2QPFA

Crystal structure of mouse transthyretin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
116
Chain Sequence
b'SKPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title Human-Murine Transthyretin Heterotetramers Are Kinetically Stable and Non-amyloidogenic: A LESSON IN THE GENERATION OF TRANSGENIC MODELS OF DISEASES INVOLVING OLIGOMERIC PROTEINS.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 26
structure length 116
sequence length 117
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2qpfA00
2G9KA 3CXFA 4N87A 5CNHA 2GPZA 4QXVA 3OZLA 4IKIA 2G3XA 3FC8A 3GS4A 1TTCA 3BT0A 3D2TA 1DVUA 3IMWA 4WNSA 3DO4A 4I87A 3IMUA 1Y1DA 4TL5A 4HJSA 5CLXA 3KGTA 5A6IA 5CLYA 4FI6A 1Z7JA 5FW6A 1SOQA 2H0FA 4PWEA 1THCA 3ESOA 4DEWA 4DETA 2H6UA 4Y9EA 3P3UA 4ANKA 1E4HA 4IIZA 4TQ8A 4TQHA 5L4IA 1KGIA 4Y9GA 2GABA 5EZPA 5CN3A 5JIDA 4PMEA 1KGJA 3DK0A 3M1OA 1TTBA 3B56A 4PWHA 3I9PA 2H4EA 4L1TA 3HJ0A 4TLSA 4PWFA 1ETB1 4TNGA 4QRFA 5AKSA 5EN3A 3I9IA 1FHNA 4WNJA 2B9AA 2H0EA 1ICTA 4ACTA 2QELA 1OO2A 3IMRA 5JIQA 1ZD6A 1TLMA 3OZKA 4FI8A 5FW7A 3KGSA 5IHHA 1BZ8A 4I89A 4N86A 3DJZA 1U21A 4YDMA 3GPSA 4IKKA 1X7SA 1TFPA 2QGDA 5E4AA 2B77A 3DJSA 3A4EA 1BMZA 1BZDA 1DVXA 3CFTA 4KY2A 4PVNA 3GS7A 2B16A 2WQAA 1IIKA 1FH2A 3GRBA 3NESA 2QGBA 4HIQA 3IWVA 4Y9CA 3U2IA 5JIMA 2F8IA 4IKLA 1GKOA 2G2PA 1TT6A 2H1XA 3P3RA 3CN3A 2F7IA 3A4DA 1ZCRA 5E4OA 1TZ8A 3GLZA 5CM1A 2B14A 3FCBA 1F41A 4IKJA 3BSZA 1SN5A 3DK2A 4HISA 3TFBA 3DJRA 4D7BA 2PABA 4FI7A 4PVLA 3GRGA 1TSHA 5AL0A 5AL8A 4I85A 5K1NA 5AYTA 1DVQA 4TNFA 5TTRA 3SSGA 2TRHA 4TLUA 5CLZA 3NEEA 5K1JA 4Y9FA 4PWJA 4YDNA 4N85A 3NG5A 4PMFA 1G1OA 3TCTA 1IE4A 1E5AA 5HJGA 3CFMA 5L4JA 4TLTA 4DERA 4AC4A 2H0JA 3I9AA 5L4FA 4DESA 1TYRA 2G4EA 4HJUA 2FLMA 3CN1A 3ESNA 4PWGA 4WO0A 4TNEA 3IPBA 2ROYA 4IK6A 3IMSA 4TM9A 3KGUA 4TQPA 1SN0A 5DWPA 3P3TA 3D7PA 2IGLA 2QGEA 4MRCA 1DVYA 3DIDA 2FBRA 3CFNA 5DEJA 4ABWA 3W3BA 4DEUA 4TQIA 4PWIA 1RLBA 4L1SA 3CN2A 1BM7A 1IJNA 1DVTA 3DJTA 5CR1A 3CFQA 4TKWA 1TTRA 1DVZA 1THAA 3IMTA 3P3SA 3U2JA 1BZEA 4MASA 3CBRA 1SN2A 4TLKA 3NEOA 1SOKA 1QABA 3ESPA 1F86A 1TTAA 2G5UA 2NOYA 2G2NA 3QVAA 5FO2A 2G4GA 3IPEA 2QGCA 3CN0A 2B15A 1GKEA 4HJTA 3A4FA 4Q14A 4ABQA 4PVMA 3IWUA 3IMVA 1QWHA 1X7TA 5AKTA 1IIIA 4Y9BA 1DVSA 1ETA1 2QPFA 3GS0A 4MRBA 4QYAA 3CN4A 3Q1EA 5AKVA 3NEXA 5L4MA 4IK7A 3DGDA 4ABUA 4PM1A 2G3ZA 2TRYA 4PWKA 5E23A 1E3FA 4ABVA 5BOJA 5FW8A 4AC2A 4TL4A 2ROXA
chains in the Genus database with same CATH superfamily
1P2CB 3ARBA 1WBXA 3MKKA 2D0HA 3LSOA 2DDQL 3F7YA 3IMWA 4WUKH 3QS2A 4JFED 4M4PA 1P7KA 1J9QA 1TEYA 1CD9B 2Z93B 3GUTA 3WNIA 4KHXH 1JTOA 1SGKA 2VXTL 2DRUA 3CZJA 4Y4FD 2CGYA 2OJEA 4N2AA 3SKNA 1DQVA 1WCBB 3L3OC 2DF3A 3N5AA 4FZEL 5T3XD 1KN4H 3AADB 2MNJB 3MCYA 4L18A 2AITA 4ERSH 3RB7A 3BAKA 4LLVA 4MS8C 5C09B 1XR9B 3ZIYA 4UTAH 3IETA 1N7ML 2F53D 5KVEL 2X7LB 3SDDB 3P9LA 1RD6A 5DLMH 1ZIBA 2X4SB 5CHNB 1R0AH 5I1GH 2J5LC 4QYOB 3UJIL 1BQLH 3X1NA 1EMTH 4AT6A 3M1CA 4NQDB 1FE8L 5D71L 3KPTA 1P5UC 4GSDH 2JTYA 3VFOB 3GRBA 2OTUB 1WAAF 3WTTA 3TNMB 8PAZA 1JVOA 5TE4H 2VXQH 4YVNA 5HGGS 4EI5C 2AQNA 2K7QA 4XR8C 4M00A 4JO3H 2FWOB 2F8VA 4H4NA 3EJRA 2ADGB 4QJ5B 3EXJA 2EP6A 3EYVB 3LPFA 1G7QB 1T83C 3C87A 1G9ML 1GMEA 2H3NB 3SCMC 3VXRB 3X3FL 5ACMA 4UANA 4JHZA 4JAMB 1UZ8A 2DWXA 4AZUA 4HZLB 1FFPB 2LFGA 3JZ7A 1XF4A 1CZ8L 5L4JA 5AW2B 4KKBC 1KBBA 3RGVC 1KJ3L 5KN5B 3HW7A 1PIGA 2QZQA 2ZG2A 3QNZA 1GH7A 2D3NA 1LD9B 3KM1A 5IW3A 2HT3D 4HUXA 3SQBB 2DW5A 1OWRM 2OTWA 3O6FC 3WXWL 1EEQA 2VMJA 4MQTB 2OL3A 1LO2H 1AZBA 2C9VA 5C0BA 4JM2F 1QLRB 1SFHA 4LFHD 1TTRA 3NP3A 4N68A 5HD8C 1ODAA 2PTUA 3OX8A 2R8SH 1N0XH 1GZPB 4PJ5B 1AR2A 4DPCX 4LEXH 3T0AA 5KSAB 4Y16B 4OU3A 1NCDH 2KHAA 4PG9A 2FLRT 3BKMH 3U0PB 3CFEB 2BZCA 5IT2L 1RULL 4G7YH 1T6BX 1EDQA 4AGOA 4X5XB 4GSRA 2X70B 2R23A 3ECQA 5E8EA 2JKJA 1EANA 3OKKA 3WFZA 4X4KA 2VDPH 3NTCH 4XBGA 1OSPL 2M1KA 5EA0H 5HDBF 2FD6L 1RZJC 2R15A 4P2RD 1E4WL 3L4YA 5JPMC 2XV0A 5EOCJ 1NCBL 4D8PB 3Q9PA 1CLYL 1MUJA 4G8IB 4LSPL 2JKWA 2P44B 4HJSA 1T2XA 3P0VL 3T3MB 4NGHH 5BO0D 4G7VL 2B5IB 4FFZH 2E74C 3B1UA 4QXUL 3RPIA 3ZUNC 3WTSA 1A4JB 3Q5YA 3KPSA 1KGIA 2OSYA 1JZ3A 1D6VL 5MI0C 2ZTBA 3RL2A 3T71A 1OZTG 3DRQA 5DYOB 4JUSA 2Y7LA 3HJ0A 5EIVA 1O6TA 4TNGA 4OJEH 5JDJA 3DX9B 5GGQH 4DFHA 3LZFL 1EEYB 1OPGH 3G3LA 2XFXA 2R4RH 1CXIA 3QXAA 1TJHL 3N42B 2CDFB 4LLUA 4AIOA 2CPCA 4LDLB 1QNZH 3LMJL 5F2FA 2WGXA 1V5JA 2B77A 2XX0A 2R4SH 2OXHA 1J05A 3D52A 4BHUI 3RZCB 3MOBL 4MA8H 1IGYA 1JNLH 3GBNL 5AW3B 2BVTA 3UBXB 1QUNB 4JQXA 2FHBA 5D2LF 2OW7A 1A3LH 3P54A 3ARED 1KXHA 2H2PC 5IKCA 2YRPA 5CMAA 3UO1H 4G71B 3IU3B 35C8H 2CKBB 3ILQC 3MBXL 4KRPB 3WD5H 4HOWA 2XIDA 3HR5B 5D1ZC 2XN9B 4ELMF 2Q10A 5CWSB 1I9EA 2X5PA 4A66A 1OAQL 3PWJA 2D7MA 2PO6C 3ARUA 1R6VA 4NP9A 2EE2A 5CZRA 1WZMA 3M88A 2PWEA 3FQTA 5EC1A 4YSSA 1BHGA 5FB8B 4Y4HB 3TASA 4XC1L 3V4PA 1N8ZB 4QHKJ 3LZQA 3QFDB 4NZTL 1HN1A 5BMFH 2DWDB 4NM8H 1NDGB 3JTSB 1U6AH 2FBRA 3CFNA 3V6OC 2JKSA 3FTGA 2RMNA 3FU8A 1EJFA 5JHDE 1HVXA 1EERB 1MY5A 4X9YA 4QJ3B 1BZ9B 1IFRA 1ZSHA 3G5ZB 4XOBA 1BQKA 4CGTA 5HJ3B 4PEEA 3X1BA 1KYDA 2M8XA 2O26U 4EF3A 1O9VA 4MVBD 4FTVE 2PYED 4XPFH 1B6DA 3WS6C 5CAYB 2YWZA 1ROWA 5D7JB 1AZVA 3IMVA 4GKZA 1MFDL 4UINH 4BK5A 4C56B 1G6RL 3L6FA 4U6HA 5DJDA 3U30B 2DI9A 4J4PD 4QRUB 1OAXH 4MMZC 2R7EB 2ROXA 4UV4H 3QWRA 1X4YA 5I1IL 1MCKA 4WU5A 3KYNA 1BV8A 2K4WA 2V3FA 3AAZB 3FC8A 2J6WA 3MV7D 3OAUL 2PYFA 4Y4KA 4RA0C 3UTQB 2ZCLH 2DY2A 3QRGH 4HSAC 3GO1L 3QQ9C 2C3XA 2QLVB 2YD9A 3FAWA 4PG2A 4QPEA 4XP9L 3L13A 3MC0A 4ZPVA 1KZYA 1BD2D 3VSUA 2EDWA 2CCVA 4F7MB 1QSFB 3QQ4A 4O5LL 3N50A 4KBPA 2VGLM 4OLXL 5EO9A 5FO7A 1H5BC 5EBWB 3RDJA 4C83A 1NGWA 4A7UA 4H2CA 1T1ZA 2XXCB 1CU4L 1DTUA 1LK3H 4QDGA 4Z7VE 3VXSB 4M4RB 5I5RA 3KGRA 3FUNA 4RWHA 2F58L 5T1KA 4D8OA 5E8OA 4HEPG 2VLKE 5E8PA 6CGTA 5CU9A 5H94B 1PYWA 3PIQB 2OL3L 5CSZA 5D70H 2VQTA 4HCFA 2GTZB 3QI9B 2FJUB 1Q9OA 4DUVA 2AXFA 1EEZA 3UACA 3O2WL 1H15B 3PGFH 5LAXA 4Y9CA 1M7IA 1JPGA 2F8IA 1XXDC 4H1LA 4GIOA 3N06B 1UZ6F 3NRQA 4OT1L 4KRMB 4CC1A 4PBWD 5E6UB 3FCUB 1R5WB 3B3IA 1DQJB 1CE1H 2VITB 1TQBB 3MRCA 3IVKB 5L2JA 1FNHA 3FB7B 1IKNA 4HH9A 4Y1AE 3KVQA 2UXGA 5IQNA 5GXBB 3EO0A 3PJNA 4G8FB 1JHTB 4G42A 3O41B 5D8JL 1AQHA 1Q1JH 3RTQD 2EE6A 3N9GH 4WK4B 4K0OA 3MRGB 1ZSDA 4W4OC 3OB8A 5D96C 5JHDA 1IGIL 1MFBH 3BH9B 4HUWB 3JBG7 3X14A 4ZAKD 4XZUB 4AKOA 4XOAA 2ETWA 2ZF9A 3CHQA 1BVNP 1VZIA 4HG4J 5EUOE 4HGWB 4L8SA 1RUAH 7PAZA 2SEBB 4XH2B 3RX5A 2BC4B 1JD7A 2B1HL 4P2CG 1FZJA 3H3PL 4FTVA 5HDLA 3QSKB 3MLZH 1ZGLB 4DP9X 3MRLB 1XBRA 2HLAB 3BYTA 3QARA 4DN4L 4GMTH 4LAQL 1MCLA 5JOFA 4JS7A 2F9BT 1NCWH 3NFSH 3D3VE 1DFBH 4X5WA 1CCZA 4AJ0A 2YC1B 3ABLB 4JGUA 4R4FH 1KN2L 4YIQA 2Y7SA 2UY6A 2X2HA 3DMMC 3JVFC 3ORJA 3KLSA 1NCIA 4TVPD 4HJTA 1XCQB 3QQDB 4N1EA 3TVMD 1CJYA 2I9LB 1T0OA 2Y3AA 4YHOH 4NYLA 4BFGA 2ZOLB 2QQLH 1KDIA 2YR3A 4CDGC 1Q9KB 4PM1A 1BEYH 1FH5L 2RALA 3BWZA 3D85B 4F24A 4LEBA 3NCBB 1OSZA 1KCKA 2Q86A 3H56A 4DKTA 3Q6FA 1U8KA 5DQJA 4JFFD 1DCLA 4YFLI 4Z7VA 2VLJA 1KGCE 4MA1B 3E80A 4EN3D 4FYRA 4PYHA 1EIBA 1JE6A 2VLKA 4P4KA 3JQOB 5FM5M 1O7DE 1PTZA 3QJHB 2RIKA 1YEHH 4LU5L 3RVXC 3LPPA 1BGXH 1HHHA 5TFSL 5FYKL 2BRRH 2C7UA 4NQEB 1ND0A 2VLRE 5IBTL 2AAVA 1BZ7A 2BFGA 2KZWA 3BE1H 3ARPA 5IQ9A 5F3HA 4XNZC 1RURH 2NNFA 1VF5C 5DTFB 1UM5H 1QTYT 3ARFC 3V4PL 2J1XA 1S5HA 4MDIB 2IGFH 1EVTC 1EFXA 1EFQA 3TO4B 3S35L 4WHCA 3VUAA 2BIHA 2JXMA 3SPIA 4ZTOL 4KY2A 1RY7B 3HCVA 3CK0L 3LEXB 3V4LA 2LE9A 2AKRB 4PW9A 2IDUA 2YPVL 2VM9A 1MHEB 4QTFA 4C58B 3FN0H 4OVVA 5DC4B 4M6NH 3CZFA 1BSIA 3B1TA 5EUOA 1WYJA 4DP2X 5EZJB 1KLFB 1OTSC 2QZ5A 2AQ3A 3FMGH 3POHA 2DWEA 4H40A 4AQAB 1EAPB 4YX2H 4M5YH 5I8EB 2R1XB 4WSGA 2J21A 4KKLC 4UYPA 2R2EA 5JW3L 4X0KB 2ATAA 1Q72L 4Y2DD 4TN9A 4U1HA 3E3QC 4XP4H 3EHBD 1GS8A 3MUJA 3D3VA 3DX4A 4QRSB 1OAUH 4XBMA 5FXCH 3SJVD 4PJ9D 3GSUB 5BRZA 3PWVB 4JKNA 4P2AA 2E6QA 2HFEB 5TF1H 4YEFA 4Z7OE 1U2HA 1GGUA 3WIIH 2FEEI 4XBEL 1QG3A 1QR4A 4M5ZH 2DM3A 2M26A 2G2RB 4U1IB 1FVEB 4XP5L 4Z0XB 43C9A 2IH3A 3BPLB 1FQ9C 2NTSP 3DIVA 4L1SA 1UGNA 4PJIF 3V8OA 2NLJA 3KCPB 3ELQA 4QRRB 1JGVH 2ED9A 4JFQB 2CMRL 2WBWB 4FFYH 5E9DE 3S35X 3U4BH 3P4NB 5FO8B 3DO3A 3JZYA 2GTQA 4G80A 4R90H 5MERB 2ISDA 3TBCA 1I8KA 4EDXA 5GS2H 4WKZA 2AEQL 3NJXA 4KOBA 5DJ0A 4F15C 1S9WB 2HN7A 3LZLA 3ETBF 1JWMA 1DHKA 5C7XH 1ACCA 1CGVA 5E6ZA 2AJYH 2HYMA 3OMIB 4UIKL 4FG2A 2VLRA 2R0KL 4CKVX 1K5WA 2V5SA 5EEZA 3FFOA 1MIML 2AJUH 1RAMA 1T1XB 2X41A 5TDPA 5ICZB 2BNQE 1DCEA 4OI9A 4E5XB 1SOXA 3IAGC 1CLOL 1HH9A 2NNAA 2AAAA 1FFNA 3PWPE 2WIIA 3NFNB 3T0ED 3A67H 5DMYA 4G1MA 3GMMA 3C60B 3O2VL 1XX9C 1ZJAA 1ZXQA 3SHSA 3BAIA 3MVSA 2H4EA 4HWEH 1HE8A 1IILE 4E42B 1AQMA 2B3IA 4HIXL 1MWAH 3MREB 2H32A 4MAUL 5D93C 4QAWA 1JK8B 4J8RB 4EEEA 3BSZH 4JFUA 2DMHA 4W81A 1ZLDA 5D7SH 1N4XL 5DJYA 1KPUB 1IZJA 3OG6B 3ARDB 3JWNE 3ZDXF 3GXDA 1U92B 1PKQA 4DW2L 3KJ4B 4D0CA 2YFOA 3OLIA 4LOVA 2L7QA 1DFXA 4Q6YA 2VIRB 2EYTA 3WMQA 1XT5A 4AI7A 3BPNB 4ZS6C 5IR1A 1I82A 4H8VA 4X2UA 1N10A 1WT5C 1CL7L 1RFDH 4M1GH 1A0QL 2G60H 4CU8A 1RU9L 1T3FA 1IKFL 4FXGB 1OHZA 4YHKL 4YK4B 2VE6A 1XH3A 1NAMH 1YC8A 1N2RA 4Z3JA 1CXHA 2CO6B 2AEPH 3DOHA 4JM2B 5E94B 4ANUA 1CG9A 5FKPB 5C1MB 1Q4NX 3LY6A 1H6TA 5FYKD 4D9RE 1XGYH 4H13C 5K5YA 4APXB 3WY1A 2DBLL 4LCCB 4S1DC 3UBXI 4I5BA 3TESA 2BSTA 3VWKD 3P4OB 2N1TE 1NGQH 1T21A 1WS7A 2VW7A 5EO0B 1CC3A 5HVHB 4LBEB 3D0AA 1MSPA 2WXMA 3EYFA 1MLCA 4U1GC 4DESA 1CT8B 3WEXA 5E9DA 5DEZA 3B5HA 3RFZC 4F1ZA 5FHAL 2AK4D 2C9UA 5E95B 5HDBB 2HFTA 2JK5B 1I1AC 4F7PB 1VESA 1CF8L 1YEFL 5I6XB 4XMPH 3L1GA 4P23A 3BCDA 2MIZA 4N9GB 1F58H 1ZHKA 2YD2A 4NKMA 3VGGA 1CUOA 2IMMA 4P2OB 5EZOL 3JWDL 1R47A 1U8CB 3W11C 2O6DA 4PJ8B 4YHNA 5EZLA 1P9MC 4B5EA 2BNQA 2IH1B 4D0BB 5AG9A 2NT1A 4L1HA 4NC1E 2FJSA 3EJYD 2VDMH 4MAYB 4PH8A 3N04A 2VMEA 3VD0A 3FTYA 2CHZA 1WBZB 3NDZE 3PWPA 4YHML 2F8XC 5F1NA 2HX9A 4ZNEE 2FUQA 3IJ9A 3DROA 4FQQB 4J3VA 1MQ8A 1UFUA 2MSPA 5DHMC 5AUMA 4ZMXA 1YDPA 5K69A 1UWXK 1MCRA 3ARBC 3QFJD 3IF1A 4XCCH 4QF1B 4BFBD 4X4XB 1A6AB 1RERA 3O4OB 5DYFA 2O72A 4HF5L 2W9EH 4LKXA 5K39B 3ABZA 4LRIA 1NBVH 2E5EA 4WW2F 3OJDA 3OD3A 3GLDA 1GGBH 5D2LB 4M6AA 4H20H 1JXDA 1EWHA 3VFUA 2C1OA 1U8QB 5J1SC 5JHLH 1AIFB 3NABL 3HOGA 2EDXA 4ELMB 1HZKA 3T5WA 1ZANH 5E4IA 3OM3B 3C5ZD 2OJ1A 2PR4L 3PUCA 1NIBA 1H9VA 4PR5A 2PXYD 4WTZG 5A16B 2XQBL 4HKBA 4CA4A 4X4ME 1E9PA 1AJ7H 4RNRA 3IBEA 3SN6N 2FO4A 5LGHL 1JI1A 1MHHB 2VZSA 4F9LC 3PXJA 2NY3D 1E90A 3MTXA 3KH4A 4G43A 3L3IA 3K1DA 1S7UA 4AENB 2FHFA 1IC7L 1B4LA 1HXKA 1PZCA 4GBXB 4P57B 3VWJB 3LKSA 4AQ1B 3W5NA 1U8PB 1D9KA 2JKIS 3LH2H 5I1AA 1QVOB 2YAEA 2QHRH 1BZQK 4KJPD 1JIBA 4JE0A 4WU7A 4XPGH 4TMPA 4A39A 3ZKXB 1J86A 3UCRA 1XF1A 3BH8B 4R97C 1T6WA 2IDSA 4WI0A 5DC0A 4NBZB 1SEQL 2BHFA 1UWXH 2QPDB 3AMKA 5CCKL 4F80A 4XNQA 3SQOH 1SHWA 3AG4B 1BVNT 3DJ9A 1O9WA 5ISZE 3IAPA 1X5KA 4F33B 1CPUA 1IU1A 1P1ZA 2ZXAA 3O11B 1A7QH 4ONOA 3TNNB 3PF2A 2BSED 1BXVA 3J2PA 7FABH 3LDBB 3GBDA 3OKOA 3ROOB 3ULUE 1I8MA 3MFGB 1BBJA 4KNSA 3T2NL 5C0ND 4IDJH 1NFIB 2GUYA 2XU9A 2YPLB 1NICA 2YXWA 3PV6A 4Z95H 4YR6B 3UXFA 4HS8L 4UV7L 4ZNEA 2BZDA 4ODXB 1RVFL 1E5YA 1PY4A 4X9IA 1NKGA 2A0LD 1AGDB 3BO8B 2NUTB 1PF3A 3C2AH 4GINA 5B7EA 4FABH 2IFFH 4QR7A 4BK8A 4L3EB 2Y7NA 5C0GB 3C6EA 1MW1A 4YUEL 3IDYC 1I8IA 2AV7B 2J2ZB 1PNDA 3I9GL 4WUUD 1BVLA 4QRTB 4MNGE 4XC3L 2F2HA 3AGWA 5DMGD 2FH6A 4Y1SA 1D5MA 2Y6SC 2Y4SA 2J8UF 1HWHB 3GJEA 4J39A 3B9VA 2PP8A 1DR9A 4AC2A 1HCYA 3KNBA 3VD9A 3VI3E 3MMEB 4N26A 1T03L 4J3WA 1CDIA 2UX6A 2ENQA 2P8LA 2C9PA 1QEWA 5DR5H 3RY6A 2K6YA 4MYWB 2Y1AA 1KB5A 3I84A 5DD3H 4Z7NE 4G9FB 5EORH 4JMXA 2A1WH 1JP5A 3EOAA 1GGYA 1QSED 3QJSB 2HJKB 3MV9B 4ODWB 1TNNA 4X4MA 5A6MA 4O2EB 4MJ2A 3BVDB 2DM2A 2J3SA 1ZPUA 3UBXG 2V7HA 5CJOL 5CBEA 2OULB 3M7OA 1CD1B 1LEGB 2DL2A 2Y69B 1V05A 3SKMA 3RJDA 3VE0B 3N41F 4S2SB 1U42A 2AZUA 3TBYB 3L4WA 3ASWA 3MO1A 4R84A 1QAWA 2NMSA 2X88A 1DN0A 3R1GL 1T0MB 5F1SA 1N5YL 3TF7C 3H85A 1DO6A 3VXME 3FU7B 4IOIB 5CINH 2CO2A 2E27H 3QO1A 5GISL 4MCYA 4YXLL 1ZA6B 2J4WL 4ZD3H 1MH5B 3C8DA 2OPCA 3KM2A 5KZCD 1P6AB 1OAZH 4G6AD 4KDVA 1D2PA 1KTDA 4FYTA 4JQXC 4JRYE 4Q0XH 1OSEA 3EYUL 4LSRH 5ISZA 3STLA 1WLHA 1MHPH 4IOSA 1BIHA 2EC8A 4LHQB 2R29L 1K8DB 3CIQA 2F1EA 1PX4A 1NOLA 6FABL 4IQHA 2C26A 4ONHB 3RILA 3T2OA 5IJCC 2WWMD 4FI7A 2A9NL 1M1XB 3L4TA 3S96A 2A6KB 4KKRA 5E2UL 2GSMB 4M6OL 1AD9A 2EDJA 3C8HA 4MBRA 3ZKND 1UUNA 5TDNA 1TQBC 4ZUSB 5DHVB 3RHWF 3T3PF 2P26A 1WICA 2W07B 3VQ1C 4AC4A 1A7RL 1AS8A 3Q8CA 1CFQB 4N2OA 2Z92A 1WEJH 4PLKC 2DI8A 5TQ2H 4AKQA 2BY2A 1BJ8A 1T66D 3ECBA 3U0WH 5ACZB 2C4XA 1P53A 4MNGA 2F5AH 2IQ9H 4RDBA 1MAML 3SD5A 1YEIL 2NNCA 4UQEA 2XWRA 1Q0XH 5JNYA 5HHME 3QAZC 5C6TH 3VI3A 1SN2A 4QHMA 3E9TA 4OFQA 4JG5A 3IJSB 2F1AA 5GRXG 3PWNB 1PLBA 1KBGH 3WKML 4JJ5B 4MXWH 1TJIH 1VFOA 3KJ6L 1SJXA 1F11A 3QWOA 5T3XE 2IALA 1MCJA 4B6ZA 4LNVA 3TOPA 2XVGA 1AO7B 1M3JA 4W9LC 4WDIA 1NL0L 5M95B 2ITCA 5KYYA 2BY3A 3EUUA 4Y4KC 1ED3B 2WWKO 4LDEB 2G5BB 4FI6A 1INQB 4GW1B 1WTGT 3QJUB 3MPCA 1KWKA 4JFHD 1HI6A 3MRBB 3VXMA 4FA7B 1P7QA 4BD4A 1R5IA 2ZWYA 1F1DA 2WLYA 3C09B 3RIFF 3LRMA 4BE6A 3PU7A 3K72A 3RGBA 4BGLA 2X4TB 5IM7A 3TN0A 3NGBB 4M61B 3WFEL 1HXYB 5D7IE 1CK0L 1W72H 4WJG3 2WOBA 2YD3A 4JRYA 1I3UA 1A66A 4QXGH 1T22B 1NZRA 3QUMA 3FFCB 4DP7X 3VGHA 1QHQA 4OFDA 4KKPA 2GK0B 4YHYB 3WNOA 3EH4B 3QC6X 4MDJA 4BFKA 5F97E 4LEOA 2GG1A 1YY8A 4K2UH 3NYKA 1RPKA 3DOSB 3H42H 4YDKL 3MBWA 3QCUH 1IEBB 3D0LB 1EO7A 2BIIA 2BOCA 3ABKB 1E8XA 1P6FA 3P2TA 4GI9A 3S8FB 1TR7A 3DPBA 4RX4A 1C1EL 4EBQH 3PNRB 5I1DB 1N0LB 2BSDA 3QUKA 4PJIB 5K59F 3IFPB 3DUSB 1IKNC 5GGTH 3ZK0A 2IAMB 4KO5A 5HVFB 5DHXB 5LCVL 3FQWB 1PZ5A 4YLBA 3VB8A 4GRMA 5BQDA 3KDMA 3B2MA 1W0VA 3L7FA 4QHNA 4LESA 5KW9H 3FF7A 4CJ0A 4JFOB 4EDWL 3H0TA 3QDMD 2VC2L 2B0SH 1KB5L 3AG1B 2ZX8A 4EUPB 1G87A 2FGWL 4L0ZA 4IRJA 1Q9LB 1JRHH 3LD8B 4P3CL 5BUPA 1BM3L 4OGQC 3GXUB 1FIGH 4PHZA 1JWSB 4GQPH 1G7JA 5IHUL 5HGAB 1AOHA 4Y5VB 4D9QD 4TKWA 1R3HA 1VFAA 1ONQA 2VRAA 3BZEA 4PRNA 3EJSA 4HT1L 5FHBL 5DRZB 4P2RE 4HOXA 4OI8A 4BQBA 3NH7H 4RBPK 5LHDA 4U0QB 3MROA 2G2NA 4B0MM 4WCYH 4YSOA 1V3MA 4TTDD 4JKWA 2CCLA 2QQKH 3GXNA 4PVMA 1SBSL 1PJ9A 3KWXA 3OKDB 3NJHA 1X7QA 1RHHB 1YQ2A 5F0JB 5FFLA 5L88L 2X6MA 4PRIB 3LKNB 3L9RB 4K4KA 1ACZA 4JFDB 2J1YA 1OM3H 2EIEA 2L04A 3ZDXB 1DE4A 1A3RL 4G3YL 1FVCA 1RJLB 3FO0H 4LVNB 5D7IA 5I2IA 5IUSA 1J8SA 1KJVA 2V4LA 4R96A 4TOYH 3HE7B 4JK0D 2EIMB 4UT7H 2DQJH 2Z8WC 1F3RB 3EJJX 5EU5A 4N6RB 4NFCA 1SOQA 3U7AA 4A2DA 4KK9C 3WTWA 1V7NH 3G5VB 4LP4A 5IBLC 3B34A 3MRJA 5DDHA 5I23A 1B4TA 2ZYSA 2AQSA 4JZOA 1ECYA 1YHPA 3KPRE 4U1SA 3L4XA 4YBQC 3I9PA 4TLSA 3FT0A 3H9SE 2O5NA 2NQCA 1RP9A 4J3OG 1A6WH 4K23L 5AKSA 3JWDC 3WL9A 3MUY1 1X6NA 4M56A 1SMDA 4N28A 4P5TA 5DMKA 5DD5L 2MRYA 2CUMA 2R0LH 4NUGH 3PQYE 2G30A 1D3CA 1CDYA 5FM4A 1K9TA 4UNVA 4DJMA 4G8EB 2FR4B 3WCYA 3RVUD 4E9VA 3A4EA 5JIIA 1HHIA 1VIWA 2FJGA 4FMFA 4JDVB 4E9YA 2EXSA 3L4CA 3OGOE 2HFGH 1SNRA 1G4RA 1WFJA 3R06A 4M8QA 4RBPH 2QBWA 4OM1L 4LSUL 5SWQB 3D07A 3PLYA 4G72B 3QQXA 2ZYHA 4M3JA 5H4YA 3GBLA 4OJCA 5MEND 3ASOB 2F19H 1KFAL 3WE6A 1U3NA 4GW5B 3HZYA 3NEEA 2K1MA 2BO0A 2VJ8A 3AU1B 5E7BA 2JCCB 4CVXB 1RPUA 2XPGA 2QPEB 5SX5K 4NUJA 4RGNC 3BGMA 2AV1A 1AQKL 4P2RA 3ZSSA 1J0IA 1N6QH 5DA0B 1R46A 4OVUA 1MVFA 2OTPA 2FT8A 5FPIA 4FFTA 3BVVA 1O6SA 3FSAA 2F53B 2YEZB 2L3BA 3JT0A 4NCC1 4XVJL 4G7SB 4N4YB 3O9WB 4FFVC 4BFNA 2RCSH 4WW2B 5DD0H 1MEXH 2OKMA 4Y2OA 2NYZA 5ANMB 2PETA 1THAA 5E1AA 1MCNA 1RIUH 2WXRA 4E5XG 3QUML 1C9SA 2XTJE 4R0LB 4TPRH 1V10A 1KJ2A 4UM9D 3TYGL 3S3CB 1TQUA 4N3TA 4F2ME 4X9HA 1PY9A 3RNQA 4ANVA 1XGTA 2M83A 3E1ZA 1L9TA 3HJEA 4QMEA 1O7DC 3Q8AA 5DHDA 2Q6WA 3HG2A 2ZUUA 4HBCL 4LRNL 2YD7A 3IFLH 3SKOA 3KPRA 5E99L 2Z31C 3M7FB 1EQWA 1L9QA 1QBLL 3PXHA 2XACC 2QVMA 3IXAB 3FJTA 3PCYA 1QLEH 2YXVA 4NHUB 3H9SA 1BECA 4K3EL 2NCMA 3F62A 2R69A 1MRCH 4L8BB 1XF5B 4LCIL 3CHRA 1NSNL 3KR3L 3OXSB 2EYSB 3HMXH 4WLCA 4N24A 1UACH 5IVXF 3PQYA 4FNUA 1YNKL 4LPXA 2WV3A 2ZNXA 3TJEL 5AW8B 1RZGB 2YRZA 1GPOH 4OLUL 3A0OA 4FNLH 5DHYA 4EIUA 5FECB 4GI8A 4NT6B 4NWTH 3UO8B 1BFVH 5SX5H 3EW3B 4LE8A 4OFIA 2X4RA 1V3KA 5MEOA 1XD1A 2K8QA 1CS6A 3NK3A 5F3BA 4R7DA 2BJML 3W9DB 1GHFH 4HXAH 1ANUA 5ENWB 4PP2A 5IHHA 5FUZH 4R2GD 3B2PA 5GRVK 3MXWL 4ELDA 4A2EA 4OV5B 5SWSE 1ZHNB 4BXVA 1B0RA 1JGLH 3BKYL 4ODBD 3WY4A 4HK0B 1BOYA 5BVJA 5GHWL 2HRPH 5C0DA 1DVXA 3WJMB 2KBGA 3KPPA 3HMWH 3AZUA 5EN2A 3SBWA 1GKOA 4MCNA 5KSUB 4XNXL 4IGBD 4Z7WF 2A74A 2G3MA 5B1CA 3CUPB 4PJBF 4K7FA 4W6YB 4X6FA 3S4SA 1OOAA 4UTAA 3KWWA 2P48B 2YEVB 1BDYA 5DI8A 1DLHB 1A6TB 4XWGL 5AAMC 4FKHA 4M8RA 5K1JA 3RL1A 5AENA 5JZ7D 1GTNA 3RI5K 1OGAD 2I5YH 1ZXKA 4KK5C 2H26B 5CGMA 1J9RA 3D4YA 4K8RL 5JXAL 2PPDA 4PREB 4X80H 2HTLD 4JB9H 4NS0A 4XCYA 2J8UB 4WNQB 1HKLL 5B38A 4F2MA 1RUPH 2VXQA 4WGVB 3H1ZA 4MB5A 3RX7A 5C0RL 3GF8A 1IC1A 1CGSL 1CO1A 3KL3A 2ZXGA 4OJFH 3E6FA 2VDLB 5LXGH 1XIWD 4PWIA 3ZYZA 5C3IA 2HJLB 3RWCA 1A4BA 3L4ZA 3NSYA 4WZ9A 5IVZA 3VFRA 2A77H 1I7ZA 3UTPD 4RMQA 4PRPD 1QUPA 2DQEH 2FL5B 3QG7L 3EG9A 4N2GA 3H4HA 1NIFA 5DRNA 5LWYL 3BVNB 3N41B 3FUMA 3ULSB 4N22A 4MRBA 4I3SH 2XTLA 2IPTL 3FT4B 2NR6D 1FYTD 2JIXD 1N3NB 2OMYA 3C08L 4C4KO 4DVRL 2LR4A 3HLAA 2OV0A 2GSGA 3QJFB 5CXPA 3VFWA 1FNLA 5CCGE 1EO8H 1JGUH 4JKMA 1CR9L 4XVTL 4Q4IA 3QUYD 3D50A 4GFXA 4KKCD 1KJMA 3DXAE 4MZ2A 4OCRL 4UAOB 4PRDA 3UAAA 2KERA 3GNMH 4LRIC 4N2IA 4AMKL 3QULA 5AZEH 2XQYG 4WHYH 2EDKA 4X8JB 3FQUA 5SWSA 3G5YB 2QQNH 3S37H 4AM0Q 3DHUA 2FATL 4A7GA 4QGYA 5KS9E 4HEME 2NYYD 4LQ1A 4I18B 5BOZG 5I5JA 3UC0L 2XZQH 3PABB 3QDJD 1L0PA 1NMAL 4P4RA 5FUOL 1N9PA 1HIMH 2BVEA 1IT9L 1HKFA 1GYAA 3C5JA 1DUZB 2VDQB 3D2UA 4GG8B 1LEKA 4HWBL 4YDIL 3D9AH 3P02A 2FB4H 3T3PB 3LNEA 1NGYB 2UV3A 4QHUA 1XSOA 5MEPA 5E4AA 2GITB 2EUWA 1K5NA 2R0ZH 2Z35A 3CFTA 4FFZA 2ZD0A 2HLEB 3HPLB 4H5SA 4L9LB 4PJHE 4XO9A 3TA3B 4D0DB 3WBDA 2NDFA 1CYWA 4IRSC 1KJ2L 3DWTA 5IQLA 1ZCRA 3UGXA 1OQOA 3D39E 1REIA 2J57A 5C8JB 1J87A 4ZZKA 1GGCL 3QWQB 2P9RA 3MV7B 3OJVC 4RGOH 1FNAA 5FAAA 4LKCA 1U3ZA 1I7TB 2VKWA 1HNGA 3GKZA 3OHXB 5CZVL 2WBJA 2K9FB 3VDCA 2B39A 2DYRB 2H0JA 1NCTA 2BSRB 1E4XI 4UB0H 2GJ6D 4XHQA 4PSPA 5ALBH 2R69L 5DT1L 5FUCE 3K5SA 2J73A 4FOMA 2HWZH 2ZX5A 3IMSA 3KD4A 3D4ZA 1Q9WB 1A1MB 2NXYB 3E9UA 4KDWA 4MRCA 1KYAA 3CFJB 4QRQB 4Z7VF 2EE3A 3MCLL 5CZXC 3G08A 2FYYB 1IJNA 1A7OH 1U8MA 1KIUB 4RETB 1XDTT 3GB7A 2RTTA 1IBGL 4XX1E 3DXAA 5IB3B 3FFDB 3BOVA 3MBEB 4I77H 1WK0A 3QIUA 4U7MA 5DQDH 1F4XH 2QKIB 4JVPA 3JUYA 4EVNA 4GT7A 1TMCB 4KTEH 5D2NB 2G9HB 1A6VH 3VMPA 1IQDB 1XTLA 4HIEA 1M2VB 3OBAA 3P30L 3PPSA 2EIJB 1VA9A 3BEVA 4UDTB 5BJTB 4JQIH 2XXFA 5KS9A 2G75A 4HEMA 4LSSH 5LNDA 2GIXA 1R4XA 3RTQB 1CE6B 4LPTA 2P80D 5T1LB 2A7BA 4OCYH 1XGRB 3ZBMA 2XA3A 4ERSL 2IOMA 2VDOH 1LLAA 1OZUA 1EEUA 4ZODA 2I9TA 4S1RH 2Q3XA 4CL7A 3BIAX 2PCPB 4AJYV 2WXHA 5GSRA 1JYWA 5DLML 3TPKA 3CH8A 2XQ0A 5EUOF 2ADFH 1JOIA 2IBGA 3DX6B 2P5WD 3VMOA 3IDJB 5EN3A 3WNNA 1AYOA 1U93B 4FHKA 4PJHA 2ZUQC 4QTHB 4BFRA 4U1MA 4GSDL 5ANHA 2ZG1A 4KI5E 4OKVB 4PB0L 5TQ0H 4UOZA 2EXYD 4UM8B 1IGTA 4NZ8A 1ORQA 4X9FA 5JLZA 5DJ2B 5TE4L 2VXQL 3A6BH 3D39A 1DUYA 4QXTB 3HRZA 3BLBA 1QW9A 3NCJH 1KG0B 4J27A 2OYLA 3TZVC 1KEMH 1A1NB 3BUPA 4FJ6A 2FX8L 5GRWA 2VH5H 5CUSH 4ADIA 1SUJA 3TVMB 3GMPB 4XI5D 5HGBA 5GRZA 3B4NA 3MUGA 3QIWD 4HIQA 2R56L 3CFDA 4AMXA 1G7IA 3EF7A 1C08A 3DRTA 2Q87A 2NY0B 3CXHJ 4NFDA 3Q8EA 3GUTB 2AJSH 4MLIA 3TIEB 5BV7H 4OJDH 4OGYL 3ULUC 4JFFB 3UAJD 2QV4A 2O5ZH 2OJEB 4G5ZH 5GGRB 4LSTH 4ADGA 1KNOA 4QKXB 5IGXH 5E6ID 2N59A 2L7JA 4Y19E 4EN3B 1SYSB 2GTWB 3EGDA 1LO2L 1FGVH 1A8JH 3VXTB 4JG1H 3HVNA 4W68A 1GVIA 2QT6A 3DBXA 2OMUA 3NJIA 1CVRA 4TNEA 1WA0X 1D5BA 4LEXL 3SYAA 4KUCD 2A38A 4WWOA 1NM9A 4XO4A 1NCDL 2VQUA 4LLMA 2VW6A 3IJ8A 3O81A 4WV1B 5JPNB 3EYQC 4AT6B 1D5RA 1G6RB 3DC0A 1KDJA 3DJTA 3JV0A 3T0BA 1XMEB 1OPOA 4B9IA 3SO5A 1FIEA 1MCIA 1HL8A 4I48A 3CSGA 2LU4A 1RSYA 4A2GA 2ITFA 1RUKH 5E08H 3NTCL 5ACLA 5EA0L 2P28B 1NCCL 1KGXA 3LZOA 4TUKH 4K94L 5IHWA 1KYFA 3TT1H 1A2YA 2NSXA 4LEEA 5I1JL 4XN2A 4NGHL 3P0GB 2ZT9C 4Y0GA 5CFHA 1LE5B 2WVTA 1XF4B 3KL0A 5FYJU 5FK9A 4AV5A 3WAKA 2E46A 4HFUH 2EDRA 3BZFB 4AYBA 2F7RA 2XCMC 1RZ7L 3V0JA 3SJVB 4HUXB 1OPGL 1ZDSA 4A2MA 2X1XR 4M1CC 2K6ZA 2OL3B 4PJEE 1IBYA 4Y9GA 1QNZL 3KVPA 3CE1A 3GMQB 4KXBA 2GJPA 4KJWC 3VRLE 1I7RB 1PEZA 43CAB 2FDBP 1V3JA 1CGYA 3ML8A 4MA8L 4AG4L 1DSFH 1JNLL 2H0EA 3PJSB 2DQDH 5CSBA 4KK6D 3DDGA 1KENH 1A3LL 2WLLA 1IGCH 3CTTA 5BS0E 2R23B 2UY7A 35C8L 3GEWB 4DPRA 4N2CA 3MLWH 2A9ML 5C3LD 3BUTA 1PLCA 4XBGB 1I8UA 2NY2B 4Y19A 4YZFE 2B16A 2BNUA 3HR6A 1VCBC 4EUPG 1DQDH 1JF1A 2H9GB 1MUJB 4KFMA 3ZL1A 3BP7A 2VLMD 4MHHI 2OK0L 5IREA 3AMLA 5T1MA 2LVCA 4LASH 5F72S 3RPIB 4YC2C 2W88A 3KPSB 3B2UC 5I5MA 4NN5B 5J11B 5BMFL 3NSFA 4M7ZC 3DRQB 1U6AL 2DLFH 3PWUB 4XNMB 5FOBA 3T0EB 4DQAA 2DQGL 2EC9T 1FORL 3RVWD 5IG7A 4MNQE 5D1QD 4GXVH 3JTTB 3QORD 4L9DA 3CVHH 4W9DC 4IRJC 3RVVD 1RIVH 4R8WL 3SDAD 5D1XE 1KYUA 4DK6A 1SN0A 1HEZA 1L0QA 4X8GA 4BH7A 4WO4D 4D94A 2IOIA 3QJOA 4Y4FC 3QHZL 4ABWA 1OGPA 1XL6A 1TCRA 3UBFA 4HUVB 3NFPB 1RZ8A 2EINB 4UINL 3FTVA 4FP8H 3IMTA 2CO4A 5IVXB 1JZ6A 3AU0A 3MA7A 3HB3D 3CH1B 3O0LA 3PHSA 3PREA 5IB4A 2HFFB 3P9MB 4FXLA 3V4VH 3IPEA 5SWZE 1XZ0A 1X7TA 2X10A 1SHSA 4OLYH 3C8KB 2YAHA 4TRPL 3PWJB 1T1YA 4PJEA 3AC0A 4PI0A 1P69B 5EV7A 1TZIB 2FEDD 3K2IA 3BVWA 3MLUH 3S5LB 2IWFA 3OLEA 4LF3B 2PTVA 4OF7A 4K8RC 4YDZA 1CFTA 1BVOA 4URTB 1OGTA 3LN5A 2E9WA 2OXGA 3V4PB 3BD3A 1U58B 1NKRA 2WVSA 2BNRA 4YHPA 1LK3L 2WXFA 4WW1B 4EN2A 4P5MA 2UVEA 5BS0A 3MOAL 4FFYA 3V5DA 4AK1A 4LP8A 3FTGB 3W9EA 4AEEA 3QIBA 2Y2WA 3LRKA 4Z7WB 1HSBB 3GLAA 3WN5B 3QZLA 1YSOA 4O4YH 1X5MA 4PJBB 2J12B 4M43L 2R1YA 1AG0A 2WHVA 4W9JC 2XFGB 3PGFL 3C6LD 1QSVA 4WFFE 4N5ED 4P5TC 3UG4A 4DAGH 4ZSOE 1R9FA 2XV2A 1F97A 1QBAA 2ZAIA 4GKZB 5A7BA 2GCYB 3Q05A 1A65A 1KIQB 1CE1L 2HT3C 5DJDB 4ENEC 1WS8A 4DO5A 3MRMB 3FB6A 4APQD 1Q1JL 3N9GL 3BT2L 4JZJB 4XX5A 4MJJA 4MNQA 1MFBL 3HKZA 4HV8B 5DJ8A 1IM3D 1MWAA 3QFJB 2FIKA 2B3RA 3BSZA 5D1XA 3VO0A 4Y5XB 2VN5A 4L8CA 4AUUA 2WWKT 4I85A 1YY9D 1BX2B 3QQ4B 2Z65C 1PL3A 1XR8A 3FN9A 2WLIA 1NGWB 3KHOA 4DKEL 4GMTL 1T1ZB 2VSKB 2XOTA 2BOBA 3SO3C 1NCWL 2EIZA 1AIZA 2ZCHH 2ZKYA 4WO0A 5E8OB 4F57L 3DYOA 5INCB 3RDTB 3T8MA 1PYWB 5FGSA 5SWZA 1T04B 1NAMA 1JV5A 2RR3A 3C5ZB 4UTBL 1SJVA 5A2JH 5LGJA 1FNSH 1Q9OB 2P7TA 3SQRA 1IB5A 4YHOL 5LAXB 3TBVA 2QQLL 7CGTA 4BSVA 1HDMA 1BEYL 1JNHA 5HDQH 4YDVB 4CMHC 4RAHA 2OP4L 2WTRA 3I6SA 3QO0A 3MRCB 2FO8A 2HX8A 2WKLA 4WFGD 5F7LB 5FO2A 3SODB 5L2JB 3UZQB 3Q9QA 1XCTA 4HH9B 1RUMH 1OOWA 3M46A 3HG5A 4HIJA 5GRUH 4PLOB 3APFA 4G42B 4IU2A 3V8CA 1OB1A 4QYAA 1PZUB 3Q1EA 4RRPG 5E1HB 2GIYA 2BINA 3A22A 1ZSDB 3FB5B 3PGCB 4B95C 4KTDH 1YEHL 5ID1A 1NEUA 1JDCA 3LIZH 5C71A 4JRFA 1AY1H 1AR1D 3AVEA 1JGEB 1S78D 4PIBA 3F00A 3GMNA 4L8SB 3RGHA 3U7WH 1NPUA 5KG9A 1X5GA 3CSYB 3AREC 2A9BA 3NIFF 3PL6B 4Z18A 1FZJB 4FTVB 4XAKD 4MHHG 4ZSOA 1D6EA 1H8OA 4OBRA 1RURL 2WQSA 1UM5L 4ZMQA 3L3JA 5IV2A 2ALWA 2IGFL 3FCGA 1CGWA 4NCC2 5CJXA 3BZ5A 1MHCA 4HIPA 4OLWH 5CEZH 4XOCA 5FA3A 1CLVA 5F93C 5LBSH 3VDAA 2ICEC 4YIQB 3NA9H 1WIUA 2B20A 2VDNL 4BFFA 3DVNA 1VACB 1I1FA 3AWFA 5H37H 1OO2A 2XWZA 3QWNA 2XYBA 3B7UX 1GR7A 4AVJA 3FN0L 5FM8A 3I2CH 1E65A 2B59A 1CWVA 2HAZA 4AITA 2I07A 1QZNA 4IHOA 4NYLB 5I1EH 4Q9RL 4G8GE 2EILB 1W8NA 4WUUB 1GGIH 3FMGL 4FHBD 4YX2L 2XWDA 1NCOA 2ZKHH 2DQ6A 4DPAX 3Q6FB 5TE7H 1U8KB 5DQJB 4H0GA 5KJ7E 4XP4L 2VLJB 3LKQA 5JHLA 1OAUL 2A74C 1K8IB 1LO3H 3QPKA 1ACXA 2VLKB 4IKJA 2YD0A 1O7VA 4N0FB 4P4KB 1FRGH 1UUSA 3KYAA 4LDCA 4P46A 5TF1L 1LNUB 2KI6A 1FL6A 4XNBA 1FL3B 4GRWF 3WIIL 5IP4A 4Z7NF 2C7UB 4M5ZL 3MRHA 3P2DA 5EU7C 4KMTL 3REWB 4YDNA 2VZVA 2D0FA 1ACYL 2Y7QA 5IQ9B 4FYSA 2OMTA 4N1CA 3KYKH 4OUUA 1SLWA 5FFGA 3TH2T 1JGVL 2XTJC 2FJFB 2AABL 3UBGA 1VADA 5F9WB 5JW4M 3UTTD 4NIKB 3WJJA 4A04A 1YMHB 3HCVB 5BO1H 4XPBH 2F1BA 1OT1A 3Q5OA 4DPBX 5A2CA 4EIGB 5KSBA 1BZEA 1T2QH 1E30A 3J8F7 4I0PB 1LO5A 3WUZA 4PGEB 1I8AA 2C3GA 2AJYL 5IEHA 5IW6A 4JDEA 4CVZA 5EUOB 4O02L 2BWDA 4L05A 3FOLA 3FN3A 4GS7C 2AJUL 1O9ZA 4J5VA 4Q14A 4ILDA 2CIIA 5E00B 3UERA 5L0QC 5JUEH 4PIRF 3BAJA 2WN2A 3QC5X 4UILL 1NAKH 2X05A 4AZ8B 5I8OH 1F18A 3F83A 3N1QC 2OQJA 3ATDA 3LQMA 5F71A 2B2XH 4XODA 3D3VB 5KUKA 2IDQA 1H3TA 2A4ZA 3IFNH 5BRZB 2APXA 1XB8A 4HIHB 4HWEL 3I50L 1MWAL 3L3GB 3V0GA 5E9AA 2ESVD 3H8NA 4CBZA 2AXGB 5D7SL 3GGWA 4ODHH 5FOJA 3EDJA 1A9BA 43C9B 5FDWA 5I66A 3DOIA 1VGEH 4XN4A 2B4CH 1AVAA 2I60H 2XBDA 3NZHH 4G8GA 3S7GA 1MIEH 5C0IA 3BISA 2YMOA 3CVCA 2X6VA 4S1QL 1E40A 2EJ1A 1JCKA 4ZAKC 2AANA 1MVYA 4G80B 2ALAA 1RFDL 3FQXA 4M1GL 1I8KB 2G60L 4WHTB 1FSKC 2BIOA 3DNKA 4NQSB 4WKZB 1NAML 3QE5A 2HSIA 2J43A 2HN7B 1ZOXA 2AEPL 3O3DA 4L37B 3NCFB 3SY0A 1TFPA 3NCYS 3ISWA 5MENE 1XGYL 4ZXBB 1HESA 3L1EA 1M71B 3JV4A 1Y0LA 1LO0H 3KXFE 2IV9A 3MRQA 1ZVYA 3CHXA 4U4IA 2Y22A 4OLEA 1NGQL 1TO5A 3VGAC 4K15A 4ZO9A 1A8ZA 5I15H 1NFAA 3KHQA 1NANI 3B5TA 4JY5H 3ALPA 4L1DA 4AW7A 1CFNB 4G1MB 3GMMB 1YCSA 1PIFA 5A2IH 2ICES 2X89D 3HE6A 1H3GA 4BSWA 2WBJC 5SX4I 4N85A 4PJCE 4DH2A 4TLTA 4BH8B 4Y8AA 4LNRB 2DB8A 1CQYA 4CSTA 2ZSVA 4B9FA 3MHZA 4MX7A 1NC4D 1PKQB 3MLVH 1M2OA 3LKPA 5D7IF 3C6SA 1CICD 4EN3C 2QR0B 2BVUA 5KYWA 2BHYA 5IR1B 3FCTB 2LGNA 3N1MC 4LSQL 4LARH 2VSDA 5EEXA 2ADIB 2KDYA 1T3FB 2EABA 3D34A 2N1KA 3CZNA 2JQMA 1T20A 3QIUC 3ECUA 5HHQB 4KROD 2YSSA 4UQ2A 2BSSB 2B1AL 1GGBL 5TPWL 4C57C 3TWCH 3ZE0F 4KQ3L 4QHLB 1ZGLM 4H20L 4QT5A 3TPUA 3F7LA 1BG9A 1DANU 5HI5C 5I8KH 1CYXA 3EYFB 3NQKA 2XHNA 4RDQF 3ARRA 3WEXB 3ZGIA 5B8CA 1DL7H 4DP6X 1R75A 5T3ZH 4ZW5A 3CPLA 1ZANL 1CFSB 4YLCA 1WCQA 12E8H 4JVUA 3W56A 5IK3A 4H25A 1QZ1A 4UQCA 5G55A 1E6JH 1PFOA 4QUOA 4FL4B 4Y2DC 3TYFB 4NKMB 1AJ7L 1CGXA 3ATBA 3EHBC 4NWUH 3W0WB 4FXKB 3KXFA 5I74B 1N59A 2X6AA 4PJ9C 1A6PA 4YHNB 3SDYH 1MAJA 4DN3H 1TLMA 1U95A 3I02A 2W92A 1DJHA 3S88L 1S7TA 2XVKA 2ZSWA 3PWPB 5I0WA 5GQBA 3E38A 3GSWA 2O6PA 4F27A 3ZYJA 2QHRL 1W8OA 3A6CH 5AUMB 4ZFOL 1G1CA 1YDPB 2Z91B 1SQMA 4X7SL 1UM4L 3LS5H 1CVSC 1H8LA 3EBHA 3ZKSD 3CN3A 5C0AD 2VR6A 4KUCF 2KDGA 1W72A 3AB0C 4AEHH 5J57B 3QUZD 1A7QL 2P45B 2Y5TB 3DK2A 5I9QC 3VFUB 7FABL 2PN5A 2C1OB 3CU1A 5F0MB 2N7SA 3CFBA 4JCLA 4NN6C 2BVOB 3ZU8A 2HCZX 1KCVL 3NG5A 3QR1A 3X12A 5AB1A 2YARA 2AQPA 1O0VA 5DQ9B 4ZO8A 4I88A 4QJ4B 1HYRC 4PR5B 1UWYA 4NQXB 2IFFL 1FA4A 4YO0B 3K80A 2UUDK 5J13B 3K71A 3E6HA 4RNRB 3K3QA 3GXTA 3IFOB 1JUFA 3EO1A 3ARGA 4JEGB 5GGTA 3F6IA 4FJYA 4KUZH 2C34A 3G6JE 4G43B 3L3IB 4MMYB 1LL1A 1S7UB 2P43B 3RNKB 4ZOAA 2ZPKH 4B7LA 4J6IA 4XVOA 5IOPA 1TTAA 3TBTA 5DR5L 3OQ3B 3Q48A 1TZGL 1KPVB 1D9KB 1Z66A 4QEGA 2VN4A 2GJRA 5DD3L 4WU7B 1BIIA 3OQRA 4HAGA 4KRLB 5EORL 1DVSA 4WI0B 2X0UA 1I3RB 4XNQB 3R4DA 1TIUA 4A37A 4NN7C 2NZ9C 2XNAB 4OTXL 3OZ9L 3IAQA 1C5DB 5CFAA 3IXTA 3PE9A 4M5SA 3QFGA 3P3UA 4NQCD 3NCXA 1J1XH 2JFCA 3IDNA 1FZKB 4R26H 4GQZA 1JSYA 1WWCA 3DK0A 2W81C 2VDKL 5CINL 2E27L 1ZHLA 2X0WA 3VWKC 3H2PA 3R4RA 4DKDC 1CQKA 4AV0A 4HCRH 3Q0HA 3INUH 2CH8A 5AW4B 1UKSA 1KTBA 2B08A 3F5WA 3FU3A 2JELL 4Q0XL 4AM0B 4LSRL 2UUDH 1VDGA 5HBBA 3DIFA 2Q8BH 1PX3A 4AEIH 3NACH 1CL7I 4HS3B 1AP2A 1EZSA 1XIWA 2V2TB 4UUJA 1MZZA 3EGSA 4LCVA 5ID0A 3VXNA 2FZ3A 4Z8FL 3OV6A 3FQRB 3U2IA 1FJ1A 4KZDL 4IOFD 4ZX5A 5JQHC 3H7BA 5EU3B 1H8NA 2BRQA 4KKNA 4U1LB 1E3XA 2GI0A 1G5GA 2PF6A 4DSYA 3DECA 5FO9A 3GLZA 1KB3A 2OMWB 4ZMPA 2FSEB 3D30A 3EJYC 5TQ2L 2P8MB 2PMZA 3CZGA 1OARH 5G4OA 1P5VA 5G2NA 3MLXL 5F96H 2DWYA 2V7HB 1QI4A 1MCFA 1M05B 2N7AA 2NSMA 5CBEB 1I31A 2F5AL 2IQ9L 4KZEH 1EGJH 4LCYA 1IBDA 1UWGH 2KZBA 1MCWW 3G6JA 3ZQ9A 1GOHA 3LN4B 5I75C 3FSVA 1Z5YD 4H8WC 1LEIA 4NRXB 3MO1B 1Q0XL 4L29A 1TYRA 4DEPB 4PJXA 1DN0B 1CD0A 3M1BA 3LRGA 4L3CA 4CN4A 3COOA 2CLZB 5I28A 2I69A 2FBOJ 4MCYB 1HQRA 1J0YA 2ATPA 2X9ZA 3FAXA 3S5LG 3ZKMC 5IJBC 1ZT4B 3NIFB 4YVUA 4R2GB 1TJIL 4EOWH 4A2FA 4JCMA 5L2KD 1F1GA 2Y2YA 3E2HB 3VNZA 3STLB 1QABA 2EH7L 3B6SA 4A7GF 3HI5L 1INDH 2NY4D 1NA8A 1B0WA 3EOTH 1RZQA 2PXYC 1NCHA 4MWFA 1Z3RA 4AQEA 6TAAA 4EXPX 5EO1A 3IDMB 1H3UA 1U91A 2XWTA 4HK3N 3S96B 4ZQKA 3MKGA 5DURD 3EH1A 2FE0A 2KL6A 2TRYA 1NJ9B 2ODHA 1OCCB 2NY3C 5TDNB 4AGNA 2WWNA 3HRPA 1FGNH 2J88H 3O3BA 4J12A 3LRLA 1W72L 4N8UA 3BRGC 3MNMA 4PRAB 3BHBA 3ECBB 4PJGF 5C92A 2ZIDA 1XV8A 2CKBH 1XMWA 4MNGB 4QXGL 3LQZA 3HG1B 2AW2A 1GYWA 2D9CA 5F0PB 5ITBH 3K6SB 2JI1A 3QIBC 3QQ3B 1AKJA 2D3VA 4TSBL 4YPGA 5D7LB 5F7FA 5HGDA 1R3IH 2QMKA 3B56A 3IDXH 4MJ4A 2X2UA 2XI9A 4KNUA 4QHMB 1QRNE 3RLSA 1VGKA 3H42L 2BDNL 5D6CA 4GRWB 3DO7A 5FF6A 5E2VH 1YQVH 3GHBL 3O6LH 5E5LA 1SXBA 4PRPB 5AEAA 4LLYA 3TURA 1ZE3C 4AMWA 2ITDA 3LNGA 1F11B 3U2SA 3CPUA 3QWOB 4BQCA 5C0NC 3PS6A 3HMXA 4M29A 4HJIA 2P5EE 2CO3A 2F54E 4G1EA 1J9SA 2DZEA 3GS7A 3T6XA 1EK3A 5E8NA 5KYYB 3MGAA 4X98A 1FYTB 2JIXB 4UNUA 3HS0A 2WZPD 3IB4A 2Z4QB 5EU4B 5JQ6L 5KW9L 1FL5A 1L6ZA 3KCWA 1JPTH 2B0SL 2WAHA 3QR2A 3QUYB 3K5RA 1HH6B 3OF6A 1HCFX 5E4EC 5C09D 1SN5A 3LRSA 3MA9H 1P7QB 4R6UA 1F56A 3SDDD 3AXLB 1T2JA 1JRHL 4G6MH 1UD8A 5CP3H 3K72B 1B0GA 3MLYL 32C2A 5IM7B 4BFIB 3TN0B 5BNXD 1G9NC 4ZO6A 4JRYB 4NQDD 3ZZQA 4PY7A 3QUMB 4I7ZC 4KY1H 2G4EA 2FLMA 5IESL 4HUUA 5KBKA 4OD1H 5KS9F 4MYPA 3QDJB 4TQPA 1MELA 1DQTA 3U9UA 2NY5H 3NH7L 3LVEA 1FF5A 4FNSA 1XGPA 4WCYL 1YA5A 2Y0SA 4LSVH 2QQKL 1YUKB 1HWWA 3ARQA 5LGYA 2BOCB 1OLLA 3QNXB 4L4TB 4S10A 3EO9L 3VXRD 3CFKB 1OM3L 3FTUA 5E8DL 2YQBA 1FWXA 5F88A 3QUKB 2XZCH 3L7EA 5GGUA 4XWOD 2YS4A 3FO0L 4OLZL 3WN6A 5I76A 3UTSB 4TOYL 5I71B 3HBQA 5FYLD 3ES6A 3KYOB 1NGPL 4LBAA 4OD3L 5H35A 2H7WA 4HC1H 3VD5A 1GC1H 1II4E 3PYCA 4EE2A 3HG4A 4GRMB 2WZAA 3KDMB 1W0VB 1V7NL 3C9NB 3L7FB 3L3DA 4QHNB 5IROD 3H0TB 3WMSA 4AE1A 5HHMB 1LILA 4YAQB 1UXLA 1QRNA 3OZLA 5IF0A 2XKNA 1XSKA 1KIRA 4XMUA 1A6WL 5I26A 4Z78A 1EXUB 4PJ5D 2X4QA 3CZSA 5IW1A 3BWAB 5DZOA 1Y07A 5KSAD 9PCYA 2A9CA 1X9LA 1G7JB 2GJ6B 4U3CA 2WWMC 4GXUM 4LL9A 4B9GA 2EKJA 4NUGL 5CJXC 5E6IA 3I6GA 2P5EA 4MMXA 2F54A 3BZEB 4PCSA 3O8XD 2HRLA 4I4WA 1MJUL 5GRYA 3V9EA 1PG7X 3DVIA 4M3KB 4BZ2L 1LMIA 3MROB 2HFGL 1MFCH 3FUEA 5IWLA 1A1OA 1JVKA 4UOJA 2ZX9A 3VVWA 1JYNA 1VEPA 1NMBH 1X7QB 2EDHA 2CIKA 4P3DA 4OZIE 3ZX1A 3BGFC 5DFVD 1DE4B 3GMLA 3JWOH 1FVCB 2F19L 1FH2A 4NKDB 5D7IB 3U9PH 5I2IB 2VUKA 4R96B 5GGRY 4HGMA 4YBHA 3CBKB 1MRDH 2HG5B 3U1SH 4HJEA 4UAHA 3L9YA 4DGYH 3BZ4A 3CIAA 4M02A 1N6QL 1Q0YH 2COQA 3MRJB 5DDHB 2EVHA 4F7CA 3B5GA 4AUYA 3H9HA 1DO5A 5DZLA 3UYOD 4DP0X 4U1SB 5FM5O 2KPWA 3TIDA 5T8IA 1QFWL 1WSST 5C2UB 3NAAH 1NEZA 1CTMA 3B7RL 1QQDB 3TCLA 3WL9B 1Q8MA 4K5OA 2OM5A 3RZCD 4CSSA 3MYJA 5DMKB 3KWVA 2P5WB 1RIUL 3MLRH 3ZE0B 3QS3A 5JW4N 2QSVA 4RVBA 1X5AA 4TPRL 3NT0A 2C1PA 2GT9B 4MSWA 1YECL 1RJCA 2EXTA 4KI5F 3S3DB 1NUGA 2VDRB 3W39A 2LTQC 5E0QA 2XN9D 3QP3A 3EKCA 3R06B 3E8UH 3IFLL 3PDOA 4K9EL 5T1JA 5DWUH 2VN3A 3HNSL 3DX0A 4HKZA 2CZNA 2ZJSL 3CHPA 3QIWB 3N6YA 4HETA 5K9QI 4F8NA 3UJJH 1F5WA 3FF8A 4IU3B 3VFSA 3WE6B 4Y4HD 3CN4A 1X9RA 1I3VA 3HMXL 4IEFB 4YDJA 3VFPB 1UACL 1H0DA 3BXNA 2DQFA 5E5UB 2BHZA 1F4WL 3SGDI 5CP7A 2XPGB 4GMSH 1ADWA 2AV1B 1P4IL 2ID5A 2VZTA 4QRPE 1DJSA 4DHLA 4ZQTA 2BP8A 1MRFH 3D2TA 4NWTL 4G59C 3DO4A 5E5MA 3IMUA 4ZK8A 2BFVL 1KV7A 4J3OH 1Z3GL 3S3PA 3SPVB 1XZWA 3UBHA 5F9OL 1IARB 5GZOA 5IMLB 1GHFL 1Y18B 1AHWA 2EKSB 3VSVA 2XWJA 5D7JD 4OZIA 4Z9KB 3ULVH 2R2CA 3MRFB 4WGWB 5F1KC 4C56D 1URIA 4X5QA 3N0AA 2HRPL 1YYLL 3WYRA 1ZVNA 2C5DC 4PRBB 1KJ2B 4JQIA 3KAAA 1FZOA 5C0CD 3HUJE 5I1LB 4JN1H 3RNQB 2Y7MA 4C4UA 1R34A 5HYJE 2VZOA 5DJCA 1XGTB 4ETQA 1GSKA 2XY2A 4IDLA 5DD6A 5I6LA 3T4YA 1KB9J 2BY1A 2QTEA 3SKOB 4HD5A 1N68A 5IB1B 5JO5A 1VFUA 4B50A 3FBKA 1MG2C 2C9RA 3L1OH 3FO2B 4XO5A 3R7QA 2XJLA 1QSFD 2DD8H 4YGVA 2I5YL 1OAJA 3F6JA 3HZKB 1AH1A 1G84A 8FABA 1H3PH 4DOHB 5B1AB 2EDNA 1J9CT 3PQYB 4NAMA 1QYGH 3SD2A 2UXVA 3VXSD 3H7LA 2APFA 1KYOK 3T8XA 1RUPL 1USZA 1FLRH 5ADOH 4POZC 3MFFA 1YNLH 1TZHB 4RAUA 3LQAL 1L7IH 4WEUD 1OE1A 2X4RB 4LVOB 3DV6A 3QI9D 1D5XA 4M3HA 1KCSH 2PLTA 5F3BB 3UOAB 4J1UA 3APDA 4N8VA 1EA9C 3D5OF 4PP2B 3LV3A 2DQEL 1RPQA 1ZA3A 2X12A 3RWFB 4PS8A 3LS4H 2WXIA 5GRVL 4FLRA 3ZRFC 3QT2A 4OY9A 2UWEE 3EJTA 5BVJB 1HHJA 1BM7A 3B9KB 2ENSA 4V33A 4B41A 2H5UA 4I3SL 1K4DA 5D9SA 5EU6E 5EN2B 1DJZA 1TVHA 1WP6A 1TENA 3PWLA 2IBBA 1MVUA 4QRPA 4H26A 1JGUL 2AJVH 5AALA 2IDCA 3C6LA 4CGUB 3O4LA 2WJ5A 4X7EC 4X6FB 1JG9A 1KGWA 3KWWB 3GNML 1QLFA 4HDIB 4P48A 5PCYA 2CLVA 5C9JA 4M48H 5AZEL 5DEGB 4PW4A 4Q2ZA 1S7WA 2HKFL 1AXTH 1SZNA 4JR9H 5JR1L 3S37L 3NRPA 3L95A 3SDXE 4NC2B 4XE0A 4ETYA 4F7TA 2EEAA 5TK4A 3ZJAA 3A23A 2XZQL 3LKOA 3QEQD 3LH9A 3HUJA 3V6ZA 3LN9A 3KPOA 1BFSA 5HYJA 5D1QB 4IMKA 3BDYL 5JHMA 1U8OA 3QORB 3S36X 3E6FB 3OKEA 1F0LA 3D9AL 1JWUB 3PHQB 3GHEH 3SDAB 4ANWA 1OD9A 1ZWIA 4GUCA 4QXWA 3T1FB 4GH7B 1I7ZB 3L81A 1U4EA 4HX1B 3V6FB 2WYZA 3G9AB 2DYPD 2R0ZL 2FBJH 1V7ML 4MJIE 4UIMA 3IM1A 1T4KA 4FQJH 3JWNG 4X6DA 4OGZA 3T6ZA 4FQXD 3PFQA 1HHKB 3BDBA 3D0VA 1I8LA 1S8DA 3PG2A 1Z5HA 2QGDA 3Q13A 3DTUB 1N6VA 3PXLA 4RISH 4Y5YA 4RGMC 5JOEA 1SLXA 5AQ0A 4NO5A 3HLAB 2XQYK 4RGOL 2C3WA 1IC5H 2V3DA 3F7KA 4WQOA 5HPOA 3TWYA 1KJMB 2FQEA 2AK1L 4M93B 3QZMA 1TT6A 4NQED 5TF0A 3SE8L 3QDGE 3QULB 1OLZA 2YA2A 4NDMA 1RJYA 3RUGF 4G6KL 1S5IH 4UB0L 5K9QG 5GJSL 2ARJA 2Y1ZA 4CNIA 2BMKB 1PCXA 1F8TH 3SYOA 3T9WA 1WITA 1W80A 2UWEA 2O6CA 4LXFA 3WUWB 5KVMC 1J8HD 2MKWA 5E6RB 3TO4D 3F01A 4HKJA 1G7HA 1M57B 2XWBA 3KWUA 1MJJB 4XMXA 3ML9A 5EU6A 1CTNA 2WK2A 1FFRA 2EACA 1L9OA 3ZDZB 2AQRA 2ERJC 2NSQA 3EH2A 3MTRA 1U3HD 2PCFA 5I8CA 4G9DA 3LZRA 2X44D 4KZ0A 5MEPB 2CO7B 2QGEA 5DQDL 1F4XL 2MHAB 1AANA 1K5NB 5C0EA 2HKHH 3ARGC 4DGUA 3V0FA 4PJGB 1A6VL 1IM9A 3APNA 1GAFH 4KV5E 3BWUF 4JZNA 2YAOA 3SDXA 4JQIL 1JGDA 5BUGA 4LSSL 4IYKA 3GI9H 4B27A 4GSUA 4N3UA 2VRQA 4WWKA 5ESQB 5CIPB 2GI7A 4OCYL 3WLBB 1EJOL 3L3OA 2VDOL 2D7QA 3CVHA 4FNRA 3I6LD 4S1RL 4LKCB 2ODIA 3WEAA 4ABVA 2AI0H 2GKIA 2VQ1A 2BK8A 3B37A 2H2SD 4BQ9A 3B9DA 4MJIA 4M6ML 4QRRD 3GRWL 2N0KA 4IGBC 5I1CH 5TQ0L 5J6GA 1N19A 1P7HL 2DICA 1TMQA 3RAJH 3R19A 1BAWA 3A6BL 3G08B 2FWUA 3V4VA 3VACA 3RIAK 3ZDYE 4Z0BL 3NCJL 1ITBB 1U8MB 2XZAH 5CU5A 1AGFB 3BP6A 4OM0H 4PWHA 1JMXA 4PBVC 2VH5L 5JZ7C 4H8HA 3WI9A 1QX1A 3AROA 4EKXA 1FHNA 4MBOA 2EDLA 1D5ZA 2HTLC 3UIZA 3FRPA 4KNQA 1V55B 1EHLH 3QDGA 1G7MB 1LO4L 2RFXA 1T83A 4FI8A 4CBPA 5EUKB 4JO2H 3KLAA 5DJXA 4HIEB 2AJSL 4FERA 4E9WA 1SJHA 4FQHA 4PB9L 1UADC 4PGJA 2OJZL 4Z76B 1S3KH 5B3JE 1XIWC 2MPAL 4HS6A 4PRHE 1U8LA 4YDLC 2G75B 5KS9B 1FN4A 4PLJD 4IMLA 3BAYA 2A6IB 3C60D 2DWTA 1XH0A 4EPSA 4RRPM 1NCUA 1KULA 3O6FA 1MXDA 2EEFA 4JREC 3T08A 2NDGA 2QDWA 3CDCA 5KSBF 2HTKD 5IHZA 4ELKB 1B90A 4GSQA 5CCHE 1AR1B 2Q20A 2PW1A 5ECGA 3UZEA 3U36A 3ARDD 3L3HB 1DQLL 1VSCA 2BVPA 2NR6C 3O6KL 3ILDA 4I1PA 1XGQA 5DK0A 4B3EA 4UOW0 3BKJL 4F7EA 3MNZA 5CN1A 3I9AA 4KKCC 5CEZE 1IGTB 1BYPA 4W70A 5JLZB 5A40E 2Q7YA 3TJHD 4WI3A 3V6OE 3FONA 4JPWH 2YGNA 2ZKMX 4FQPA 2EYRA 3HRZB 1RUKL 5E08L 4ONGL 1VEMA 2FX7H 3VJ6A 2YHGA 5CR1A 4HFWA 3SZKC 5F3FA 5JPMA 4BQ8A 3P3SA 4P5RA 2CHNA 2JB6B 1G7IB 4JG9A 1C08B 4HJJH 5AD0A 4DP4X 3H9ZA 4GJTB 4FULA 1ZLWK 4PTUA 1DVFD 4GQ9L 3CXDL 4GAJH 1PLGH 2B8OT 4RIRB 4ZX3A 1J48A 2WXQA 3BPOB 2A2QT 3QYMA 3MRKB 2LAAA 1KNOB 4AQ8A 5IIEB 2IPUK 1IGJB 3QXUA 4HIIA 1KLUA 4MQ7B 3EGDB 1A6UH 1M4KA 3BUYB 2XDHA 1FZMA 1ES0A 3WO3B 1CD8A 2WB1A 2J1WA 4E9RA 3DSFL 1ZV5A 3AM8A 2K8MA 1QA9A 1IAOA 4X99A 5I19H 3QUXA 1D5BB 4TL5A 3F8UB 1JZDC 5HYQA 4L4VA 3WKQA 3DVGA 3T0XA 3L5WA 4JKPH 1RZKH 1FNEA 1B9ZA 1P4BH 3T0WA 4MAYD 4PRHA 3GIZL 1DP0A 1T80A 3DETD 3MLWL 3X1FA 1ID2A 3G04B 5DHVH 3FOMA 4NAJA 2I27N 5D1ZA 1IX2A 1NLBL 2XKUA 2GBAA 4OF3A 1W6WA 3HHSA 3LIZA 3POCA 1DQDL 4MCZB 1A6ZB 2EDYA 3W82A 5CEYA 4AK2A 3OAYK 4QRBA 1KBKA 2PO6A 4NPJA 2FCBA 2WINA 2JMRA 4HAFA 3F12A 1HZHL 4NNXA 5EG6C 1S7VB 2WTPA 4PTTB 4IRZL 4U2YA 3MYZA 4AXWA 1YNTA 1FFQA 1ZLWH 3K6FA 4HEPA 4JW3A 3BZDA 3GD1C 1F45A 3DLQR 2F0CA 5LBSA 5J1TC 4HPOH 3QYNA 5INDA 2Z1PA 3V6OA 1TKWB 3DTXA 4R4NC 1T0PB 1MFNA 2DH2A 2J8OA 5C08D 4XNUH 3ASNB 3MGOA 5H37A 5MHSD 4RZCA 5I30H 2YN5A 1RSFA 2ESVB 4PJFE 4W4NA 5JXEA 1A7BA 3GC3A 2E75C 3VXQB 2GYSA 5T5FH 1FO0H 5BXFA 1E5AA 5GS0H 3WS6A 1SHXA 1X5LA 4FP8L 5AVVB 4V11A 3V0AC 1KT2A 1UJ3C 4XO8A 5BZZA 5FCUH 5B7FA 4DP1X 3OVUB 3EFDL 4ZW3A 2UY7B 3LJ3A 1F4HA 4XCFH 1CDBA 4ONFH 5MP6H 4G6FB 2W8CA 3V4VL 4DGWC 4GBXD 3VWJD 4OH2A 5BZDA 2VMCA 1DVTA 1JGIA 4OLYL 4ZUUA 2UZIH 4DGVH 1BW8A 1FYHB 5I0DA 5HSFA 5KTEH 3BSHA 1JF1B 3H55A 1AD0B 4AVKA 3MLUL 1CYGA 1QACA 3BP7B 3RWIA 4KXCA 3T65B 3ECVA 3VRIB 4YHLL 2ZG3A 3OAYH 3QJRB 3V5KA 4BKLA 4UQ9A 1HCVA 1KELL 3EFOA 5JORA 2A9DA 1R1CA 1UYWH 1PU0A 4JFZH 2G3ZA 3OPZL 3KS0H 2IAND 1Y6MR 2ICWB 3HVDA 4JGNA 2OMVA 2D3JA 4HUKB 2HH0H 4XCEA 4XI5C 3VVVA 3WHE1 4IW4C 4K3DH 5IG7B 3KL5A 3QIWC 4HPHA 4JPQA 3BQUD 1OP9A 2VDNB 3GMRA 1KACB 4QY8B 5IQ7L 4UNIA 3DX7A 4JRXE 5T33H 1S7RA 1L3WA 4TUJA 4OIFA 4BH7B 1IGFL 4DAGL 1WFMA 2F61A 1TCRB 1MFAL 4TQHA 3B7SA 5F1IA 1RZ8B 1NC4B 1UB5A 5E6IC 1JYVA 2VB5A 3ZW3A 4MMXC 3W57A 4E0RB 1AGCA 3MA7B 1FBIH 3U0TA 4AYID 4OGAD 3WO4B 1UD2A 2OAAA 5B3NA 5D7HA 4EUPH 5F7UA 3A4AA 1XF2B 4NKQB 3U4EA 3SIKA 3GINA 3BVUA 3SDCD 3MN8A 1RZJL 4KROB 2XG4B 4PJFA 4AGLA 1YN7A 3BP4B 1KLGA 2V2WA 4MB3A 5DS8A 1MI5D 4X6BB 5JIMA 5IEKB 1AFVH 1CFTB 2MTAA 3BC9A 3OLDA 4FJZA 3QPQD 5DJ6A 3EH5B 3LN5B 4XHJD 4JY6A 2OXGB 4P2QD 3UL4A 3V0WL 1CDHA 4YHPB 2BNRB 2DJMA 3WFBH 4AYEC 3HNVH 4RDQG 4A38A 5BS0B 3V5DB 1UVQA 4TS6A 4HISA 3W9EB 1UD3A 5T3ZE 4KVNH 5MEQB 2VRKA 3Q2VA 4GRLA 1FAKT 1GZQA 3GIVB 3NPSC 4X7FC 4GIPD 5KSVB 2JWYA 4GT0A 2NXZD 1FNSL 3DMMA 3FU6A 4PD4K 1I53A 5J3HD 1AZZC 3VDBA 3MNVB 2FH8A 3OWEA 3HZVB 4O02B 1XVSA 4PPTA 3L5HA 4OQTH 2PTTA 2OYPA 2VR5A 2E7BA 3MJ7B 3D7PA 4LLWB 3N85H 3NSJA 5I0ZA 3EYOA 4GLRH 5TK2A 2VR3A 5IMOA 2H6PA 1FG2B 5GRUL 1NCAH 3NMEA 5HDRA 5KVFL 4AL8H 1JV2A 4PAZA 4JFYB 4E2OA 3GMOA 4MD4A 1NFDF 4MNQB 5LGKA 4OZGA 1BJ1H 4KTDL 1BLIA 4NJAH 4UQ3A 3STZA 3LIZL 3UDWC 1MWAB 4KK6C 5D1XB 2QADC 1CFBA 4GSXA 4JRXA 5IB5B 4Q6IA 1SYVA 3JV6A 1KY7A 3L5XL 4HKXA 1E28A 2D7TH 5C0AB 2E86A 4L8CB 2AJZA 4YE0A 2I25N 3V52H 1WAEA 1OSYA 1XR8B 3QUZB 3MRIA 3BGAA 4ZFFA 3ZZLA 1NMCC 3ZMNA 2CM5A 9CGTA 4BUHA 2BOBB 4ODTH 4OLVH 1MW3A 3ZZSA 4N90E 5CEZL 4B7IA 5GS1B 2VYRE 1X5IA 1WIOA 3X3GH 4PV1C 3ZT7A 3NA9L 5F9JA 4AIXA 4U6YA 1NAMB 4EI5D 1IVTA 4IHBA 5LGJB 4BE5A 2E4TA 2V0AA 3WENA 3I2CL 5BZXA 3RUGB 3VG0L 1JHLH 3TBVB 5E7FA 1P0SE 5I1EL 4BSVB 2PUQT 4N2HA 1GGIL 3SCMD 1YEDA 3OKMA 2CG9X 3VXUD 4NNYA 4PQXA 3QO0B 2ZKHL 1ICTA 3U6RA 5TE7L 5HY9B 2KLTA 4WEBH 5ELIA 1BZ8A 3G6JF 1TITA 4HIJB 2N56A 5J1AA 1L6XA 1OB1B 1JN6B 4WO4C 4NRZA 4BUGA 2Z8SA 2CRYA 4PJXF 2WJ7A 5B39A 1HILA 5J6HA 2ZX6A 4RMRA 4KXZI 5ID1B 2EH8H 1FFOB 4BDVB 1G6VK 3FHQA 4M9PA 3MUHL 3ZZ1A 4FQIH 5KG9B 4NQDE 3HB3C 1AGBB 4RAVA 2BM3A 3A4DA 2W0FA 4K9JA 4XN7A 3UPRA 3B2VL 4Y2LA 4OUOA 2V7NA 3VGBA 3WEBA 1ZK5A 4GNKB 3FFCD 5F6IC 3X1GA 4RWYH 4EXKA 4NO3B 1MHCB 3V0VA 2VO5A 1R3JA 2NZ1A 1BPLB 2FEDC 4PWJA 2LVEA 1JDDA 1MJ8L 1YN6A 1I3GH 3SPCA 3U9WA 5BO1L 1N8OE 4LVHC 3DVNB 1WRFA 4XPBL 4JO4H 4NNPH 1EBPA 2ZONA 3VRJB 4OFYA 1S46A 1PX8A 2J56A 4OCWH 1TU2B 2I07B 3OC8A 2XC8A 4LT7A 5ICXA 4U1KB 1DQQA 1YEKH 3PNWA 4RSVA 4HLJA 5BV7C 3K81A 5C07D 4G5AA 3RWHA 1JZIA 1B2YA 1NAKL 4HSQA 1TPXC 4JN2B 2O1AA 4MJ5A 5I8OL 1TO4A 4OAWA 1ORSA 2WBKA 4GKNA 4NQUA 1LK2B 2B2XL 2HVBA 3LKQB 3A6OA 2G5UA 1ULVA 3QVAA 3C6LC 4N5EC 4QO1A 4XMKH 5JYMA 4UT9H 4PJDF 5LQBL 4PJ5E 4LB8A 4A6YL 3IRZA 3VGDA 2DTMH 1OM9A 4P46B 2NX5E 1CURA 1ETZB 2MOVA 3EIFA 4AVIA 2V2XA 1MG3C 4LHUB 3DGDA 3MRHB 1X9QA 3N40P 2Z93A 4UOQA 3QZWA 2B4CL 4DGIH 1QI3A 4APQC 3HFMH 2Y36H 4OUUB 1QHPA 3GSNB 2EQDA 4FG6C 3UEZA 3WDIA 1G5AA 4WI6A 1PZ3A 2VO8A 4IMKC 4PS4L 3BD5A 3VSQA 5A7EA 1XR9A 1WT5A 4XXDB 2FECL 3ILQD 5AZ2H 3T3ME 4YSAA 4TULH 1F6FB 2DLIA 5CHNA 4ZFOB 5KSBB 3ZTJG 3VTTA 1KCRH 1QSZA 1OTUD 4PRID 5IW6B 4JDEB 3BJLA 4JFDD 2OZ4L 2QV2A 3FOLB 4N0RA 5L2KB 4FQ1H 4JHWH 3VFOA 1ZHBB 3FPXA 2OTUA 3WJLA 2WZ0A 3DHJA 3EOYG 3HE7D 5IMMB 1I8LC 3WUWG 1H8SA 4FTDA 3L5JA 5I15L 2NY4B 2UZYB 2OQJB 4JY5L 2XG5B 2VDLH 2FWOA 1KBWA 1WF5A 1E5ZA 3HS9A 4WTZA 3EYVA 4MLSA 5LG6A 5T1DL 3P73A 2H3NA 3CQQA 4NXKA 4JAMA 1MFEH 5LUMA 3NIGE 3K4AA 4HCRA 1C12A 1I1AA 1FFPA 3CX5J 4U6XA 3GJFB 2G0LA 2OZNA 3THML 5I66B 5KN5A 3VD4A 2A5UA 2KC0A 3TFBA 4D7BA 3FYIB 1SMAA 3V95A 3I75A 5AL8A 5AYTA 5DC2A 3US0A 2IVFC 2TRHA 1LD9A 2ZE0A 3SQBA 3TBBA 2L8AA 4LARL 2F15A 1JXFA 3NRFA 2VW4A 2A6JB 1QLRA 1SRDA 1XCXA 4ZOEA 1AI1L 2ZP8A 4F1SA 1YEJH 3O3DB 4PJ5A 4JX0A 5GGVL 4E9SA 1IBBA 4Y16A 2NX5A 1ADQH 1QFUL 1XFPA 3QQ9D 3CFEA 3CBJB 3JV4B 1Y0LB 5HJBA 2FT6A 3FUFA 5BRQA 3AT0A 2QVIA 3G7TA 2YZ8A 4X5XA 3MRQB 2ZOOA 3NA4A 4U49A 3TWCL 4OCXL 4KQ4H 1EGJA 1U2CA 1BZOA 2VDQH 4FLQA 1AZNA 4KO9A 5I8KL 3QHFH 4GXFA 3CHOA 4U6TA 2G4GA 4WWKC 2Y24A 4YLQT 1UOKA 1SY6H 1SEBA 1DL7L 5FYJD 4BCXA 5T3ZL 2D4FA 5GIRB 4ZX4A 1ETA1 5H8DA 1ZLUK 3HE6B 1IRAY 4PYGA 12E8L 1G9MH 3X3FH 1WISA 2VDKB 4Z7AA 1KIPA 4XRCA 4DP5X 3O9WD 4GP4B 3BIBX 1CZ8H 2GBTA 1KJ3H 4NWUL 4X50A 1BOGA 5A6IA 3NZ8A 5FV2A 4FEIA 1OE3A 3RPKA 3HTLX 5SV3A 4S0SD 3DX9A 4F9LA 1EEYA 2ICWI 3RI5F 1E4JA 1G94A 3FXIC 1USQA 2CDFA 4P06A 5ILTL 3WXWH 5F7AA 2IDTA 4JHAH 4PMEA 2IFGA 4PBDA 3V0HA 4F58L 4BZ1H 3VYOA 2YMXL 2ORBH 4L2LA 4NO0D 1JERA 3A6CL 4WNJA 5DMIL 3VU2A 1HK6A 3TC9A 3RZCA 4BIKA 2VSCA 4WVRA 4PP1D 3UBXA 5IT2H 5AAWC 1CLZH 4PJ7E 3VXSE 2FJHB 4XVUD 3IU3A 4KO7A 2CKBA 4QT5B 3WIFB 1HHGB 1I4FA 5CKAA 4I1RA 2RQ8A 1OSPH 3QUGA 2XICA 2D8KA 3ECWA 5EIIA 3W5MA 1UASA 3BD4A 3FYEB 4BV1A 3FQYA 3CPLB 3E0GA 1NCBH 2K70A 3PGDA 5EPMA 4LSPH 4H2AA 4YSQA 5DXWA 2ZWNA 4YXHH 3UZEC 1ZLUH 2OI9B 4G7VH 1HXMA 3VFTB 3EGXB 1WUNT 4QXUH 5FB8A 1N8ZA 4ODUA 3QFDA