2KBGA 1JZ7A 5E08H 4FQJH 1XCTB 2WIMA 3MLWH 1BFTA 3UTQB 4PEEA 1E9OB 2ZTBA 3ISRA 3QFDA 1CYGA 3HG1B 4JRFA 3FQRB 2HFFB 5JW5A 1DJIA 3MCLL 5D1ZA 3V5KB 4ZMPA 3UCQA 1DQML 2V17L 4A7GF 2VXQL 1XEDA 2BNUA 1BWMA 3WKMH 2WVUA 5SV4A 5EN2A 3THML 4Z7QB 4ZX5A 5E6IA 2FJGA 3P69A 4J6RL 1I8UA 5I23A 4KXBA 1ES0A 4IMKA 4NI3A 3RIFF 3CU1A 4S1QH 5C0JA 2F19L 1HL4A 3QG7H 4IU3B 1T1ZA 3VDCA 3NIGF 4J3OH 5DYOA 4M8QA 1EDYA 1X5ZA 2V9RA 4YN3A 3ATAA 4FQPA 4KKCD 3WUWG 1XXDC 2ETWA 2EYSA 4GW4A 3T4AC 5FO8B 3F7KA 1A7NL 3MXWH 3Q01A 1OAQH 2CBPA 3SKOA 1PSKH 4WHCA 3FUFA 1TYJA 5FM5M 1PNDA 1T80A 1NFDA 1GTFA 2BNQA 5HHXH 1ZT4A 4OD3L 3MYZA 1AHWA 4X6BB 1NMBL 1PCXA 2JI2A 1XHHA 3QHFH 5DZPA 5IUSA 2VKWA 1CTNA 3TBSB 5H8DA 1J11A 2IV9A 4LSRH 1GZPA 2H45A 2FEJA 2BJML 5I2IA 1T5XA 4AQAB 1C16A 2DEXX 3Q5OA 2D4DA 4JO3H 3NFSH 1IBBA 1N2RA 5I1EH 1EGJL 2DQJH 2VMEA 3S3PA 2HRPL 1HS6A 1QWUA 2O5YH 1A8JH 2XV6B 2CCLA 4A39A 4R2GB 3W57A 1WRFA 4XBEL 4GOSA 5FO7B 1RFDH 2KS0A 4QRRE 4AYGA 3KLKA 3NFSL 2NY2C 3UTPE 5DS1A 2NPLX 3MJ8A 1UQSB 3EBIA 4G3YH 4ZSOE 4LHUD 3VWJD 4DTGL 3ESNA 1JJUA 3CAFA 3DETD 3QIBA 3CBRA 2OMTA 4ZXBD 5L8LB 4BFIB 3ZZSA 2WXGA 3OHXC 3BW9B 4H0LC 3A67H 3HBZA 1INEH 4G8AC 1SHXA 4B9FA 3CX5J 3LXAA 2NRDA 4BKLA 5BZDB 2BPBA 3VRIB 5EBMA 1G6RL 1N5AA 2CWRA 2GBTA 3E9UA 4GSDL 2MNJB 4PV9B 2YBRA 1WFUA 4RVBA 3KLDA 4XVSL 2OL3A 3MR9B 2D8KA 3ML9A 1HZHH 3BIAX 5F9JA 1S9YA 4X4XB 4YFLI 2X4OB 4AYID 2GJ6D 4NRXA 1XMEB 5CCJA 1T89C 4LAQH 5H37H 2DYPA 4OIAA 5C0BE 2X3AA 3BN3B 1DUYB 2IQ9L 2VUYA 3G5YA 3FQYA 3HRZB 3UTSD 3UAAA 1K4DA 1XR9A 3ECVA 4HK0B 3RDJA 1Z9NA 2GC7C 3BAEL 4OUUB 4GT7A 2VLRB 1CGUA 5AW4B 3IGAA 3VFPB 2QADD 4J3UA 5E7BA 4DQAA 3A6OA 4M93B 1QLEL 4L4VE 2EACA 3MCLH 3KWVA 5T5FL 1M6OB 1IGIH 1OQOA 5DJ6B 5E9DE 4JO4L 1SQ2N 3MCYA 4GI8A 4XBMA 3P77A 3ME0B 2F53B 1RURH 3EOTL 1BIIA 1EUUA 1UJTA 2VMCA 1NWOA 4MMXB 3TYGH 4XZ4A 2NLJB 1G9MH 3NTCL 3DGDA 4XR8C 4BZ2L 4YZFF 3AXIA 1IL1A 3UXFA 2Z92A 3HHRB 2NYYC 2YN5A 3QT2A 2RBLA 5FFGA 5KSAA 2F54E 2BRRH 3RNKA 2H3NB 1AXIB 2ZAHA 3PJSA 4HIJA 5I1KH 3KJ4B 1H9VA 2TRHA 3SKJH 4BDVA 4N6RA 1BIHA 2YD9A 4FL4C 15C8H 4ZDHA 1O75A 1X7QA 4WV1A 3TC9A 5KOVC 3P3TA 4M02A 5E56A 3CMOH 5AVRB 4YGVA 3STZB 3UAEA 2Y06L 1I9RH 1F4AA 3BVNA 3QUXC 2VSMB 3PXLA 4XCYB 2R4SL 3DGGA 4FULA 4LLWA 5E5MA 3IFNH 3KYNB 2WSPA 4MQTB 2YGVA 5F1OB 4PJ6A 1TEFA 1QFWI 4CSSA 3KW8A 2DKSA 2PWEA 3VRIA 2DQEL 3HG1A 4ACTA 5JHMA 4XPBH 5K59E 1CU4H 5DHEA 3NZHL 4UINH 1NGXB 4XGZA 1UACH 3SYAA 1JRHL 1JZGA 1U58B 4P2RD 3TYGL 4NUGH 2NY0C 4LCWD 2J3SA 2AJUH 4V2BA 4G42A 2R2BA 3X14A 2F74B 3IFOA 4O58L 3OZ9L 4JPWL 4YDLC 5HY9B 1FJ1B 2JH2A 1QO3A 4NJAH 5BS0B 3GMMA 5FA4A 1FDLL 2WTRA 3EJUA 1XWVA 1SQMA 3ASOB 1PBYA 2G3XA 1A7RL 5KYYA 4LSDA 5AZ2H 3TO4A 3WE1A 1U8NA 3MCKA 5FYKE 3UO1H 4KGJA 4CN6A 1X4YA 1PEZA 1YJDC 5E1AB 2Q10A 2DRUA 2H47C 4FZ8L 5IB5A 1SLWA 5T1LD 3VJ6A 3IJSA 1NKGA 4JFHD 5DZOA 1U95B 4X6BA 1E9PA 4CDGC 1CDJA 1UD6A 1MRDL 1BQHA 3MRNA 4GG6A 1MCIA 1D5BB 3ARBD 3QORA 1C5CH 4AQ1A 4MJ5A 3DXAA 5LNDA 2Z35A 1EZLA 2FR4B 5E4IA 1PQZA 3EOYG 3FONB 1QUNB 1X9LA 1RIHH 3D30A 4AJVA 2VDQL 4HJGA 1A3RL 2XKNA 1AFVH 3II1A 3LTVA 5F3BB 3SGEH 2WO4A 3VXUB 2VR8A 2CR6A 4XMVA 3PAYA 2YXVA 4Y2DD 3L3KB 2G9KA 3GSNA 4UIKH 1UT2A 3SJVE 2DYRB 3VYPA 1OLLA 3X3GL 4HV8B 1NFAA 1G7MA 1SXSA 4HC1A 2Q5BA 1BBDH 2EDRA 2FO4B 3M8OL 3O11A 4K5MA 3IDUA 4G8GA 3B56A 4B9JA 3WLBA 4H0GA 3ZR5A 1CDGA 4ODUB 3U79A 2MTPA 5B3JE 3BP6A 4LLDB 3QO0B 4ODVL 4F8PA 5J89A 4B0MM 4MTMA 5EZLB 3K6SB 2CUMA 4JO3L 4RMQA 3ZE0B 3GSVB 1YEGH 5EFIB 3VU2A 2DWEB 3WS6A 3P73B 4MDJA 5EBWA 5C08A 3T5WA 4N5ED 1ZPLA 3H55A 1PYWA 3NSDA 3O2DH 1E6JL 2P3YA 4XO4A 4UMGA 1UZ6E 3GXFA 4YAQA 4JRYB 5T1KB 1FORL 3GSQA 3RVVD 3NPSC 2IBGA 2OX5B 1G7JA 4WUKL 5LBVA 4XMLL 1R3LA 5BOZG 5AVWB 1YMMD 3BWAA 4OQTL 1UYWH 3RVTD 3VWKB 5IUCA 3VI3A 4ZX4A 1J1PH 5GZOC 1TZGH 4RA0C 4FZEH 4FYRA 2XV3A 3U2IA 5DQDL 3HW7A 1TCRB 2C7FA 4KI1A 4GBXD 1MHHA 3U6RA 3I3DA 4BM7A 5I82A 4UOQA 4PB0H 5D1XC 5GIRB 1DR9A 3NSCA 3QDMB 1BX2B 5IB4A 5L4JA 2F58H 5CD3B 1DVZA 4M61B 4A55A 3MLSH 2BNRD 3MI6A 4PP1D 1S7WA 1ZV5A 2N7SA 3ETTA 5D7SL 4NHCH 1KCRH 2QQKL 1BOGA 4HF5H 4EEEA 1EXHA 4FFYA 2H3NA 3PE9A 3EBGA 1WF5A 3ZJAA 4OLXH 5AB2A 3OBAA 1I9EA 2O5ZL 1UA6H 3IDXL 3DI3B 4UT6L 4A2MA 3NQIA 3MLYH 3NABL 4XX5A 3BPNC 2OQJA 4BHUI 1GSMA 3G5ZA 4X4YA 1E6OL 2H2SD 3RA7L 4JJHA 4XNAA 3QWRA 3K91A 4JFEE 1MHPH 5GS2D 5IK3B 4ONHA 4JFXA 2WKOF 4N9GA 3V4PH 4L37A 2NNFA 3BDYH 1GRWA 3KPLA 3QJTB 4M3JA 4TULH 3ABZA 3PHAA 1LE9B 1XR8A 4POUB 3S5LB 4YHZL 2H8PB 3P4NB 4LDOB 7TAAA 2ZPKL 3LKQA 3D0AA 1FAKT 5JXEC 1B0RB 4LOUD 1JPTH 4S1SH 3P77B 3D3VA 4OZFH 3BD5A 3BPLC 4JLRA 1HH6A 2WZ0A 4KQ4H 1YMMA 2GIMA 3K80A 4R4FL 3QCVH 3UABA 3VXPB 4YAQB 4GUPB 2AV7B 3HZVA 1L9OA 1TQWA 4P2QA 3TIEB 1DEDA 3TN0D 3KWWA 4YSAA 3OMIB 4U6XA 2Q86A 4OGAC 4F7TA 1N8ZB 1OK0A 9CGTA 4MA3A 3ZO9A 4TLKA 3I75A 2P5WD 4PFEA 3EYSH 1JGEB 1U92A 4GIPD 4KDTA 2FWOB 4WRLA 3L3OA 4JZJB 4BQ9A 1ND0B 2NXZC 1RL1A 2WP3T 1UD8A 4ZK8A 1DN0B 5K9JH 1P69B 4HKZB 5DHXB 3DX9A 3WD5H 5FO2A 3BHBA 1I9JL 1VEMA 2XPGB 4W93A 5D2NC 4WKXA 1E8WA 4IKJA 1L9TA 3CVHL 1KYAA 4TSBH 3DGGB 4LLWB 3ZL1A 3ZE0F 5J13C 4AQ1B 3E2HB 3N85H 1FN4B 4BE6A 2OJZH 5I15L 1KTJA 1NKRA 1J8HA 2XTJB 4X99A 3TZVB 2PXYB 1DBML 1SJEB 4XHJC 4V1DB 4Y9EA 2OAAA 3NJIA 5LGJB 1RMFH 1T21A 3I6KB 2R29L 5F0MB 3NACH 3WIHH 1WZAA 4YK4B 2XV0A 1ZVSA 4WNQA 1HE8A 4KVNH 4W70A 1O7SA 2RJMA 4C56B 4QJ4B 3IMWA 4AYSA 1DCEA 4RRPA 2MTAA 5ICYB 2FJGB 4WCYL 5IQNA 3KHQA 2VXVL 5DD5H 2W9DH 3ILPB 5D7LE 5BW7A 1QYGH 4XNYH 4UI2A 3DO3A 5F7UA 4F7CA 4J4PD 3VD9A 3ILQC 4MSWB 2Z7UA 3T8VA 4HH9B 3FRUA 4Z5RA 3K4AA 1CFSB 4WHYG 5AL0A 2NZ9C 3MBEA 1SBSL 4AQ1C 1BOYA 1W2KT 3NJXA 3TJHC 4L4TD 1FAIL 1A5FL 5I1JH 4F91B 4N2NA 3QZMA 4IRSA 4KVPA 4IJTA 5EHFA 1KENH 3O3AB 1AHWB 3CBKB 4G83A 3PGCA 1CGSL 3MRKB 1W8NA 4QY8B 4Z3FA 1CFVH 4HS3A 4I48A 5K39B 4QXGL 2W5PA 3D34A 1BZ8A 3QVAA 2LU7A 4QRRB 1L0QA 5DLMH 2PTUA 1EEZB 1TETL 2ZP8A 2YOCA 4J3BA 3V6BR 4HOWA 2BCKA 2KT6A 1YQ2A 3L5XL 3TNNA 1TQBC 3L4TA 4GRWH 4QXWA 3RGVB 5GGSB 1JGEA 3P9LA 3AY4C 4PRBA 5DUPH 2LAGB 1H3TA 5BUAA 4G6MH 1CL7H 3PV6B 3ESOA 1Q0YH 2ADFL 3IDGB 1C7SA 4HV8A 2Y07L 3EH5B 4WWID 4R4NC 4KAQL 5D2NE 3QPKA 3WFDH 1A21A 5C6PB 4BFJA 3BW9A 4K9EL 2HH0L 3C5JB 4MAYB 5ESQB 2CMRL 1XH3A 4HH8A 4ONGH 2D03L 1N0LA 4N0RA 3JWOL 1C1EH 5I24A 4KKLC 2VDOL 4GW5B 5IJVA 3LRKA 5LBSA 1IAOA 2YD7A 4TSBL 1OANA 1WSST 5FC9A 3PDOA 2WBJD 2YKLH 2RCSL 5DQ9A 2L7EA 3NJVA 1I1RA 1TZAA 5K9JL 4HUXA 1XEUA 2YARA 4PJEE 4QRPB 2WTOA 2WBWB 3KPMA 4PB9L 3TBCA 1KXQE 5J6HA 1QSVA 1KTDA 1L0PA 5LGYA 4XBPB 2ZXCA 1OOAA 3CBJB 1KIUB 3AQYA 1F8TH 2OPCA 5IK3A 3R8BB 1J1PL 2RQ8A 4K7PX 5C0IA 2XZCH 4RBPH 1XB6A 3M88A 4X2UA 5ICZB 4M8QB 1UT1A 1MDTA 4O4YL 5LCVH 2OMUA 3SYPA 1XD0A 4JHVA 3FU5A 3VGAC 4Z7UE 2W59A 2F53D 2W65B 2QFRA 1YUHA 1MAML 4ZTOL 1OXYA 2GJJA 5CSZA 2Y1YA 4Y4FC 2D7PA 1A65A 2Z8VC 2V5RA 5EO0A 4KJQC 1WFOA 2VLMD 2WBJB 5T5FA 3VD0A 3MUUA 1RZIA 1C5DB 3CFCL 4J3TA 3D0LA 4IGBA 5LQBL 1RU9H 5I1GH 1P2CA 3IGUA 1NCUA 1EEUA 4MB4A 2PYEE 4YDMA 3UTQA 2NW3A 3MV7B 5JMOC 5JQ6L 2O61B 4URKA 2UZPA 3QDAA 4ABQA 4TF4A 1OOWA 3C5SA 1I3UA 1LL1A 2EDFA 4YQXL 3N1FC 2E7LA 1BBJA 2ZG2A 3OXRB 4OLEA 2EDMA 3B4NA 4NN7C 3ALWA 2I69A 3IB4A 5E23A 5A2LH 3WFBL 1INDL 4R96B 4YHLH 2G2PA 4PH8A 2MEJB 4KHXL 1W72L 4MA8L 3U7YL 5TPWL 1QRNE 4P2OD 2GTZA 1J05A 1ECZA 4HGKC 1VCAA 2VLME 2BW5A 4JGNA 4DOHB 3QNZB 1MIMH 35C8L 1WIPA 1KY6A 2J71A 1N5AB 5CJXA 2CCWA 2IXQA 3S35H 3LQAL 5C0DA 4PB0L 5PAZA 2QL1A 3NCXA 2IH3A 4EKXA 4M5YL 3MJ6A 1A14L 4FCAA 4HETA 2QSCL 3HZKB 3RGVD 1IQDA 4QJ5B 1E3FA 1CXEA 5SX5K 1FIEA 3PWUA 5IY5B 3BUYB 4YDJB 3QS3A 4BH8A 1A0QH 5I2IB 1ZHLB 3BVUA 2ZQKA 3O8XB 3Q8AA 4DOHE 1OVZA 2V7HB 3DJ9A 2QLVB 3FSWA 3WLWD 3WNOA 5E99L 4B9ZA 2AJYL 4H40A 3EDKA 4Y4HB 2BIOA 3O9WC 4TTDC 4NHUB 3GHBL 4FQQB 3Q0HA 5JW4N 2RIKA 4N90D 4OCYH 5JDSB 4BK5C 5IOPA 4DUWA 1ID5I 2K45A 3P30H 3VFVB 3NJNA 1YYLH 2EH8L 2PP7A 3QH3A 4ZSOB 4NZUH 4XP6L 4BWUA 4E9VA 1BP3B 3SDYL 4JKMA 2X7LA 1T20B 2QEJA 2VR3A 4O2CB 1XD1A 4U49A 3KJ6H 5AWNH 4C58B 5FO9B 2NY4C 1IQWL 3GBNH 1F11B 4GG6B 2Z8SA 2ZNXA 1HAWA 3ML8A 1ITBB 4G8IB 1J8HB 3B5GA 4LMQE 2O72A 1NUDA 4AV0A 5IEKB 1IZJA 4PGEB 1PG7X 4CNIA 1R1CA 2JF1A 1G1KA 3MR9A 5LXGH 1F90H 4CADA 5E4EB 1MNUH 1C9SA 3GSWB 5BW7C 5SV3A 5I0DA 1N18A 3QUZD 3VD2A 4QXTA 3T77B 4CL7A 4EI0A 5E9DD 2MPAL 2NY0B 4X8GA 4APQC 1DQDH 3WUZA 5J11C 3RTLA 4JFZL 1ZA6A 4I2XA 3OKMA 4PM1A 1BA9A 2CUHA 3NCFB 4YWGL 2Y72A 4KI5D 4EZLA 2X0UA 2Y1ZA 4DK3A 4HOXA 3NRQA 3P0GB 3CX5K 2R27A 1CFSA 4PJFF 2WWKT 2A9NL 4FQLH 4DHLA 3F83A 2YEZB 5E9AA 3W11C 4NQCA 3WS3A 3ALXA 3QYCA 2Y69B 1UD5A 4NKMA 3WFCH 3FUKA 2GJZB 3GSXB 5T1DL 1FYHB 4BKTC 3CLWA 5FECA 4N2BA 1OF0A 2KPWA 3DV6B 3LKNB 2AF2A 2XZAL 3PIQA 4JR9L 2R2BB 3HI5L 2WXFA 3V4VB 4FZ8H 4H4NA 2W60A 2OJZL 4PLNC 5HYQB 4KHTL 4QR7A 1WIOA 5E95B 3ARDD 4JFPA 2HP4A 32C2A 3HZMB 3S35X 3SDDD 5GJSH 5IVXE 2ZAGA 3KJ4C 3ZX1A 1IBHA 1PDKB 5C07B 4PMFA 2B3RA 3G6JE 1M2VA 5FX3A 2ITDA 4BDVB 5F1NA 1NL0H 2N7BA 4HLZH 4N8VG 4XO5A 5FWQA 4FLHA 4MCZA 1RUKH 3FCGA 1XTLA 3MLVH 4XC1L 5IOPB 4OCNC 1MHEA 2EYTA 3HHMA 3P0VL 4UCFA 3UTZA 4CU7A 4PIBA 2V8MA 3V0HA 5J06A 2FTAA 1TZOA 4ELKA 4HIHB 2E6JA 3DX0A 2YPVH 3S3CB 4HFWB 4HIXL 3NJMA 4IRJC 5GGQL 3QDGE 5CINL 4PRNA 3HBGA 4FYTA 4JKKA 4R3SA 4K3GA 1A4KB 1M56B 4I3RL 4U1GC 3DOHA 3P3SA 1FQ9C 1A6UH 1I1YA 5I1LB 2PF6A 4HSAC 4WU5A 5C0AB 3QEUA 4HUXB 3CXHK 1JFQH 3QFGA 4HEPA 5ESAB 3U48A 4I0PB 2R2HB 2F74A 4OW6A 2GCYA 3FFCD 2ERJB 1AS7A 4OM1H 2OCJA 4QF1B 4MS8C 2ENQA 4UV7H 2EDQA 2FIKA 4F37K 4YC2B 1PGRB 5I1CL 3QZBA 5HHVH 1ZA3A 2NTFB 3QK0A 3VXSB 3UZEA 5ADOL 4OKVA 3SYCA 3TFKD 1OB0A 5LHDA 4POYA 5F1KC 4FTVA 3NCWA 1A3LH 1KLGA 1KZYA 1U8LB 2O93L 1LE9A 1YEDA 5JHBA 1ESOA 4NNYA 4RMSA 2XIDA 3VXRE 1X9RA 5C0DB 3GSVA 4N8CL 1OSPL 3ARGB 4YR6B 4XBGB 3BDBA 4LRNL 4K0OA 5IFAH 1IRAY 1NMBH 5F88A 3UYRL 2AQTA 3BWSA 1O7DE 1PSKL 2CK0H 3N50A 1R3IL 2P1YA 1FE8H 4JQIH 4KQ0A 4PVNA 4QDGA 1XGUA 1M7IB 3O6LL 4GXFA 4QIRA 4EO5A 1P4IL 3U4EA 1P1VA 3ZRFC 2J8HA 1G7PB 5HHMD 3S36L 4ZMXA 3F65A 4NO3A 2EUZA 3TO4D 5TE6H 1LNUA 5D7JB 5EC2A 4HCRH 5F1SA 1OAKH 4PG2A 4W1TA 3FTWA 3RWFA 1I7ZA 3HKFA 3B7RL 4KDWA 4OB5H 2DWYA 1CXIA 4FXTA 2EEXA 4G1MB 3HJEA 3LX9A 2X10A 3F7PC 3QAQA 1P4IH 4ANUA 3WLBB 1AC6A 5DRWB 1SPDA 1XGQB 4LLUB 1OCRB 5IQ7H 3LNIA 1FZJB 1AQDA 2X28A 3VACA 2YPKB 3BJ91 3NA9H 3HG1D 3TN0C 2JJTC 3WHE1 2NXYD 4X42A 1S7UA 3CUPB 5CU9A 2YQBA 3AT0A 5F9WB 1YMME 3BEWB 1D9KD 3HZYA 2A6DB 4NO0B 2VC2B 4N2GA 1MJJB 1UVQA 4ALAH 1XL4A 4YHKH 4F9PC 2BERA 1TKWA 4JJ5B 4NKIH 3KZ8A 3NJFA 2BNUB 3EO9H 3MLZH 3FUMA 4QXTB 6CGTA 4G3YL 4GP4B 1ZVSB 1ZGLB 3GYRA 3MRPB 1YEKL 1EAQA 3N41B 2AEPL 2B59A 4NGHL 1HIMH 3IWVA 5DGQA 4HS8H 3HLKA 1MCNA 4F8OA 3GSQB 3A3YB 1JDAA 4LL1A 2O5YL 2WXPA 1BF5A 4OJFL 4DK6A 1BQKA 2B2XL 4QEGA 3KPQA 3OKOA 4YSQA 3HI1B 3ZW3A 3VFPA 2BVQB 3KYMB 5HYFA 3JYBA 1X5IA 5KN5B 5FO8A 4PJDE 4X98A 1Z9LA 3K8KA 3VFVA 1T04B 1ZVHA 1PY9A 3H54A 4S0SD 3RL2B 1KBVA 3EDEA 4PY8I 3WIFA 2EC9U 3AFLA 4PRHD 3LYRA 4N2OA 5CAYB 4W6WB 3EDJA 1Q8MA 5B38G 2C7UB 5EU3A 2UXVA 3OKNA 4LFHG 4Y5VA 3LN4B 5JXAL 4CKQA 1ETA1 5EU5A 1IC4H 2FD6L 4G43B 5ETUA 4RSVA 2O6DA 5C8JA 2LGNA 3D0VA 1KCWA 4ZMTA 1QTPA 3HS8A 5EU7E 4FABL 3O4OB 1QFWH 2Q7YA 4Y2LA 5D1XD 3WDHA 1M2VB 5IVXB 3VD7A 1FFRA 4DKTA 2WCPA 4RESB 4RETB 1HJCA 4A6YH 5EZOL 1KN4L 1SY6A 3UTSA 4ZDHB 3KGSA 4M6ML 3B3IA 3CN0A 1UQSA 3BC9A 3UZVA 1RK0B 4OV5B 4UYQA 3RURA 4XVUD 1IC0A 1H3UA 1P7QD 3V0IA 2UVFA 2WYTA 4UU9A 5DZ9A 4QAWA 1MJ8L 3UBFA 3MRBA 4AUUA 2VLLB 2WJ5A 5IB1B 4E36A 3QI9A 6TAAA 3QNYB 1K2DB 3LQZB 1ZK9A 4JY5H 1ZSHA 1J8RA 1MH5A 4JR9H 4K5LA 3UL4A 4B5EA 4NZ8A 4GLRH 3QUMA 5F7AA 1RZKL 2WUCL 5I28A 1RK7A 4J23A 3WJJA 4UTBH 3WMPA 2JIXB 2VJ0A 1LK2B 3CZKA 5IM7B 1J9QA 1NDMB 1G7LA 3D39A 1T1WB 1X5KA 5TQ2H 2MCAA 5D2LB 3CK0H 1ZHNB 2APXA 4K94H 4GSQA 4UQ3B 5EIVA 1NMCB 1DO5A 4YXKH 5FUZH 3EOBA 3WFCL 4H8VA 1MJUH 4JGJA 5C6TH 1C16B 2CRZA 4MXVE 3RKDC 2VT0A 4DGYH 3B3BA 1M7DA 2VH5H 4D0CB 5I8CA 4Z8FL 1U8PA 3SQOL 4LBEA 1EZUA 2AI0H 4O5LH 4OUOA 1J8HE 1IM9D 1T7XA 1J8KA 3C8HA 3FOMA 3SJVB 3ZDWA 3HBPA 3EO9L 2Q87A 4H25A 2WBJC 1Z3GL 1NEZB 2BFVH 3E0GA 3LEXB 3WHXB 1E2ZA 4FQXD 4IOIA 2XI9A 3HS0A 3MODL 4PUBL 4WO0A 5D93B 1MLCB 5FLUA 4HDIB 3TLRA 2PXYC 2R7EB 1YNKL 4NI6A 5E9DB 5JQHC 3WYRA 2VAAA 4PRPE 1IBDA 1WBYA 2E9WA 3CDGA 1H5BA 3U30B 1RURL 3EOTH 3JV6B 1AGCB 5FUOH 4OQTA 5HTSA 3ULSB 1PAMA 5DUBB 4DKEL 4JS7A 1NINA 3B34A 2DH2A 4XMUA 4BZ1L 4N6RB 1CFTB 2E0PA 4IOFD 2D2CC 4OCYL 4LHQB 4MBOA 4E42A 1W8EA 5EEZA 4I0PA 5DVNA 2DIEA 3OXSA 2OMWA 2CDFB 4N8UA 2NXZB 3B1TA 4D8PA 2AJYH 1URLA 4UF7C 5IMOB 4ODBD 2BMKA 3VXRB 3IDMA 7PAZA 3HLAB 4E9QA 1OGPA 2R1XB 5KSBA 3SKNA 3WEXA 1CQKA 1N7MH 3VFSB 4ELMA 2CHDA 5DS2A 1DBKH 2CK0L 2XPZA 1MCLA 2ZWLT 3A4AA 3NJKA 5EBLB 4B9YA 1R5IA 3N1MC 1F5WA 5BS0E 2FWLB 3I9PA 2YD4A 3UBXB 2NMSA 2OJEB 2GG1A 4MAYC 1GYCA 2ATKA 5D1QD 1JTTA 2E7DA 2DI8A 1IBYA 4IIQC 5DURD 4ZUTA 4N2FA 4FERA 5FA3A 5FGCE 1BVZA 1U41A 3MNZA 4HQQH 2VGLM 1QSZA 1Y07A 3TN0A 1OM3L 3WV0A 5EULV 5KVGL 3QXDA 2HWZH 4KFZC 5J6HB 4B27A 4F9PA 3KS0H 3ARDB 1MREL 4AIEA 2Q1EA 3OB8A 5H2BA 2F5AL 1MJ7L 5KG9A 1I1AD 3P4MB 1WC7A 1HL9A 3TTYA 3W11D 2WB7A 4AG4H 3REVA 2Z6FA 4JCMA 1L9PA 3JTTB 4KZEH 4YHIB 5HYQA 1WBZB 2FX7H 3LDBB 3QB7C 1O5DT 2BSRB 1LEKA 3FOMB 3GINA 4R8WL 3SJVA 2IOOA 5HYJD 4KUCD 3F7YB 4JO1H 3W5NA 3MREA 2WWNA 5CMAA 4AL8L 2HRPH 4JUSA 4U1GB 2HMID 4JZJC 1MHHB 3A6CL 5DEGB 3IE9A 4NQXA 2EECA 5INCA 1OW0C 3QEGL 1HEZA 3RUGF 3GPSA 3BLKA 1HKLL 4AVJA 1L7TL 4JZOB 2VQ1B 5C09E 1VENA 4JBSA 3ARFB 4QCIB 1BOGB 3KMDA 3MBWB 4GFTB 4G9DA 5SWZA 1TXKA 1ZSDB 4XXDB 3GTVA 1UH4A 2F53E 2XYCA 4ODSH 4RDBA 3VXMB 2ZOOA 2XVLA 1E2VA 3E38A 4OBRA 5DHVB 2EEDA 2G5BB 3RB5A 1GHFH 1CGTA 1SJHA 3ZE1B 3TURA 4L8CA 4FYSA 2NR6D 4CVWA 1NIDA 3ZMNA 4A37A 1E5ZA 2QGEA 4Y4KB 5KYYB 3BGMB 5IB1A 3NPSB 4I5BB 5IB3B 4W9LC 4KJYB 1TZHB 4RMBA 4LLQA 4Q8BA 4AMKL 3AXLA 1OHZA 2DF3A 3L16A 4MNQA 5TQ0H 3TBVA 2BWQA 5JW4R 4N2CA 1D5ZA 4M4PA 1WFTA 3HS9A 2HKHH 1WEJH 2YBGA 2WXMA 4TUJB 2CM6A 1LVEA 1OM3H 5D2NB 4HQQL 5FKPB 2HJFA 3D87B 4ZMYA 3KYOB 2NXYC 5AB1A 1C1EL 3SDAB 1TZIB 3INUH 5FM5O 4FA8A 3PWJB 3VYNA 3DMMA 3QR1A 3KPRD 3MX0B 4TTGA 3UADA 2GSIB 4ABVA 3GI9H 4Q9BA 5F6HJ 5AW0B 1EFXB 3MACH 3ORJA 1HCZA 2QADB 1WUZA 1L5GA 2OR7A 1RUMH 4JHAH 1JUFB 3TV3H 2FH6A 5IV2A 4E9LA 3X13A 5BZXA 3NEOA 1BLNA 5FYJD 4MWFB 3ZL2A 3ARRA 1MRCH 2ATPA 5DD3L 5MEND 1NGZA 5HGHB 4NM4H 4H0IA 3DJTA 4L3AA 1JNNL 4UT7L 1KB5A 5F7MC 4Z7UA 3MRBB 1VA9A 2BW4A 2W95A 3CPLB 5BJTB 1CL7L 3LNFA 3E1F1 3ROOB 4LE8A 2AQPA 3FTXA 4LLMB 1N64L 3Q5YA 1JVLA 4K73A 5EOQH 2GBUA 4LPWA 2ENYA 4EIUA 2H1PL 3MPCA 1FZMA 3RFRA 2NY4B 3DA0A 1HTYA 5KVFL 4L4VD 4QAMB 2FVNA 3NZ8B 1A5FH 1R3HB 5I1JL 1F18A 4DO6A 2DQUH 2ZG3A 4PY7A 4YIQB 4ZRGA 1O7VA 4AYMC 4CVZA 3BSGA 4BSVB 5AG9A 1G9NH 3H3PL 4D0BB 5LCVA 4JHAL 1GC1L 4AV4A 2UUDK 4HXBH 5H37A 3T1WA 3I6GA 1DVQA 1M1XA 2FT8A 3G6JA 3RIFK 3OGCA 5KSVA 2HTLD 4TPRL 5AW8B 4QOKA 2V7HA 1OZUA 4PJ8A 3VGEA 3DVNB 3ILPA 1CI3M 1MVUA 4TRPH 1A1MA 1UM6H 4Y4KA 3U6XA 3U83A 5I8CB 3N42F 3VFSA 1O0VA 2IGLA 1TNMA 3AWEA 4HK3J 2ADIA 2XIIA 2UY7B 3C5XA 1XIWB 4OF8A 4S2SA 4DP0X 1IFGA 3GS4A 2W92A 4B60A 2PCFB 3KPRA 2R29H 3WN5B 2QSCH 5F6IC 4P9HH 5H94A 4KKBD 2J88L 1KPVB 4HD9A 4E9YA 5FECB 3TL5A 3K1DA 2X4NB 2GC4C 4WEBL 5FKPA 1FO0A 2VLKA 4OLZL 1F97A 4QNPE 1G5GA 1ZANL 2HRGA 5C09B 3FH5A 1QSFD 3WNKA 1XSKA 1VACB 3STLA 5TPWH 2Y6SC 3G08A 1WWWX 1LK3H 4XP5L 3Q8CA 4Q0XL 1FYTE 4Y16A 4JFQB 4P9HL 3FCSA 3SSGA 3IT8D 1WISA 5EUOB 3SYQA 2QQLH 1ND0A 5D1QB 4FXGB 5J9PB 5EZJA 5ITFB 2YAFA 1I53A 5FWRA 1Z9OA 3MLUL 3BE1L 4JRXB 4P2RE 4M6MH 4QOKD 5G5DA 4LK4A 5AZEH 4U1LA 2IPUK 4FEIA 4KO6A 1BD2D 1CXKA 4PS4L 3VJ6B 2CSPA 3D85B 1P0SE 25C8H 4Z7UB 4JL1A 5LO7A 2C26A 2JQMA 1LJMA 2NUTA 4GUOA 5DJAA 5EB9A 4F7KA 5F1IA 1OT1A 2DLGA 3HC4H 1ZE3C 1QSFE 4P4RA 1XXFC 4P2OB 5K59F 1SEBA 2BNQE 3VQ1C 1QAWA 5MEPA 1G1YA 5C0BA 2RH0A 5I71C 1ZRUA 4ECNA 3W38A 1A9EB 1IAIL 2BSSB 3FO2A 4JQXA 4HLEA 5IW3A 5F9JB 2Y5QA 2LLLA 2PXYD 1NGPH 2V3FA 4YNYB 5IMKA 1JZ5A 5KBDA 1G7IB 4LPTA 2OYMA 5KBMA 5J3HC 3ZYJA 2QFPA 3EH4B 1E5YA 3ARDA 1MJ7H 1SJXA 2BIPA 1ZV2A 1AD0A 2E8YA 1KJ3H 1E3ZA 2EKSA 1T6BX 3Q9PA 2KDYA 1ZAGA 3CLFL 4RA3A 3KPQB 1CD1A 3KCWA 2GUYA 4Y7OC 4PB9H 2X5PA 4BH7B 1T0MA 1JSYA 1EVUA 1N8OE 3PP3H 4YFEA 4LIQH 3OMZA 1FCCA 4WDIB 2VLJA 5FGBC 5B3JF 4BQ6A 2EDKA 3H9HA 2WSDA 4RMRA 4U0RC 1OO2A 3NN8B 1H8NA 4NC1C 1GGBL 2G5UA 4YZWA 2MCMA 4PWHA 3H4FA 3FTVA 4G7VH 4MAZA 4GI9A 3V79C 2FT6A 2IH1B 4NRZB 1BVOA 3QFJE 4RWYH 3ZDYB 1SF3A 4DGWC 2DKMA 1BQLH 3B7UX 3CHXA 1CDBA 2W88A 2YGOA 4K9EH 4PRID 1NSNH 4PJ9B 3F05A 1PG7H 1N67A 1OD7A 4MNQD 3R7RA 4OFPA 4JO2L 1YYCA 2E59A 4J8QA 5GS0C 2ZXDA 5F3BA 1X5FA 1OARL 5C0FB 1R5VB 3CLFH 4MCNA 1IAII 3RWCB 3EF7A 2NY6D 2AXHA 1M6UA 4G8GD 4KBPA 2HVBA 1TENA 3TZVC 2XTJC 1FFTB 3N1PC 5A3ID 4MJIE 2O6PA 4GAFB 4UAOB 1PAZA 1D2OA 1LTXA 1U8HA 1VFBA 4MZRA 1KJVA 3NFNA 3QXTA 2ZCKL 1E5AA 4YFLF 1BJ1H 2Y2WA 3ULUC 3PQYE 3J8F7 4F92B 1GZQA 4MGXA 1T7WA 3K5RA 1HNFA 4I87A 1MCCA 1TTRA 4HWNA 3U4KA 5SWSA 4YPGA 5DT1L 4C56E 4MVBD 3RDTC 2MH4A 3VFUB 5DJ0A 2P80D 1T0PB 1DVFB 3L6FB 2V9UA 3WNLA 2ZOKB 2ZWNA 4F80A 1QO3B 5KBNC 3V4VL 4PJAF 3GXDA 1BD2B 4HJ0D 2DZEA 1OWWA 4BUQA 1XQ4A 2LFGA 1T5KA 4OLYL 2BO0A 3DETC 4P5TB 2DW5A 2P47B 4K94L 1ZLUH 1XV8A 3QQNA 2ATPB 1S3KH 5I73B 5A6MA 4Z6AT 2FUQA 1VADA 4MJJA 1GOFA 3GMPA 4B53A 5B1JA 4LLVA 3L5IA 1DDHA 5HYSB 2VQTA 3GBEA 4PI2A 1JFQL 3OC8A 3QIWC 1Q72H 2ZUYA 2ZXGA 3D39D 1A4CA 3RVXC 4F3FB 3QHZL 4NRZA 2BP8B 4FQIH 3W5MA 5L8KB 4ANWA 5JZ7C 1MOEA 1FNGB 2IWFA 2VDQH 3QDJD 4IBWA 4A7GA 3TVMC 3FQ1A 3DX8B 4DN4L 1ED3B 1C5CL 2QQQA 2DBLH 4RMVA 1OGAB 1BMZA 4Y2NA 3FN0H 4PGCA 4E41D 1DLFL 5I74B 4PJBE 4PJ5D 3OGCB 4FI6A 1J10A 2GK0B 2UXGA 1NLDL 3PF2A 2I25N 4ZZKA 5B21A 1Y0LA 5DWUL 1D2PA 4PRHE 4XTRD 2HPOA 4NZFA 3VW3L 5BQ7A 5E94B 3RB7A 3P11H 2PO6A 1J05B 1YNTF 3GRWL 3PL6C 4L37B 4YSOA 1XB3A 3L4UA 3PLYA 3RBGA 5B7MA 1P5VA 1JP5A 3C6LD 4E9XA 3I6LD 5D93C 2LABA 2E47A 3O2DA 1J1XL 4GRLB 2WGXA 3ZDZB 4CDHA 2VLJE 4Y2OA 5D5MB 4XOAA 3NZHH 2H1PH 4UINL 4NRYA 3RTQA 4Q9RL 1KBBA 2F61A 5EOQL 2EEAA 5IEHB 1DJZA 1H0DA 4ZMZA 1ASPA 5MHSD 5FOBA 1OP5K 2AJUL 4OCRL 2HT3C 1CXLA 4DJMA 3BSZA 4KU1A 3U4AA 3BUYA 3ZXAC 2WD0A 3TA3B 2Z31C 3S97C 2X3CA 2NY3B 3S88H 1GYAA 1V10A 3HUJA 3LPFA 5CGYD 1ET7A 2APWA 4GAJL 5JW4Q 5GGVH 2AEQL 1M05A 3T2NL 1KBGH 4ZFOL 2DMKA 4FNRA 5JIPA 3IFNL 1E7UA 2X89D 3EKCA 4N4YB 3LAFA 1CE1H 2KZBA 3L3OB 4HK3N 2QVTA 3GQFA 2OS7A 2DD8H 1P53A 4OGZA 2VLJD 1ZLWK 3S6CA 1FUNA 1N12A 1QFWM 1AJ7H 3DDGA 4PJGF 2BVOA 3FRPG 2H3KA 3E8UL 2F53A 3DECA 2MRYA 4DPAX 1CBVH 3QGVA 1BX2A 2OXGB 4RAHA 5IB4B 1BGXH 3SGEI 2DEYX 4H1LB 5B38A 2NY1D 1PX3A 4G7QB 3QDMD 1EHXA 4WWKA 2NY4D 2JFCA 3O41B 1JMZA 3FNKA 1MCPL 4YBHA 2Z3FA 2X1QA 4G6FD 2XJLA 1AI1L 1O7DC 2VN7A 1IQWH 2XFXB 1WZLA 4JQVC 1JTOA 1RPQA 1CFTA 5CP7B 3ZE2F 4N6QA 4OZHE 3RE0A 4CILA 4JVPA 3S36H 3LPPA 1X5MA 5C71A 4NEHB 5HVFB 1LE5B 5JUEH 1NDTA 2DH3A 4GY4A 3V52H 3O6LH 2D7QA 3RPBA 1IGIL 4WY7H 3OV6A 5CZKA 3VE0A 1M71B 3S3JA 4Y9GA 2BWDA 3DJRA 2HLAA 4ODSL 2XY2A 3MRFB 4F7CB 1IU1A 4PBXA 1WHOA 4AIXA 1FCGA 3RQ3A 5E5MB 3UYRH 1XR8B 3S5LA 4PJHE 4WK2B 4NLHA 3WDJA 2HKFH 4AY0A 3EOAA 2YD5A 7CGTA 5T3ZD 3FF8A 2XQYG 4WVRA 4XAKE 4F7MB 2AV1A 2G30A 4F57H 3BP7A 4JHUA 1KLFB 2CE6A 2ZWKA 4GSDH 2EE2A 5IG7B 2OULB 1WO2A 3EYOB 1UXSB 4CW1A 3BAJA 1BEYL 2YC1A 3VA2C 3A67L 1W15A 2ZG1A 5KJ4A 4JM2B 2ITCA 5HHVL 1JV5B 2VM4A 32C2B 4X5QA 2DN7A 4BA0A 4Q6IB 5TE4H 3ZDXB 2FJSA 35C8H 5CILL 5DC2A 5CCGE 3IJEA 4W4OA 4Q97A 4L0PB 1LO5B 2XOTA 3CFBA 3UZQA 5T3ZL 1KN2L 3HPLB 4W6YB 5DO8A 4DO5A 1ROWA 5EIIA 1NUGA 3VI4A 2R0WH 1A4BA 5EEWA 2QLYA 2Q8AH 5T3ZH 4YHLL 4XNMB 1MFNA 1LGVA 5DA4A 2OK0H 3OKMB 1I8MB 3KLSA 3RZCA 4LPUA 2IMNA 3PYCA 1DFXA 5EU6D 1SFHA 4LP5A 3CFEB 4H5SB 4Y4KD 3WL9B 2FEDD 1GZHC 3HG0A 4OCSH 3I9IA 3KE0A 2VERN 3CFTA 3Q7JA 2Q8BH 3V7MA 4X4MA 4HJIA 2PABA 5GXBB 2FX8H 1NOLA 4OF5A 4GRWE 3AS1A 4GW5A 1Q0EA 4PJHF 4X80H 1HNGA 5LGHL 2W8CA 3R4RA 3I6KA 4JG5A 4LCCB 1A4JB 3D2UB 4F7PA 1ED3A 4PN6A 4QHKI 2IAMB 4XGZB 4IRJA 2P5EE 3JV4A 4YO0B 1IGFL 2FLBT 4ALAC 4HPHA 2WVVA 4HIEB 4L0ZA 3S3DB 1IB5A 4LEXH 4UMSA 2D0FA 5ACMA 3AGVA 4NDMA 4Z78B 1ZHBB 4LP8A 3QORC 2EDOA 5CHNA 1YPZA 2K0RA 3O3DA 2Y7MA 4WWPA 5EA0H 5AYQA 4PGDB 2GTZB 2QSVA 1S9WA 3QW9A 2J6EH 2V8LA 4LLDA 4KJWD 1VADB 1OARH 1HE7A 5IBLC 3O2VL 1YNKH 1CF1A 4AJ0A 2MKLC 4PJFE 5E1GA 2ZAIA 4Y4HD 2P5ED 1FL5B 1YECL 3QWQB 5JW3L 5EU3B 4F93B 5K9OA 2JKTM 3V4UL 2PPAA 2GFBA 4CC4A 4KRPD 1GVIA 4HJUA 3V7AG 3WUWB 1IL1B 2QZQA 5CBEB 1PIFA 2HTKD 5GHWL 1F41A 3O8XA 1XF5A 2BCKB 2WJ7A 2H2SC 2WLIB 2J2ZA 4FTVD 2VDML 2HH0H 3PXJA 2DQ6A 5G55A 2ADGA 3T2NH 2QPDB 4ZOBA 3M17A 1SJMA 5ABZA 2FECL 3PS6A 4BYHA 2I60H 4PJAE 1PD1A 2IGFL 1JTPA 1HSBA 4HT1H 4L4TE 5B1CA 5IOKA 3CHPA 4JRXA 1ECYA 3AM8C 2X4UB 1U9KA 1Z5LA 2K1MA 4X5WB 4DCQA 1JZ4A 2GJRA 2HKAA 3FFCA 5KVDE 2KLSA 3I50L 1SY6L 4AOFA 2OJ1A 5JIQA 5DU7A 1JZEA 3LZPA 4N68A 1E9QB 1OTTD 2IF7A 1B2YA 2AXJA 3QDMA 5D55A 1N59A 3MOBL 4NQDB 5HP5A 2XQ0A 1MFBL 4PD4J 4WFHE 4X5RA 4OIBA 5ADPL 4MXWH 2FJUB 4LRIA 2IQAA 3QEQD 1XF4B 3EFFB 4XNBA 5HHPA 5DQ9B 4ANVA 3FW6A 2E27H 3CDZB 3EDDA 1HXMB 2I5YL 3AS3A 5KSVB 5HY9A 3EBHA 2FK9A 4HIXH 4ES8A 3WSQL 2ITEA 2DQHH 4LSQH 3VFMA 2FBJH 1CYXA 2BNRA 4BFEA 2JK5B 2ADIB 1LNUB 4LU5L 1C08A 4MFHA 4NWTH 4B0MB 1QFWL 2YLHA 4XPTL 1ZLSH 1H6FA 4PG9B 3FN0L 5DWPA 3W56A 3AACA 3GPEA 3JWDH 1FVCA 4JHWH 5EV7A 1G9EA 1IC5H 2YO3A 4LCWB 3S35L 2VDRB 4HS6B 4QRAA 1OB1A 4YHYC 5LWYL 2FYYB 3JTSB 2ARJQ 1O9VA 1PG7W 4D94A 2YSSA 1HH6B 3ZMRA 2KZKA 1HC1A 3D0LB 1TDQA 1CG9A 1GR7A 2CHZA 1A9VA 4OCXH 3IJ8A 4WFFE 3RGBA 3VGBA 3LNDA 4J3VA 2R1WB 4K3JH 4YDIL 1U8QA 4J8RA 2NY2D 4YHNA 2VDOB 4JFDE 2Q86B 5DDHA 2GSGA 2VN5A 4XNUL 5TE7L 1INDH 3EG9A 1AGCA 4KKLD 5EUKA 4R4BB 3CU7A 1T2JA 2Y7LA 2V33A 4KMQA 5E4EC 5D1QA 2GJ6B 5J9PA 2PCYA 2E6PA 2AMGA 3LH9A 4X83A 4AGLA 1ILUA 1S9KC 2WKGA 2DMBA 3TJEH 2F8OA 2CJTA 3HKZA 4LSUL 1NFKA 1M71A 4FADA 1OPOA 1RU9L 5I1GL 1H5BC 2BJMH 2ZSWB 1DQDL 1MCWW 4HXBL 1MPAL 4AEFA 3QZWA 1SEBB 4FKEA 4PP1C 5I1DB 3AUVA 4P57B 1GKEA 4OJEH 1VCBC 1CT8A 3IRPX 1FH2A 2OJEA 3LHPL 5BV7H 2P8MB 4PSPA 3JXAA 4JFHE 2R1YB 1T1WA 4M1GL 3A47A 3KLAA 5DFTA 3L17A 3EJTA 2CCVA 4PV8A 4QRSB 1F90L 5EZIH 4Y4HC 5IHWA 1JHKH 3DX6A 1DQKA 2KQMA 3CH1A 3TA3D 3EOBB 4HBCH 1E42A 3HC0B 4A6YB 2DYPB 3WG7B 3ZIYA 3D4CA 2K3TA 4M43L 2IC2A 5JIKA 1AMYA 1ETZB 3QARA 6PAZA 1H3PH 3FUJA 4L48A 3M45A 4NENA 4KTEL 5T8IA 1Q38A 5F1NB 3PGDB 4WW1A 2R2CA 5FDYA 3MBXL 4KJPC 3FRUB 3CSFA 3UTSB 4ZPTA 4Z5RB 3PABB 1S7XA 4JG0L 3IXTB 4PWIA 3MYJB 5DCCA 3UTOA 1FE8L 4R90H 4CRPA 4WO4C 3KLHD 4GEIA 1I8MA 3GI8H 5T1LA 1RY7B 2VDOH 4EDWH 1QLRB 3DRQB 4L3FA 3MU3A 1EDQA 4LVHC 2ED6A 4FQJL 1XB8A 3MGOB 4EN3B 4TMPA 4X6FA 5KW9H 1ORQB 2GBVA 3CC1A 3SEPA 3UP6A 3TBTA 4U6YA 5HI5D 4MJ2A 2F58L 3WTYA 1WEJL 3BQUC 3O81A 4PCKA 5L0QC 4Y0GA 1UUNA 5DMKA 1XSOA 3JV4B 4YO0A 4WU7A 1BAWA 1CE6A 3VFRA 2VDLL 2GITA 2QHRH 3OWEA 4AQEB 4UB0H 3F85A 3KVQA 3MQIA 4L5FL 1CURA 4CKVX 4TSCL 1KB5L 4FFYL 4LHUG 3L3IA 3C8KB 3N55A 3PAVA 5E94A 3CSBA 2O5XH 4LFHD 3O6KL 3CN4A 4ZUWB 5KZCB 4LBEB 4NZDA 3X12B 3HAEA 1GOHA 3GBLA 3BLBA 2EYSB 4PBVC 4ZMAT 1BCIA 3Q05A 1EXGA 1KTKE 5KVDL 5CBAB 4DEUA 4ZBJA 3SZ6A 3PPSA 3ZSSA 5BV7L 5IJVB 5I5MA 1J87A 3H9HB 4BQCA 3CIAA 3F6IA 4OTXL 2ZWZA 1G0DA 1MLCA 3BT2L 2C34A 2HT3D 4HGWA 1OGTA 4K9EC 3U9WA 4NN5B 2ZXQA 3MLXH 5ID1A 1HK6A 4M3KB 3QEGH 5IBTH 3QXAA 3PIQB 4N2MA 2AK1H 4M48L 5CSBA 4UQEA 1MG2C 3GBML 4A68A 1YEGL 3KL0A 4QRPA 3MLUH 1LWJA 3LH2H 1KJ2H 1L4IA 4NUJA 5FOJA 4BE5A 2VZSA 3Q8EA 3MV9A 2FQFA 5EF2A 2PP8A 4WJKB 4X9HA 5IR1A 1B0GB 4PGZA 1RH8A 2C3HA 1WHPA 4NCDA 1P7BA 2EDNA 3ARGD 5F7EL 4Y5XC 3U82B 2MMXA 3CCHA 5D7IF 3HI6L 1RI8A 4LDLB 5IMOA 4M7LH 2EYTB 4UIKL 4P59H 4ZUSA 2CBTA 1KB3A 2XZCL 1N19A 5I16B 4GYBA 2JELH 4N0UA 1Z0MA 3DIVA 3OKNB 1NBZA 4TLTA 3SCMB 3TIDB 3N9GH 4NOBA 3CVHH 3WBDA 3KXFD 1N0LB 1FFQA 4LHUA 1JGVL 4G11A 2YPLB 1VDGA 2OMBA 1FZMB 4IDJL 3VTAA 4U6YB 5B4MD 1NAML 3HZYB 4U33A 2EKJA 4GRLD 2Y36H 1TJHH 3ISYA 3O2WL 1I8LA 1THCA 2YKLL 2WOYA 5F9WC 5IF0B 2Q7YB 1JZ2A 4TRPL 1F13A 3U36B 1WTLA 3FTGA 3MV01 3DTXA 3MJ7A 1FZKA 1OE2A 4PGCB 2X12A 3EYQC 2X87A 2H6PB 4D0BA 4L0YA 5HDLA