2QPWA

Methyltransferase domain of human pr domain-containing protein 2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
147
structure length
147
Chain Sequence
NQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 2
publication title Structural biology of human H3K9 methyltransferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 31
structure length 147
sequence length 147
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2qpwA01
3M55A 5AYFA 4O6FA 3F9ZA 3CBMA 5KJMA 4NJ5A 2JV0A 4J7IA 3K5KA 1H3IA 3N71A 3S7DA 3DALA 1XQHA 5HQ8A 4FMUA 5T0MA 5JIYA 3MO5A 4YNPA 5ARGA 2W5YA 5LSXA 4YNDA 1N6AA 2RFIA 3OXFA 5F6LA 5TTFA 4QEOA 3TG4A 5F6KC 3F9WA 3S7JA 1ML9A 3VUZA 3MO0A 5JJ0A 3CBPA 5HI7A 1O9SA 3S8PA 4YPAA 5F59A 4MI0A 4LDGA 3RIBA 4YNMA 3FPDA 5TH7A 5JHNA 2R3AA 3M56A 1MVXA 5CCLA 1PEGA 4QENA 4WUYA 3RQ4A 3OPEA 5CCMA 3OXLA 3QWVA 3S7FA 4I51A 1ZKKA 3MO2A 4AU7A 3RAYA 3SWCA 4H12A 5F5EA 4C1QA 3EP0A 4YPEA 2W5ZA 3OXGA 5CPRB 4IJ8A 3KMJA 4IJDA 5KJNA 3PDNA 4RZ0A 4Z4PA 2BQZA 5TEGA 5EG2A 3VV0A 5JINA 1MUFA 4J7FA 5T0KA 4J83A 3TG5A 3SW9A 3M57A 4YPUA 3CBOA 3HNAA 4O30A 2G46A 3M54A 3M59A 3MEKA 1MT6A 3BO5A 4BUPA 3KMAA 1N3JA 5EX0A 3OOIA 5T5GA 4J8OA 5EX3A 4QEPA 2O8JA 3KMTA 4JLGA 3RJWA 4NVQA 2IGQA 3F9YA 2QPWA 3M53A 3QWWA 3S7BA 4E47A 1MVHA 3M58A 5KJKA 5ARFA 5KJLA 3OS5A 3IHXA 3QWPA 2F69A 3RU0A 1N6CA 4JDSA 3DB5A 4MI5A 3M5AA 3F9XA 5LSZA
chains in the Genus database with same CATH superfamily
3M55A 5AYFA 4O6FA 3F9ZA 3CBMA 5KJMA 4NJ5A 2JV0A 4J7IA 3K5KA 1H3IA 3N71A 3S7DA 3DALA 1XQHA 5HQ8A 4FMUA 5T0MA 5JIYA 3MO5A 4YNPA 5ARGA 2W5YA 5LSXA 4YNDA 1N6AA 2RFIA 3OXFA 5F6LA 5TTFA 4QEOA 3TG4A 5F6KC 3F9WA 3S7JA 1ML9A 3VUZA 3MO0A 5JJ0A 3CBPA 5HI7A 1O9SA 3S8PA 4YPAA 5F59A 4MI0A 4LDGA 3RIBA 4YNMA 3FPDA 5TH7A 5JHNA 2R3AA 3M56A 1MVXA 5CCLA 1PEGA 4QENA 4WUYA 3RQ4A 3OPEA 5CCMA 3OXLA 3QWVA 3S7FA 4I51A 1ZKKA 3MO2A 4AU7A 3RAYA 3SWCA 4H12A 5F5EA 4C1QA 3EP0A 4YPEA 2W5ZA 3OXGA 5CPRB 4IJ8A 3KMJA 4IJDA 5KJNA 3PDNA 4RZ0A 4Z4PA 2BQZA 5TEGA 5EG2A 3VV0A 5JINA 1MUFA 4J7FA 5T0KA 4J83A 3TG5A 3SW9A 3M57A 4YPUA 3CBOA 3HNAA 4O30A 2G46A 3M54A 3M59A 3MEKA 1MT6A 3BO5A 4BUPA 3KMAA 1N3JA 5EX0A 3OOIA 5T5GA 4J8OA 5EX3A 4QEPA 2O8JA 3KMTA 4JLGA 3RJWA 4NVQA 2IGQA 3F9YA 2QPWA 3M53A 3QWWA 3S7BA 4E47A 1MVHA 3M58A 5KJKA 5ARFA 5KJLA 3OS5A 3IHXA 3QWPA 2F69A 3RU0A 1N6CA 4JDSA 3DB5A 4MI5A 3M5AA 3F9XA 5LSZA
chains in the Genus database with same CATH topology
3M55A 5AYFA 4O6FA 3F9ZA 3CBMA 5KJMA 4NJ5A 2JV0A 4J7IA 3K5KA 1H3IA 3N71A 3S7DA 3DALA 1XQHA 5HQ8A 4FMUA 5T0MA 5JIYA 3MO5A 4YNPA 5ARGA 2W5YA 5LSXA 4YNDA 1N6AA 2RFIA 3OXFA 5F6LA 5TTFA 4QEOA 3TG4A 5F6KC 3F9WA 3S7JA 1ML9A 3VUZA 3MO0A 5JJ0A 3CBPA 5HI7A 1O9SA 3S8PA 4YPAA 5F59A 4MI0A 4LDGA 3RIBA 4YNMA 3FPDA 5TH7A 5JHNA 2R3AA 3M56A 1MVXA 5CCLA 1PEGA 4QENA 4WUYA 3RQ4A 3OPEA 5CCMA 3OXLA 3QWVA 3S7FA 4I51A 1ZKKA 3MO2A 4AU7A 3RAYA 3SWCA 4H12A 5F5EA 4C1QA 3EP0A 4YPEA 2W5ZA 3OXGA 5CPRB 4IJ8A 3KMJA 4IJDA 5KJNA 3PDNA 4RZ0A 4Z4PA 2BQZA 5TEGA 5EG2A 3VV0A 5JINA 1MUFA 4J7FA 5T0KA 4J83A 3TG5A 3SW9A 3M57A 4YPUA 3CBOA 3HNAA 4O30A 2G46A 3M54A 3M59A 3MEKA 1MT6A 3BO5A 4BUPA 3KMAA 1N3JA 5EX0A 3OOIA 5T5GA 4J8OA 5EX3A 4QEPA 2O8JA 3KMTA 4JLGA 3RJWA 4NVQA 2IGQA 3F9YA 2QPWA 3M53A 3QWWA 3S7BA 4E47A 1MVHA 3M58A 5KJKA 5ARFA 5KJLA 3OS5A 3IHXA 3QWPA 2F69A 3RU0A 1N6CA 4JDSA 3DB5A 4MI5A 3M5AA 3F9XA 5LSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M55 A;  5AYF A;  4O6F A;  3F9Z A;  3CBM A;  5KJM A;  4NJ5 A;  2JV0 A;  4J7I A;  3K5K A;  1H3I A;  3N71 A;  3S7D A;  3DAL A;  1XQH A;  5HQ8 A;  4FMU A;  5T0M A;  5JIY A;  3MO5 A;  4YNP A;  5ARG A;  2W5Y A;  5LSX A;  4YND A;  1N6A A;  2RFI A;  3OXF A;  5F6L A;  5TTF A;  4QEO A;  3TG4 A;  5F6K C;  3F9W A;  3S7J A;  1ML9 A;  3VUZ A;  3MO0 A;  5JJ0 A;  3CBP A;  5HI7 A;  1O9S A;  3S8P A;  4YPA A;  5F59 A;  4MI0 A;  4LDG A;  3RIB A;  4YNM A;  3FPD A;  5TH7 A;  5JHN A;  2R3A A;  3M56 A;  1MVX A;  5CCL A;  1PEG A;  4QEN A;  4WUY A;  3RQ4 A;  3OPE A;  5CCM A;  3OXL A;  3QWV A;  3S7F A;  4I51 A;  1ZKK A;  3MO2 A;  4AU7 A;  3RAY A;  3SWC A;  4H12 A;  5F5E A;  4C1Q A;  3EP0 A;  4YPE A;  2W5Z A;  3OXG A;  5CPR B;  4IJ8 A;  3KMJ A;  4IJD A;  5KJN A;  3PDN A;  4RZ0 A;  4Z4P A;  2BQZ A;  5TEG A;  5EG2 A;  3VV0 A;  5JIN A;  1MUF A;  4J7F A;  5T0K A;  4J83 A;  3TG5 A;  3SW9 A;  3M57 A;  4YPU A;  3CBO A;  3HNA A;  4O30 A;  2G46 A;  3M54 A;  3M59 A;  3MEK A;  1MT6 A;  3BO5 A;  4BUP A;  3KMA A;  1N3J A;  5EX0 A;  3OOI A;  5T5G A;  4J8O A;  5EX3 A;  4QEP A;  2O8J A;  3KMT A;  4JLG A;  3RJW A;  4NVQ A;  2IGQ A;  3F9Y A;  2QPW A;  3M53 A;  3QWW A;  3S7B A;  4E47 A;  1MVH A;  3M58 A;  5KJK A;  5ARF A;  5KJL A;  3OS5 A;  3IHX A;  3QWP A;  2F69 A;  3RU0 A;  1N6C A;  4JDS A;  3DB5 A;  4MI5 A;  3M5A A;  3F9X A;  5LSZ A; 
#chains in the Genus database with same CATH topology
 3M55 A;  5AYF A;  4O6F A;  3F9Z A;  3CBM A;  5KJM A;  4NJ5 A;  2JV0 A;  4J7I A;  3K5K A;  1H3I A;  3N71 A;  3S7D A;  3DAL A;  1XQH A;  5HQ8 A;  4FMU A;  5T0M A;  5JIY A;  3MO5 A;  4YNP A;  5ARG A;  2W5Y A;  5LSX A;  4YND A;  1N6A A;  2RFI A;  3OXF A;  5F6L A;  5TTF A;  4QEO A;  3TG4 A;  5F6K C;  3F9W A;  3S7J A;  1ML9 A;  3VUZ A;  3MO0 A;  5JJ0 A;  3CBP A;  5HI7 A;  1O9S A;  3S8P A;  4YPA A;  5F59 A;  4MI0 A;  4LDG A;  3RIB A;  4YNM A;  3FPD A;  5TH7 A;  5JHN A;  2R3A A;  3M56 A;  1MVX A;  5CCL A;  1PEG A;  4QEN A;  4WUY A;  3RQ4 A;  3OPE A;  5CCM A;  3OXL A;  3QWV A;  3S7F A;  4I51 A;  1ZKK A;  3MO2 A;  4AU7 A;  3RAY A;  3SWC A;  4H12 A;  5F5E A;  4C1Q A;  3EP0 A;  4YPE A;  2W5Z A;  3OXG A;  5CPR B;  4IJ8 A;  3KMJ A;  4IJD A;  5KJN A;  3PDN A;  4RZ0 A;  4Z4P A;  2BQZ A;  5TEG A;  5EG2 A;  3VV0 A;  5JIN A;  1MUF A;  4J7F A;  5T0K A;  4J83 A;  3TG5 A;  3SW9 A;  3M57 A;  4YPU A;  3CBO A;  3HNA A;  4O30 A;  2G46 A;  3M54 A;  3M59 A;  3MEK A;  1MT6 A;  3BO5 A;  4BUP A;  3KMA A;  1N3J A;  5EX0 A;  3OOI A;  5T5G A;  4J8O A;  5EX3 A;  4QEP A;  2O8J A;  3KMT A;  4JLG A;  3RJW A;  4NVQ A;  2IGQ A;  3F9Y A;  2QPW A;  3M53 A;  3QWW A;  3S7B A;  4E47 A;  1MVH A;  3M58 A;  5KJK A;  5ARF A;  5KJL A;  3OS5 A;  3IHX A;  3QWP A;  2F69 A;  3RU0 A;  1N6C A;  4JDS A;  3DB5 A;  4MI5 A;  3M5A A;  3F9X A;  5LSZ A; 
#chains in the Genus database with same CATH homology
 3M55 A;  5AYF A;  4O6F A;  3F9Z A;  3CBM A;  5KJM A;  4NJ5 A;  2JV0 A;  4J7I A;  3K5K A;  1H3I A;  3N71 A;  3S7D A;  3DAL A;  1XQH A;  5HQ8 A;  4FMU A;  5T0M A;  5JIY A;  3MO5 A;  4YNP A;  5ARG A;  2W5Y A;  5LSX A;  4YND A;  1N6A A;  2RFI A;  3OXF A;  5F6L A;  5TTF A;  4QEO A;  3TG4 A;  5F6K C;  3F9W A;  3S7J A;  1ML9 A;  3VUZ A;  3MO0 A;  5JJ0 A;  3CBP A;  5HI7 A;  1O9S A;  3S8P A;  4YPA A;  5F59 A;  4MI0 A;  4LDG A;  3RIB A;  4YNM A;  3FPD A;  5TH7 A;  5JHN A;  2R3A A;  3M56 A;  1MVX A;  5CCL A;  1PEG A;  4QEN A;  4WUY A;  3RQ4 A;  3OPE A;  5CCM A;  3OXL A;  3QWV A;  3S7F A;  4I51 A;  1ZKK A;  3MO2 A;  4AU7 A;  3RAY A;  3SWC A;  4H12 A;  5F5E A;  4C1Q A;  3EP0 A;  4YPE A;  2W5Z A;  3OXG A;  5CPR B;  4IJ8 A;  3KMJ A;  4IJD A;  5KJN A;  3PDN A;  4RZ0 A;  4Z4P A;  2BQZ A;  5TEG A;  5EG2 A;  3VV0 A;  5JIN A;  1MUF A;  4J7F A;  5T0K A;  4J83 A;  3TG5 A;  3SW9 A;  3M57 A;  4YPU A;  3CBO A;  3HNA A;  4O30 A;  2G46 A;  3M54 A;  3M59 A;  3MEK A;  1MT6 A;  3BO5 A;  4BUP A;  3KMA A;  1N3J A;  5EX0 A;  3OOI A;  5T5G A;  4J8O A;  5EX3 A;  4QEP A;  2O8J A;  3KMT A;  4JLG A;  3RJW A;  4NVQ A;  2IGQ A;  3F9Y A;  2QPW A;  3M53 A;  3QWW A;  3S7B A;  4E47 A;  1MVH A;  3M58 A;  5KJK A;  5ARF A;  5KJL A;  3OS5 A;  3IHX A;  3QWP A;  2F69 A;  3RU0 A;  1N6C A;  4JDS A;  3DB5 A;  4MI5 A;  3M5A A;  3F9X A;  5LSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...