2QPLA

Crystal structure of calf spleen purine nucleoside phosphorylase complexed to a novel purine analogue
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
282
structure length
266
Chain Sequence
NGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPEGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYEAGKQAAQKLEQFVSLLMASIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystal structure of calf spleen purine nucleoside phosphorylase complexed to a novel purine analogue.
pubmed doi rcsb
molecule tags Transferase
total genus 91
structure length 266
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2007-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qplA00
3T94A 1JP7A 3E0QA 4M3NA 4D8XA 3NM6B 3NBQA 5B7QA 1ODJA 1OVGA 1SJ9A 2QDKA 4YNBA 1V3QE 4OEHA 3OCCA 1VHJA 2BSXA 4TXHA 1Y6QA 4EB8A 1JDVA 1A9OA 1Y1QA 2OC4A 1G2OA 1TD1A 4DA7A 1RCTE 3FUCA 2PGAA 2HWUA 3DPSA 1ODIA 4EARA 3UAZA 3OOHA 4QEZA 3UAWA 5CXSA 1PKEA 1PBNA 3KVVA 4R31A 1LV8A 1SQ6A 5K1ZA 4TXLA 3OF3A 2RJ3A 4TTJA 4MCHA 1QE5A 1A69A 5F7ZA 5EPUA 4K6OA 1U1DA 4F3CA 4YMLA 1ODKA 4H1TA 4OGLA 3BSFA 3PHBE 1Z5OA 4WKOA 3O4VA 1T8WA 4BN0A 3ENZA 2QSUA 4DABA 1PR2A 3FB1A 1ODLA 3KU4A 1T0UA 4DAOA 4DAEA 1CG6A 4TXJA 1RXUA 1TCUA 2HN9A 4GKAA 1B8OA 3DJFA 1OUMA 4DA8A 5CYGA 4LNAA 2OC9A 2ON6A 4F1WA 4UC0A 5B7NA 2GUWA 3OZBA 1Q1GA 1OV6A 1JYSA 1K27A 1T8SA 4TTAA 4QARA 1OU4A 3TL6A 3LBAA 3LGSA 1SD1A 1NC1A 1RXYA 1ECPA 3FNQA 3P0EA 4MARA 3UAYA 2QPLA 1TCVA 3MB8A 3KUKA 5KB3A 5B7GA 3BL6A 1YR3A 1PK9A 3P0FA 4DARA 5EFOA 1OTYA 3EUEA 4QATA 4F3KA 3EEIA 4DA0A 4BMXA 1XE3A 5CCEA 1YBFA 4JP5A 4D9HA 3FWPA 1TGYA 1TGVA 5F7JA 4L0MA 1RXCA 1JDTA 3IOMA 3NM4A 4WKBA 4PNPA 4L5YA 2QTTA 1Z38A 5C80A 3INYA 3EUFA 1A9TA 1JDUA 4RJ2A 4LKRA 1V48A 1JPVA 4G8JA 1SD2A 2I4TA 4PR3A 4QFBA 3DF9A 3IEXA 4LDNA 4LZWA 4L5CA 4OY3A 3MMSA 3NM5A 3OZDA 1A9PA 4WKCA 4G41A 1T8YA 2IQ5A 1Z5NA 3UAVA 1OTXA 3KHSA 5I3CA 1JDZA 5B7PA 1Z35A 1YRYE 3BJEA 3PHCA 1U1FA 4KN5A 3K8QA 1A9RA 2B94A 3FAZA 1PW7A 4P54A 1V4NA 1VMKA 4LNHA 3QPBA 1K9SA 2HSWA 2A0XA 1ZL2A 4TYMA 1RXSA 1PK7A 1N3IA 1V41E 1ULAA 4R2WA 3C74A 5F73A 3E9ZA 4OGKA 4TS9A 1CB0A 5JPCA 5CCDA 4R2XA 3LA8A 4WKNA 5FAKA 3PNSA 1ULBA 4GLFA 4U2KA 4D8YA 2QTGA 1PF7E 4OF4A 2AI1A 4X24A 4OJTA 3ODGA 5F77A 1VFNA 1RT9A 1Y1TA 5EUBA 1Z34A 2H8GA 1U1CA 4JWTA 3BGSA 4M1EA 1JDSA 1WTAA 1YQQA 1Z5PA 4E1VA 3SCZA 5ETJA 1M73E 2I8AA 3FOWA 2Q7OE 1RR6A 4DANA 1Y1SA 1PWYE 5F7XA 1NW4A 1JE0A 3O6VA 1T8RA 3E9RA 1PR4A 5IFKA 5CYFA 3OZEA 1Y6RA 2AC7A 5F78A 1Z33A 4NSNA 5IU6A 3GGSA 1A9SA 1Z36A 4TS3A 2A0YA 3ONVA 4L6IA 1FXUA 4YJKA 4DA6A 1B8NA 2A0WA 1V2HE 3EMVA 3UT6A 2P4SA 4L5AA 4ECEA 4FFSA 4NY1A 2ISCA 4I2VA 4BMZA 3GB9A 1Z39A 4QASA 3K8OE 4F2PA 1U1EA 1U1GA 2OXFA 3DP9A 4F2WA 1LX7A 1RFGE 4GLJA 2OECA 1Z37A 4GMHA 1C3XA 4D8VA 3KVRA 1LVUA 3OZCA 4G89A 3PNPA 2HRDA 5F76A 1PR5A 1K3FA 1I80A 1PR6A 5CXQA 2XRFA 1RYZA 3KVYA 1A9QA 1ZOSA 2AI3A 1NC3A 1JE1A 3DDOA 4YO8A 1YQUA 3OPVA 4WKPA 3OOEA 4QAQA 4NS1A 3F8WA 4BMYA 1RSZA 2AI2A 4TXNA 4MCIA 1Y1RA 4D98A 1PR1A 3D1VA 4TTIA 5F7OA 1VHWA 4M7WA 4JOSA 4TXMA 2A8YA 1V45E 3UAXA 4IP0A 5DK6A 3U40A 1PR0A
chains in the Genus database with same CATH superfamily
1U2TA 1G8JA 1KHHA 2LE0A 1NJFA 4KWTA 2O8EB 4Z8YA 6REQB 1ACJA 1I1NA 2WSSA 3V7YA 2CYBA 1F12A 1Y8AA 4GG1A 4OAQA 2FA9A 3V6MA 4YP9A 5AIBA 3SKVA 1LXCA 2G9QA 2QNBA 2Z9BA 3ENVA 3W5HA 2YWDA 5HJEA 5KTKA 1C3OB 1I3OA 5SYAA 3WNVA 1EUYA 4F91B 5LUBA 1UBSB 4ZT5A 1MX5A 1WSDA 1WPGA 2REOA 5EHQA 5FEMA 1ZCJA 4U0KA 3H2YA 3OZUA 1G5RA 3WJ2A 3R3ZA 3G13A 3IPLA 4BO5A 3PEYA 2ZDHA 1Y1QA 3HABA 2PUWA 3I34X 3QPCA 3WJAA 1NWHA 3JX9A 3U7HB 1KERA 1LDGA 2NTYC 2KPOA 3W9BA 4EUNA 1IULA 1TA9A 2GYUA 1AUVA 2BGKA 2EKZA 2HBQA 4F56A 1U2DA 1MG5A 5F1PA 2B1IA 1FVHA 1Y4ZA 2UYGA 4WASA 5CLFA 3ZZNA 1OXSC 2CNKA 5KSZA 3I2FA 2C4VA 3N87A 3OE4A 3NQ41 3ONFA 3UAWA 2ATCA 1UPBA 4YUYA 3SKXA 3H3XA 1VRCA 1TM1E 2ZUCA 5TX7A 1D2MA 2VT6A 3EYAA 4Q6BA 3DVRX 2KLBA 3ZUGA 4B73A 4G5GA 1W94A 1A9XB 1U3CA 1QONA 1I14A 4ZCQA 2CUNA 3IXQA 3RB8A 1CQIB 3ZHUA 1UBTS 1JBKA 3O8OB 3AUUA 4XPIB 2OP0A 3CMCO 3QENA 4JJ6A 3R5FA 4ENSA 1CUUA 5A4KA 3BD7A 4L75A 5AJVB 1CQJB 2PUFA 3AB3A 1Y5RA 3Q7EA 5CT9A 5LP1A 2POCA 1DFGA 2D1FA 2BEWB 4WK6A 3KOUA 2Q3MA 1KU0A 2XKKA 4ARSA 1H94A 4P86A 3A2MA 3ROEA 2I4OA 4V1CA 2FFHA 1L8AA 1CFZA 3R0ZA 3W6ZA 1J1ZA 4HG2A 1ODTC 1U3WA 3TLGB 1KQPA 3A0UA 4F3CA 3PYMA 2XRYA 3LWNA 4IJUA 5BUCA 4YMLA 1E6MA 1X19A 3CINA 3OD5A 4GPEA 4HWPA 4DY4A 3O8BA 3N75A 1FRVA 3UCEA 621PA 3V1NA 1ATZA 1PJ3A 2BHTA 1PYOA 3AUXA 3KB8A 1LPBB 4AZSA 4E2WA 2BEJA 4B3RB 3SG0A 3AEZA 1M1UA 1JS1X 2AX4A 2EG9A 2XUQA 1XTPA 3FLAA 4NCIA 5ILGA 1L5QA 5JBNA 4YGXB 1T9HA 4JI1B 3JU3A 4HEJA 5ERGB 3R0XA 1BDIA 3DC2A 5ANRB 1DUVG 1PR2A 3JQ6A 2Y1OA 1MGOA 1AQLA 1P1IA 2WUGA 2NAFA 3WZMA 2H7YA 2IL1A 4OM7A 4BLRA 3JRWA 5JLJA 1VL0A 3BA6A 4JU8A 1QFZA 5TMPA 4JP3A 4H0FA 1EH5A 1R10A 4XX0B 4K28A 3TRDA 2P5UA 3EVEA 1TFUA 2A35A 1PJAA 4RSGA 5AVWA 4B47A 3SXPA 4EUSA 4PRKA 3BCUA 4J0HA 4S1OA 3HYNA 4LNAA 4O0MA 4Z7OB 3M1IA 4RH1A 2KS6A 3DE4X 4JI4B 2P69A 3TMAA 3DZ8A 4BB9A 1GGKA 2J48A 4GI1A 3JPYA 1H5NA 2R6JA 1RAHA 3ESAA 2YYSA 3NCTA 3OZBA 4J9VA 3WLKX 1T36B 1E2KA 2GTPA 3RC9A 4LF6B 1FRNA 1OV6A 1PW5A 1VYTA 2LKCA 3C4VA 4ZZ2A 3LPMA 5A6VA 3SQLA 1Z4MA 1JHDA 4B6OA 1T8SA 3CLRD 4H6PA 4WJZA 2RE8A 1U3UA 2JFPA 4KXUA 4P0QB 4ADSG 1LQTA 2QLMA 3UM9A 2ZT5A 4EH1A 2QRVA 2V7TA 4BLUA 1E77A 3LGSA 1NC1A 4PYLA 3ZVNA 1WQ1R 3ES9A 5J4YA 2VP2A 4W6QA 2X42A 2FWPA 3O82A 2O2XA 5BVHA 5FA6A 2H2DA 1U7PA 1MW9X 1RJDA 1UOPA 1Z0SA 1D7AA 1I3NA 3JZMA 3S5JA 1P0PA 1ZD2P 1YJ5A 4H16A 3TZ6A 3V55A 1SUIA 1TCVA 2A9RA 2ZSKA 4JQZA 4R0MA 2FY8A 4CIWA 5J4VA 4B34A 1P44A 3ADBA 2VTKA 3PQ2A 4JODA 1A4IA 4BKOA 5ARBA 2ASVA 3S7TA 2JCVA 3EPPA 2XNCA 2FN9A 1WXFA 2FZGA 2Q29A 2XTZA 3B1WA 4KQFA 5LBTA 3HCOA 3OZVA 2FW7A 5C4GB 2W98A 4URWR 3H3FA 2TMYA 1NJ6A 3DWEX 4HDSA 2UUOA 1GDTA 1ENYA 1EM8A 2D1SA 2QVLA 1P3DA 3E5RA 4HVCA 1QP4A 1MJ5A 1L8OA 3ZJ4A 2GBFA 2I1WA 4L85A 1SHKA 3THYB 2VEDA 3MK31 5KX5F 5IFLA 5ITZA 2FPUA 1GEEA 2IVFA 4PF1A 1PCXA 3FPHA 3NTVA 5FYDA 3LHDA 1ZVQA 3OIYA 4M36A 4LQ4A 2V7WA 3C3CA 3WISA 1DE0A 4ARBA 1YKFA 4JH0A 4WVLA 3IXMA 3A2KA 4HRVA 2BH9A 3K0FA 4KTTE 3AR6A 4KKVA 4W9NC 1P80A 4DLLA 2E89A 3A4YA 3F49S 3FCUB 4YQYA 3VO1A 1KK0A 2DB3A 1CYEA 3H8WA 1KHTA 4TVSA 5FOWA 5C4MA 4PCLA 1JDNA 3BH0A 3C5VA 5CT4A 3FOFC 1L5HA 4FE4A 2VP5A 3HUTA 5F23A 1GRQA 4U2CA 5ADWA 4GM1A 2IWHA 1JQLB 1FLAA 3MUOA 4LMBA 4ZFNA 3K0EA 4KWEA 2JA2A 2RHRA 4FXOA 3OCXA 1L7MA 4OKIA 4FW9A 4Q7KA 4JQYA 5D6NA 3T4UA 3ZXUB 1XMVA 3ZKWA 5I4CA 3VA7A 5IVHA 2G0TA 5EGNA 1U0NA 2UXDB 1HDEA 5DCUA 2XLBA 4ALLA 3RYHB 3E9MA 4J1TA 3WKEA 1UODA 1HM5A 1VGVA 2OO5A 1BFDA 2V6FA 4G5RA 4BFZA 1PJBA 4DUZB 1I51A 3HK2A 3KCQA 1P1JA 2HCTA 2XWSA 2Z8YM 3CLUC 1XO1A 4DPLA 2YXLA 2BRUC 3LW7A 1W35A 3E4CA 4LIPD 4QIHA 1E66A 1NZDA 4RHCA 4LDNA 5LOVB 2VCEA 3VZBA 4NPCA 1R8QA 1FDTA 3T4PA 4QZVA 2C0QA 2PZBA 3RHSA 3LOPA 4XVUA 3E9EA 3MMSA 1OX4B 5AIAA 4OXKA 3ZG6A 4AMVA 4G1EB 2XE7A 1M0TA 3CZ4A 4WKCA 1G55A 4QGGA 1EFAA 3CNQS 5DBFA 1Z3CA 1VJ5A 2WTEA 5EJGA 3HJFA 2PBZA 2ENUA 3I2JA 3PHGA 4V3BA 2KI5A 3UAVA 1MQAA 1L7BA 3SK0A 1PWXA 1JQDA 4OQYA 5CEEA 5JS7A 1XA0A 3A6GA 3JSXA 4NU6A 4P53A 4HEQA 5HEKA 1YRYE 3OZTA 5AR1A 4L22A 5C1DA 1QM5A 2YJGA 1MF7A 3BL8A 2WYOA 2NXJA 4P92A 5HKKD 5IT9A 2AFHE 4GQIA 3TE6A 2VSOA 1P9WA 1KSFX 1CUHA 1WMFA 1CY7A 2UZ0A 3B52X 3MBKA 3C3KA 4JEIA 3UATA 4ZYTA 3IUBA 1GZHB 5J2UA 4OI0A 5C1BA 3UK6A 2RAPA 5AVUA 4ZOCA 1E92A 4J16C 4A2CA 1MVNA 1JNYA 4UUOA 4AMYA 5AVRA 3HBNA 3L84A 4W6ZA 4RZUA 4EM6A 4NXMB 5TIIA 3NVDA 2YZKA 3N9IA 4EY6A 5IJWA 2BFOA 2YVQA 3I9V1 4RZ2A 3CIFA 3RVKA 2ASEA 3RQSA 3RVQA 4M7OA 3C7CB 4NMMA 2CCKA 3QHPA 4K1LA 4BASA 1Y8RA 4UMVA 5LMZA 3UOAB 1UBEA 3RODA 3VX3A 3D6MA 2C95A 1UPCA 3J7TA 5IN4A 2CDCA 2GSDA 2BGLA 2P35A 3O8QB 4N5IX 4DSOA 4X8HA 3RUCA 1ZJJA 2BKAA 3QKSA 4N7JA 5DTEA 4IUYA 1B0PA 4HNAB 4YFVA 4AKIA 2H59A 1B2RA 2Q41A 4UHEA 3ZWAA 1FSPA 2ZDQA 4YK7A 3ND9A 2D4HA 2DTDA 3HGMA 5HKOA 1CV2A 4AI6A 1CRLA 4IDHA 1VJ1A 3K1TA 3IMCA 4BO4A 4R2KA 4PLZA 1RWOA 1ZI6A 1U4NA 4HN4B 2GAAA 4P4LA 2E7ZA 2O5RA 2ZR7A 3GWGA 5AJHA 2EWMA 2IU4A 5AICA 3HN2A 1TZKA 4IHJA 1B0UA 4N65A 1V6SA 4D3YA 1T5BA 3QPVA 1DVRA 2DY0A 1ZJZA 2EIXA 5BWBA 2CLDX 1FLNA 1U1CA 2GARA 2R3SA 5G40A 1C9KA 1TDJA 1J8QA 1JILA 3MRVA 3BZUA 4BB0A 5BP7A 5C5CA 2RI6A 1UK9A 3HPRA 1Q44A 3G5TA 1LDYA 3RABA 4RCVA 4ABTA 2AZXA 3PUHA 4EQ6A 3CZ9A 2QQ0A 3HSSA 1T34A 4E1VA 4TN1A 3N1UA 3TRIA 2I6FA 3VR1A 4P32A 1GR1A 1BN7A 4E33A 1JWBB 3ECAA 2JAXA 2YYZA 4Y6LA 1DQSA 1Z28A 1CDZA 1FFDA 1SKBA 1GGVA 2AG6A 4CMHA 2FWAA 1NSFA 2JIDA 4BNFA 1JYFA 3N74A 3HY6A 2BVNA 3IBTA 1KAGA 4N0PA 4RD1A 4F2HA 3OUUA 1GZ4A 4CM7A 3PQDA 1DMSA 4HLUC 3PJEA 2XDAA 2EJTA 3KR2A 4YRLA 4F4FA 1QQ5A 1HQKA 1N2HA 1E79A 3BGDA 1GKUB 3DGFC 5EQDA 2IUUA 3RVJA 1VIVA 4C4XA 4LY6A 2ZAOA 1T1IA 1T0HB 1L4MA 1TQ2A 4BJ5A 4QDKA 4ALNA 1DBRA 3VR4A 1L5SA 5BQPA 5DTJA 2R66A 3Q3JB 2FZ5A 3CG4A 5TVGA 2VC2B 5K09A 2BBSA 2J0EA 2PZMA 3K53A 1FFHA 4HQFA 3X1KA 4CG2A 1JQJC 4EMTA 5B2FA 3P94A 1FF9A 1OFTA 5AKKA 5KNCH 3S2EA 1UT5A 3PQ3A 1Q22A 1S4MA 2YTZA 3VJLA 4WZAB 4DC1A 2X7HA 5K8VA 3T35A 1VPTA 4MITA 1GRRA 1Z73A 1P31A 2GFQA 2ZROA 1Q0PA 1B8VA 1L4UA 1VSUA 3ISJA 4S04A 3SYTA 4QPJC 4MJ3A 1OBHA 5EMJA 1C50A 1HWYA 2ZJ0A 4PIVA 5CW1A 5JLAA 4DM4A 3CNBA 3H2JA 2OILA 3W5AA 2WB4A 1AKTA 4AY6A 2EWVA 1WABA 4FYKA 1U81A 3ZBQA 1GPYA 1K7EB 4U7TB 1NXOA 1KDTA 3OIUA 1PLLA 1XFDA 2JGDB 2QZJA 1GFZA 1BW9A 5FBWB 4ZCTA 3WDSA 4F2PA 2OBMA 4OI1A 2CV1A 3LCCA 2X58A 4G81A 3QEJA 4UD2A 1OBOA 4TV8F 4ACAA 2GVZC 4F86A 2Y9MB 3F6BX 1U1GA 4HP8A 1ORWA 5DT9A 2PUVA 3E58A 4UREA 3FPFA 3PWTA 1VB5A 4MVJH 1WE2A 4NG4A 5EJ7A 1W6RA 3KEFA 4MO2A 2FK7A 1Z0JA 2W2LD 1KZ7B 4URUR 5DBHX 5T4FA 2YRXA 4UPEA 5LKAA 1NXTA 4Y0VA 3EXFA 3CLTC 4WBSA 3M6WA 2BZGA 3EDMA 3FAKA 3KZKA 4IEIA 3SLRA 2PLFA 1CULC 2ZREA 2J3KA 1Z07A 1UWLA 1E61A 3FR8A 1K7XB 1BHO1 1M8PA 3HV0A 2I4IA 2V7QD 4GDMA 4D8VA 3OZWA 2HLHA 3BSYA 1DCKA 2CEKA 4MA0A 3K3PA 4RFLA 4P31A 1O95A 1EEHA 2LXNA 1Y80A 3QV2A 2VDQB 3ET4A 3IT3A 1N6OA 2VF8A 4IFTA 3AX6A 2AJDA 5E4YA 1HMPA 1XQYA 3K1AB 2AW3A 4Q3KA 3AF2A 3HUEA 4X1YB 3M9WA 1TUIA 4CQNA 1GGNA 1NJ1A 4N47A 3ZVLA 3EZYA 2R11A 3GEIA 3QEMB 1GNLA 5PNTA 4YUAA 5JSFA 4KXFB 4MULA 5L6MB 4PBRA 1Q3HA 2BC9A 4X95A 4H7HA 1A5SB 1T4MA 4IXNA 1D5CA 4F71A 5E9WA 3UA3A 2IYTA 2KE5A 2QRLA 4ERXA 3HLYA 5EUMA 3TQCA 1NVWQ 1FX0A 2B99A 3K9QO 1JT9A 5JECA 2W2KB 3RYIA 2PLNA 5TQ2A 3HO8A 2YV1A 4OI4A 3B3GA 1QLJA 2GD1O 1DI0A 3KJZA 5JNRA 4TWAA 1XFAA 1GJRA 1SBIA 3MOSA 5FNVA 5LLDA 3PNMA 3HCDA 3OQNA 5KREA 4F1KA 2BFEB 4TX1A 2OMKA 3GAFA 3GRKA 3BN3A 1E1NA 1XN1A 2QAGB 2VZEA 1ETHA 5CLJA 1HG0A 4BPBA 1OYOA 4ZZ0A 1I4EB 1GCIA 3VNUA 4EY4A 3ITEA 5CPFA 2FN8A 2FUNB 2UDPA 3IP9A 4ZCSA 3H2HA 3TDMA 3KQQA 3WIUA 4LXXA 2CN1A 1X15A 3IMKA 4M86A 3H75A 4LF7B 4I1PA 1MAAA 1H0HA 1FIUA 2O1XA 3H86A 1SQ0A 3I05A 3TK1A 2UUBB 2ZAIA 3I1FA 3O0TA 4JJEA 1Z2OX 2VQ6A 1T9KA 3DYVA 3L93A 3MLBA 4QDZA 2X0EA 1SHJA 3G5MA 3F3SA 3EXHB 2XUJA 2Q8QA 4J0FA 2F3TA 2R1TB 4PHCA 3WWZA 2NGRA 1Z4LA 3H7AA 3G1UA 2XGMA 4FONA 2JLWA 2CVZA 3T94A 2OHHA 5AVYA 1YS9A 3T3MB 4AJOA 4PGAA 1JBEA 1R0SA 3KB2A 4IH1A 3PF8A 5DGCA 2F7SA 2VTDA 5IAEA 2E3JA 1UK6A 3R74A 3NBQA 4Y9UA 1N75A 5HF8A 4BBZA 1ZJWA 1SJ9A 5LZ2A 5GGYA 1M0SA 1C1YA 1RRGA 5ALGA 1TT5A 3ZLBA 5AI6A 4GKJB 5JSZB 3AXTA 5HBGA 1OWNA 1D04A 3D81A 5JQGF 1FFYA 2DRIA 1LI5A 4P08A 4B2IA 3G17A 4D43A 3VV2A 2OC4A 5ED0A 2YOHA 1C4XA 2O3QA 3DE0X 4BNXA 5G3ZA 3JQ9C 1JF8A 3I42A 2IKQA 4NHEA 2I33A 3WMXA 2I1VB 1OI7A 3WGNA 1Z83A 1D2NA 2CNBA 3TR5A 3B1FA 3R3JA 5JJKA 2HF9A 2LPMA 5I9LA 1DX6A 4RKEA 2XGJA 1INLA 2P0AA 4YAGA 4G4SO 2A9OA 3ORYA 4DMHA 4B35A 1I9GA 1EP3B 1DIHA 1LFAA 1THZA 5FI1B 5T8KA 4EYEA 1LK7A 5CAEA 2FR0A 3D4NA 4E2FA 2ZQZA 3DO6A 2PL9A 3IIJA 2O4UX 4WZBA 2GEVA 4L72A 1AE1A 2NU7B 4IRMA 4PINA 4CLRA 1F14A 4WK4B 1SHLA 2IZOA 1LKZA 2XIQA 3QITA 5B5SA 2QNIA 3T7CA 2OESA 3M89A 3OIWA 1OC4A 4LE1A 3E22B 3C3JA 1EVIA 5C34B 1VMDA 1X77A 2Z2IA 5DH9A 4HPJB 5KX5B 3CVYA 4QTUB 4BN5A 2XE6A 3EEQA 4P7GA 4UAGA 3UQZA 4A7PA 4B76A 4XYGA 2PSSA 4QPNA 3RREA 1QH1B 4YDSA 2O9JA 5BSRA 4KSBA 4UVEA 4XQ0A 1RTTA 4FFMA 4UMDA 2J5RA 1OKKD 4IFEA 3EJWA 2UZ4A 1H69A 3L6EA 3KTAA 1HR0B 4MROA 3VH3A 3RFCA 1AHPA 2VXYA 2F3PA 1II9A 2FG6C 3DZJA 4UDOA 2V1UA 4LSGA 1QV9A 2ZZMA 2VTVA 2GPNA 3W6PA 1F2UA 4IIUA 1Z0AA 3TLYA 1K5DA 1K89A 1XQ1A 4EB0A 1ODKA 3IEKA 2VSFA 3HM9A 1MRNA 4KB5A 3QQ5A 4KYIB 1P91A 2Q5LA 1EK0A 4H1TA 1SXPA 3P9QA 2Q2OA 4X91A 2XVMA 1V71A 2FWJA 4WV3A 3TTXA 4W5RA 3Q4GA 3COYA 1TEHA 4W5WA 4CKEA 4Q9KA 3AZPA 1AN9A 5AM2A 2W6JA 1WDKA 4OOEA 1IQRA 1RPZA 2BDEA 1JALA 2DPMA 3MM4A 3VYSB 2L69A 4PLTA 1GTJ1 1YUNA 3S99A 1XTTA 5HJ2A 1RE1A 4A03A 2IVZA 4YJHA 4P35A 4Q4JA 1PJ8A 1MDBA 1Q15A 1TJ5A 3FYUC 5D7BA 1MB0A 4ZVMA 4ZYZA 2H7CA 4X7MA 2DWUA 2NXWA 3ZJYA 1C14A 1JLLB 2ECFA 2PKQO 1CE8A 3BORA 4H0CA 4IRUB 4D74A 1OUMA 2X40A 2QR3A 3EXEB 3F7TA 1ZK1A 3GBPA 3OZGA 3TSAA 1SC4A 2WKRA 1EUDB 3GYBA 3IIIA 3VNRA 2P7IA 3ZDZB 5IBCA 1MPTA 2WPNA 4TRNA 2PH5A 2ZUEA 1ZM7A 1DKUA 1NNUA 4H0NA 1PV1A 2CXUA 4AMUA 3NB0A 5B7NA 4E70A 4JZYA 2I2BA 5FOQA 3EMBA 5GONF 3RV3A 1FQJA 3ONWA 4NOJA 1U99A 2C5AA 3GV0A 1KJNA 4AQDA 3TSWA 2J07A 4HGQA 4WUVA 5EWJA 4HGOA 4N41A 1MJFA 5I8ZA 3ILVA 3FBTA 1E5VA 3G68A 4DV7B 4KQ2A 3D2CA 3UG7A 3MGCA 1EFVA 3KZXA 1OU4A 5DN6D 5KTOA 4HBGA 1N1MA 3A36A 3EVDA 1TM7E 3PSAA 1RD4A 1XZEA 4MUBA 3ZKAA 2H9IA 5JMTA 1KYXA 2QSYA 1R27A 4M37A 1TMKA 3ANNA 4FFBB 1W29A 1GITA 1QIHA 3DTVD 2X76A 2K2WA 3ACDA 5HSGA 2CHGA 2IW3A 1PEAA 1OD6A 3LKZA 3MAGA 2X7XA 4GYJA 4MW9A 2QPLA 3WKCA 1ORDA 1IZ8A 3CUYA 4HAIA 2FWBA 4MS1A 5DM70 1DAOA 1YVDA 2VPWA 1SKUA 1AU9A 1S0UA 2PWZA 4R83A 4EX6A 5KYXA 3VI4B 5EJ8A 1T3ZA 3NJ8A 1S2GA 4PAQA 5CLHA 3RT9A 1UIMA 2GBLC 3S2UA 2NXNA 1Z8NA 1GPNA 3EAGA 4MR7A 4OUDA 4KYTA 4DARA 1TKBA 1RJGA 1OIVA 3NVKI 3B1ZA 4HH3C 3E82A 3ELDA 5E2BA 2QXTA 3ZZTA 1XLVA 1JXQA 1SVIA 3E70C 2Z9DA 4G4JA 1F0PA 1E9AA 1X7XA 1GZ5A 1EU1A 1N6NA 3G0CA 5C8YF 2HHAA 4AM8A 2WFAA 3P96A 5JD5A 2O19A 4W7SA 5LQUA 5JSUA 2WIBA 4NJEA 4B4WA 4ER5A 2E4AA 3PFNA 3BXXA 1KJYA 2XQFA 4BCBA 3ETNA 4JQSA 2C88A 2O2JA 4IQ4A 1E1QD 2HIHA 2GZ3A 2V9CA 1TGVA 4EEKA 1SC1A 1QO7A 1R0XA 3GF4A 1L5RA 1EDEA 1N3LA 4A0SA 1P9LA 2CLEB 3IBCA 4JDUA 4L0QA 3EQ6A 4M1QA 3QFCA 1EHCA 2BMJA 4F84A 1XI2A 1D6JA 2IHJA 2Y77A 3D8SA 2ZIVB 1RKBA 4JUBA 4N9WA 4RLQA 4YR9A 3Q9SA 2B4TO 1F1BA 4WQMA 5D87A 5EP2A 3ZWVA 4WLUA 3TGLA 2HMAA 4L1KA 1EGVB 4FEEA 2FSVA 4NYIR 3C7DB 3M4NA 1SUAA 4KAFA 1OFUA 4MUFA 4AN0A 2JLVA 1B1AA 3E5NA 2YW9A 3A1DA 1MNAA 2ZVDA 4PBSA 3SKYA 4YT5A 4Q1FA 2XMRA 1ZEJA 2AC4A 4LJ8A 4W1QA 3T52A 5CVCA 4MLZA 2YVLA 1KDVA 4BYMA 1D9ZA 4CIVA 1I3CA 4E12A 5CFMA 4DR2B 1UPTA 2H4WA 2AHRA 2PWBA 4L3WA 2PSFA 4NWIA 4YJFA 4F8JA 5KKCA 2J9RA 5FOUA 1BRTA 3DKKA 3R5TA 5DNWA 4LJ5A 4IJQA 1LJLA 1K0FA 2D2EA 1K86A 2X0IA 2B92A 4ZO7A 3ROMA 4LZWA 2ZSDA 4NZZA 3A0RB 5DI3A 3RTBA 4GPD1 4B4KA 3LPCA 1IHOA 1TM3E 3A9UA 4OAPA 1PS8A 2XT6A 4B81A 3D3WA 4OATA 5TJHA 5KQPA 2C42A 4JBHA 3IP8A 2JGRA 3FUXA 3EG9A 5T3YA 4BXOB 3VOTA 5KS2A 4ER6A 2XECA 3B5EA 4A0HA 5KYNA 1XTQA 1HYBA 2QRNA 2OGTA 3STUA 4LJRA 3TBKA 3EBPA 2X1LA 4L07A 5ALKA 1KETA 1NNEA 4I3GA 1GGEA 1LQ2A 2ES4A 1US8A 3BCRA 3DXYA 3Q5DA 4DBZA 1JFFA 4HAVA 3SJBA 1CQPA 4UTRA 1H42A 3BG5A 3UFXB 2Y0DA 3H0CA 3ADDA 4KQHA 1YZUA 2RI0A 3BXGA 4ZOAA 2YOGA 5ALFA 3TXXA 1CNEA 4MUNA 2ZJZA 1RKQA 2LCFA 2W6MA 2H1CA 2X13A 1I5OA 9ATCA 1ESEA 1EFPA 4N8DA 2WW8A 1BWRA 1PZGA 2WOOA 1K4YA 4K6CA 2Z2JA 1IOLA 4TV8B 3QVUA 2A0XA 2QL6A 4IWYA 4ZJUA 1JHAA 3PNKA 4TWBA 1J70A 3ZZMA 4A3SA 1SPBS 1NVEA 1SBYA 1RMYA 3EVNA 3AVQA 3UKJA 2CMFA 2QUKA 3V8VA 4HXYA 3PDCA 5H9VA 3KHTA 2R84A 1C81A 2G1UA 1QRDA 2QI9F 2XD9A 2DGDA 1LBSA 1N8NA 3NPMA 3OT1A 3PR3A 4L95C 1Q11A 3ZD9A 5C81A 3GI1A 3I01M 1ISSA 4OHMA 1AKUA 2WHPA 3R5KA 2R5FA 4MV3A 3GMDA 3OIFA 3VU0A 6CHYA 1FMJA 1DO8A 2ORYA 3L7NA 1E4VA 4GOLD 3AUSA 3CMMA 5AXDA 4CL8A 2ZR9A 1UXHA 4HDNA 1M2OA 4MQUA 2UXBB 2VYQA 3SSMA 4OREX 1B4DA 1DAGA 4HXFB 5DWVA 2G6TA 2PCJA 2Y99A 3LAWA 3P2YA 3PGA1 3PGKA 3SD7A 1OLSB 4C20A 1K08A 1SO8A 1YV9A 2JVIA 1H22A 2VDPB 2RIRA 3O2SB 4EHAA 4ZI7A 3GFOA 2E4YA 3VOSA 1JDBB 3IOCA 1DJNA 4JWTA 2VOJA 3SP1A 1VE9A 2OCGA 3L07A 2O20A 3PC6A 4IX9A 4Q4HB 1LFDB 4TSFD 3E9NA 4XAQA 3JQFC 4DB2A 1BVUA 2BF7A 3H1PA 5T3UA 1PZXA 4R1PA 1IEQA 5EXSA 5I5EA 2Q3LA 3KV1A 1E3WA 4B09A 2Q1SA 1CUAA 1A8IA 1YIOA 4P3NA 2NZYA 5BRJA 3ETGA 3Q11A 4KUHA 4ZO8A 2I2CA 1Q1EA 1G9SA 1T91A 2QHXA 1I9CA 2AYZA 1NBMA 4U1RA 3I5AA 2Z57A 4AKHA 3K8ZA 1PDVA 3AI1A 4YTEA 4E5PA 4FINA 5F7XA 1COWD 2Y1KA 3PLRA 1JE0A 1QU3A 2WJZB 4Q82A 2W00A 1PVOA 3SMQA 3MWFA 2YJZA 1QV6A 4DC0A 4YP0A 4X84A 3N2NA 2ANBA 4EKIA 4ZU6X 2I55A 1RM4A 1ZBQA 1U2PA 5FUBA 2XWQA 3WC4A 4RTJA 4D79A 1DAMA 3WHLA 2UAGA 1DCTA 3UGQA 1C1XA 3MTIA 4NBTA 1E2NA 5JAOA 3W2FA 3X1JA 3GJYA 4PYMA 1B43A 2D2XA 3SZGA 3S2IA 5K2OA 2E1RA 2GM4A 1LLFA 1MIHA 4BNIA 2D2IA 3AFOA 2MCFA 3WLIA 5BOSA 1CIVA 2BFNA 5IDXA 2FPSA 3IEIA 1CQXA 1E2LA 3QLUA 6PFKA 3KJHA 4RORA 1CNMA 2J09A 1KGDA 3I58A 4KPFC 3OZ7A 1XNJA 2DFKB 1GLGA 1Z15A 3FYHA 5D3QA 2JARA 3QXJA 1TM5E 2P9QA 4D0RA 5M7EA 4BX2A 2IYLD 4B3HA 4JT4A 4UHDA 2WYIA 3H4TA 1QRSA 4QU8A 1UJ4A 4YV2A 1SY7A 2XUOA 3DD1A 3L40A 1C7JA 1NW5A 4MQBA 3GO4A 1XXHA 3N2IA 3OLYA 4RY2A 4XFDA 4I1VA 4GSKA 1JAHA 4IEEA 4IVRA 4MS4B 3A6EA 1CJTC 1REQA 1VSTA 4W5JA 1QVWA 2FEWB 5DBOA 1PWHA 3CLSC 1M83A 3OC6A 2NVUB 4GD3Q 1FP6A 1SBHA 1MX9A 4GX1A 5DRTA 3W3ZB 2ODWA 3L5KA 5JQGB 3BERA 4YH1A 1PT9A 1VIDA 5T6BA 5CG1A 7REQA 5D01A 2EFDB 4AQ7A 3KRTA 2VKTA 5B1YA 1Y3CE 1C4OA 2PKRA 3KT6A 1EFLA 3OO0A 2PMWB 4GS5A 4IF4A 1X1TA 1FDIA 1G3RA 3PQCA 4MLCA 1THTA 1EFHA 2IXAA 4DM7A 5C9ZA 1QBKC 1M6YA 4IIEA 3KXPA 1MDFA 4V39A 3WGUA 4CL2A 3WB1A 2Y8EA 3Q1KA 2WU0A 4OQFA 1W1UA 1HT0A 3AEXA 4NOKA 1RFGE 1BFKA 2H4YA 4GLJA 5DASA 4TKVB 4BLVA 4QQ8A 1IQ0A 5D5HA 4B87A 1AQNA 2C4NA 4QUJA 1UBGA 3L6DA 4JK3A 4F2DA 3TTTA 4I1RA 2QYOA 2J3EA 3OTIA 1SVUA 2QL7A 2AMFA 4P4GA 1YK0A 2ET6A 3AHFA 1CBUA 4ZODA 5JDCA 4G5SA 4L2IB 1OW3B 3BWBA 3SSNA 4HV4A 3BULA 3ZS9A 3PXUA 1UBRS 1KZ4A 3TX2A 3MIIA 1QGAA 2YYYA 3UWPA 2WKQA 5TB5A 3S2ZA 4OCZA 3R7LA 2QROA 1ZRHA 4WDQA 5T64A 3KZOA 2J45A 1LZLA 1KYIA 5FR1A 4Y2HA 1L8LA 1TF7A 1UIRA 1IN6A 2ENWA 2PH3A 3BK1A 5KBYA 1SCIA 4IM7A 3VKVA 1MAUA 3WRXA 3B9PA 5K0CA 3A26A 2O8BB 1IY0A 1LWOA 2IYUA 2K7ZA 2PDAA 4QSHA 2PXCA 1CD5A 4BNZA 1M7BA 2OWDA 1BEEA 2H5JA 2ZRHA 3FH0A 1ZK2A 5TE9A 2UV8A 1KBZA 5CB6A 2CZQA 2CUKA 1YU6A 3MAAC 4NV1A 2CD9A 3JPWA 4OHPA 3OFKA 1H66A 3A32A 1JEQB 2J6HA 3HB0A 1P7PA 1VJTA 5LVAA 3BMCB 3D6HA 2RCNA 4M8NE 2GPWA 3AHIA 2F8SA 1XZMA 5E3JA 4TL6A 5FBKA 4HSEA 4N7BA 4QNRA 1AURA 3UANA 4DCUA 4IQ8A 5JAMA 1Y1RA 4FB4A 5A5EA 3D4PA 4ZPJA 3D1VA 4FWTA 3QVXA 4NEGA 3D64A 1XDSA 1WVGA 4CDNA 1P29A 4LRTB 2CYCA 4RLSA 3VR5H 3HVJA 1MIOA 4TWZA 1UXJA 2P1RA 4KAXA 1EIZA 4A91A 2A33A 4JOSA 4MIEA 4FGJA 1YR2A 4S1TA 1ISIA 3AL0C 4TXMA 3LP5A 4TRRA 4JI6B 3HCEA 5JSHA 3IESA 1JHQA 1YOVA 5EEHA 3T5TA 1MFZA 4YRBA 1Q6ZA 1SC6A 1E6WA 2C4WA 1JPUA 1HFWA 1HE8B 1V4BA 2IYAA 1QGOA 3KLMX 4G5HA 3ZPXA 4YDQA 4KODA 1DO0A 4G84A 4NYMQ 5GONB 2L82A 4JKOA 3DKPA 4PXAA 4BU0A 3KCNA 3IP5A 1RXIA 1ZC4A 2QXUA 3UK2A 5M04A 1QLHA 2VATA 4GP7A 2WTNA 1GY8A 2PZGA 3EQZA 4UMFA 3JWEA 4XCQA 3ZCTA 4CTNA 3BWXA 1QZZA 1KH1A 3OCCA 1QGUB 4RIIA 5DTMA 3M3HA 1DOHA 3DTYA 3DLHA 1WHSB 1V9SA 2HQRA 3UC9A 4ZTBA 1V6CA 4IGAA 5KQGA 4PHHA 3C97A 1ZEMA 4EKYA 1T9GR 2G77B 1CRWG 1BX1A 1H65A 3KR9A 1DTSA 1LSOA 1U5BA 1LSJA 2R6FA 4AU1A 5AW6A 4HGRA 3SJAA 1GILA 8ADHA 5EJFA 1CF4A 2VUIB 5KOJB 4PNEA 2OL4A 4RHYA 3ABSB 1C29B 5KVQA 4BNNA 1P7CA 2R6R1 4CJXA 1G60A 1ZW6A 2FW9A 3IILA 3OEEA 4LTDA 2G5TA 2X3FA 5JC1A 2Q0HA 2XQIA 3O7WA 4EYOA 2I2XB 2NW6A 2AXQA 4KR2A 3KLOA 1KKUA 1LEHA 4J6FA 3GJXC 1ELOA 5C8YB 5B3AA 2YJ5A 1QSGA 1SKYE 4MV1A 4HX9A 3EVTA 4N03A 1TK2A 1Z0ZA 3AL3A 1MN6A 1YQ9A 1K8QA 3TIIA 2FVYA 4KMSA 2RJ3A 3TSCA 4PPGA 2BV3A 1Z68A 1NJ5A 4H77A 2Y1DA 3U09A 2H1OA 4BNUA 1ES9A 1U0JA 1Y7IA 3DEYX 5LU9A 1FPMA 1QE5A 1V0JA 4UFNA 1G38A 5DTQA 1MJHA 1NQXA 2WFMA 3IDFA 3UHFA 2VNJA 1CUXA 3DE5X 2N0SA 5DWQA 4TKUA 5EIBC 3ZNOA 4C6SA 4OTZA 3ZCVA 2GTHA 5I47A 1Z2DA 3LLSA 3WYCA 2ZWIA 2XTNA 2RGXA 4YECA 1NR5A 2XMGA 3O5AA 4RHTA 5KYYB 4WK0B 4JXZA 3A1FA 5FD8A 3F1KA 3KETA 3KYIB 4MQLA 1N7GA 5HTKA 3R8XA 1DBWA 3Q87B 3JAKA 2YOFA 3OMXA 2IGTA 3JXEA 4WNYA 5H81A 4EKGA 3BWDD 1YFJA 3AKEA 3BSFA 3PHBE 1GTMA 5CVJA 3B1JA 3V9AA 3R7NA 1ISRA 5EKUA 1XRQA 4R81A 1CLUA 3K09C 4LYYA 3FSGD 1P77A 1SXQA 1SMKA 3G2OA 3ENZA 3I09A 2R86A 1U02A 1NVUQ 1R00A 1WU7A 3FMPB 4DABA 2FJ0A 2YBDA 3IJEB 3LFUA 3ZHRA 1A5TA 1GUDA 1IQPA 4RTLA 4TZ0A 1T0UA 4IZOA 5CDHA 4LJSA 1OY1A 3EF0A 4U7JA 1XVAA 3BWYA 4RVSA 3W78A 3QEBZ 5DHQA 2G7ZA 3ZXYA 4BLWA 4LRSB 2I2AA 4EGJA 4GKAA 4ZQEA 4DLNA 1G2IA 3EOZA 1XTUA 2B8WA 1WTCA 5CLIA 1N9GA 4MGEA 5FOSA 5EE5B 1ODCA 1KK2A 3VYVA 4JI0B 1N2BA 2IW1A 1QBGA 2Q1XA 1NT2A 1SKAA 3GUUA 1W87A 1UWKA 1JJVA 1TKRA 3IBYA 5KYGA 4KNYA 1EP2B 3BGVA 3HC7A 4C7OA 4UC0A 3KKLA 4LVNA 3LY9A 3RUDA 3VZPA 4EG4A 1Z12A 4L16A 1J8MF 3BTUA 1J1IA 5HK8A 3TTVA 5J4KA 2QBYA 2CXSA 2ZI7A 2Q99A 1VCMA 4OPMA 4PCUA 4GLOA 3OE7A 3CW2A 3ESYA 4X71A 1JXMA 4DCPA 5MDHA 4FS8A 3GHHA 1PJ4A 5FTNA 1K7FB 5BMOA 3A8TA 4IV0A 4E46A 2AVNA 4I55F 1YZKA 1XZQA 3ZHTA 5A4IS 1E96A 2DWOA 2F1JA 1TCAA 5HE9A 1K6MA 5KYWA 3EAFA 1ECPA 1AJEA 3AJRA 4MARA 3K6SB 3HWSA 2Z6AA 5LIRA 1OVMA 1F38A 2RGDA 3K1YA 1GRNA 2HUPA 4C7BA 1Y89A 4DGQA 2O54A 3B9QA 3W79A 2DM6A 3ST7A 3V4RA 1Z47A 5AXAA 4H7FA 5KZMB 1IBLB 1ZSVA 4II7A 5EZ5A 1APBA 1NWCA 3L7DA 3UH0A 2PR7A 3LUFA 4BNKA 1ZIYA 3MMNA 3TXAA 3AY7A 1E3SA 2Z3VA 4UTZA 1GZDA 3I8XA 4Q0MA 1F8YA 1G8SA 3GLKA 4ICIA 5I7WA 1R2QA 1U6KA 2C20A 2HMYB 1X38A 4KLZA 3RFUA 3RU9A 1QS0A 2MSWA 4NV0A 1U8UA 3LQ4A 4FGSA 5DP2A 5ALVA 1XQWA 3TRHA 4AX8A 3W5BA 3RU2A 2J0VA 4JV5B 2VLBA 2XB2A 4AO8A 1YJAA 1DDOA 2FKAA 1N2CA 1NNI1 1WXHA 1SA0A 1WHTB 4N1AA 4OV6B 4BGUA 3I52A 2O7NA 1RNLA 2PKYX 1I2BA 1P1RA 1SCNE 2WAXA 3KUDA 2Z0MA 2Q3CA 4KIFA 4O8ZA 3V9PA 3QMVA 4S1NA 4E4YA 3EFOA 5IBPA 1XDZA 4X54A 1NUUA 3H5LA 2GH1A 3P9XA 3L7KA 3TZHA 4ZHQF 2DU8A 5AUOB 2UYCA 4TMVA 2P75A 4Y67A 4XM1A 1L3IA 5I4BA 1E7YA 4BPRA 2IZ0A 1EP9A 3FYDA 4G4GA 4GGMX 5BQXA 5C80A 3AYZB 9ABPA 3TUIC 3EUFA 3NBMA 4G24A 1Q57A 1XKLA 3G8CA 2Q1UA 1QZ3A 3AGPA 1Y33E 3N2GB 5CH3A 3RVRA 2OAEA 1OHHA 5LYJF 3QE0A 3M7IA 1F20A 2FPRA 1EGQA 3ANXA 2JHGA 1Z56C 4GLBA 4MW7A 2XT9A 3JQAB 4DDWA 2HWYA 4WADA 4A1OA 3O8RA 5AKXA 3EIXA 1HV8A 1NM5A 3M2TA 1Y42X 2QYHA 3DBLA 3FZQA 3ROTA 2DQ4A 1J09A 2CWWA 5FLYA 1X7ZB 4PR0A 2ZSJA 1TQDA 1ZNYA 3JAWA 4G8BA 1Q83A 1ZI8A 1X2EA 3Q8XB 4OY3A 2IHUA 4DG8A 2OQ2A 2WYUA 1ZA2A 3AFGA 1VHTA 4X60A 4DIEA 3E2MA 3BD9A 1ZN9A 5FAXA 1YTUA 1W85A 5A1TA 4BP8A 4KX3A 5DKFA 1DRUA 2NYVA 4FNMA 2Z30A 2I66A 2ZVQX 4CT4B 1LY1A 2RGCA 4CEIA 4YAKA 2OBLA 4UULA 3L02A 3TQRA 4BX9A 1YQWA 3QLVC 3ZCSA 5ALDA 4EGCB 5DWDA 2GASA 2P4HX 1CP3A 5JROA 2ATIA 3V6LA 3FM9A 4J4BA 3E3LA 3EGWA 2QTZA 2VT7A 1VG8A 2OV1A 5CDYA 4IKPA 2GCPA 4KRGA 4YRKA 8GPBA 4HYYA 4L5IA 2O0HA 1PW7A 3O8LA 2FG5A 2X2OA 1E6LA 4MI9A 4MW2A 4G9EA 2AT1A 3T61A 4LWOA 2QIOA 1BYIA 1XV5A 4RM3A 3MT7A 5EWMB 3D7SA 5H16A 3RUIA 2CJWA 2R8YA 3T8YA 3UK7A 1I1HA 2O23A 4HL6A 4BV2A 3ERCA 1Y8QB 3GXBA 5K2MA 3OIVA 1FUEA 1I2AA 4KMRA 4OI2A 3GIDA 3SS9X 3UWDA 1J9EA 2CXPA 2JRCA 4QKQA 3W06A 1EFTA 2P9GA 5DHFA 3RF6A 2BM0A 3PJGA 1CUEA 1W49A 2WMOB 1BN6A 4BTLA 3G2IA 3JALA 3QIAA 3DG9A 1PRYA 5A3JA 1U0RA 1GEGA 1DARA 2IBSA 3K73O 4IHQA 3KZNA 1RYYA 5IKMA 1D09A 2H7VA 4JQCA 4KBFA 4G5XA 4KMOA 2VDNB 4LX8A 4JKIA 1SOUA 5FAKA 3KJEA 4PS0A 1ZD9A 3RIEA 3PKIA 4CQMB 2ST1A 3S44A 2WD7A 1O0BA 3A7EA 1PYGA 2QY6A 4PQRA 1GZVA 3C0KA 2HF2A 3V5NA 4DIOA 4YRTA 4EENA 2GXAA 4UDYX 1PZHA 5EE3A 4TTSA 1UKBA 1HKHA 2FN4A 2DT8A 2VT2A 4PAWA 4ZU1X 4BL5A 4U2EA 2C7VA 1BJTA 1F8XA 1VHDA 2JVJA 1XEWX 4KZKA 4I4TB 2LW7A 3H4MA 1JIKA 3BDAA 4PZLA 1QYIA 3Q5GA 4CETA 4RKQA 3P2IA 4BECA 4FYVA 2GBGA 4Y3UA 2JI9A 5F12A 5IARA 5LA6F 4ZCMA 6Q21A 1CY1A 1Z63A 1XPJA 4PO1A 3ROPA 2M6RA 1YZ3A 4IINA 1JDSA 3GLIB 1NASA 4R3WA 1HOTA 1JH9A 5LP6A 3U9TA 1V7PC 1Z88A 1KNXA 1MB4A 4FEAA 3OT5A 1KKLA 2ZUSA 4C14A 4WESA 2GBCA 5JATA 1JI3A 3BMNA 1UOEA 3ORHA 2VJQA 4XWAA 3R3XA 2XUPA 4Q12A 1I0IA 1JEYB 3GFPA 3O03A 5H4HA 1T8RA 3E8MA 4QDJA 1DUIA 1HH4A 1CRQA 1UJ5A 3OKPA 4N5DA 4DKXA 3FSEA 3QU4A 5K05A 1II8A 3FIUA 4WOCA 1Q12A 4FGKA 4OJYA 4R69A 3ELUA 4V0MA 4YJ3A 5BUSA 4NSNA 1MT3A 3WY9A 2X8JA 5D85A 1X3LA 4D8UA 3N8HA 1I0LA 3MRTA 3M3DA 1GYQA 3ULKA 1OWPA 2YIVX 4JBGA 5FTMA 3IOEA 3PEEA 3QFFA 5TEWA 1CZNA 4OXYA 4DQ0A 5KVVA 1ECFA 1P4JA 2FLVA 2PG3A 2Q2WA 1PL8A 5B58C 3K31A 1BDMA 4ZOQI 3KSRA 4MVWA 4PZYA 3EMVA 3UT6A 1ZXXA 1QHEA 2UVPA 4PXYA 5SV2A 2XVAA 1SWVA 3GLSA 5EFZA 1N4AA 1RCFA 3PUZA 4AY4A 2XRZA 2MU1A 3OAAA 5BV8A 4FD3A 2WLTA 2F1IA 4QRHA 3ESRA 3Q40A 4H7IA 5HYVA 5DNUA 4RGYA 3DQQA 4Q5IA 5IX8A 5JWRA 3G7SA 5D84A 3DB1A 3WWDA 4AIIA 1XRLA 4HNHA 4KV9A 4RTRA 1BXZA 3TKYA 1AKMA 3RLIA 2FW0A 3RQIA 5CFOA 1JG3A 3FHCB 1KI7A 2GK3A 1CDOA 2SKEA 5D5QA 1AV7A 2CK3D 2CLHB 3ZV7A 1MXFA 4BFUA 3FE2A 3TFWA 3Q15C 4K81B 3C41J 5FPYA 3D3NA 2O3TA 4D3XA 4EKDA 5AESA 3CVXA 5B6IA 1K98A 4J2HA 2JEOA 4G56A 5KNDH 1FZQA 3WRVA 1KL7A 3H5RA 3S27A 4BO9A 4DCJA 4KLAA 3NYRA 3GPIA 3IDOA 2FMKA 2W6IA 5L7TA 3C6QA 5BSWA 4GWKA 2GS9A 3SZRA 1T2VA 3ESQA 2OUIA 5EHNA 4EHHA 5J5CA 4J0IA 1FVXA 1Z13A 4HWGA 1L7OA 3FNRA 3N8IA 4KE7A 2JD1A 1DC3A 1OLXB 2O4CA 4G09A 4L28A 1NXVA 2DUUA 2IHTA 2Q46A 1QE3A 1SK8A 5HMLA 3SOPA 2QT0A 1YC2A 3PPIA 1JPNA 4LECA 4AY2A 4BFSA 3HXKA 5CTJA 3ANSA 1TRHA 2VDKB 2VNAA 3EXIB 3KVRA 4QGAA 2WWGA 4F21A 1IBMB 2GYWA 3SU8A 3W05A 1A04A 3E1GA 4U9UA 1SHZA 3COWA 1RACA 3YASA 4Z0HO 2DOKA 3WTCA 4OHKA 4XM0A 3V46A 4D9GA 2ERYA 4YBRA 4D6PA 1GWNA 3F9CA 4GMGA 1DKPA 4ZI3A 1U2DC 3RR2A 3D4LA 2XZOA 5A2GA 1QCDA 3IO3A 2AOTA 2M2IA 4BBAA 2JI6A 1P0MA 4AICA 3QOYA 3BWCA 4US1R 1G4UR 2PANA 2MHCA 3CSSA 1BO6A 5IT4A 2VRWA 5DTRA 1ZMBA 1UMCA 2GYVA 3DMFA 4B82A 3TOXA 3HB7A 5AQ1A 4X00A 3ZDYB 2W43A 1V8FA 2N1BA 1NY6A 4RPLA 4DILA 3RRMA 4OQDA 4EB6B 4C4TA 4EATA 5KNBH 4C2TA 3IS3A 5K45A 3ZU6A 3LO8A 1E0JA 3VNQA 2IE0A 2YYAA 4KW7A 4DF3A 2HRQA 5A2QA 3K9BA 4DSUA 4P3YA 4LOJA 2UXCB 3GEGA 4XLLA 2I87A 3HKDB 1X70A 4QYWA 4UHKA 1FSSA 4UTNA 2Q1TA 4TYQA 4E22A 1PNVA 1P4RA 5E3IA 3COPA 2QVCA 2PFKA 2B20A 1W36B 2Q1WA 3KWLA 4GUDA 1SQGA 3VU3A 2XMSA 2VI5A 1JJ7A 2Y27A 2ID4A 2FNAA 2OG1A 4IMPA 4JJFA 1C41A 4TMWA 4D45A 4UNSA 4H4CA 1GQRA 3PQ4A 4K9QA 3O4RA 2NU9A 5E7MA 2GPJA 5IKOA 1DC8A 2XYPA 4NK5A 1NUTA 3AKYA 1Q17A 3GHYA 2GERA 4F3RA 4DV3B 3FMIA 5JH7A 4NFLA 1QH9A 1UKVY 3C8UA 1SUCA 2FX2A 1NVDA 3EVCA 2XITA 1GZ3A 3R4CA 4FX2A 1XVTA 1NJGA 1NQWA 1O97D 2Q5OA 2HXGA 1KJWA 2PU5A 2ZTLA 1THGA 3DEZA 2BMDA 3I04A 2R6AA 3L8EA 4I55B 4IMRA 4YYEA 4A8HA 2UUAB 4I1UA 5KQRA 1BXRB 2R5WA 2XX3A 2QV7A 1ORVA 3B51X 3IA7A 1XJ0A 4IVNA 4K8OA 3CGGA 1A0OA 5CLGA 4DNFA 2C1XA 4DCSA 4E5YA 1JDVA 1E7SA 3OJOA 4O0LA 1W9MA 4GUAA 2NOAA 3D59A 4B6RA 2QRKA 3KKZA 3U9SA 1HE2A 4WKGA 1Z5UA 4K86A 1V25A 4DYDA 3RSLA 4LXQA 4B6EA 1VPWA 3NFYA 3FUCA 2PS0A 3HJGA 1L5MA 4PTYA 3DLTA 2ADOA 4TROA 3VMFA 3KIPA 3UMRA 3K16A 1QC5A 2WSYB 1KKMA 4O4IF 1NVMB 1TVCA 4JWKA 3MS7A 1ZR4A 4CF3A 1QIDA 5AHKA 5K51A 3W5SA 3WAKA 2N9UA 2QRZA 2QX8A 2ZTVA 1U6JA 3ZHXA 4KDCA 4KDEA 3F47A 3DEAA 3EZGA 3OCZA 4CKWB 3SQXA 2C59A 1QP8A 3HHEA 3ZDXB 4F0JA 2CNWA 2Q07A 3KKKA 1QIKA 2GHRA 4LPSA 2GM9A 5TQJA 4M98A 2H0AA 4Z3KA 4KPGA 4ZHSA 2OWEA 2R7MA 3W04A 3WB9A 2RGEA 2JFHA 3ETEA 4JS0A 3JQAD 2MJLA 3NWOA 5ICCA 3K72B 1VHQA 3QK7A 4P3PA 2RHWA 3FYUB 2WM9B 1TFRA 2EHJA 5I7EA 4FMPA 3I9MA 1SKMA 1Z8DA 3IUJA 2Y1GA 3H1EA 1QHGA 1PTJA 1B76A 4OGGA 5GP1A 2SKCA 5EKDA 2OOSA 3OVMA 1J0BA 5FO1A 3JVUA 4ZHQB 1XZHA 1WW3A 3QX8A 4G0OA 1NXWA 3V4SA 3SBDA 4H9GA 3VO2A 2OSBA 16PKA 1ML4A 1YB4A 1QFSA 3JQBA 4IIJA 4WLNA 3VJMA 4EG3A 4BMDA 3NTLA 2YQ5A 4JI8B 4X41A 3TVDA 3K9WA 1VIMA 4PFJA 1QPGA 4BLOA 4UHCA 3UAGA 2EX1A 1F9AA 3ECSA 5CLQA 4UHJA 3V80A 3IQDB 2RBEA 3NHAA 3ZYZA 5LYJB 1Z5OA 2BM8A 3HA3A 4EFKA 5I9NA 2F1OA 1OH5A 1KDPA 5E38A 3UV6A 4B7UA 4JELA 4LZOA 3AWDA 1BA3A 5AM0A 4C21A 2OZVA 2R65A 4AZ3B 4DLAA 3DBIA 2QTLA 3MBOA 4GBMA 3B78A 2B9EA 2WP8J 4PN3A 3FTDA 3TZQA 5AUPB 3TPCA 2NT4A 4BFLA 4FHGA 4D41A 3PWKA 1LW7A 4IS3A 4KYUA 4BVLA 5K7SA 1MABA 5G0VA 5BWMA 5KTRA 3OJEA 2O2EA 3KYJB 4HMQA 3KEQA 1BTOA 2ZYSA 4XOUA 4UFOA 3AKZA 2IA5A 2VXBA 4HLCA 5FPKA 2HDWA 3DUFA 3PDIA 3A6PC 4AJ9A 4GEGA 3DHEA 1H3FA 5B4VA 4JLPA 4UUBA 4ZO4A 4RV5A 1NRWA 3COJA 1D2EA 2HWWA 2BMFA 5AM5A 2PGJA 5LZ8A 5AVSA 5FA8A 5IG2A 3OTWA 4IW3B 2AOUA 4URHA 1RXVA 2SBTA 2F43B 3HCAA 2C5HA 1CJMA 4ZEXA 4MJ7A 4E1AA 1KAHA 4NAVA 3QUTA 5BNWA 1ILWA 2BFBA 2ZJBA 4J1TC 1X74A 4R5MA 4RV4A 8ATCA 2OO5C 1MH1A 4BVHA 4CQMD 1TTQB 1XHEA 1ORTA 5E95A 1LTKA 4XIGS 4B40A 3B1YA 3MJVA 2WVGA 5BOVA 1BG6A 2D3TA 5AM3A 1JBQA 4M22A 5EKXA 2ONJA 4G1BA 4JX8A 1KJIA 3K0HA 1SCKA 4GWLA 2OCAA 3PBKA 1W0KA 3PRJA 4DRYA 2WQ7A 5KTYA 4F5WA 3V34A 5F33A 1U7XA 1NBHA 1RLTA 3N0WA 4FKMA 4MR8A 1EDZA 1LBIA 5AO9A 1DFHA 4RA9A 3THSA 2AD1A 1DEKA 2R62A 2XUZA 1FRFS 1EQUA 3DMTA 3N0TA 5E7QA 4WERA 4CEHB 2GK6A 2J32A 3VSEA 5M3BA 2VBIA 4B4DA 4KQJA 4DSNA 1XXLA 3IQGX 2C29D 2HU7A 2AXPA 3B9BA 1QYVA 1YCDA 2B35A 4OD0A 4QOJA 4TRJA 1DIGA 5IW8A 4DA0A 3DAFA 3HKCB 3PDJA 4P4SA 3FTNA 4TLAA 5KJEA 3EA4A 4QGSA 2CD7A 2AW5A 2IHYA 4PYRA 4AN4A 1PNRA 1U0BB 3OE5A 3RYFB 4RVOA 2VH5R 3MWDA 4WY8A 4ZREA 1GVHA 4HAZA 1V11B 1WCWA 3HE3A 5U4XA 2RHCA 4BWGA 4KFCA 5COBA 1M6VB 1ABEA 1U0OC 2C1ZA 1X1BA 2D62A 5YASA 4Z3DA 3MTQA 2AJTA 4BLQA 1NBOA 1FMCA 2HMWA 1P5ZB 4ESEA 5LA6B 1JDTA 1IN5A 2WSMA 4LISA 4MA4A 1VPEA 4FYPA 2GRJA 2RGBA 3GQBB 2FPWA 4UAJA 1NONA 3K2QA 5IH3A 3ZIAD 5JIBA 3T38A 2HT6A 2N47A 3CN7A 3U7QB 2FPIA 3HXTA 2GO7A 4JA0A 3JYQA 3RUHA 4UOZA 5FPTA 3EX7C 4MDEA 1JIXA 2PM8A 3RASA 2LDBA 3JQ8A 4D9CA 1F4PA 4WNAA 1QCZA 3CF4A 3VDNB 1L8QA 1U4OA 3C3MA 2DH6A 1C4WA 4JC5A 3BGWA 2PD4A 4JUAA 1H23A 1Q1QA 2ZUUA 3FVTA 1MGPA 2EBWA 2OP1A 4L15A 3CNNA 3HJCA 4UVHA 4OXNA 4YAFA 3RYCB 5CFQA 3GCXA 4TMXA 3M49A 1CUIA 4J6EA 3LI2A 3LBIA 4W5HA 1MA3A 9MHTA 3A4NA 3BMQA 3GJ8A 4MSUA 3QBDA 1SD2A 1RRKA 4X0EA 1ZJYA 3LD9A 1N2XA 1XTIA 1DCFA 2XGGA 3WL3A 2BI7A 4V3CA 4QFBA 1GAWA 3NHRA 4LWPA 1D1QA 5EWLA 4ZRMA 2YFKA 1KJ9A 4HB2A 1P2FA 3AI7A 5J58A 1V1MA 3A05A 1XK6A 1JZSA 2J9FB 3BMOA 5CPBA 1YVRA 4L7QA 4Y6GB 4GPTA 1UM9A 4IGEA 3X1XA 2LDXA 4X6LA 3KAQA 2EKLA 3BJRA 2OYSA 4Y9DA 1PX2A 4MUAA 4XUDA 4FTWA 4QUDA 1F51E 1U7OA 2PMBA 3O8DA 1UANA 4C6HA 3I6YA 1LDBA 2FYTA 1NIPA 4MKFA 4CM3A 4JGIA 3BJEA 5I9BA 4KN5A 4OB6A 4LYAA 1Y7HA 1B1CA 1IZ0A 3MCVA 4I14A 5JHHB 4EKNB 1NN5A 3EDQA 3IE1A 3HCRA 3KPJA 2BKLA 2VWGA 1ULTA 3HJTA 1PWZA 2X5XA 4QVIA 3NDPA 1OT3A 1MEEA 1TJ3A 2IYRA 2V98A 3AI3A 4TT3A 3UPDA 3ZGLA 3ZVRA 4GMDA 1E62A 1FTNA 1YMUA 3LT4A 3WQSB 2G9VA 1M0WA 3SM3A 1V4NA 3CF0A 2XHZA 1CR0A 4QBIA 3LFHA 5BRAA 1ZOIA 1L7EA 1J56A 4YYZA 5JSYA 3I04M 3SJZA 2BFDB 3QBVA 1KC3A 1C8KA 3REQA 3IVRA 3RC8A 2WTAA 1OFHA 3OLWA 1CUZA 1T3SA 1KK3A 1Z5GA 5IWCA 5F73A 1XZIA 1VE5A 2C7BA 3WV4A 1NX9A 2LNDA 1GG8A 3N2ZB 2LCQA 2O0MA 2O14A 1YB2A 5CCDA 3UICA 4RHXA 1DOAA 1IMJA 1GPBA 3OFSA 5CB4A 3ROKA 3OOWA 3ESDA 3Q8WA 3KQLA 4DT1B 4K0RA 2I8LA 3PT5A 4EW6A 4UVDA 2DFNA 4DR4B 1WXXA 2BFFA 1XZFA 3ICPA 5K0SA 1EMDA 4OF4A 4OOFA 1ADGA 1OLOA 5DN9A 5MFZA 2KX7A 1AQYA 1PWEA 1SHTX 5I5GA 2ZATA 4CE6A 4K2AA 2VHVA 1M9NA 2HA4A 2Z56A 4YP5A 3ROZA 4FM9A 1L3CA 1VRWA 1L7QA 1IJEA 1Q2UA 3HSKA 4HMPA 5LQMA 4DLYA 1XWIA 2G0AA 3PV0A 4MV0A 5JJ5A 4XGKA 1XJQA 5CVTA 3EOBI 1RM3A 1RP1A 1PFYA 2Y2UA 5J59A 4H7PA 5NULA 2ZTMA 5ITVA 1AC5A 1UK7A 3P9PA 3Q7PA 3OEWA 1E1DA 5DSTA 2NADA 1ZY2A 4HRAA 3FVWA 5D7NA 2PUDA 1J4AA 5EYPB 2OXEA 4RVUA 1W36D 4B3GA 3LHSA 1AKEA 4RM2A 2FI1A 4KQ1A 4WCFA 5ER6A 5BYJA 3TNDA 1P8AA 4F5YA 3GRAA 3I37X 4JUDX 4CQLA 3T7TA 2P6NA 4Y9TA 5KMGA 1D8AA 3Q12A 1J39A 1Z0IA 1M73E 1MOSA 2R6HA 3QBTA 1E0AA 1RR6A 3SJUA 3TB6A 4DANA 5CA1F 2H5IA 3CR8A 3OOJA 2EJUA 1Z7EA 3WZ2A 1RLOA 4KXXA 3RJ5A 2A84A 1ZGCA 1W19A 3UKOA 4C4OA 4C4RA 1FYDA 2RHLA 3O6VA 3AFHA 1VL6A 3VDRA 3OQOA 2JBAB 5KYUA 2JIRA 3KTOA 1O95C 3LOQA 3OY7A 4O2AF 4BAGA 5JPDA 5AVXA 1V5GA 3AM3A 4L6AA 4MW6A 4P22A 5BN5A 4GOMD 3U48A 1Z33A 1Z0DA 1ZH6A 2QYTA 5KU7A 5HZMA 4EW2A 3GWZA 2C7GA 2ZXFA 4X5OA 1MRSA 3I9JA 4L76A 1IQUA 4M0UA 3TDKA 4TWRA 1GCUA 2E5LB 1VDMA 1U2GA 4YI5A 2OCKA 3D0OA 3V32A 3KKPA 1NVVQ 5TRTA 1DWUA 5A0FA 3TRJA 2YS6A 3PXBA 4UTPA 4UNNA 1CLEA 3C8HA 1DC6A 1BMFA 1PHRA 2TSYB 1P2TA 1CZLA 5GQSA 2BDUA 1E7RA 1VC2A 2FPPA 4OVKA 4RZXA 5ELLA 1Z16A 3WWPA 1L9XA 3L46A 5HNKA 3A4TA 3OHMA 2E2WA 2O7VA 3B1VA 3BIXA 1UPAA 1V5IA 2V58A 3EARA 2CEAA 3ZWYA 1LNQA 5IXJA 4RD3A 4QXQA 2D5AA 2NP6A 4NZ9A 3IHWA 4F72A 1KEEA 1XRSB 1QIGA 1RAFA 5TPZD 5C8XA 4DR1B 3LLCA 4Z9AA 2DEUA 2XZLA 3UENA 5E6RA 1Z2EA 3GD5A 2VJMA 4EA7A 1ISGA 2HHJA 1CDDA 1UBOS 2QM8A 3BFJA 3X3HA 1W34A 1XCGB 3T12A 1EUQA 4PANA 1DEOA 5F2OA 3H11A 3AUAA 2XKBA 2PT9A 1F8GA 5E6UB 3U4HA 4LQLA 2D59A 2FDXA 4LWQA 3AW8A 2C2ZA 2FMTA 2YV3A 3HCPA 4CT5A 4DSTA 3V1MA 1R15A 3GN1A 3DP9A 2GRUA 2O7SA 4Q9NA 5A62A 4XLZA 4BMNA 3E48A 4F2WA 1O8CA 3CLVA 4QDXA 4NL4H 3U62A 2GWHA 3MJDA 5BORA 3RVOA 3PXGA 2IEAA 4HEA6 2D06A 1PT5A 3OBBA 3G2NA 2XCQA 4O4IB 1H2EA 1HRKA 4BC1A 4Z4GA 1YDGA 2EQBA 2PUJA 1EGHA 1T2NA 2FOIA 4EI2A 4G1FA 4L3VA 1TXGA 4BMSA 4F1JA 4YROA 3TXYA 1HL3A 1NMQA 3O3OB 1HA3A 1VLVA 2QB5A 2W6QA 2WWWA 3PGJA 5JWHA 1WDLA 3TJMA 4QHTA 2QG6A 3AETB 2WUDA 3UWSA 3FROA 4D4JA 2YCLA 3G1TA 5DNYB 3EXG1 1GG5A 5D51S 1TEZA 1SK9A 4ZA2A 1Y5MA 3KUCA 5FUXA 1PP4A 3T15A 1UAGA 3UOGA 5KVAA 2HA5A 1IZZA 2MINB 1W25A 4UUMA 5KYTA 1T35A 1UMDA 5SZKB 1THMA 3A58B 2QN9A 3SR3A 1I6WA 3B7GA 3IP7A 4IX1A 1GFSA 2NQ8A 4CZ2A 1R50A 4JHXA 3VPXA 1DKQA 1R4MA 5C5EA 1JKFA 4NYIQ 1HX7A 3AVUA 3B89A 3WX0A 1JMVA 2ZBEA 2Y1LA 3RIHA 5T8KC 5BO5A 2AFIA 3IAS6 1Z08A 4OHCA 2XCTB 3JYNA 4R5HA 3RU7A 3W5IA 2FZKA 3PCXA 5BR4A 4CGZA 4ARZA 1A8HA 3HZRA 5HA5A 5KHAA 4CKXA 5HXAA 1OB2A 2WF7A 3GOHA 4BMYA 4QXOA 4RQUA 1LCIA 2C0CA 3JYPA 721PA 3MCWA 4L78A 1KPIA 2ZE6A 4LBVA 1W2HA 3WMEA 1CY8A 4HUTA 1EWQA 4C1BA 2HAEA 1J1UA 4V24A 2B21A 1N5IA 3UG6A 2A1UA 1UBMS 4EFMA 5AOAA 3BE5A 3FG9A 10MHA 5JTUA 2H2FA 1E2UA 3TG2A 2WSIA 3PR1A 2PYIA 2F8MA 3WLOA 1VKRA 4YLEA 1ADJA 1WMEA 1H9CA 4JLNA 1IAQA 2WM8A 1YCHA 3JZFA 4N12A 1YF3A 5JMPA 3JASA 2PGDA 4FWIB 3L9WA 4N0MA 2M1XA 3DHYA 1ISFA 4L8GA 5CBPB 5GJWC 3ZWOA 1UADA 3G5UA 5E1OA 4PYKA 4EIWA 1ZISA 5ADHA 5HRAA 4DPMA 5AK4A 1Q0QA 5FBLB 5FXMA 5M5BA 4M3NA 3ILYA 1E18A 3ER6A 2ESRA 1L5FA 5CURA 3L0OA 2AMYA 2JJQA 3FX2A 3SEZA 3TLXA 1YD7A 4HQRA 3QEKA 2DXIA 1T6NA 4ML3A 1GN9A 1WKCA 2P1ZA 3HB5X 3LWZA 1FSGA 2JGEA 2Z83A 3SC2B 4XCXA 4BCDA 3PEWA 3T3DA 3R6DA 1I6LA 1MOPA 2G6BA 1G19A 2QE7A 4CUZA 3KB6A 3MD0A 1L3BA 5CNIA 3ZHVA 4IXTA 2JJ2D 2IZ6A 1ZM9A 3B3JA 1P9NA 3B38A 5EG5A 3MYYA 1S2MA 1XMJA 3U0BA 5DHAA 2FW6A 1IIRA 2ZZNA 3GR6A 3C43A 3FUTA 1NJ8A 4DJDC 3NI2A 4EGSA 4IMIB 4EJ0A 5HPYB 2PUEA 3GFVA 1NPTO 2Z4SA 4XIFA 4DA7A 4JJ8A 3LDUA 4PFSA 1NW8A 2KQUA 4EPRA 4V0SA 1RZVA 2IXGA 1O87A 3GL9A 4FT4A 4BX0A 3I8OA 4MV6A 1ODIA 4CM4B 2FCAA 1ZDMA 1X39A 2XB6A 4B3DA 4DSZA 4CV1A 4X7RA 2GKSA 3ZVMA 1VXRA 2HZ7A 4GICA 1ISPA 4RDCA 4D56A 1QTIA 2EDAA 4YRCA 4JUIA 5C0OE 2P68A 2R1UA 3AVVA 3JY6A 1OX6A 4XGQA 2QZ4A 1M2NA 4I1OA 4I4CA 5E6SB 4BKUA 2IS2A 1J33A 4LJYA 4TXLA 4MHSA 1XQ9A 3OT4A 3ZI4A 2IY7A 2PUGA 2YW2A 3G0HA 3FCAA 2IY8A 4RHFA 3H05A 3LRXA 5JU6A 1JEEA 5I9IA 3AQ4A 2ZRJA 1RZ3A 2YWRA 4WW0A 3AIKA 4Q6WA 4UEQA 4AWBA 1NIJA 3OJFA 1ESDA 4IIYA 4XPZA 4AXBA 1ZR2A 3A2LA 1MO5A 1WXQA 1KYVA 2N1MA 4RA6A 5FP0A 2NUAB 3HI4A 3V8RA 4MRMB 5F7ZA 2OXTA 1X7YA 5GADl 4Y6PA 5CVUA 4FI3F 4UPVA 5EPUA 2ZRPA 5JJBA 1NOJA 1TM4E 1QRUA 2X6RA 2PLWA 4X93A 3NH9A 3CFYA 1MEJA 3IR6A 1ZH2A 3ANYB 2O3SA 3LM8A 4KPUB 1U1DA 3W9UA 5BN3B 3NDBB 3F5MA 5ELMA 2O8FA 3NLLA 4IVPA 4OA5A 4EJSA 4MVJI 2B7CA 3EZ9A 3ZU4A 3DKVA 4ANFA 5FI3A 2QVGA 3GLTA 2H3HA 1UPFA 1NDQA 3E7WA 3I5XA 1MKYA 3H04A 2WAAA 2DR2A 2JGLA 1GL7A 5C31A 1CXZA 2NM0A 4TMKA 1N5JA 2OAP1 2XUIA 1COZA 1O6CA 3LQKA 3QSYA 1ZQ1A 1N6PA 2QSUA 3A9RA 3F90A 4ENUA 1XKXA 4HS9A 3PVCA 5FO0A 5AW1A 2LD4A 1E99A 1FJXA 4EA6A 2JS7A 4Z49A 2YVUA 5JI2E 3KQUA 1I2MA 4YWJA 3OQIB 2XBUA 3RKRA 2QLJA 4PCVA 1RQGA 1BOFA 4H27A 4J7AA 1T13A 2DTXA 2V97A 3AH8A 4M99A 4R7TA 2AN1A 4X3OA 1A1VA 2IPNA 4JROA 2OPHA 5HVNA 1W4AA 3LZDA 2YNMC 2IHBA 2V65A 3OOYA 1ZIXA 4DA8A 2QTVA 1L4NA 1GT6A 3OSZA 3PXCX 2FSVC 3LKVA 1Q7EA 2JFVA 4W9NA 5IUNC 2GHQA 1QX3A 3VHXA 4BDSA 1B00A 1HTWA 1P1FA 4ZVOA 3BGOS 2HC9A 1Y4DE 2ZRGA 4ZO6A 2JFYA 4PW0A 3ZDQA 1CR4A 2ZJ6A 1VOTA 3LY8A 1BCSA 2UZ1A 4Y2GA 3WIBA 4G65A 4OXIA 1FTGA 4TTAA 3W5UA 4MP3A 4BQFA 1A7UA 2RG7A 4I50A 4L57A 3OKFA 2IC5A 5T4BA 3VYTB 1SWWA 1E58A 2BT4A 1Z7BA 2R8PA 5KKAA 2RGAA 3RDPA 1EXDA 4M1SA 1DBIA 3JQDA 3B3QA 2RBGA 2BFCB 3IV7A 4M46A 5B4UA 1XD2A 3GDHA 4CMEA 4LMPA 2XNSA 3HBLA 3Q8LA 2I7VA 1H2HA 3K20A 2MSLA 1M2VA 1U8AA 2XA9A 2BRUA 2XR1A 3LBFA 3LUAA 2BBWA 1ZOOA 2JIQA 1GT91 4C29A 1E2BA 3BZBA 2VJNA 2B4KA 4PYQA 1RYNA 5EVJA 1XTKA 4J03A 2Y1FA 3KWFA 4OHFA 4E7OA 1W75A 5KNCD 5MFPA 3S70A 3TVTA 4DLPA 2IS1A 3E03A 4MVXA 2Y0CA 4BMPB 3HA2A 1V8BA 3BM5A 2QLLA 5DHUA 1L0BA 3C39A 3RK0A 3NHJA 3L1VA 5EFOA 2WG2A 2XUAA 1B7GO 3PFFA 2NO9A 3OM0A 3R5JA 1NRJB 2CGEA 4UAVA 2EKQA 2Z5FA 3BTVA 1PX0A 2DP4E 3WHIA 2YIDA 1XTZA 2XF2A 4CW7A 3CG0A 4UTVA 5BWLA 3G59A 4DNXA 4LGMA 3DFZA 3GVHA 5I7FA 4RF2A 3PXDA 4LXGA 3G9ZA 4HHEA 4MV8A 4HR7A 1OZAA 2B36A 1KXZA 4OA8A 1U2SA 1TMOA 4LXIA 2PGNA 1E6UA 1I8TA 4J16A 3MWYW 4QPDA 2WSLA 1L7AA 1RFLA 1QAMA 2IDZA 1TJYA 4G4SP 3N53A 1M34B 2JJ1D 1IBSA 1M1NB 2FJUA 3CKLA 3UXMA 1GGJA 2IYVA 1H2AS 2DETA 3CW9A 1ZWKA 4MVJD 4NJOA 4PSUA 4FOTA 1AS2A 2OY0A 4QXRA 4I5FA 3ZX5A 3BILA 3BTSA 3FDZB 1O0SA 1KE1A 3R7DA 1BX3A 2BJWA 1CWUA 2IT1A 2ZFUA 3AR4A 3FFWA 4G0ZA 5IDYA 4AUKA 1W48A 4OHWA 3ZH9B 2A1TS 4OJMX 3RG8A 2M98A 4LOLA 3KXDA 3WQRA 3FI9A 1GV0A 3AV3A 1GADO 5CA1B 1NNLA 3GN2A 1BD4A 2HT1A 1JKJB 3C98A 3ROXA 3K30A 1A76A 1Y98A 5GGXA 3X1YA 4KHZA 4FOSA 3R7WB 4WSOA 1T10A 1U1IA 1AB5A 2O3JA 2EFCB 2QS9A 4OAOA 1ULUA 3RFXA 2C7RA 4O2AB 1HI9A 3UPTA 2J0QA 1HUQA 2W83A 2I6SA 5LZ9A 2BL4A 1E1RD 2PQ2A 4ZOLA 3VR2A 4JXJA 5TQ0A 2QMOA 2FMHA 2RC5A 3TIXB 3MGBA 4C5CA 3G88A 5K6AA 3EY9A 2XTMA 5IASA 2Y3IA 4X1IB 1E2GA 1E7QA 2E18A 4WN9B 3EVFA 4HFJA 1NHGA 2ATVA 2WZCA 3OZDA 1BC5A 5AKLA 4IGFA 4O59O 1RQLA 4NFSA 2IXTA 3W1WA 3D2AA 5LN1A 3MRXA 2I5PO 1L4GA 2EGUA 3MBIA 5CGZA 3T3EA 1QQAA 1Y3FE 2AC2A 2YY7A 5JUWA 3U3RA 4M0FA 3IX7A 3FWZA 1XD9A 1Z6GA 4RJKA 5MGNA 2H4JA 1U7UA 2NO4A 2VF5X 4JEUA 4H3VA 4DDTA 1OB5A 2ZYTX 4UNQA 2JHCA 2JFWA 5HUJA 4PYOA 2PFSA 1Z0KA 3IVGA 2C84A 2CSUA 3KKOA 3UXHA 5LJLA 1OXTA 2AN4A 5JD4A 5K6RA 1H2WA 4JC8A 5JADA 1GKKA 1UQUA 2FP3A 3ZWQA 1UQRA 2PQ0A 4NEHB 3AUFA 1L5VA 3UGJA 4A2QA 4UQLA 2W8BB 2JRLA 2EU8A 4ZQCB 4PZAA 1QO0D 3UKDA 1KP9A 1XZAA 2AEJA 2XSZA 1ECLA 4DLUA 5JS8A 2I4LA 2CMHA 1DNPA 2P2CA 2VRNA 4MI3A 4YR7A 1WO8A 2P9TA 1AA6A 4MRRA 2ERXA 1Z8FA 2VDWA 2QMZA 2DYKA 1OLUB 1YFZA 1V16A 3FMFA 3DB2A 1SXJE 3C16C 4HLUA 1A2BA 1IHPA 3ET5A 5CM8B 5HILA 4DNOA 3OIDA 4ESOA 2O2SA 2ZXUA 3ZBUA 4FFLA 4R2WA 3F98A 3AF1A 3QLUC 4F8YA 2PLRA 2E9SA 3QVKA 5AI0A 1P5RA 1I6MA 4FYIA 4I4NA 1KI3A 5DEOA 3P52A 1ZCFA 3T3HA 3W2IA 2BMAA 4M4SA 3G8AA 4MVJG 4LHZA 1XNQB 2O8EA 6REQA 4QGHA 5IVDA 1IRIA 1ULBA 2O2CA 3S1AB 1MP0A 1AIPA 1ECJA 1ZG3A 4U2KA 2XLCA 4D8YA 5BQ3A 5CDSA 1N9ZA 2C2XA 1FVOA 4R68A 3OESA 3QOFA 1Y3AA 4EPWA 3K4QA 3HPQA 1C3OA 3QU7A 1DT3A 2XY4A 4JJ4A 1YGPA 3DZFA 4LI3X 4TTVA 3LY5A 4OHBA 3KYCB 3VZCA 4ND5A 4CNQA 2YRWA 1ZLYA 1A4UA 3IMGA 5CHYA 4RFSB 1YI8A 3DVQX 5A7HA 3S2GA 2HWXA 4YUXA 1RZRA 2APJA 4RL4A 4ZT7A 1ZU4A 1S01A 2QRMA 4JYBA 4GL4A 4PRZA 1W44A 2XNJA 4YXWD 4DMGA 4NENB 1P72A 4TYPA 1DJLA 3VR6A 1Y7LA 3BXOA 4DLTA 3RRNA 1GOTA 5AXCA 1EDDA 1RU3A 2QRHA 3LCVB 1UINA 1WG8A 3EGCA 4CMBA 5THQA 4R1TA 4EF4A 4JT2A 2HIGA 1J25A 4TLCA 4F7WA 3ITKA 3AHCA 4PGFA 1O96B 2DG2A 2GZRA 3M6FA 2DPHA 3E27A 3HN6A 2A9QA 4XJSA 2B5WA 2V7UA 1J2YA 1Y1SA 3JTMA 3TD9A 1VI6A 4BQNA 4HOYA 2G28A 3LVBA 4LRQA 1F7VA 4XPIA 3T54A 1BDBA 2OHJA 2I7DA 3ASZA 5FLEX 3OJCA 3E8XA 3I9V6 3RC7A 4J76A 2G5PA 1OIXA 4ILKA 4N8EA 3TJZA 5JNVA 4RACA 4EHKA 1OFUX 5F78A 1QZXA 4MR9A 2H1HA 3ZI0A 5LDHA 4U7FA 3QELB 2FFBA 1MORA 2DWCA 5G0SA 1NLYA 3G0IA 3GGSA 3UMMA 2M6KA 4AECA 4Y2XA 1Z36A 4D2IA 1T2AA 2W2LA 4KH0A 3A70A 2X2EA 1IVYA 3Q0EA 3W77A 3N2KA 2C96A 3BD8A 1OQAA 1S5PA 1FXUA 1E2EA 1VSBA 3WFIA 4K9DA 4NZNA 4D7AA 1E98A 4YAOA 3PQ7A 3A7DA 1OAKA 2PA3A 3ZYCA 1Z6AA 3JVIA 1E60A 3O2NA 4H1WA 3TEJA 3N2LA 1V2HE 2V7QA 4UNIA 3KSZO 5CIQA 2Z58A 5H70A 2VA8A 3PQFA 1R74A 4QOFA 4F5EA 1CHDA 1QO9A 1BMTA 1B41A 3BHNA 1QF9A 4NATA 1A5AB 5A9SB 2IYOA 1SG9A 3I62A 1I5EA 3Q5EA 4EEXA 3PQ5A 1HEIA 2WZBA 1EZZA 3S8EA 4AJ4A 3OA0A 4GX5A 2ZDGA 3RAEC 5L4SA 1UR5A 1VKNA 3KXLA 2WMNB 4LZJA 2IF2A 2A58A 4CM1A 1M1ZA 4C0AC 4FC7A 4ZN6A 2V7GA 4QQNA 3HGQA 5E2IA 4I19A 3IUPA 1P4AA 3A2NA 3L0ZA 2O2GA 2RMKA 2Z95A 3E2IA 5KOYA 1JSLA 4NNJA 1MAHA 3MJRA 3TOCA 4C9BA 1C7QA 1AY0A 1DXYA 1NE7A 4HLDA 5ICEA 4HQLA 1NXXA 5DBIA 4B6FA 3R0QA 1UMBB 3LA6A 2CT8A 1T36A 1J97A 2VR1A 3NOQA 2DHEA 4Z86A 3TIVA 4WOPA 3VTZA 3ZDEA 4EHBA 4D99A 4ZV9A 3KC2A 2XNDD 4FGUA 2R4QA 4MUYA 4GXQA 4PS1A 4YO7A 4LYHA 4KFRA 2CJPA 5HG0A 4E5VA 2ROQA 4KN6A 1L4BA 4DS3A 1IN4A 3VSBA 2P6OA 1KI9A 1R6AA 3NHLA 5EYPA 1V37A 4URXR 5FX2A 4JLMA 4ZEWA 3O21A 5A4AA 1PQ4A 1U8EA 1U9YA 4KGVA 3UXEA 1E5TA 3DO5A 4A8PA 2EFYA 3HP7A 4N7RA 1FUIA 4BTVA 1IZ7A 4NBUA 1WDWB 3O8CA 3OEHD 1LJUA 3CJTA 2QU8A 3DAPA 1P75A 4WLEA 2X7JA 3QGMA 2Y92A 2XRFA 4Y6OA 1V9CA 3T7IA 1M8GA 1U2EA 1I36A 4QFMA 1T5DX 2BHLA 2WJ4A 1GSIA 2FE4A 2IYNA 5BW4A 1JUDA 2GD6A 1NC3A 3SQNA 4QODA 3T4XA 5I7UA 1YAJA 2QEQA 3KQMA 3DFMA 3IB3A 3JS5A 2G1KA 3PHLA 1DRJA 5FNVF 2GPBA 4ARIA 5B30A 4OSOA 2IPXA 3FCSB 3SHVA 5L95A 1D2AA 4MWTA 1P2SA 1XYVA 1KGSA 2JCYA 5HIJA 1RTKA 4GVLA