2QPWA

Methyltransferase domain of human pr domain-containing protein 2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
147
structure length
147
Chain Sequence
NQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biology of human H3K9 methyltransferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PR domain zinc finger protein 2
total genus 31
structure length 147
sequence length 147
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2qpwA01
3OPEA 2BQZA 1XQHA 3S7JA 3MEKA 5T5GA 5EX3A 1ML9A 4NVQA 2IGQA 3KMAA 3M57A 4JDSA 4J83A 3BO5A 3KMJA 3SWCA 3KMTA 4O30A 3M54A 5JINA 5F5EA 5KJLA 1ZKKA 4YPUA 5LSXA 3K5KA 3CBOA 5EG2A 3VUZA 3M58A 4QEOA 1H3IA 3M55A 3OS5A 1MVXA 5EX0A 4AU7A 3M53A 4JLGA 3OXGA 3QWWA 4NJ5A 3DB5A 4FMUA 3OOIA 2F69A 4I51A 3OXFA 3F9ZA 3SW9A 3N71A 5KJMA 4Z4PA 4BUPA 3M5AA 4LDGA 3F9WA 4YNDA 5CCMA 4YNMA 5HI7A 4MI5A 5JHNA 1MUFA 5ARGA 3F9YA 1MVHA 2O8JA 3RU0A 5F59A 3RAYA 3RJWA 5TEGA 3RIBA 4QENA 5F6LA 3CBPA 5CPRB 5KJKA 2W5YA 4H12A 3TG5A 3OXLA 1O9SA 3M59A 3RQ4A 4QEPA 5CCLA 3MO0A 3S8PA 3TG4A 5LSZA 3HNAA 4YPEA 3VV0A 4J8OA 3QWPA 3QWVA 3M56A 4YPAA 3S7DA 3PDNA 3CBMA 3MO2A 4RZ0A 5KJNA 5T0KA 4YNPA 5ARFA 3S7FA 5JJ0A 3DALA 1N6AA 2QPWA 4J7IA 4E47A 3F9XA 4IJDA 5F6KC 5JIYA 2G46A 5T0MA 5TTFA 2JV0A 3MO5A 4J7FA 3IHXA 4C1QA 1N6CA 5HQ8A 1MT6A 1N3JA 1PEGA 2R3AA 4WUYA 3FPDA 4IJ8A 5AYFA 5TH7A 2W5ZA 4MI0A 3EP0A 3S7BA 2RFIA 4O6FA
chains in the Genus database with same CATH superfamily
3OPEA 2BQZA 1XQHA 3S7JA 3MEKA 5T5GA 5EX3A 1ML9A 4NVQA 2IGQA 3KMAA 3M57A 4JDSA 4J83A 3BO5A 3KMJA 3SWCA 3KMTA 4O30A 3M54A 5JINA 5F5EA 5KJLA 1ZKKA 4YPUA 5LSXA 3K5KA 3CBOA 5EG2A 3VUZA 3M58A 4QEOA 1H3IA 3M55A 3OS5A 1MVXA 5EX0A 4AU7A 3M53A 4JLGA 3OXGA 3QWWA 4NJ5A 3DB5A 4FMUA 3OOIA 2F69A 4I51A 3OXFA 3F9ZA 3SW9A 3N71A 5KJMA 4Z4PA 4BUPA 3M5AA 4LDGA 3F9WA 4YNDA 5CCMA 4YNMA 5HI7A 4MI5A 5JHNA 1MUFA 5ARGA 3F9YA 1MVHA 2O8JA 3RU0A 5F59A 3RAYA 3RJWA 5TEGA 3RIBA 4QENA 5F6LA 3CBPA 5CPRB 5KJKA 2W5YA 4H12A 3TG5A 3OXLA 1O9SA 3M59A 3RQ4A 4QEPA 5CCLA 3MO0A 3S8PA 3TG4A 5LSZA 3HNAA 4YPEA 3VV0A 4J8OA 3QWPA 3QWVA 3M56A 4YPAA 3S7DA 3PDNA 3CBMA 3MO2A 4RZ0A 5KJNA 5T0KA 4YNPA 5ARFA 3S7FA 5JJ0A 3DALA 1N6AA 2QPWA 4J7IA 4E47A 3F9XA 4IJDA 5F6KC 5JIYA 2G46A 5T0MA 5TTFA 2JV0A 3MO5A 4J7FA 3IHXA 4C1QA 1N6CA 5HQ8A 1MT6A 1N3JA 1PEGA 2R3AA 4WUYA 3FPDA 4IJ8A 5AYFA 5TH7A 2W5ZA 4MI0A 3EP0A 3S7BA 2RFIA 4O6FA
chains in the Genus database with same CATH topology
3OPEA 2BQZA 1XQHA 3S7JA 3MEKA 5T5GA 5EX3A 1ML9A 4NVQA 2IGQA 3KMAA 3M57A 4JDSA 4J83A 3BO5A 3KMJA 3SWCA 3KMTA 4O30A 3M54A 5JINA 5F5EA 5KJLA 1ZKKA 4YPUA 5LSXA 3K5KA 3CBOA 5EG2A 3VUZA 3M58A 4QEOA 1H3IA 3M55A 3OS5A 1MVXA 5EX0A 4AU7A 3M53A 4JLGA 3OXGA 3QWWA 4NJ5A 3DB5A 4FMUA 3OOIA 2F69A 4I51A 3OXFA 3F9ZA 3SW9A 3N71A 5KJMA 4Z4PA 4BUPA 3M5AA 4LDGA 3F9WA 4YNDA 5CCMA 4YNMA 5HI7A 4MI5A 5JHNA 1MUFA 5ARGA 3F9YA 1MVHA 2O8JA 3RU0A 5F59A 3RAYA 3RJWA 5TEGA 3RIBA 4QENA 5F6LA 3CBPA 5CPRB 5KJKA 2W5YA 4H12A 3TG5A 3OXLA 1O9SA 3M59A 3RQ4A 4QEPA 5CCLA 3MO0A 3S8PA 3TG4A 5LSZA 3HNAA 4YPEA 3VV0A 4J8OA 3QWPA 3QWVA 3M56A 4YPAA 3S7DA 3PDNA 3CBMA 3MO2A 4RZ0A 5KJNA 5T0KA 4YNPA 5ARFA 3S7FA 5JJ0A 3DALA 1N6AA 2QPWA 4J7IA 4E47A 3F9XA 4IJDA 5F6KC 5JIYA 2G46A 5T0MA 5TTFA 2JV0A 3MO5A 4J7FA 3IHXA 4C1QA 1N6CA 5HQ8A 1MT6A 1N3JA 1PEGA 2R3AA 4WUYA 3FPDA 4IJ8A 5AYFA 5TH7A 2W5ZA 4MI0A 3EP0A 3S7BA 2RFIA 4O6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPE A;  2BQZ A;  1XQH A;  3S7J A;  3MEK A;  5T5G A;  5EX3 A;  1ML9 A;  4NVQ A;  2IGQ A;  3KMA A;  3M57 A;  4JDS A;  4J83 A;  3BO5 A;  3KMJ A;  3SWC A;  3KMT A;  4O30 A;  3M54 A;  5JIN A;  5F5E A;  5KJL A;  1ZKK A;  4YPU A;  5LSX A;  3K5K A;  3CBO A;  5EG2 A;  3VUZ A;  3M58 A;  4QEO A;  1H3I A;  3M55 A;  3OS5 A;  1MVX A;  5EX0 A;  4AU7 A;  3M53 A;  4JLG A;  3OXG A;  3QWW A;  4NJ5 A;  3DB5 A;  4FMU A;  3OOI A;  2F69 A;  4I51 A;  3OXF A;  3F9Z A;  3SW9 A;  3N71 A;  5KJM A;  4Z4P A;  4BUP A;  3M5A A;  4LDG A;  3F9W A;  4YND A;  5CCM A;  4YNM A;  5HI7 A;  4MI5 A;  5JHN A;  1MUF A;  5ARG A;  3F9Y A;  1MVH A;  2O8J A;  3RU0 A;  5F59 A;  3RAY A;  3RJW A;  5TEG A;  3RIB A;  4QEN A;  5F6L A;  3CBP A;  5CPR B;  5KJK A;  2W5Y A;  4H12 A;  3TG5 A;  3OXL A;  1O9S A;  3M59 A;  3RQ4 A;  4QEP A;  5CCL A;  3MO0 A;  3S8P A;  3TG4 A;  5LSZ A;  3HNA A;  4YPE A;  3VV0 A;  4J8O A;  3QWP A;  3QWV A;  3M56 A;  4YPA A;  3S7D A;  3PDN A;  3CBM A;  3MO2 A;  4RZ0 A;  5KJN A;  5T0K A;  4YNP A;  5ARF A;  3S7F A;  5JJ0 A;  3DAL A;  1N6A A;  2QPW A;  4J7I A;  4E47 A;  3F9X A;  4IJD A;  5F6K C;  5JIY A;  2G46 A;  5T0M A;  5TTF A;  2JV0 A;  3MO5 A;  4J7F A;  3IHX A;  4C1Q A;  1N6C A;  5HQ8 A;  1MT6 A;  1N3J A;  1PEG A;  2R3A A;  4WUY A;  3FPD A;  4IJ8 A;  5AYF A;  5TH7 A;  2W5Z A;  4MI0 A;  3EP0 A;  3S7B A;  2RFI A;  4O6F A; 
#chains in the Genus database with same CATH topology
 3OPE A;  2BQZ A;  1XQH A;  3S7J A;  3MEK A;  5T5G A;  5EX3 A;  1ML9 A;  4NVQ A;  2IGQ A;  3KMA A;  3M57 A;  4JDS A;  4J83 A;  3BO5 A;  3KMJ A;  3SWC A;  3KMT A;  4O30 A;  3M54 A;  5JIN A;  5F5E A;  5KJL A;  1ZKK A;  4YPU A;  5LSX A;  3K5K A;  3CBO A;  5EG2 A;  3VUZ A;  3M58 A;  4QEO A;  1H3I A;  3M55 A;  3OS5 A;  1MVX A;  5EX0 A;  4AU7 A;  3M53 A;  4JLG A;  3OXG A;  3QWW A;  4NJ5 A;  3DB5 A;  4FMU A;  3OOI A;  2F69 A;  4I51 A;  3OXF A;  3F9Z A;  3SW9 A;  3N71 A;  5KJM A;  4Z4P A;  4BUP A;  3M5A A;  4LDG A;  3F9W A;  4YND A;  5CCM A;  4YNM A;  5HI7 A;  4MI5 A;  5JHN A;  1MUF A;  5ARG A;  3F9Y A;  1MVH A;  2O8J A;  3RU0 A;  5F59 A;  3RAY A;  3RJW A;  5TEG A;  3RIB A;  4QEN A;  5F6L A;  3CBP A;  5CPR B;  5KJK A;  2W5Y A;  4H12 A;  3TG5 A;  3OXL A;  1O9S A;  3M59 A;  3RQ4 A;  4QEP A;  5CCL A;  3MO0 A;  3S8P A;  3TG4 A;  5LSZ A;  3HNA A;  4YPE A;  3VV0 A;  4J8O A;  3QWP A;  3QWV A;  3M56 A;  4YPA A;  3S7D A;  3PDN A;  3CBM A;  3MO2 A;  4RZ0 A;  5KJN A;  5T0K A;  4YNP A;  5ARF A;  3S7F A;  5JJ0 A;  3DAL A;  1N6A A;  2QPW A;  4J7I A;  4E47 A;  3F9X A;  4IJD A;  5F6K C;  5JIY A;  2G46 A;  5T0M A;  5TTF A;  2JV0 A;  3MO5 A;  4J7F A;  3IHX A;  4C1Q A;  1N6C A;  5HQ8 A;  1MT6 A;  1N3J A;  1PEG A;  2R3A A;  4WUY A;  3FPD A;  4IJ8 A;  5AYF A;  5TH7 A;  2W5Z A;  4MI0 A;  3EP0 A;  3S7B A;  2RFI A;  4O6F A; 
#chains in the Genus database with same CATH homology
 3OPE A;  2BQZ A;  1XQH A;  3S7J A;  3MEK A;  5T5G A;  5EX3 A;  1ML9 A;  4NVQ A;  2IGQ A;  3KMA A;  3M57 A;  4JDS A;  4J83 A;  3BO5 A;  3KMJ A;  3SWC A;  3KMT A;  4O30 A;  3M54 A;  5JIN A;  5F5E A;  5KJL A;  1ZKK A;  4YPU A;  5LSX A;  3K5K A;  3CBO A;  5EG2 A;  3VUZ A;  3M58 A;  4QEO A;  1H3I A;  3M55 A;  3OS5 A;  1MVX A;  5EX0 A;  4AU7 A;  3M53 A;  4JLG A;  3OXG A;  3QWW A;  4NJ5 A;  3DB5 A;  4FMU A;  3OOI A;  2F69 A;  4I51 A;  3OXF A;  3F9Z A;  3SW9 A;  3N71 A;  5KJM A;  4Z4P A;  4BUP A;  3M5A A;  4LDG A;  3F9W A;  4YND A;  5CCM A;  4YNM A;  5HI7 A;  4MI5 A;  5JHN A;  1MUF A;  5ARG A;  3F9Y A;  1MVH A;  2O8J A;  3RU0 A;  5F59 A;  3RAY A;  3RJW A;  5TEG A;  3RIB A;  4QEN A;  5F6L A;  3CBP A;  5CPR B;  5KJK A;  2W5Y A;  4H12 A;  3TG5 A;  3OXL A;  1O9S A;  3M59 A;  3RQ4 A;  4QEP A;  5CCL A;  3MO0 A;  3S8P A;  3TG4 A;  5LSZ A;  3HNA A;  4YPE A;  3VV0 A;  4J8O A;  3QWP A;  3QWV A;  3M56 A;  4YPA A;  3S7D A;  3PDN A;  3CBM A;  3MO2 A;  4RZ0 A;  5KJN A;  5T0K A;  4YNP A;  5ARF A;  3S7F A;  5JJ0 A;  3DAL A;  1N6A A;  2QPW A;  4J7I A;  4E47 A;  3F9X A;  4IJD A;  5F6K C;  5JIY A;  2G46 A;  5T0M A;  5TTF A;  2JV0 A;  3MO5 A;  4J7F A;  3IHX A;  4C1Q A;  1N6C A;  5HQ8 A;  1MT6 A;  1N3J A;  1PEG A;  2R3A A;  4WUY A;  3FPD A;  4IJ8 A;  5AYF A;  5TH7 A;  2W5Z A;  4MI0 A;  3EP0 A;  3S7B A;  2RFI A;  4O6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...