2QPWA

Methyltransferase domain of human pr domain-containing protein 2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
147
structure length
147
Chain Sequence
NQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biology of human H3K9 methyltransferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PR domain zinc finger protein 2
total genus 31
structure length 147
sequence length 147
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2qpwA01
5LSZA 3MO2A 4Z4PA 4LDGA 3QWPA 4O30A 1MUFA 4YPEA 3M55A 4QEPA 5CPRB 3IHXA 3CBPA 5ARFA 3S7FA 3CBOA 3KMTA 3DB5A 3S7BA 3PDNA 5KJKA 3MEKA 3N71A 5F6LA 1N6CA 1PEGA 4YNMA 2F69A 1MVHA 2O8JA 3VV0A 3RU0A 1O9SA 3BO5A 4J7FA 5TTFA 5CCLA 4FMUA 4YNDA 3M54A 4C1QA 3MO0A 3F9YA 4QENA 4J83A 3VUZA 3M57A 3F9WA 5EX0A 3F9ZA 5T0KA 1N3JA 3OXLA 3RJWA 3SWCA 4JDSA 3M53A 5JJ0A 4BUPA 5F6KC 2G46A 4IJDA 5TEGA 4H12A 5CCMA 4QEOA 3S7JA 4RZ0A 4J8OA 3F9XA 4AU7A 3DALA 3HNAA 5EG2A 1ZKKA 5KJNA 3OS5A 2BQZA 4E47A 3EP0A 2RFIA 3KMAA 4I51A 4IJ8A 3OXFA 4NJ5A 3TG4A 4YPAA 3QWVA 5F59A 3QWWA 3OXGA 5HQ8A 3M58A 4O6FA 2W5ZA 3M59A 3M56A 5LSXA 1ML9A 2QPWA 3S8PA 5ARGA 4JLGA 3RIBA 5JINA 5TH7A 3CBMA 5EX3A 3TG5A 2IGQA 5T0MA 2R3AA 3S7DA 5JIYA 4WUYA 5KJMA 3RAYA 4YNPA 5HI7A 4MI5A 1MT6A 4YPUA 1MVXA 3M5AA 5AYFA 5JHNA 1N6AA 3SW9A 3FPDA 4NVQA 5F5EA 3K5KA 3OOIA 4MI0A 2W5YA 3RQ4A 5KJLA 1H3IA 1XQHA 3MO5A 2JV0A 5T5GA 4J7IA 3KMJA 3OPEA
chains in the Genus database with same CATH superfamily
5LSZA 3MO2A 4Z4PA 4LDGA 3QWPA 4O30A 1MUFA 4YPEA 3M55A 4QEPA 5CPRB 3IHXA 3CBPA 5ARFA 3S7FA 3CBOA 3KMTA 3DB5A 3S7BA 3PDNA 5KJKA 3MEKA 3N71A 5F6LA 1N6CA 1PEGA 4YNMA 2F69A 1MVHA 2O8JA 3VV0A 3RU0A 1O9SA 3BO5A 4J7FA 5TTFA 5CCLA 4FMUA 4YNDA 3M54A 4C1QA 3MO0A 3F9YA 4QENA 4J83A 3VUZA 3M57A 3F9WA 5EX0A 3F9ZA 5T0KA 1N3JA 3OXLA 3RJWA 3SWCA 4JDSA 3M53A 5JJ0A 4BUPA 5F6KC 2G46A 4IJDA 5TEGA 4H12A 5CCMA 4QEOA 3S7JA 4RZ0A 4J8OA 3F9XA 4AU7A 3DALA 3HNAA 5EG2A 1ZKKA 5KJNA 3OS5A 2BQZA 4E47A 3EP0A 2RFIA 3KMAA 4I51A 4IJ8A 3OXFA 4NJ5A 3TG4A 4YPAA 3QWVA 5F59A 3QWWA 3OXGA 5HQ8A 3M58A 4O6FA 2W5ZA 3M59A 3M56A 5LSXA 1ML9A 2QPWA 3S8PA 5ARGA 4JLGA 3RIBA 5JINA 5TH7A 3CBMA 5EX3A 3TG5A 2IGQA 5T0MA 2R3AA 3S7DA 5JIYA 4WUYA 5KJMA 3RAYA 4YNPA 5HI7A 4MI5A 1MT6A 4YPUA 1MVXA 3M5AA 5AYFA 5JHNA 1N6AA 3SW9A 3FPDA 4NVQA 5F5EA 3K5KA 3OOIA 4MI0A 2W5YA 3RQ4A 5KJLA 1H3IA 1XQHA 3MO5A 2JV0A 5T5GA 4J7IA 3KMJA 3OPEA
chains in the Genus database with same CATH topology
5LSZA 3MO2A 4Z4PA 4LDGA 3QWPA 4O30A 1MUFA 4YPEA 3M55A 4QEPA 5CPRB 3IHXA 3CBPA 5ARFA 3S7FA 3CBOA 3KMTA 3DB5A 3S7BA 3PDNA 5KJKA 3MEKA 3N71A 5F6LA 1N6CA 1PEGA 4YNMA 2F69A 1MVHA 2O8JA 3VV0A 3RU0A 1O9SA 3BO5A 4J7FA 5TTFA 5CCLA 4FMUA 4YNDA 3M54A 4C1QA 3MO0A 3F9YA 4QENA 4J83A 3VUZA 3M57A 3F9WA 5EX0A 3F9ZA 5T0KA 1N3JA 3OXLA 3RJWA 3SWCA 4JDSA 3M53A 5JJ0A 4BUPA 5F6KC 2G46A 4IJDA 5TEGA 4H12A 5CCMA 4QEOA 3S7JA 4RZ0A 4J8OA 3F9XA 4AU7A 3DALA 3HNAA 5EG2A 1ZKKA 5KJNA 3OS5A 2BQZA 4E47A 3EP0A 2RFIA 3KMAA 4I51A 4IJ8A 3OXFA 4NJ5A 3TG4A 4YPAA 3QWVA 5F59A 3QWWA 3OXGA 5HQ8A 3M58A 4O6FA 2W5ZA 3M59A 3M56A 5LSXA 1ML9A 2QPWA 3S8PA 5ARGA 4JLGA 3RIBA 5JINA 5TH7A 3CBMA 5EX3A 3TG5A 2IGQA 5T0MA 2R3AA 3S7DA 5JIYA 4WUYA 5KJMA 3RAYA 4YNPA 5HI7A 4MI5A 1MT6A 4YPUA 1MVXA 3M5AA 5AYFA 5JHNA 1N6AA 3SW9A 3FPDA 4NVQA 5F5EA 3K5KA 3OOIA 4MI0A 2W5YA 3RQ4A 5KJLA 1H3IA 1XQHA 3MO5A 2JV0A 5T5GA 4J7IA 3KMJA 3OPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LSZ A;  3MO2 A;  4Z4P A;  4LDG A;  3QWP A;  4O30 A;  1MUF A;  4YPE A;  3M55 A;  4QEP A;  5CPR B;  3IHX A;  3CBP A;  5ARF A;  3S7F A;  3CBO A;  3KMT A;  3DB5 A;  3S7B A;  3PDN A;  5KJK A;  3MEK A;  3N71 A;  5F6L A;  1N6C A;  1PEG A;  4YNM A;  2F69 A;  1MVH A;  2O8J A;  3VV0 A;  3RU0 A;  1O9S A;  3BO5 A;  4J7F A;  5TTF A;  5CCL A;  4FMU A;  4YND A;  3M54 A;  4C1Q A;  3MO0 A;  3F9Y A;  4QEN A;  4J83 A;  3VUZ A;  3M57 A;  3F9W A;  5EX0 A;  3F9Z A;  5T0K A;  1N3J A;  3OXL A;  3RJW A;  3SWC A;  4JDS A;  3M53 A;  5JJ0 A;  4BUP A;  5F6K C;  2G46 A;  4IJD A;  5TEG A;  4H12 A;  5CCM A;  4QEO A;  3S7J A;  4RZ0 A;  4J8O A;  3F9X A;  4AU7 A;  3DAL A;  3HNA A;  5EG2 A;  1ZKK A;  5KJN A;  3OS5 A;  2BQZ A;  4E47 A;  3EP0 A;  2RFI A;  3KMA A;  4I51 A;  4IJ8 A;  3OXF A;  4NJ5 A;  3TG4 A;  4YPA A;  3QWV A;  5F59 A;  3QWW A;  3OXG A;  5HQ8 A;  3M58 A;  4O6F A;  2W5Z A;  3M59 A;  3M56 A;  5LSX A;  1ML9 A;  2QPW A;  3S8P A;  5ARG A;  4JLG A;  3RIB A;  5JIN A;  5TH7 A;  3CBM A;  5EX3 A;  3TG5 A;  2IGQ A;  5T0M A;  2R3A A;  3S7D A;  5JIY A;  4WUY A;  5KJM A;  3RAY A;  4YNP A;  5HI7 A;  4MI5 A;  1MT6 A;  4YPU A;  1MVX A;  3M5A A;  5AYF A;  5JHN A;  1N6A A;  3SW9 A;  3FPD A;  4NVQ A;  5F5E A;  3K5K A;  3OOI A;  4MI0 A;  2W5Y A;  3RQ4 A;  5KJL A;  1H3I A;  1XQH A;  3MO5 A;  2JV0 A;  5T5G A;  4J7I A;  3KMJ A;  3OPE A; 
#chains in the Genus database with same CATH topology
 5LSZ A;  3MO2 A;  4Z4P A;  4LDG A;  3QWP A;  4O30 A;  1MUF A;  4YPE A;  3M55 A;  4QEP A;  5CPR B;  3IHX A;  3CBP A;  5ARF A;  3S7F A;  3CBO A;  3KMT A;  3DB5 A;  3S7B A;  3PDN A;  5KJK A;  3MEK A;  3N71 A;  5F6L A;  1N6C A;  1PEG A;  4YNM A;  2F69 A;  1MVH A;  2O8J A;  3VV0 A;  3RU0 A;  1O9S A;  3BO5 A;  4J7F A;  5TTF A;  5CCL A;  4FMU A;  4YND A;  3M54 A;  4C1Q A;  3MO0 A;  3F9Y A;  4QEN A;  4J83 A;  3VUZ A;  3M57 A;  3F9W A;  5EX0 A;  3F9Z A;  5T0K A;  1N3J A;  3OXL A;  3RJW A;  3SWC A;  4JDS A;  3M53 A;  5JJ0 A;  4BUP A;  5F6K C;  2G46 A;  4IJD A;  5TEG A;  4H12 A;  5CCM A;  4QEO A;  3S7J A;  4RZ0 A;  4J8O A;  3F9X A;  4AU7 A;  3DAL A;  3HNA A;  5EG2 A;  1ZKK A;  5KJN A;  3OS5 A;  2BQZ A;  4E47 A;  3EP0 A;  2RFI A;  3KMA A;  4I51 A;  4IJ8 A;  3OXF A;  4NJ5 A;  3TG4 A;  4YPA A;  3QWV A;  5F59 A;  3QWW A;  3OXG A;  5HQ8 A;  3M58 A;  4O6F A;  2W5Z A;  3M59 A;  3M56 A;  5LSX A;  1ML9 A;  2QPW A;  3S8P A;  5ARG A;  4JLG A;  3RIB A;  5JIN A;  5TH7 A;  3CBM A;  5EX3 A;  3TG5 A;  2IGQ A;  5T0M A;  2R3A A;  3S7D A;  5JIY A;  4WUY A;  5KJM A;  3RAY A;  4YNP A;  5HI7 A;  4MI5 A;  1MT6 A;  4YPU A;  1MVX A;  3M5A A;  5AYF A;  5JHN A;  1N6A A;  3SW9 A;  3FPD A;  4NVQ A;  5F5E A;  3K5K A;  3OOI A;  4MI0 A;  2W5Y A;  3RQ4 A;  5KJL A;  1H3I A;  1XQH A;  3MO5 A;  2JV0 A;  5T5G A;  4J7I A;  3KMJ A;  3OPE A; 
#chains in the Genus database with same CATH homology
 5LSZ A;  3MO2 A;  4Z4P A;  4LDG A;  3QWP A;  4O30 A;  1MUF A;  4YPE A;  3M55 A;  4QEP A;  5CPR B;  3IHX A;  3CBP A;  5ARF A;  3S7F A;  3CBO A;  3KMT A;  3DB5 A;  3S7B A;  3PDN A;  5KJK A;  3MEK A;  3N71 A;  5F6L A;  1N6C A;  1PEG A;  4YNM A;  2F69 A;  1MVH A;  2O8J A;  3VV0 A;  3RU0 A;  1O9S A;  3BO5 A;  4J7F A;  5TTF A;  5CCL A;  4FMU A;  4YND A;  3M54 A;  4C1Q A;  3MO0 A;  3F9Y A;  4QEN A;  4J83 A;  3VUZ A;  3M57 A;  3F9W A;  5EX0 A;  3F9Z A;  5T0K A;  1N3J A;  3OXL A;  3RJW A;  3SWC A;  4JDS A;  3M53 A;  5JJ0 A;  4BUP A;  5F6K C;  2G46 A;  4IJD A;  5TEG A;  4H12 A;  5CCM A;  4QEO A;  3S7J A;  4RZ0 A;  4J8O A;  3F9X A;  4AU7 A;  3DAL A;  3HNA A;  5EG2 A;  1ZKK A;  5KJN A;  3OS5 A;  2BQZ A;  4E47 A;  3EP0 A;  2RFI A;  3KMA A;  4I51 A;  4IJ8 A;  3OXF A;  4NJ5 A;  3TG4 A;  4YPA A;  3QWV A;  5F59 A;  3QWW A;  3OXG A;  5HQ8 A;  3M58 A;  4O6F A;  2W5Z A;  3M59 A;  3M56 A;  5LSX A;  1ML9 A;  2QPW A;  3S8P A;  5ARG A;  4JLG A;  3RIB A;  5JIN A;  5TH7 A;  3CBM A;  5EX3 A;  3TG5 A;  2IGQ A;  5T0M A;  2R3A A;  3S7D A;  5JIY A;  4WUY A;  5KJM A;  3RAY A;  4YNP A;  5HI7 A;  4MI5 A;  1MT6 A;  4YPU A;  1MVX A;  3M5A A;  5AYF A;  5JHN A;  1N6A A;  3SW9 A;  3FPD A;  4NVQ A;  5F5E A;  3K5K A;  3OOI A;  4MI0 A;  2W5Y A;  3RQ4 A;  5KJL A;  1H3I A;  1XQH A;  3MO5 A;  2JV0 A;  5T5G A;  4J7I A;  3KMJ A;  3OPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...