2QPFA

Crystal structure of mouse transthyretin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
116
Chain Sequence
SKPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human-Murine Transthyretin Heterotetramers Are Kinetically Stable and Non-amyloidogenic: A LESSON IN THE GENERATION OF TRANSGENIC MODELS OF DISEASES INVOLVING OLIGOMERIC PROTEINS.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Transthyretin
total genus 26
structure length 116
sequence length 117
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2qpfA00
3IMUA 5IHHA 3NESA 3DK0A 1E4HA 4Y9FA 2QPFA 4FI8A 4PWHA 5FO2A 1IE4A 3DJSA 3IWVA 1QABA 1TZ8A 1X7SA 3GLZA 1U21A 5K1JA 4PVNA 4ACTA 1ZD6A 4TL4A 2QGEA 4L1SA 5HJGA 4MASA 1E5AA 3CN0A 3DO4A 2B16A 4TLSA 3KGTA 2B9AA 2G2PA 4PM1A 4QYAA 4PVMA 4I87A 1SN0A 4HJTA 4TNFA 1BMZA 3NG5A 1TYRA 2H0JA 1IJNA 3DJTA 4Q14A 1QWHA 3U2IA 2QGBA 3ESPA 3I9IA 3Q1EA 4IKJA 4TNGA 4HIQA 4WO0A 2PABA 4PWJA 4ANKA 4IIZA 1BZDA 4DERA 2QGCA 1Z7JA 3DIDA 3GS0A 2FBRA 4YDMA 1ICTA 2G5UA 3CXFA 3ESOA 3IPBA 5A6IA 2H4EA 3IWUA 1X7TA 4ABUA 1TTBA 2G9KA 1DVUA 3D7PA 4TM9A 4TQPA 3BSZA 5DEJA 3TCTA 5CLYA 3IMRA 5EZPA 4IKIA 3CN3A 1THCA 4TQHA 4HISA 4Y9BA 4N85A 5EN3A 1TLMA 5CR1A 3I9PA 4PMEA 3A4DA 4QXVA 3BT0A 4N86A 3DGDA 3KGSA 4FI6A 4WNJA 1DVTA 5L4JA 4PWIA 4ABWA 4N87A 2B14A 2WQAA 3OZKA 3D2TA 4HJSA 3SSGA 1F41A 1GKOA 3FC8A 3A4FA 4PWKA 4PVLA 3W3BA 4DETA 3CFMA 1TTAA 1TTCA 2H6UA 4HJUA 4PWEA 1BZEA 1ETB1 5JIMA 4DESA 3FCBA 1THAA 3P3TA 1ZCRA 4YDNA 5E4OA 4WNSA 4TNEA 2IGLA 2H1XA 3GRBA 3IMSA 2ROYA 4IK7A 2QELA 5E4AA 2H0EA 2TRHA 3QVAA 1DVXA 3CFTA 4Y9GA 4L1TA 1TT6A 3IMTA 5FW6A 3KGUA 2B15A 1DVZA 5AKVA 1IIKA 2B77A 4DEWA 1ETA1 1RLBA 3M1OA 3CBRA 3GS7A 3GS4A 4FI7A 5AL8A 4PWGA 4PMFA 1DVSA 1SN2A 4QRFA 3OZLA 5E23A 2NOYA 3TFBA 4IK6A 5L4FA 1DVQA 3IMWA 3IMVA 3I9AA 3DJRA 4AC2A 1BM7A 3U2JA 2F7IA 4KY2A 4ABVA 2TRYA 2GABA 5CNHA 2G4EA 5CLXA 5TTRA 2G3XA 3CFNA 5AL0A 2G4GA 1OO2A 3DJZA 3NEXA 4ABQA 1FH2A 4IKKA 5DWPA 2QGDA 1KGIA 5L4MA 4PWFA 2ROXA 4MRCA 5CLZA 5L4IA 3CFQA 1SOKA 4Y9CA 4AC4A 1DVYA 2GPZA 4TLTA 1Y1DA 5AKTA 5JIQA 2H0FA 4TQ8A 4TKWA 4TLKA 4TLUA 5FW7A 3A4EA 1GKEA 4DEUA 5BOJA 2F8IA 3B56A 1SOQA 4IKLA 4I85A 2FLMA 1SN5A 2G3ZA 1G1OA 3P3RA 2G2NA 4TQIA 3P3SA 1IIIA 3HJ0A 3P3UA 5CN3A 1BZ8A 1F86A 5JIDA 1KGJA 3CN1A 1FHNA 3IPEA 4MRBA 3CN4A 5AKSA 1TTRA 3GPSA 4TL5A 4D7BA 1E3FA 3GRGA 3NEEA 1TSHA 1TFPA 5FW8A 3ESNA 3NEOA 5CM1A 5K1NA 3CN2A 3DK2A 4I89A 4Y9EA 5AYTA
chains in the Genus database with same CATH superfamily
2G30A 4DQOL 4K71B 3THMH 1E4HA 3HUJB 1E8WA 4XPTL 4WWKD 2P24B 3HHSB 4MMZA 2P26A 4OZFG 1EHNA 4KNSA 2DQJH 3E80A 3T6XA 4PU2A 1NGQL 1DSYA 3T8XA 3NRQA 4X5PA 2ZKHL 3ILDA 3MLVL 4M6NL 4XC3L 2O6CA 3TC9A 2ADFH 5IKCA 2PWEA 1GY1A 1BZDA 4I0PB 1BOGB 3FCGA 3FQ1A 4O02B 3VE0A 4TUJB 3CZKA 5EOQL 5B7FA 3GIVB 5EDSA 3LZFL 1W72A 2DWDB 3CMOH 3E6FB 4DWHA 4I3SL 4B9KC 1YG9A 3CK0L 2CDGA 2HFEB 1QYGH 1XGYH 2OI9C 4QKTA 1AQMA 1FNGB 3ECWA 1Y0LB 4ZMZA 4TQHA 4QRUA 1HL4A 4A7TA 3I9PA 2WIMA 1KXHA 2VM4A 1CE1L 5ISZD 4GOSA 4KDTA 4QXUL 1BVKA 4E9YA 3MRLA 1IBHA 2NQDA 3EBAA 5FCUL 4I3SH 3HNVL 3QEQA 4K9EH 3B5TA 4YDNA 2NXZC 3B9KD 1ACXA 3S35H 1K3IA 3F7LA 1HL8A 4LRIA 5E2UH 1VIWA 4LCYA 2F1AA 4PFEA 1QP1A 1FSKB 4AV0A 3QFDA 4GT7A 4JDTL 3Q6FA 3KPOA 5B1BB 3C60C 5C09D 2FEEL 4CNIA 3HZKB 3LKPB 5DO2C 4HWBH 5JW4Q 4K3GA 3S35L 5BW7A 1PLGL 4M6MH 1USQA 2D7QA 1OIOA 2X3AA 3I9AA 3IDNA 3Q6FB 4FZ8H 3P4LA 1NCWH 4M1GL 1BVLB 4XN2A 1YPZB 3FB8B 2N7BA 1A9BB 1CBJA 1SXAA 1N0XL 1JV2B 5I23A 5LN8A 2XNAB 2VIRB 1Z9PA 1XF3B 4OJCA 1EDQA 5EORH 2CLZB 3QZWB 4POUB 1T03H 4AK1A 3N91A 1N7ML 3LNIA 2XVKA 3K2KA 3RX7A 4GRMA 2GJRA 1Z6JT 3KNBB 2F58L 2WZPA 4MB5A 3KWWB 4X7TA 3UZEC 4ODWA 3TV3H 1FO0B 1VZHA 1X5MA 3BPLB 4N9GA 4DPBX 3C5XA 3BZEA 3ILQC 2EDNA 5C09A 3B7YA 1YAIA 3BAXA 2A74B 4JZJB 4DGYH 3VD9A 3EYQC 1OM3H 1MWAH 3CNKA 5HDQH 1HFUA 3FZUD 4Y1AE 4AMKL 4FCAA 3INOA 5ITFB 4M93C 4TUJA 4EUPA 2GHWB 2JB6A 1XXDC 4OD2A 3EGXB 4RBPK 1JZ8A 2HA1A 1MLBB 2WVVB 4YSCA 4WF7A 3L9BA 4JFFB 1P4BL 3ULSA 5T1KD 3DXAA 5DUML 4Q14A 4MJ5B 1JP5A 4PYHA 5ELIA 3EYOA 3UTQA 2DWEA 4ZW8A 4RWHA 4CJ0A 3D30A 3US0A 2CGRL 2AABL 4P3WA 3ZKND 2QHLA 3NSJA 5H2BA 4R2GB 1KIUA 1JZ6A 1JPEA 3ZIMA 4GG6A 5DJDA 1BECA 1U8IA 5DD0L 4M62L 4Z7QB 4GRLC 4AM0Q 1BG9A 4UTBL 4N85A 4UT6H 3EJPA 5F1OB 2Z64C 3FB6A 5I74C 4UCFA 2RALA 3DV4B 4JO4L 3RWFB 2DQTL 3KDMB 4NKDB 4GQPH 3NZHL 2NYYD 1MUJA 2R56H 4NNXB 2WO3B 4ONHA 4YHOH 2B1OA 5J4MA 1O9WA 5LNGA 5F88A 4R8WL 2WZAA 3BUQA 3IMSA 1N6QH 4Y1AB 1F18A 1W15A 1L9PA 3ZTJG 1TZOA 2NY3C 4ODHH 4HGWA 4NIYE 5MEOB 1A6ZB 5DDHA 2V17H 4P59H 4IMLB 1PD6A 4X8CA 1D5RA 3UERA 1GZQA 3OL2A 3UROR 5A2FA 2X28A 4XP5L 3DBXB 3CZUB 4OCXL 4PRID 1JHKL 5IIEB 5FOJA 3DHMA 4ODVL 1JF5A 2YC1B 1A7QH 3LQAC 5D8JH 4XMUA 3V0AC 2CPCA 3BN9C 5FYLD 4RA0C 4R97B 1FFNA 4GBXB 2P48B 3LZNA 2YJQA 1KTRL 1VRSA 2ZWSA 2XKNB 4QXUH 3KNBA 1U3ZA 3G5WA 1EDYA 4I4WA 1Z9LA 4H4NA 4PJ7A 2EDDA 4N0UA 4FHBD 4RMVA 3P4OA 1UENA 2D7TH 2OSYA 3IAQA 4XAKD 4M48H 4IKLA 4PUBL 5KAQF 4Z7NF 1PYWB 1WSST 1Z66A 1B0GB 2ZXAA 3OAZH 1KGJA 4HIIA 2XXCB 5AW7B 5GZOD 1XIWD 2XN9B 3NACH 3BPOC 5C07E 5JHLA 2BZCA 2XI9A 5BRZA 2ZE0A 2WMPA 3CX5J 5EU6D 1TFPA 1UM5H 2OYMA 3L95A 3PGCA 5CD3A 2O26U 1U8JB 2Y5QA 4WHDA 1LO3H 3QULB 2ZWKA 1ZWIB 1IV8A 5GRVL 4IU3B 2WSDA 3B3IA 4PUBH 3GLEA 3PJLA 1N3NA 3H2QA 2WYZA 4G9FB 1XWVA 4NSKB 4KO5A 1KY7A 3LSOB 3C6SB 1NANH 1OCWH 5FUZL 3R1GL 2BNUB 1U3YA 4P4KA 4RAVB 2C3WA 2R8SL 1HEZB 2BC4A 3NCFB 4UT9A 4B7LA 1MVYA 4MLSA 1I1YB 3G6DL 1G9NL 3KPSD 3EH3B 4M4RA 1MEXH 3ATDA 1SZNA 3PGFL 4FABH 5A2BA 3FYEB 3MV8A 4HS8H 4YH6A 1QSFD 3KYKH 5GGRY 1V3KA 3B3IB 4ZW3A 5EZOH 2WTOA 1WF5A 1U3HB 4BQ9A 5DYOB 3PWVA 1QFUL 4XI5D 3BPCA 3BFWA 3LEXA 4DGWC 3KM1A 2GIYA 2FDBP 3ABGA 1B88A 3LEYL 4ZMOA 4NYLA 1F3DJ 4YDIL 2CJSA 1I7UA 1NJ9B 5GZOC 4TUUA 2F53D 3DX0A 2VXQH 5BOPA 3JV6B 2MKWA 2YD3A 2C9QA 1KPRB 3KGRA 4L8BA 5JDSB 4J3XA 5EZLB 1LO2H 1NCJA 2JSFA 4OUUB 1R5IB 4FLRA 2FBOJ 3TZVC 4N8CH 5LGHL 4OCYL 2B1AL 4L48A 3X3FL 5DRXA 2D03H 1LNUA 1TJIL 4KX9A 5ITBH 5E4AA 1KCSL 3RX8A 1MCJA 3SDCB 4AYEC 1FP5A 3QZNA 3K5SA 3S8WA 3R7QA 1A1OB 4DPCX 4DZBA 4NDMA 4OAWA 3ARBA 1RIHH 2K78A 2HLAA 3RIAF 3UPCA 4ZT1A 1JTTA 3AROA 1WFIA 4HJJL 2GJZA 1AOHA 4G59C 3ZHFA 5IF0A 2XOTA 4I1RA 3AM8C 3U9PH 3WIAA 2MQ3A 4R5XA 1M53A 3RE0A 3R4DA 4MXQC 3GJFA 5T3XH 4POZC 5BO0D 2JJWA 4TNWK 4TKWA 3F83A 5DURD 1R9FA 4PGJA 2Q2LA 1QR1B 1G94A 2QQQA 1PPIA 1UCBH 1UOVA 3FB6B 2F19L 2BIMA 2PTTA 5T1DH 1XGRB 1ZJAA 3FQWB 5CN2A 3GRGA 1TXKA 3FTZA 3L4YA 3ZTDC 5H35A 1PFCA 3L5WB 3FQ4A 2ZP0T 1AGBA 3QUKB 4XVJL 4Y89A 4Y9EA 3GSQA 1U30A 2EEXA 3LRMA 3SKMB 4FA6A 1PBYA 3AWGA 5ADPL 5I0VA 3LH9A 5GGRB 4EI5C 2E0PA 3DDFA 4LSDA 3S37L 5J12B 2Q86B 5IVNA 1P4LA 4NO5A 3VYNA 4I8DA 4ZMPA 1AD9A 2HXAA 2EADA 2K8MA 4HIJB 3LS5H 3H0TA 2ZP8A 4L9LA 1JXDA 3U2SA 3WIHL 1F58H 4G42B 4Q9CA 1JWSB 1S3KL 4Z7VA 2QGCA 2C7UB 3MJ9H 4OY9A 3D39B 4GQZA 4CGTA 3MV8E 2DQFB 2QPDB 1L9SA 1YEGL 4W6XB 4HKJB 5BZZA 4HUNB 3F6LA 2ATKB 4GXFA 4QRPE 3VGAB 2M8XA 2N56A 1NAMH 2WANA 3CHRA 4FG2A 2L7UA 3A4DA 2NY1D 3A6BL 3T65B 2BP8A 3BPLC 1NOAA 1JZFA 4ABWA 4DNLA 4UM9A 3ESUF 4KJQD 2O5YH 4UINH 3UTZB 3L3HB 1LO5B 4HH9A 5DUJA 3EO0A 1VESA 4KKPA 2R39A 4ZUVA 5IMOA 5TFSL 4X8GA 3QQ9D 4S0SD 4JFPA 3AS3A 3II3A 3ELQA 3KM2A 1HWWA 4Y4HA 1VENA 3QVAA 1TZAA 4G70B 5KYXA 1RIVH 4LIQE 4EZJA 1L9TA 1I85A 4R4NC 1YECL 5EOCH 5C3LD 2HJFA 5K9JL 4X4MA 1AOZA 2XV2A 2CHWA 2NY4D 3L1OH 3PABA 3MA7B 3V4VH 4OZGE 3VXOA 4F7EA 1MCOL 2E74C 3O2VL 1U8QB 1QO3B 1QHOA 3SY0B 43CAA 1KENH 2QQKH 4NPYA 1WBYA 5KG9A 4KC3B 4WW2B 5ALBL 1MRFH 1ZV2A 4APQB 5IEKB 2GVYA 2P8LA 3OAYK 1SVZA 3QG7L 4HJ0D 2VLJB 4PJ9A 1SOKA 2Y1VA 3FUKA 1MH5B 1NBZB 2E9BA 4OFKA 2X6UA 1IRAY 2CHXA 5FW7A 4GRMB 5HHQB 4Z78A 1V7MH 4Y4KA 1ILUA 2HLFC 3QUXA 2V7HA 3KLAA 4NZUL 1EO8H 1CDJA 3SQRA 3UTSA 4KKBC 1DDHB 2DQJL 2OX5B 2A9CA 2DIAA 2XX1A 3CN1A 4PREA 3NA9L 2OMNA 5EN2A 4ZXBC 4F37F 1BIIA 4KKRA 2WVTA 4RGND 3VSTA 2WXQA 1KTKE 4WWPA 3VMOA 3UBXB 4QRSB 4IRJB 1YEKH 1TZ8A 1F1AA 1RXLA 2AJUL 2DQTH 5ITFA 2VDKH 2VQ4A 1XAUA 2NSMA 5AVRB 1ECYA 1NC2D 2W81C 1L7IH 1NIAA 2C26A 3H0TB 2HN7B 2X10A 3T4YA 2ZD0A 3LRKA 3DV6B 4C55A 2ZZUT 3BDYH 3CFUA 4ALAL 3MFFB 1U4FA 4WZ9A 3SDAC 1MWAB 4BSJA 4BQ8A 1A47A 2CDFB 2VDRH 3QXTA 1OP3H 2QV2A 2F0CA 2BVUA 4GRLD 1I3RB 2DH2A 4OGXH 2XACC 5AKRA 5IBUG 3U1SL 1N2RB 4PJHE 4JPKH 3SE6A 1JZHA 3WKPA 1YRKA 1AD0A 1MHPH 4U0QB 3DUUA 3DO3A 5B7EA 3KH4A 5DHVH 2BJMH 2V9UA 1KLGA 3TCTA 1KBGL 2IH3B 4PV8B 4ZOBA 4J3OF 5ANME 3PAUA 5EU5B 5IHUL 3CSGA 1ZGLB 3C6SA 3BAEL 1FNGA 2Z9TA 4FG6D 3EADA 1KJ2A 2CM6A 4YFLI 2ED9A 3LQZA 5E7BA 4KMTL 5L2KB 4FZEH 1QFHA 1CFBA 1YNTF 1C7SA 2R1YB 3EBGA 4OF3A 5CEYB 3B2DC 1NSNH 2ZF8A 2CDEA 3MKGA 3G5XB 4AYFA 1DBMH 1TU2B 1ZCRA 1OP5H 1FE8H 1XGQA 1TZIA 1YY8A 3KJ4C 3DX9A 1KLUB 2B4CH 2BVQA 4RMSA 2JK5A 5IG7B 2VDMH 3PWLB 4JB9L 2PPEA 4U1NB 2R69H 2E6JA 2F2HA 1SJEA 2G5BB 2VQUA 4P5SA 1EZVY 3T8XB 3CDFA 1UD2A 4ELMF 1IIKA 4HBCL 4AQAB 4N5ED 4IOIA 1BJ1H 2J12B 4AEEA 4YE4L 1DLFH 1GOHA 2BSRA 4IBZA 4JDEB 3ZU8A 4NWTH 3CTTA 3M88A 4MMXC 1V3LA 4PJFE 1DFXA 2GABA 2XBDA 1NGZA 4K0OA 2HFTA 3RRQA 3IETA 2J6WA 1AQ8A 5IWLA 4CMMB 5EIIG 2DLFL 3ARBC 3N2JA 4NNYA 1LQBC 3ROLB 1TJHH 5CS7A 4DH2A 3ULVH 1BGXL 3RZCB 1GHFL 2FECL 3DVIA 4PJEA 1OGSA 3SJVA 1MWAL 2ICES 2BDNH 2EVGA 2Q8BH 4DKFL 4I85A 4XO8A 1BXUA 2X12A 4MXWH 5SWSA 2IDCA 2DMCA 5DJ8A 4AG4H 12E8L 2DQEL 4FQLH 3VRIA 3WFHA 3E1ZA 3Q8AA 3QI9A 3DKHA 3G04B 2DYPA 5E08L 3MLTB 5DYOA 5DC4B 2AITA 1DBBL 3MLXL 1OHQA 3CHOA 4U3SA 1C9SA 3F7VA 3NFPB 3N1MC 3B9KC 1I9RL 1DQDL 1CIUA 1ZS8B 1JRHL 1AZRA 2VOTA 3HB3D 4MASA 4UIKH 5AW3B 5HGAB 5JMRA 4MA3A 1BQUA 2O5ZH 2P5ED 2SODB 4PGCA 3JWNG 1A4JA 5DQDH 1HESA 4AW7A 1H0DB 2CO1A 3KXFA 2CO2A 4JFFD 1C5BL 3L3OC 4YK4C 2QJDA 4NRXA 3MRKB 1XCXA 1HH6B 1N68A 1G7LB 5FYJH 5I0WA 3QIBC 5TF0A 3A6CH 3BQUA 5F21B 1DUYB 4L9LC 1JZJA 5EZPA 3WY3A 1IC4H 3RWGA 4FI6A 3QJOA 5D7LE 5DD6B 5C0EB 3VACA 4DQOH 5J7CC 4S0HA 2ZX7A 2D9QB 4AYID 1BZ7B 4CN6A 2WJ5A 4JANB 3QRGH 3MNVA 5DHXB 3SGDI 1NZRA 3C5ZC 1TDQA 3RL1A 4WEMB 5DS1A 2C9PA 1XF5A 4PJDE 1E4WH 3VXME 1S7UA 2EDXA 5CWSB 4LGPB 1JOIA 3CUPA 4ZO9A 2V2WB 2B5IB 2OFQA 4OZ4A 3VSUA 3D12B 5J1AB 3KGUA 1WBZA 2O5NA 1Q9KB 3HC3H 5JNYA 3KPLA 4G7VL 2W1NA 2OL3B 4U1IA 5AL8A 2EXTA 3T77A 1HIMH 3IAGC 3GJEA 4DP5X 3ISRA 4F20A 3VVVA 2IBZY 5I6KA 3TNMB 3QIUD 5T3ZD 4FQ1L 1OARH 4LCWA 5GGQH 4L9LB 5CJXA 3MOAL 4FXGB 5INCB 5I1HL 4HIHA 5F96L 1T7WA 3SDYL 2HLEB 5AL0A 4U6YA 1KLFA 1HL9A 2KC0A 4PRAA 1LWJA 1EHXA 2LHAA 3KYNA 3NIDE 4JFEE 1EO7A 3FOMA 3TN0C 1KB5H 4QGTA 5GGRA 3IDYC 3LKPA 2MCAA 3NN8B 2QSTA 4J1UB 4DUVA 3CXHK 3BP7A 4FGMA 3FPXA 2I9LB 5DD5L 1M7XA 2E6QA 3RKDC 7PCYA 1IEHA 2FX8H 2K6WA 2CA4A 4LOEA 4TNWF 2QPSA 4NQEA 1ZHNB 1UJ3C 1PCSA 3GSOA 4L8SB 5SWZE 5EFIA 5HDBE 5DD3H 3GTVA 3PQYB 1VHPA 1DANU 5DURB 5E1AA 4RAHA 5PAZA 2WQXA 3FMGH 4OIAA 2R9HD 4PJHF 3CWGA 4JFED 1M9SA 1NGXB 4G6AD 2NRDA 2V7NB 3ARGA 3B2UD 5AEAA 5IQ9B 3U2IA 2VCOA 3NFNA 3UXFA 3O6FA 3IJSA 2R0KH 2YQGA 3KPSA 4TSCH 3HNSL 4G7YL 1EANA 1KNOA 1Z7JA 2DM7A 1RP8A 4AV4A 2VT0A 1HHGB 3LNEA 1H5BC 3HG0A 3O6FB 2VLME 3HUJF 2JCCA 4TSBL 1AZZC 3WS3B 1J1OH 4BZ1H 4M7LT 4Z0XB 4XMLL 3P2BA 3TVMD 3OJMB 3C08L 1CXKA 3EDEA 3T0VA 5IR1B 1KEGL 5EUOE 3FO2A 1DBAH 4KUZL 3IF1A 4RCAA 2WB1A 1RUPL 4Y4KB 4JKLA 5LKNA 1HVXA 2BERA 4X5XA 1P4UA 1G1KA 2OZ4H 1EAOA 2Q9OA 2Y6SD 3EKCA 4EN3C 2A6IB 2WINB 3CFIC 3MGAA 2CO3A 2F53B 3NSDA 3BP5B 5DD1L 1DL7L 3VSVA 3VFUB 4QTFA 5IEKA 3R19A 1FFOA 3W9EA 3UYPA 1Z5LA 2BVOB 3WIFA 3Q2VA 3NJLA 5A7BA 2AQPA 2F1BA 2HYMA 1IKFH 3ES6A 2Q3XA 3HR5A 3BWAA 4R0LC 4ZMNA 3OPZH 1ZHLA 3H7BA 3T2NH 3TVMA 3NVQA 4OLYH 1UG9A 5DK2A 4HG4J 4P2YA 1BG1A 3OGCA 5LWYH 2ESVD 5IHZA 4G6KL 3MR9A 1WJ3A 4WFHE 3GLAA 4ABQA 3ET9F 3GKZA 3OB0H 1WCBA 3CC5A 4IS6A 4NNPH 4ZUVB 4PJGB 5IMOB 3BEWB 4X6FB 1G6VK 1DHKA 1KB5A 3IFOB 5CU9A 5EHFA 3RGVC 3BKCH 2GK2A 4DEUA 4Q0XH 2V8MA 4UT9L 3C8DA 2KL6A 4PCTA 2E76C 1QFPA 2F5AL 4GRWB 3C8KB 2LTQC 5I30L 4MWFB 5IJKA 2EDYA 4Y19E 2Y1YA 1NM4A 2EEDA 3O9WC 4G1EB 3A22A 4NAJA 1SFHA 1F90H 1E4KC 5HJ3B 4LQFH 3K5RA 1CF1A 1H8SA 4FXLA 4Q2ZA 1N5AA 5BVPH 4Y2DB 4MNHB 1SGKA 2QGEA 3EF4A 4RISH 3PPEA 2MNJB 4PJAE 4Y5XA 3REWB 3H3BC 3MRJB 4QYAA 3ZE2E 5I66B 5F44A 4DTGL 1U4EA 4PJXF 1C1EL 3DOIA 3VYPA 1NAKH 3P30H 2CKBH 4JVPA 1QBLH 2CLRB 3VFPA 4C4KO 1NAML 1CYWA 5AG9A 1RSFA 3MRKA 3D3VA 3EH1A 5GGVH 2KLRA 3QXAB 2FR4A 5D7HA 3JBG7 1A6PA 2WQRA 3Q9PA 1JXFA 2CIKA 5EEWA 3OKDA 1WAEA 1X5ZA 3UPRB 4X7SH 4P2QB 3K6NA 1XCTB 4A7SA 2VL4A 1M1SA 2NY6C 4X4XB 2W95A 4TUKH 5EC1A 5C08B 1MNUH 1A7OL 2XZQH 2ZNWA 5FA4A 1HXYA 1ZS2A 3L3KB 3B9EA 4U3HA 1MUJB 5ABDE 1PEWA 1MHEA 4GXVL 3BYTA 2VLKB 1ES0A 2DD8L 4QWWD 4LSSH 3TPUA 5FUCC 1I8LA 4QAWA 3F6IA 4UANA 2ZAGA 3T1FA 4D7PA 5HHXH 1DQQB 4HMDA 2XRAL 1M6UA 4I18B 3RJOA 3RYMA 2TRHA 1SOXA 4ZS6D 5C0BE 3ENEA 4OF7A 2NXYC 4UINL 1Q9OA 1L0QA 1S5HA 5HDQL 1VKXA 5K39B 3ZZ1A 2FNBA 4G8GB 3LD8C 2ZOWA 4JRWA 1VCBC 1C5CH 4HWZA 4OQTA 1A1OA 4XAWL 1RZ8B 3GF8A 1NCIA 5T1LD 4P2OD 2H5UA 1X5HA 2DV6A 3L4VA 1J8HB 2O5ZL 1X7QB 2UZPA 2P9RA 4RIRA 3TT1H 1Z9MA 4WWKC 4K4KA 1A6UH 5I8EB 2FVNA 1QLEB 1EDHA 4I2XA 1AYOA 5E5UB 4RSYA 1VACB 2AJVH 2GUOB 3CSYB 1MDAA 4POYA 2GTQA 1J5OH 1M71B 2Y07L 3ZTNH 3LQAH 4KKCD 2X9WA 1NMAH 1AKJA 4AITA 2P5WE 2E7LC 2W0FB 1PZCA 4BQBA 4Q9BA 1BM3L 2JI1A 3MFGB 4HIJA 3KPQA 1FGNH 1A6UL 5HYSA 3I02B 1F4AA 1UZ6F 3MNDA 1IBZA 1NDGB 4UIMA 1JPTL 3UG4A 3P2DA 1OK8A 2RIKA 4W9HC 4PG9B 4BKTC 1K2DB 1T3FA 3EH4B 4NT6B 5F7WC 4L8CB 1HK6A 1E5BA 2WXLA 2YD8A 4FKEA 5E1AB 1JPSL 5KBMA 3LCYA 1XEUA 5L2JA 4WW1A 1ID2A 2E3VA 5MI0B 4GINA 1GYVA 2XBZA 3GSQB 1RZKL 3DO4A 4OZGA 2F08A 4I87A 1DJSA 2RGSA 2BJML 4WI0B 3U4EA 2AXGB 4G83A 3LHPL 4G8GE 1DVFD 4HF5L 3ARVA 5JUEH 2OXGB 1H3TA 3RUGF 3RFZA 4FS0A 3IDNB 2B39A 1BEXA 1WG3A 3MV9B 5F2FA 4PB9H 5J57B 1I3RA 2MCG1 2BMKA 3W57A 3LD8B 4RETB 3P0YH 2F15A 4JFHD 4JKKA 3U7WL 3V4PL 3ARFD 3QIBA 4HHGA 3WENA 1E8XA 5FFOA 5I0YA 3GZKA 4IW4C 3MRMB 5CP7B 3NZ8A 4LLQA 4O51A 5IEHA 4FQJL 2FSEB 4PJGF 4JM2D 1GZPB 1MFCH 1XTLA 2QR0A 3CMOL 4JY5H 3ZYIA 1DE4B 1RCYA 2LV4A 5AOJA 4KH2A 4JQVA 3T0BA 4PRPE 1JGUH 5MEQB 4JLRA 4N0YL 3SE8L 1C1EH 2P5EB 2ROYA 4M29A 5GS0L 2X0VA 4YVUA 1NEZB 4L3EB 3MREA 3FU8A 1ET8A 3N40F 5GZNC 2G3MA 3Q13A 2DLFH 3HC0A 3H3PL 4H2CA 3N0AA 3WMPA 3NJXA 3PLYA 5FYKD 4QLRA 1PQZA 1F3JB 3QE5A 4A04A 3ML9A 5AB9A 1U8LB 3QZPA 5I82A 4DEPC 1GW6A 5CNHA 5B38B 2VUOA 3O8XB 4LLDA 1MXDA 4TUKL 2W0FA 5I9QC 1IGYB 1T04B 5L6YH 2HJLA 1MEXL 1A7NH 2VMCA 2ARJQ 4D3CH 4X6CA 4RZCA 2QQLL 3BN9D 1HH6A 3KYKL 3VFMB 5IV2A 5EBWB 4JKMA 2QADB 2E47A 2FLMA 2NX5E 2IPTH 4P4KC 1HXYB 4U1GC 3WFZA 3LN5A 2WK2A 3EYVA 3AABA 3TNNA 3GKWL 1P4IH 3VWJB 1QSED 4HOXA 2WUBH 2BO0A 3VGGA 6FABH 3PL6A 3OKDB 4YMPA 5I5MA 2V2XB 2G5RA 2VSMB 4GRLA 4ZMLA 4XXCC 1DQML 2CMRL 3RTQA 4BFBD 4X98A 3IDMA 1S5HB 4XPAL 1VKXB 5H2BB 3BWSA 1UB6B 1KN4H 2K8QA 1T7VA 4JKPH 3TFKC 3FTGB 4DP7X 1U2HA 2FX9L 5KN5A 4YHKH 2B8OT 3OJDB 1UHVA 1S7TA 5ALBH 2C9RA 2MSPA 2H0JA 1AZBA 1CU4L 2D7OA 5FYKU 2VSCA 3K2UH 5BZWA 4OZHB 3QG7H 2J4WL 4AEIL 2UY7B 4GKNA 1YN6A 2NY5L 3GO1L 4AE0A 4OTXH 4Y5VB 4ZYKA 1IC5L 3BLBA 3SE3A 1CK0H 1CIDA 3GS0A 3GGWB 4JHBA 5D70H 1PEZA 3LQAL 1KXQE 1CL7L 3ALXA 4IHOB 3D7PA 3GNML 4NCC2 5DA0B 4QJ5B 2XPYA 4OZ4B 4DP4X 3Q5OA 3BZFA 4Z9KB 2DMKA 3G5ZB 2ITDB 3P1VA 4A37A 4BH7B 5BUPA 1DVTA 1REIA 5FM4A 1K6QL 1J0YA 3DBXA 1R3KA 2QFRA 2EYSA 2CSPA 2X4TB 3IJEB 4PGZA 3IJHB 4PJ5B 4I5BA 5GGTH 1FUNA 1AGBB 4PB0H 1FZOB 3QZLA 4Q6IA 4W81A 4O02H 5DQ9B 1IAOA 2BCKA 2H1XA 4E42B 1F4XH 3MNMA 4WKXA 1RZPA 1EEZA 4NAMA 1P5VB 1NFDF 4HEPG 2EE2A 4L1TA 4MSWB 1TO5A 5F96H 3SDYH 5JW4N 1TZIB 1YY8B 2BSDA 4F7CA 1OB1A 4A2DA 5I6OA 1G9MC 1B3JA 2DLIA 2E5EA 2R0WH 1ET7A 3PYCA 3LRHA 4K7PL 2NDGA 2EH7H 4LBAA 1OLLA 5ADOL 2IF7A 1HOCB 2CPUA 2G4EA 3QIUA 4U2ZA 4HDIA 3QO1B 5JIHA 4AQ8A 2AI0L 2I32A 3H9HA 4BCZA 3RKPA 2PW2B 4G1MA 4QDGA 3NEXA 5FDWA 3QO0B 4PJ7E 3U7YL 2R23A 1FYTD 2XG5A 3BP5A 1LD9B 4Y1TA 5DLLA 9CGTA 3EXJA 1Q38A 2LFGA 2EINB 5IJBC 3LTVA 4B97A 1JUFA 5C2BL 2J21A 4Y1SA 5M95B 3D5OF 1J87A 1RUKL 4XOCA 5SV3A 4LASH 1S7SA 3MROA 5CN3A 4PY8J 4QRUB 3N1FC 1P5UC 4ONFL 3W0WE 3D0LA 4LVEA 1TTRA 2VISB 4XX1G 4HCFA 3UTTD 1S7QA 5IB3A 2PO6B 5EPMA 1CURA 2XV0A 3O2DL 3IVKA 4X9IA 2R1XB 4FG4A 3KLLA 1V7NL 3NSFA 3RVWC 1YJDH 1T1WA 3QAQA 1A6VH 2VABA 4XAKE 1DJGA 4Z7WE 1MHHA 2Q76A 3O9WD 5D7EA 2YPKB 5IFHL 4FQIH 1QLEL 2A77L 4CVXA 4PG2C 2I5YH 4M5YH 1GOFA 5I18L 3P40A 4Y5XC 2BY1A 1AGCA 2TSAA 1OXYA 2VN3A 3AREB 2KPNA 2DYPD 4NXKA 3HC4L 1W80A 4CMHC 1QA9A 2VLKE 4U6HB 1UXSB 4FMFA 4MKMA 1BZOA 1X7TA 4NUPA 3T2LA 3QUZB 4TM9A 3VI3A 1MW2A 2BLFA 2FJSA 2C9UA 4X5LA 2VXVH 3QDGD 2DIBA 2KERA 1IAIL 4TQEL 2CIIA 1HC1A 2AEPH 3Q44A 4HALA 1QATA 5C08E 2EYTA 4A2EA 4N0UE 2YXVA 2J44A 3KGSA 4LAQL 4PD4J 2DTMH 5AAPA 2X4QA 1MCLA 1QSZA 2W0LA 3MCG1 3KBEA 5BVJB 3U0TA 3EIFA 1EVTC 2ZCKH 2H6UA 4YOKA 1ET5A 4GW5A 5H94B 5JPMA 3TA3A 3BUBA 4RFEB 3MBWB 5CXPA 5IJVA 1CGSH 2AEPL 3EH5B 4BYHA 5EO9B 3VTAA 3QNZA 4HLEA 4KTDH 2A9NL 5I1IL 1JG9A 1CB4A 5EWIL 1TQTA 3VXUB 3TBWA 1UFGA 2MCPH 5E9NA 3ZE2B 1TNMA 5JQ6L 4F7PB 3QEQB 4FFZL 2AXFA 2LGNA 3FONA 1DJZA 4L05A 1OAQH 4Y4KC 5D96C 4A67A 4F37K 2JKSA 4LCUB 1I3UA 2P80A 4A7VA 4CKVX 2OXHA 1J10A 3EOYG 2X87A 3NIGB 3C5ZA 1UVQA 1T1ZB 1AR2A 2OMUB 1BYOA 3ETBF 3QYCA 2C34A 5EWIH 3GFUA 3AG1B 3TTYA 4N2MA 5CGYD 1RULL 2HKFL 2EVIA 3I9GL 3QCTL 3N41B 4AC4A 4IJ3C 4PBDA 3TJEH 4FEIA 1MJ7L 4H8QA 4EDWL 2VR3A 4WWKA 3EOTL 4K7FB 2BNRA 2ZCHL 5C0CA 1OSYA 3H42L 3O4OC 5L0QB 4F57H 4PB0L 2F61A 5HDRA 5D7JD 1IKNA 2VZTA 3B2UC 4AEHH 1LDSA 2YRBA 3PHAA 5IB3B 4B9ZA 4I0CC 3Q05A 3ARGB 5KVEH 4KKCC 4MRBA 1XCQB 3HZMA 4N0CD 3ILPB 1OY3B 4DW2L 1JZ4A 5GS3A 1NOFA 2D3NA 4G7VH 4UDUA 5GGSA 1A4AA 2EIEA 3VW3L 4MZ3A 4M61A 5ICUA 1MFCL 3PJSA 4DKEL 1PZDA 4ANXA 3C5SB 3VMPA 4HT1H 1QLFA 1ZA6B 1S9XB 4KZCA 3ZGHA 3CSPA 1FVDA 1P9MC 4PGCB 4PY8I 4HAGA 1PZBA 2VDPB 3N1QC 2X4UB 4H20H 1LO0L 1IM9D 4L4TE 4BWWA 5JHDE 4HIQA 1JGDB 2ZYHA 2AJYL 3PJSB 5DRWA 2ATPB 4PLJD 3BEVA 3F7VB 4DPAX 1KJ2H 3FOMB 1WZLA 2GT9B 1XB8A 3NIDF 5KYXB 1Q72H 4M1GH 1FAIL 5HGGS 1WDAA 2IG2H 3H7LA 3KS0J 4NN7C 4YR6A 5LBSL 4KI5E 5EF3A 5EOTA 2H6PB 2K1MA 4QWWC 5CSBA 4KOCA 1D7DA 1OTUD 4OI8A 2YUXA 3O6FD 3GSXB 5BRQA 5E4EB 1RERA 3H4FA 3V6BR 3ZL1A 4K3JL 4DGVH 4JY6A 4LCIH 3K72A 4I0PD 3UL4A 1O7DC 3BJLA 2YBGA 3BO8B 3QQDB 4XOEA 2I27N 3EBIA 1OF2B 4IMKA 4OW6A 5F7BA 4JRXA 5I17B 1U8HB 3LKOB 3X2QB 5E0QA 2QQKL 3P02A 5FB8B 5AVWB 2Z91B 3TLRA 3BKML 2DQDL 5C3TA 1WP6A 2IADB 3GXIA 1U8OA 5E08H 3UCRA 3EOAB 1RURL 1NAMB 3FN3A 2XG4B 2AJVL 5GZNA 3WEBA 1E43A 4UDUB 3WNLA 4DGIL 2GBUA 4LCWD 3QI9B 4QHUA 3CZFA 5HDOA 5LNEA 4W9LC 5E8NA 2N0KA 2VZUA 3M86A 5FHAL 3T4AC 3MOBH 4CMHB 2GSMB 5IEHB 3JV4A 4MVBD 1YN6B 3FBKA 1GJUA 1RH8A 3U46A 2FSDA 2Z65C 3MSPA 1EZLA 1FRGH 2BVQB 4W9FC 4IJTA 4X0KA 1MLCA 3F7RA 3IRZA 5I1EH 3TONA 3OX8A 4XPGL 4O58L 1YEDB 5IHBA 4OLWL 2D73A 4TLUA 3AZUA 3ZTEA 2ZKWA 4CNIB 3A4EA 1JGVL 5BVJA 1WC7B 2J25A 5IQNA 4NUGH 3T0EB 1KJ3L 5EUOF 4PP2A 3V6OC 4XVTL 3IN0A 2WBWB 4OQTH 4PRHB 4RRPM 3AQXA 5L8JB 2GITB 4W9EC 1IGFL 5A3IC 2BHFA 2MOVA 2A9AA 2YEVB 3FU0A 3IE4A 4MAYD 4WUUD 5BUAA 1NFDB 3IN2A 5D7IE 2WQUA 1J05B 1J1PL 1JF6A 1ZJBA 1P5UB 1HXMB 2WXOA 2CO4A 3JVFC 5KVFL 1B0RA 1EEUA 3P0VH 2X4SA 3FRPG 1N2RA 2ZNXA 3IDGB 3CZNA 1A14H 4NT6A 5E9DA 2J1XA 3OWEA 2CRYA 4YHMH 3PXLA 3QFGA 4FAAB 3HMXH 4KWUA 3OXRB 2WMPB 1QYGL 4OV5B 4P5MA 1AO7B 1DLHB 3BN3B 5IF0B 3ZUCA 3S8GB 1Z0NA 3WTWA 3V0VB 5H4ZA 3LJ3A 1KIPB 4IIZA 3CJJA 3P73B 3TYGH 1LYQA 5CJ5A 1UUSA 4RFOH 3ULUF 3U4BL 2ZAIA 3OLIA 2EIMB 2NZ9D 3BPNB 1TO4A 3D6GA 5DRNA 2MJWA 3CXDL 4P9HL 5T5FA 1CGVA 3HN5A 1RV6X 2EDFA 4HMCA 3ULAB 3BKJH 3G6JF 4RRPA 1VFAA 4JO1L 4PV1C 1NEZA 1TENA 5TK4A 3SCMA 4WY7L 4LK4A 5HHOE 5CCGE 4UT6A 1MQ8A 3KPMA 4WNJA 1LK2A 3GBLA 3SDDD 4RA3A 2K3TA 1HZHL 5BVPL 1EX0A 2W0PA 4MX7A 3LXCA 4XN5A 1XR9B 3RL2B 2JELL 3JV6A 4DN4L 1DLFL 3WBDA 4E41D 1A6ZA 5E2WL 2R23B 4ICXA 3E8VA 3BCDA 4BQ6A 2FX8L 1I7UB 2C3VB 5F7UA 3W56A 3L13A 1IM3A 2OQJA 4Y9GA 3RIFF 4NQEE 3FFCE 5FW6A 5IMMB 3MBED 3WXWL 3VGAC 4FI7A 3QNXA 4KKLD 5LBSA 5JPMC 1JK9B 3D1MC 3O6MH 3QJUB 4F7KA 4KMQA 3W38A 1URLA 2CCWA 1FVEB 3ZY7A 4D0CA 1BEYH 4Y19A 1J8HE 2B4CL 3LQZB 4EN2A 5IB1B 3Q0HA 1H19A 2NQ3A 3WS6A 3FU9A 4YLCA 1HNGA 4XXWA 3IKKA 4GI6A 1A4KB 1AJ7L 4FE9A 1K8DA 4YDJA 1H5BB 3TO2B 3A6BH 2GSIA 3JWDC 3OSKA 4UAOB 4F8TA 4MQTB 1SDAB 4NSKA 1OE2A 4ZMTA 4PP2B 3AQYA 1G7IA 1UADC 4FCHA 4KH9A 1QSEE 2IXQA 1QFWL 3QYMA 1OT2A 2EO1A 1Q9WB 5I1DB 1XT5A 5FKPB 3SDDC 4EAEA 4X4YB 3SOBL 4PRNA 4I1PA 3FK3A 3BQUD 4PS8A 2AEWA 1OCOB 4F7EB 3NPZB 3D0VA 1CI3M 5JXED 4POZD 4M6AA 3TN0D 4XCNA 2EXSA 2H3XC 3SPJA 4OD2B 3QA3A 2ZG2A 2HJFB 1IC5H 1EA9C 2EIBA 3TA4D 5T33H 3VH8B 4PJFA 1BREA 5TPWH 1CG9A 5D1XE 1EBAA 3JTSA 4X2UA 2DDQL 1KXQA 4JFPB 4LLVB 4TNFA 5SWQA 3A6CL 1JL8A 4WQOA 4WTQA 4I2XE 1LEGA 1MW1A 3F62A 1T5WB 5ISZA 2YC1A 4LLYB 4A66A 5CEZD 3MOQA 3U30B 1GPOH 5LUMA 4KI5F 3DVGB 1AAJA 1K72A 3NP3A 1P9MA 5TPWL 1U93A 1V7ML 1QNZL 3VGBA 3ESOA 1PAMA 3QDJE 3IFLH 3NJFA 4LLYA 5DMKA 5A6MA 4EF3A 3QZWA 5H35B 4YO0A 3NZHH 1P7KA 3MRNB 4QMEA 4YHOL 4G5AA 3CU7A 4FL4C 4FN0A 2NY7H 5DQDL 4PJCE 2LVEA 3SN6N 4FNLL 3IDUA 3RDTD 3ZUNC 2IFGA 2KZ1B 2H47C 1MAKA 4WO4B 5DJAA 3D39A 5GISL 3SYAA 1GJIA 3D33A 3T3PF 3QWOB 4HOWA 3CDGA 2WSPA 3HS8A 1WS8A 1TF4A 4P3CH 1AHWB 2DEWX 1C12B 4JFSA 1Z5LB 1JHKH 2BVOA 3WIFB 5B3JF 3V0GA 3FUNA 1V54B 2C4FU 3QUHA 3ECBA 2BNQA 3VG0L 5C0NC 1Q9WA 2ADFL 4PY7A 1BBDL 1PL3A 3MUY1 4FQHB 3BJ91 4PJCB 5KJ7E 3VXPB 4RMUA 5CEZL 1S9XA 4DIXA 1PLCA 1UYWL 5HGAA 3KG5A 1DVSA 3DX6B 4QY8A 1DVQA 1EPFA 4YSRA 5G4NA 5E24E 1ZVSB 4KHTL 1F4XL 1AG0A 4RISL 3WAKA 2R15A 4UTCA 2MOGA 3VGDA 4B7IA 1J8HD 4PRBA 4FOMA 4ODTH 4M1DL 1J7VR 1FV1A 3NACL 3ZTJH 4Y5XB 5EU3A 2XPZA 2ZG1A 4PJ9D 5D1QB 3CVCA 5BV7C 1DVFA 3AGVA 4N25A 4EUPB 4J5VA 4IU2A 3QA3B 2C1OA 2NUPB 3D25B 4L4TB 4HGKC 1UXWB 2D9CA 4HHWA 4Z7QF 4ZUTB 3UMTA 2R2EA 2WKOA 3P73A 5JYMA 4C47A 3I6LE 1F3RB 1MI5A 1E7VA 4NWUL 4F33B 1HINL 1R47A 2V7NA 4LNRA 5B22A 2P4AB 3MJ8A 2CIKB 3OMNB 1GC1L 3FRPA 3G6DH 3V4UH 4JGMA 5ETUA 3IDGA 1FIGH 1YEHH 3DVGA 3LNFA 4HCGA 4OLXH 2JCCF 3TL5A 4YFLF 5HHOD 4V2CB 4WHYG 2VDNB 4N0CC 3FO1B 1VGEH 5EZJA 3V52H 1IC0A 4F2FA 1D5XB 2UVEA 1RP9A 3VXUA 3HMWL 1KXVA 3SYCA 2W9EL 1QSEA 2C4XA 1OTSD 4OZGF 2H2PC 1IT9H 3BP6B 1DQTA 3QNYA 3KYOA 1J48A 1E27A 3FUMA 3B8YA 1S7RA 2W88A 1I1CA 4F80A 2JKNA 3HE6C 4KTYA 4L8CA 2BY3A 3MDJA 5C9JB 4CVWA 3VFWA 3CFKB 1NEUA 3P9WB 3WNNA 3NABH 5HHNB 1HHHB 1B9ZA 3NAAL 5A2JH 1ZLWK 1MG2C 2VR6A 1XCWA 4Y4HD 5FKPA 3UYPB 4HPOH 5D7KD 2V33A 3QT2A 1HHHA 1HCVA 3H56A 4OIFA 2IH3A 4PV8A 1T0MB 4RDBA 3R4RA 1BF5A 4BK8A 3ECQA 4KRPC 5IVXE 2D0HA 2D3JA 3CZFB 3HKFA 2HLAB 2MCPL 1A6WL 4KXZH 1LDPH 3MV8B 2VERA 5IMLB 2ZWYA 1NKOA 2IBZX 5EUKB 4BZ1L 4JKPL 1GY2A 3Q8BA 4AYSA 1KGXA 2R83A 2QKIC 4KDVA 3ATBA 3L1GA 1WRFA 1ZLDA 4JRXB 4UOW1 5D9SB 5BZXA 1S7UB 3S5ZA 4JR9H 2EKJA 4G9FA 2C3XA 2Q10A 3M1OA 3VI4B 1KELH 1USZA 4JFEB 3WTTA 2BZDA 4PCKA 1W0YT 3GIVA 1EO5A 3QEHB 1HCZA 3QUXD 1NCGA 1T83C 2KZKA 3KLHC 1E40A 2HTLC 3MAWA 3N9GL 5C0EA 3AVEA 2V5SA 4NQCB 3V0VA 2WTPA 2OTWA 2HTKC 5DJCB 4BSVA 3VGHA 4MJ6A 5L4MA 2MCMA 3RVTC 4RMBA 3T9WA 4F2EA 3AG2B 1TCMA 1L6ZA 2VYRE 3EBHA 4HAFA 3BYYA 1CVSC 1ZLEA 2QHRH 3L9RB 3KCWA 3JWDL 4OFYD 1TJGL 4PBWD 4YZFE 2J8HA 4WFFD 1XF2B 1ML0A 4KY1L 1AXIB 1IFHH 4UQ3B 3L8QA 3B9KA 1IIIA 3P0YL 1XTMA 4X5RA 5FA4B 1XGYL 3F12B 4MDJB 2WWOA 4JG0H 2A7BA 1JWUB 4WW2A 5F9WB 2QHRL 2YWYA 4ATTA 4FXKB 5TE6H 3NESA 3VRLE 1NINA 4LPXA 4JX0A 3D3VB 4DO4A 2EE0A 5C92A 4QRQA 2AK1H 1MKFA 3TEYA 3CN0A 2ESVE 4PY7B 5GGVL 5T1DL 2BWQA 2HX9A 5TF1L 2VDRB 5JR1L 1A6AB 4Q58C 3TEZA 3D18B 2WAQA 3VXTB 3RWDB 3OXRA 4O2EB 4HK0B 3UAJA 1AHWA 1N19A 4YDZA 3FH8A 4U7SA 4BFJA 4E42A 1MPAH 2PW1B 1OQOA 2OJ1A 3MZTA 1QW8A 2WB7A 4WRLA 2WCGA 4L5FE 4N90E 3BZDA 3ORJA 2CHZA 1T2QL 4U05A 5JHDD 2WN3A 1PD0A 3BUPA 4M48L 1U95A 3BUYB 4PGEA 5CBEB 4Q9QH 4ZOCA 1J05A 1SJVA 2G9KA 4L8SA 2WBXA 4WEEA 3E8UH 5LG1A 1NIFA 5GIRA 3IPFA 4HEME 1BJMA 1MXGA 2H45A 5D5MF 1R17A 2RHEA 5F7KC 4EVNB 3EYFB 3FOLA 3GXNA 5B3JE 3STBA 3GEFA 4YSUA 2M1KA 5CF3A 3QG6A 1KTJA 2E8ZA 1PMYA 2X4OB 3F04A 5EEZA 1BZ7A 2KHAA 4CN4A 1T4KB 5HDBF 3QCVH 4KV5E 1SEBB 3BKYH 3D9AH 5FUZH 1GYAA 3N42B 4XAWH 4PD4K 1MFBL 1ZXKA 2OZNA 2Y69B 4X83A 3EYUH 4BFRA 5KANI 5CJXC 1JN6B 1S9KC 1R5VB 4LNVA 3IBOA 3E3QC 3CXHJ 3H9SA 3MX0B 4CSZA 5E6SB 3OJDA 2YD9A 3HNSH 3N50A 4NKMB 3SBWA 2Z31B 1TQUA 2PUQT 4MD4B 3OZLA 4G9FE 4XPGH 1K5WA 2N7AA 2R1YA 5CEYA 3BWAB 1X5XA 1UFUA 1QPXA 1ZTXE 3AITA 1WA1X 5SWSD 2P3YA 1I9IL 1EMTL 4LCYB 1OSZA 4GO9A 3EAKA 4U7MA 3FFCB 3ZHNA 3ABKB 5I76A 4AL8L 3HUJE 4S11A 1SBBA 3WUWG 4HIEB 1SRDA 2OZ4L 3MJWA 2E4TA 1YCSA 3QDMD 3U4KA 3IS1X 3QJHB 4K07A 1SY6L 2NTFB 4QOKA 4S10A 5DTFB 1SXBA 3EYSL 3G04A 2IAMA 1N64H 2JI2A 3DI2B 2FD6H 4IDJH 4QCIB 2E9WA 2I9TA 4OM0H 3U48A 2FEEI 2NY7L 5F7FA 4DVBB 1WZAA 3D18A 5ICYB 5IB1A 2V9QA 2WXFA 5CJBA 2J55A 2K7PA 2EDLA 3QHZH 5DXWA 4M6NH 4WO4C 5DMIH 4N3UA 4NUGL 3LPFA 3HR5B 3OPZL 2JH2A 4MS6A 1PZSA 4GAGH 5AUMB 3EYQD 1XD0A 3O4LE 4Z7VE 3TYGL 3VI3E 1Z3RA 5C0CD 2VWEE 1NGWA 2BRRH 2ENSA 5ANMB 4OF0A 3VWJC 4GKZB 1JXGA 2EP6A 3Q06A 3RQ3A 3UPAA 4DVBA 3RFRA 2VDOH 3RNKB 4ECNA 1DDHA 2OX5A 5HHMB 3WO4C 3TWCH 3C2SA 3V6FA 4ANKA 2WXKA 1WIPA 3F84A 4U6HA 2CR3A 1OAKH 1MN4A 2IQ9L 2YXFA 5C0AA 4H26B 3UIZA 3U25A 4ZODA 2WUCL 5DQJB 1OPGL 1SXNA 4ATWA 1SJEB 2DEYX 2G5BA 5D7LA 2IH1B 4HD5A 3ALPA 3GWJA 3EDKA 2NY2C 4XWGL 1G7QB 3QDJB 3B9VA 3TCLB 2DKMA 2WQWA 4XO5A 2OS7A 3FCUB 5H94A 3CXDH 4P9HH 8CGTA 2E6PA 1R3JB 2A9MH 3AMKA 1TTAA 2BIOA 2E4FA 2FWOA 2WO2B 2FH8A 4NERA 3VWKC 2BSCA 4QD2E 4JN2A 4UQBA 2Z7UA 1MHCB 2MOQA 5IQ9A 4NBYB 3SDDB 2WXMA 3OF6A 2YWZA 4UOW0 5JXAH 4ZUWB 3WKML 2VGLM 2NY0D 3QB7C 2Z7WA 5D1XB 4KQ3H 3KVPA 1OOAA 2DOCA 4KJWD 1AE6H 3ALWA 3WNMA 4XR8C 3ZQWA 3VXRD 4ALAC 2ADGA 4JFFE 1CQKA 1GC1H 4L1BA 2BSRB 3TYFA 4KJQC 4PMFA 4P99A 1KJ2L 5JPNC 2QDVA 1N3NB 1FYTE 3V6OE 1ZDSA 2QQLH 4W9JC 5L4FA 5ALCL 4YHNB 3IMWA 1DQLH 2VLKD 4WFFE 2G2RA 2VDML 1ZHNA 2J1WA 3NTCH 4F92B 1IAIM 5CINH 3IGLA 2D2OA 4ZUWA 5T1MB 1P1VA 5HVHB 4YZFF 3QNZB 5B1AB 3R1GH 5CWSA 2DLTA 2XETA 2ZSWB 1NFKA 2PCFB 4JE4B 5I28A 1G9NH 2VJ0A 5JHMA 3HFMH 2Z4QB 2BCMA 1L7TH 3HG3A 2BP0B 4JY4A 4TQ8A 2Y9RT 1N70A 2Y72A 4E0RB 5DFVD 5IFJB 1L5GB 1F13A 5C0GB 2BSTB 4Z7VB 1GGCL 1P6AB 1OP5K 1LP9B 3P3SA 4N2NA 4QAMB 3BP6A 5KSAD 4C4BA 2Y7OA 4XPHL 5D72L 5T1LB 2D8KA 4KZ0A 5IUSA 2Q3ZA 3FB5B 5DQJA 1FL3B 3O45A 4NXSA 3ZT5A 3FFDA 3DK2A 3IMBA 4NN7B 2OMZA 3W0WD 3MHZA 4Q97A 3WTSA 2COVD 3L4TA 1ZT1B 2HVKB 3ZKXC 2ZYRA 2EUVA 3N41F 2X0WA 1INDL 3C12A 4LEBA 5FHAH 4YWGH 5GGSY 4BH7A 1VFBB 1GCYA 4J3OD 4MB3A 2BS8A 2PPFA 3V6OA 1KTLB 1URZA 1F2QA 1ZEAH 3GNMH 3I6KA 3RZCC 3WI9A 4AY0A 2LU3A 4DP8X 5K9KA 2CJTA 4LSVH 4WEBL 3S35X 3B8SA 3BO8A 3QQDA 4AVHA 5JO5A 2X9YA 3O11A 1KEMH 3FL7A 4BFFA 1P84J 2DMGA 2CALA 3TBCA 5HVFB 2DL9A 3RY4A 1KIQB 3OG4B 4LEXL 5FECA 3BDBA 3G7TA 1AHKA 1JDDA 1DBJH 1OAQL 1NIDA 5ACZB 4L5FL 3UBXA 3MLYL 4DPRA 4J8QA 1J8RA 5B3NA 1ZEAL 4P2OA 1DVUA 4K5PA 4MNGB 3IDIB 4ZMXA 3UAJC 2ODHA 5C0JA 4UQIM 2EVFA 5EMYA 4XN1A 1IM3D 4QCIA 3K6IA 2Q6WB 3US9A 1HCYA 3QUYD 2LU5A 2C7FA 5HVWA 3HHRB 3MNZA 1IVLA 2DKSA 1JYNA 3NOIA 4N87A 2OSXA 5HYIA 3IM1A 1JVKA 3PNWB 4N2AA 1AZUA 4BJLA 2AJXL 4TSAH 3O4OB 2V6HA 1BQ5A 2EKSA 1FZJB 1FHGA 1HIML 2DI8A 4M7KH 4WCYL 1ZLSL 2EE3A 3M6DA 1TEGA 3L45A 1U8NB 2IIJA 1RL1A 4XBEH 1PAZA 4TOYH 5FK9A 3QXVA 1AS7A 1HE8A 1T0OA 2OMWB 5SWQB 3IJYB 5GS2H 3J7HA 2QVIA 1CLZL 3ZE2F 3VFOB 5GJTH 3K4AA 2FCBA 3HAEH 5DSCB 4P3CL 1CICB 2BP3A 3N1GC 3MRIB 4ZO8A 5IB2B 1CD8A 5EU7C 2ZOUA 5E8EA 1TETL 4NZ8A 5D2NC 2Q8AL 4KQ0A 1LILA 2G9HB 2X09A 4OZHA 4WKZA 2QTEA 2CZNA 1LGVA 3O8XA 5HI5D 2CKNA 3VXUE 5FYKE 3BD3A 1X4YA 3VUAA 5FOBB 1J9TA 5FAAA 2ROXA 4HH9B 4ZO6A 1UZ8A 4YL4A 2IMMA 3B9DA 4WHTB 3CFKA 1UD8A 4Z3IA 2HFFB 3IGAA 1DBML 4M5ZL 3LV3B 5B8CB 1V7NH 3CV5A 1R4XA 3HI5L 4TUOB 1GC1C 4KK6C 4LCVA 1J5DA 5C3IA 2Q3AA 3SE8H 1WTGT 2ITDA 3L3IB 3P3UA 1F86A 1CDUA 2A1WH 2A4EA 3RIAK 3ETBJ 3V4LA 2P5EA 4CSPA 1A6TA 1FZKA 2ZKMX 3EYVB 3ZKQD 3DSFL 2NY6D 1OGPA 2VO8A 5HJBA 1TOXA 4Y2DC 1YJDC 2JIXA 3WXWH 4CUCA 5CBEA 1JGEA 2BVPB 1YEIL 3O6ML 2PXYA 3QWRD 3TYFB 3F7PC 1MJ8H 5TDNB 2EXWC 5I75C 3QNXB 3AXHA 2XZAH 2ZPKL 3FT3B 4NOBA 5FYKH 2N01B 25C8H 1EJ8A 2Y6TE 1SN0A 1P7QB 4E68A 3DJTA 4LLDB 3V8CA 4AJ0A 3D87B 4YVNA 3V0IA 5J6GB 2ED6A 1JK8A 4AZ8B 1SUJA 5KEZA 4EIGB 4M00A 4HH8A 4OZIE 5C86A 1DBAL 2ARJA 15C8H 3GBMH 1YMMD 4YDMA 1S7RB 4DKFH 1QPKA 1UM6L 2WLMA 1S9WA 5ENWB 1SJHB 4M8QB 5D7LB 1IT9L 3DPBB 2C9AA 5FYJU 1LXMA 4O5LH 2PYEE 4PJXA 5DJYB 1UWGH 1CTMA 1NTDA 1BXVA 3U1PA 3VXMA 4G7YH 4KXAA 4M8QA 3GHEH 3INUH 1CZ8L 1R5IA 2XQYK 4R0LB 4AQZA 4LHUG 5E1IA 3S0PA 1S7VB 2RQEA 1E6JH 4QY8B 4JFQB 5AW0B 1MIEL 1T6BX 5K9OB 2V2TA 2H6OA 4QHLA 4CC0A 3T3ME 4I0KA 4MDIB 1W0VB 2IGLA 5LVEA 4YBQD 5E4EC 1B4TA 1OTTC 4JDZA 3SKNA 1TTUA 2QELA 1HZKA 1IBBA 3U6RB 2DYSB 2NXZB 4ELMA 5L0QC 3TBVB 5JTWA 1TVBB 4K9EC 4X7CC 3BI9X 1W0VA 2C8NA 1FJ1A 2AXWA 2HRGA 5E8EB 4IJ3B 2CUMA 4AGLA 4JFQA 5D70L 3Q1SL 1PY9A 1YEKL 5IW6B 2YLKA 3BH9B 3CFDB 1CICC 3ARED 4CU8A 1AANA 2LU7A 3DNKA 2OSLB 1X5LA 5T5NG 1WWCA 1E28A 1HEHC 5B7MA 1CE6B 5EEYA 1OANA 2IPKA 2VDOL 4YXLL 4XOBA 3E6HB 1P7KB 4G8GD 3RAJH 2G60H 1R3IL 4DZ8B 2O6EA 4PTUA 4ICWA 4DW2H 5K9QG 3V0JA 3DX6A 3GMLA 3IFNL 4FF9A 2VERN 4J3BA 2IOMA 1NBCA 4UF7C 3GEWB 4R8WH 1NANI 4MS8D 4UTBA 4Q8BA 4YXLH 3MUGA 3I9GH 1XO8A 3DYPA 4NHUB 4TV3A 1TVHB 1ZANL 4K3EL 4OB5H 1MJ7H 4MMYB 4EDWH 5INCA 4MNGA 4BK4A 2BMKB 1WT5C 1U3HA 4PJFB 4P5TA 4B41A 4MNHA 4OD3L 2P5WD 2VAJA 3E7JA 4X6DE 1ACCA 5F72S 4WO4A 2Q8AH 1NFDE 2EH7L 1IL1A 3ZGIA 3NK3A 4ODVH 4FNTA 1JTOA 1MCCA 5EC1B 5C08A 4IGBD 5D1QE 5E2WH 4A7QA 5AD0B 5K9KB 1I31A 4PRNB 2GITA 4PLNC 4KQ3L 4WI3A 4ERSL 4UT7H 2A6DA 4HLJA 4H1LG 1P0SE 3L3GB 4P2RB 2FR4B 3ARRA 3BW9B 3QDMB 4W68A 4W4OC 3PWNB 3J8F7 5LXGL 4WWOA 1HHKB 1T2JA 3B37A 3II2A 4NX0A 5EH1A 2O5YL 1RZIB 4LEOB 1F8TL 3G9AB 3F5WA 2QQNL 4W9ZA 4OCWH 2BHZA 4FYTA 1IGCL 4WGWB 4LDCA 4ZD3L 5I66A 2P8PA 3IJ8A 1N9PA 2YPLA 4Y2NA 3EYUL 3B7TA 5CKAA 2E59A 1IAMA 5B4MC 1INEH 2BXZA 3PV7A 2BSTA 2GUYA 3WNJA 4HJSA 3PIQB 5F9AC 2ITEA 2VDOB 1NAMA 2EC9U 2IDTA 3LH8A 4OCSH 3P77B 3GMRA 3RX9A 5DFVC 1C5DB 1RURH 2YZ8A 3RWFA 2IVFC 4XXWC 2DB8A 4CC1A 3PE9A 4ZUUA 2XKSA 1X7QA 1PKQB 3O2VH 5FK9B 4XNAA 1IGTB 4Q74A 4Y16B 1YUHB 5JOFB 2VW4A 5EO1B 2UZIL 3WMQA 1EXUA 5KSVB 2GAZB 1QSFE 1T1XB 2UWEF 5LHDA 1ADQL 1FG2B 2FLRT 2VDLL 1BZQK 1KDJA 1WZ1L 3FXIC 3FTVA 3RBSA 3NBNA 5GS1B 5E23A 1OE3A 4YHYB 5DWUL 7PAZA 4PRHE 4M7LH 4ETYA 1ZDQA 4KVPA 4O00A 5KW9L 3NPSB 2WLJA 2TRYA 4M8VA 1DCEA 1F1DA 1P6WA 3ARFC 1YPZE 3FFDB 4RDQF 5C70A 4NZUH 5D2NB 2G4GA 4KJWC 1DQQA 2QKIA 2ID5A 4UQ9A 1MRCH 2FZ3B 4FFYH 4OM0L 3D4GA 5IM7A 2E8YA 3K6SB 5JIPA 3ABMB 3WYRA 4PJCF 3DXAE 2WBJD 3GJFB 3NCEB 3RLSA 1RVFL 5BZDB 2MQ0A 1TSRA 2L04A 5A1AA 4X99B 1NLBH 3IAPA 1T0NA 1KIPA 2JI3A 2UUDH 3O11B 5E70A 2AQRA 4EUPH 3I3BA 3L4WA 1AMXA 1AZVA 3QPQC 4OV5A 2XN2A 1R3LB 2XWJA 1NGXA 2VQ1B 5T3XE 4S1SL 3P11L 4B3EA 4I89A 4MWFA 5KAQG 2WIIA 3RL2A 2EVHA 4RGMC 3DGCR 5KYWA 1Q9LA 2H1PL 3BW9A 3ZRFC 3WTUA 3HS0C 4G8IB 2H41A 2PP7A 4XCEA 3KPMB 2FQDA 3LZFH 3VDAA 2MPAH 3JWOH 3I74A 3QNFA 3VFGH 3F01A 3MTXA 1IJNA 2VLMD 3Q2CA 4HOMA 4TOYL 3QHZL 4NNPL 4D2NA 4EJ1C 4WFHD 5I16B 4IRSB 4LRIC 2O6FA 5I71B 5D6DC 3RIFK 1PF3A 4EPSA 3EFDH 4K15A 3GSRB 5TD4A 4K7FA 1MFUA 2QTVA 1Q0XL 2V5RA 3OVUB 3ES6B 3S34L 2MTAA 4HFUL 2F19H 2O6DA 3X12B 1AIZA 1G9ML 3B2PA 4K5MA 1MFAL 3LEXB 5FFLA 2IH1A 2MQGA 3HOGA 4OGXL 5E5LA 5BPPA 1PZUB 4Z3EA 1JXJA 1CFSB 1UURA 5AVYB 4GAFB 4O9HH 5A2IH 4OKVB 4PWKA 2R4RH 1AXSB 4ZFGL 1AD0B 1Y6MR 2WUCH 1J12A 2BS71 1B2WL 3IS0X 1KG0B 1WFTA 3K8MA 1ONQB 2DQUH 5D1QC 4MB4A 5BV7B 3ZQ9A 4ANVA 4NRYB 1BBJA 3VRLF 3CFJB 4J2QA 2IANE 2AV7A 2B0SL 3NRFA 1NFAA 2SEBA 3ZMRA 5J0BA 3FAWA 1LE5A 1O7VA 3DV6A 4IBQA 4NFCA 4QF1B 4TRPH 5C2UB 1XBDA 1U6AL 3AU1B 2EEBA 4GLRH 4XNZB 1UWEL 3BOVA 5GSVB 5ID0B 3VFVB 1YEDA 5IB4B 3RWCA 3KWTA 2YQ2A 1F8TH 3HI6L 4M43L 4QPEA 1F4WH 5AVZB 4J39A 1IEBB 5EPMB 2QL1A 1V3MA 2D0FA 3B2VL 2EIDA 5L88L 5IVZB 4R5VA 4TVPL 1OAJA 2HVJA 1L9MA 3IKCA 5L2KD 3GJEB 6FABL 3FHAA 3HC4H 3MXWL 2Y2WA 1A7BA 2B2XL 2EIKB 2V8LA 3MRLB 4OFVA 2VC2B 3HA0A 5TDOB 4FQXA 2Z91A 1FLRH 5F9JB 2BRQA 3VXMB 1GGBL 1ED3A 1JRHH 4OFPA 4OGQC 4Q4IA 4UILH 1OF2A 1N8ZB 4YX2L 3H9HB 3BE1L 2WXJA 5IIEA 3BVXA 3NEOA 1T7YA 4GEIA 3WG7B 1X4XA 4E2OA 3HE6A 2NY0C 2QVMA 4IRJC 3VI4E 2UWEA 2AABH 1R0AL 1FLRL 4LSPL 4KJYB 1X9LA 3GM0A 2Y24A 1OCCB 3EFOA 2E9IA 4NO2A 5GXBB 2BNQB 5IVOA 3KBHE 4OCMC 5C9KA 3CVIH 1NWPA 1HAWA 2QGBA 4HIHB 1YNLL 2X2YA 4FFWC 4AJVA 4P23C 3N55A 4XPAH 4XP1H 3VQ1C 2J1KA 1JPGA 5HBBA 2UWEB 3SDXE 5DHYB 4P5RA 4J6RH 4NJ9L 2RQ8A 2JIXB 2H4EA 3MACH 4U6VL 5E6ID 1WBZB 2FJUB 5JNYB 1CD1B 2X4UA 1WUNT 2NW2A 3SKOB 3GMMB 1A3RH 1XCTA 1YEFH 5LCVL 2JKXA 5DFTA 1RKRA 4K7PY 3FQUB 4UQ3A 5K9QI 4E9RA 1NL0L 5LGJA 3OAUL 3P0VL 4CDGC 2L8AA 4YHLL 2PETA 1WFMA 2CBMA 5IREA 1KT2A 3RWJB 3R0MA 1TKWA 4L37A 4WHCA 3MLTA 1A3RL 3QJFB 2VDQB 5HGBB 2X2HA 2Y06H 3VSQA 2GBAA 2G0KA 1AO7D 5DLMH 4Y8AA 1NUDA 3FT2B 5D7LD 1T4WA 3VI3F 4U4IA 2R1WA 2QLVB 3H3KA 4Z7OF 3K0WA 4KUCD 5SV4A 1V10A 2OR7A 1FH5H 3GD1C 4NZTH 5E95B 3KLHD 4JPVL 1MHPL 5AVUB 1YYLL 3E1F1 5FGCE 5I2IA 3S34H 4JQXC 3LB6C 3U2JA 1N6QL 2A74A 1XSOA 3LS4H 2D7TL 3LN4A 2YAMA 4R6UA 2OMVA 4KGLA 1GAFH 1OZUA 3HBQA 3EOBA 3L5HA 4GI9A 3TEXA 3TVMC 3VG0H 4LASL 3TBTA 3FQWA 3CHQA 3Q3GB 2QGDA 2OW6A 5DJ6B 4Q9RH 1HINH 1CFVH 1P6FA 1WD9A 2DQHH 1XAKA 3L6FB 3QXDA 4YGVB 1ZS8A 3QHTC 4IM8A 1XF2A 2VJXA 3WIIH 5HI4C 4NN6C 2WNWA 2VAAB 4HMEA 2AP2A 1BVKB 1BJ8A 5MP6H 1AMYA 4MHHI 4RZCB 1HI6B 3WFHB 3TOPA 3S5LB 2MMXA 1OTUC 1FHNA 2FIKB 4P0DA 3RY6A 4BKLB 5KTEL 5C0IB 4D7BA 1OCWL 3EJSA 1GOGA 4EI5D 1VZGA 3C8HA 4AQOA 3N44F 2XVLA 3IXAB 3PHSA 2H32A 2CHNA 3H7BB 4GSQA 5HHNA 1EJOL 2BK8A 4ZW5A 4TSCL 4HS6A 1ECZA 4TL4A 4L1SA 4M43H 1RPUA 4GRLB 3D08A 4J8RB 5F1NB 2MHAB 4PIBA 1IQWH 4HWEL 1UQSB 4EBQL 3DWTA 4U6XA 2VO5A 1VFBA 3UTSB 4PJHB 2A6IA 2WINA 3F58L 3CFEA 1BGXH 4GAJH 4EZKA 2OYPA 4LXFA 1U91B 2X4NB 4L4JA 4WIQA 5J3HC 4BQCA 3T6ZA 2WXPA 2FBRA 1UD4A 4QNPE 2VE6A 5KS9B 3TV3L 1A4CA 5DRZA 1AG6A 2X70A 4PJ9B 5D1QD 4EOWL 5MHSE 5I19L 4LOUD 4MYWB 1WICA 1CTNA 1NJ9A 2WZ0A 1OZTG 3ESVF 4PV9A 3RJQB 4G80A 4FJZA 4YPGA 4OLEA 4AL8H 3BT0A 5AAMC 4LQ1A 3IDXH 4LKCB 4O2FB 3VNYA 1BFOB 3ZXAC 4L3CB 2B59A 2C3GA 1GGYA 3AY4C 2A0LC 4RGNE 4QO1A 2FEJA 1RIHL 1SOSA 2YZ1A 2PO6A 4LLMB 3VRJB 5T8IA 1S9VA 1YY9D 4NUJB 2CJUH 4O5LL 2FZ3A 3RFZB 1OVZA 1QMUA 2PCXA 1MVFA 4HKBB 4XPBL 5CILH 3MBXL 4PTTA 3L4XA 1W72H 1I8LC 1UA7A 4LAQH 3CDCA 2GI7A 5I74B 5LWYL 4RAVA 2NTFA 4JQIL 3QORA 1C5BH 4U33A 3VQMA 1RULH 2HKFH 1RUQL 4PEEA 5GS0D 1NMBH 3TH2T 3MNWB 5L2JB 1TQVA 4K8RL 2FHCA 3NSYA 2CJUL 2GTZA 4JFYA 2WGXA 1R3KB 4U0RC 3NGBB 3MV01 3B3BA 2XTJC 1NFDA 3IU4L 1ZIBA 2VC2H 3JWOL 4NLAA 3UAEA 2G3XA 3BZ5A 1IFHL 5CZXC 4JHUA 4XCFL 3SY6A 3UOAB 2JXMB 4OD1H 3OZ9H 4GRWE 1XGQB 1G7HA 1SBSH 4ZFZA 5CLZA 1PZ2A 2VDNH 4CSTA 5GISH 3SPIA 2HRPL 5E2VL 4DP9X 2CA3A 5CHNA 4PB9L 4JUTA 1V8HA 4NKIH 4E36A 1MVUA 5D6CB 4F3FB 4MD0A 5IJCC 5IROD 2F8OA 4A7UA 5D1ZA 1V27A 3MRHA 5IW1A 4HHAB 1AGDB 4PS4H 2Y3NA 3VA6A 3JWNH 2WBJC 1IGMH 4R5TA 2H32H 1DFBL 3IMUA 4HK3J 3L3HA 1HZLA 1RZ8A 4F57L 3N1PC 4O2CB 4JO2H 2XZCL 3TN0A 3HPJB 5AAWA 4MGXA 2XA8L 2JFCA 1JBJA 4W1TA 3KGTA 1PX8A 3V7AG 3FCSA 1E65A 3VD3A 3FQYA 2ZXWB 5SX4H 5GIRB 1Q94A 1TYRA 1CR9H 2ERJC 4JCMA 4MAYA 3VXQB 5AD0A 1F90L 1OAZL 2AJ3A 4H0HB 4X6BA 3WMSA 1D9KD 2IDQA 4UNTA 4JANA 4ONHB 1U41A 2CNYA 3DIDA 3LPOA 3WNKA 4JFHE 3N40P 2HJKB 3Q7JA 3VTMA 5MP6L 2NY4B 3VFOA 1JJUA 4A55A 3WDHA 3PJNA 1JFQL 5EOTB 3SKJL 2FBJH 3CHSA 1LO0H 4UYQA 3DOSA 4XO9A 3X11B 4IKIA 2IWFA 3X14B 5I73C 1WFUA 4KK5D 3LHAA 4PMEA 1VEOA 4WU7B 5DHMC 2EKSB 5KJRL 1HU8A 1XH3B 2EXYD 3FO0L 2B2XH 3DC0A 4PWEA 5J56B 5KBKA 4E9WA 2FEDD 1H5BA 1T5WA 5CUSL 2EIZB 4RRPG 2DEXX 3QIUB 4UM8A 3M46A 5ESAA 3S3JA 3FF7A 2XQYA 1X6NA 2R0KL 4F27A 1OM3L 3DTXA 3WV0A 5CP3A 4GEJA 5AOIA 3HCVA 4BGDA 3LYRA 5SWZB 3H54A 1BQHB 3DJRA 1M7DB 3HB3B 1NDTA 2VTFA 3MRGB 1ZVHA 1MCPH 1JNLL 5AVVB 3MRPA 3OXSB 2VKWA 3QHFL 5CP7A 3LY6A 3F85A 1EJ6A 4B9PA 2C3VA 1MRDH 2QSCH 3SGKC 2DQDH 5B3SB 1IM9B 1YECH 5EOCL 3DROA 1KPVB 2F5BH 3CFQA 1B6UA 3TIEB 1OAXH 1BX2A 1UWXH 2X42A 1QASA 4QOKE 4LKXB 3S3BB 2EYSB 4G5ZH 4FTVB 3NIDB 3HVDA 4UNIA 1D7CA 4R0LA 4QF1A 3MBEB 3EUDA 3DRTA 5HVGB 5HGHA 4XRCB 2YMTA 4L3EA 1JMXA 4TTGA 1A7PL 4M4RB 1BQRA 1MRCL 2WOBA 2JJTC 3C5ZB 4HQQL 1SJHA 3B2XA 4A6YB 1UJ3B 4E9VA 4KO7A 3SBRA 3OR6B 4GMSH 4YNYB 2OA9A 4ZMVA 4PWHA 1PLAA 3FQ2A 3JUZA 4IU3A 4XZ4A 2NX5B 3VXNA 2CXKA 3EYSH 4JY4B 3RUGA 4XVSH 3F65A 1MJUH 2G3NA 4H8HA 1X5GA 5DC0A 4URTB 3AAZB 2EDKA 4JKWA 3S36X 1SM3L 2MWCA 1L6XA 4MAUL 4HG4K 4JFZH 4X4YA 4A2HA 1J1PH 4E9XA 1TR7A 4LF3A 4GUPA 5HDLA 3V4PH 3QCUL 3L54A 2H1PH 3CHPA 1FC1A 1UZGA 4PBXA 3HBZA 3SKMA 3TJHD 2PXYB 4Q6YA 2R0WL 3D06A 4A7GF 1G1YA 1E27B 1F11A 3D69B 5EBLB 5DA4A 4ZFGH 4IRSD 4HJ1A 4AIZB 4PJGA 4NPKA 4HJEA 4DT2A 1JHTA 1GAFL 2AZUA 3NCBB 3LN5B 3QBTB 4HC1A 4ODTL 3O2DA 1E9PB 3RHWK 3RVVD 2A6JB 3KPRA 3KPNA 2FHFA 1FVEA 3A4FA 5EBGA 4AKOA 1KTCA 2DPKA 2HLFD 4F15B 2J8UB 5JORB 5KYWB 4EDXA 3MU3A 3UTTB 4N2EA 3KCPA 2OKMA 1E2VA 3AQDA 3VFTB 4E9QA 5JR1H 1ASPA 3WNPA 4DTGH 1RJCA 3WN5B 4HS3A 2F53E 3RPIA 4S1DD 1J9SA 1FDLL 3VFUA 2VZOA 3OSVA 1DQKA 1WV7T 4JY5L 3RDTA 5FCUH 2C1OB 2NUPA 1CGUA 2CGZA 3D25A 3GS7A 4ISVB 4L4TA 4ZUTA 4Y19D 2J8UA 2C9VA 3ARBB 4GRWF 4N2FA 3QI9C 5I1GH 2VRKA 3RHWF 1FN4B 2IWGA 4GPVA 2DQUL 5DO2D 5E0FA 5I24A 1FV1B 1AHMA 2EYRB 2J2ZB 5FF6B 1A1MA 3CZLA 1XZWA 1GTFA 3PWJA 2D4DA 4GG6E 4M6OH 4S1RL 4U4BA 3OG6B 3AADB 3T8MA 3F58H 4FLHA 3L4ZA 4R90H 1F4WL 2Z31D 1BQKA 1SF5A 4HXAH 5F7EL 1WVZA 2DQCL 2YK1L 2AGJL 4OFYA 5CIPB 3OPUA 1IBGL 3TA3D 5F7DA 3QEGH 1IQDA 2K3HA 1WBYB 4PJ8A 4BH8B 5KG9B 4K23H 1GYUA 1IAIH 2FIKA 4BKLA 3IK2A 3ZYOA 1B0GA 1GHFH 3KBFA 5C07D 3TP4A 4FYQA 4JM2F 5IHHA 1FL5B 1PG7H 3DUSA 4JVWA 5TQ0H 3RUGB 2VZ3A 4ORGB 3CVHB 3GI9L 2FO4B 4CADB 5KW9H 3HG1A 5FC9A 1GGBH 2CBOA 3LKSA 5ESAB 4H25A 1ZT7A 2XKNA 2DRUA 3DX7A 5DFAA 4YSTA 1FFTB 4J3WA 4X9GA 2KLTA 1FYHB 1O75A 1XHHA 2A2QT 5EUOB 4ZFQA 3WFDL 5JW4M 3MODH 3GMOA 4CILA 3OHMB 4FNLH 4M5TA 4MQXC 4YAQB 4DERA 4BK5A 5I2IB 5TE7H 5L2KE 4YWGL 1OWWA 1RVFH 4HUVB 1EGJA 4MMXB 1KWGA 4FMVA 2OMZB 1AYRA 5DUMH 1KPVA 5EF1A 2P44B 5FOBA 3S5YA 4I77H 3APCA 4IS6B 4XMXA 4DQAA 5CLYA 2XQBH 2YAHA 2ATAA 2ED8A 3EGDB 5F3HB 3MA9H 4UB0H 3WTVA 4FP8L 3LRLA 1GPOL 3JV4B 3O4LD 5ERWA 2NCEA 4Y1AD 3B6SB 3KPTA 5IFJA 3FC8A 4HZ1A 2JCWA 4DO5A 2L7QA 4OVVA 2QADC 1CICA 5D7JC 3EOAA 3HZKA 1UYWH 3Q2WA 2XV3A 1JZGA 4QYOB 5D7SL 1GJWA 3ROOA 3SGJC 3X1EA 3UAJD 1JDCA 3QXWA 2BX5A 2Z35A 1PZ5A 1WWWX 5C6PB 3I6SA 2GJ6D 4OBRA 2DQMA 1G0XA 2RJMA 3LX9A 4X7TB 5EA0H 5SWZD 3QDME 2EDHA 2CHDA 3QRGL 4PGDA 2UYLA 2CH8A 2JV6A 4ACPA 2WP3O 5MENA 2BW4A 2GBVA 3M7OA 3QORC 1UACH 4AENB 1IAII 4BINA 1JPGB 2PTVA 1MFEH 4WU7A 5FYLH 4A2GA 4HFUH 4GUQA 3U9WA 5DMGD 2WLIA 2Q7YB 3WKQA 1A8JH 3I6GB 1CE6A 4QRRE 2GSGA 5DJZA 4AGQA 2NNAA 5JOEA 1F97A 1K4DB 3MCKB 4ES8A 3DX8A 1M7UA 2YSTA 2HMIC 4G9FD 3NQKA 4OH2A 1X9RA 4JPVH 5EBWA 5ABAA 5AKTA 4JM0A 3CLEH 1FNHA 1WS7A 3ZKMC 1HHIB 3N3EA 4IBWA 4XB3A 2XA3A 2D7MA 4I13B 4A2MA 3GSWA 3N43B 4LCCB 4N6RA 3SGKA 3P9MA 1HEJC 2DBLH 3VQ2C 4Y7OC 1SDDA 1G7MA 2I07A 1VGEL 1KTLA 1ADWA 4YDKL 4TTDD 1DN2A 4MA1B 1BLNB 4HOZA 3EJYC 1EHLH 2EJ1A 2WLLB 1ACYL 2E7MA 1ETZB 2CE6A 4YPJA 1M6OA 4NRZB 3VXMD 4G7QB 1RPQA 4ONOA 3OAWA 4UQDA 5E2TL 1NEPA 3TJPA 2A5UA 4G11A 1B4LA 2AQ2A 15C8L 3GBML 1I9EA 2J8UF 3MREB 5E03A 1QLRA 2OMYB 3ZHLA 1R19A 4MJ5A 4NFDA 2ADIB 5KSAB 5B4MD 1VFAB 2FB4H 2VIRA 3O2DH 5G5DB 4MNQB 4N3TA 4HU2A 4WW2F 4MD0B 4B5EA 4CC4A 4A39A 1T03L 3NDZE 4RFEA 6TAAA 2X2JA 3C09B 3T2QA 4XCCL 5FPIA 4AK2A 2Z8VC 5JDSA 1T1WB 2J6EH 1Y6KR 3I85A 1RZGB 2FO8A 2B08A 4S1DC 3W82A 6CGTA 1A8ZA 4I3RL 3KPOB 3MLZH 5GRUH 5DJ0A 5CZXD 5IQ7L 2HKHL 2WBKA 5J12C 5C09E 3IMRA 3H6AA 5FO8A 3T3MB 1THCA 4JKNA 2X70B 4XT1C 3LPPA 4P46D 2ICEC 3KR3L 3X1GA 1JPFB 4B6ZA 1W72L 1LL1A 4V1DA 3I6GA 4N86A 3ZE0F 3CSTA 1N12A 4UTAL 4PRHD 1XV8A 2J6EL 1CF8H 2NZ1A 2JIXD 2OXHB 4IEFA 4AKPA 1BQLH 4J4PD 5EUKA 3NCWA 1NDMA 4CDHA 3ARGC 2GG1A 3RILA 1RK0B 4NHCH 3F7QA 5GGUB 3WN5C 5F0LB 3ZZLA 3QQ4A 2GC7C 3M1CA 1QOKA 1NM9A 2H3NA 3UAAA 3DVNB 4OD1L 2HN7A 3QIWD 3C6LB 4K5NA 4NC2B 4Y0GA 1BFTA 3QWQB 3VXSE 1WZMA 1JK9A 1HYSD 3UTPE 4WHTA 1U8JA 1Y18B 3US1A 5DVNA 3IGUA 1RZFL 5DEFB 1AGEA 1CTOA 1JF1B 3U9UA 5CIPH 2WGNB 4BBWA 4N8VG 1OWRM 3QJZA 1S7QB 3FT2A 3ZBMA 3ISYA 4LVHC 5TDPA 32C2B 1LWRA 1ZSDA 2YUZA 3LHPH 5DWPA 4BDVB 5D96B 3OKMB 2IV9A 4JG5A 3P4OB 5HDWA 4LEOA 4X9BA 3DIFA 1J0ZA 3QZWG 4JFDB 4JFDD 4TSAL 4XCYA 3OF6D 1H6UA 4XBGB 4NRZA 5LGJB 5CJOL 4KHXL 5KVGH 1AGFA 2OMXA 2IFFL 2EUZA 3HJ0A 1RLWA 2VQ1A 2YAPA 3PQYE 4JHAH 3SYQA 3MMEB 1ZGLP 2ZCLL 1NFIA 4X80H 1DUZB 4RGNB 3L2LA 5FW8A 1BPVA 2YD5A 3HC3L 1HAUA 1PSKH 1QHQA 5KVDE 1GGIL 1NGWB 2P80D 1TNNA 3D09A 1VB9A 3RG1C 1FZMB 4UT9H 2BOBB 1P2CB 1F00I 1JMZA 4CADA 1TMQA 4FDWA 1RUAH 2IDUA 1TETH 4HETA 4R7VA 4QRSA 2BSEA 4UM9D 5D7KE 4QTIL 2VL5B 1AFVH 2R0LH 3FN9A 3O3DB 4MNQA 1HL5A 3AS2A 5DT1L 1OP3K 4PVMA 5KYUA 4BXSV 4UTAA 2J5WA 1OLZA 4W6YB 4PRPB 1VPOH 1KB5L 2X3CA 3H8NA 3GB7A 4FTVD 3L17A 5IK3B 2XA8H 3TO4B 4AIOA 4M5ZH 2APBA 1UWEH 3UC2A 2FGWL 2OYLA 4JDVA 1QKZH 2NPLX 3L6FA 4DP2X 4BM7A 3EO9L 2IMNA 1KN2H 2GAZA 2P8LB 3AS0A 3T65A 1TVDA 4ONFH 4L3FA 3MYJB 2Q87A 4AW4A 3RJDA 3X13A 4AGMA 5F9JA 4LDOB 4PJDF 2BOCA 3GRWH 3MXVH 1UEMA 3SCMC 4ES9A 4J3TA 3MV9E 5E56A 4M7ZC 1K4CA 3PXJA 1FPTL 2LQRA 3QWOA 2ISDA