2QPWA

Methyltransferase domain of human pr domain-containing protein 2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
147
structure length
147
Chain Sequence
NQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 2
publication title Structural biology of human H3K9 methyltransferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 31
structure length 147
sequence length 147
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2qpwA01
3SW9A 5CCLA 3RIBA 5KJLA 4I51A 1O9SA 3MO0A 5ARGA 4JLGA 3M54A 3S8PA 3M59A 3HNAA 4IJDA 5EG2A 3OOIA 4J8OA 4Z4PA 4QEPA 3SWCA 4BUPA 5AYFA 2BQZA 3OXFA 5TTFA 1ZKKA 4NJ5A 3QWWA 4H12A 3S7JA 2W5ZA 5LSXA 4JDSA 3VUZA 3M5AA 5JJ0A 4J83A 4YNPA 3MO2A 3QWVA 5HI7A 3S7BA 5T0MA 5T0KA 3CBOA 1MUFA 3F9XA 5T5GA 3BO5A 1N6CA 3VV0A 3M57A 1ML9A 3EP0A 4FMUA 5F6KC 4QENA 4IJ8A 5JIYA 3N71A 4O6FA 4WUYA 4J7IA 3KMJA 5TEGA 2F69A 3F9ZA 5JINA 2IGQA 5LSZA 4O30A 3RQ4A 3M56A 4AU7A 4YNDA 1N6AA 3CBMA 4J7FA 2QPWA 5HQ8A 3S7DA 3F9WA 3DALA 3CBPA 3S7FA 3M55A 1XQHA 2RFIA 4QEOA 1PEGA 4LDGA 3PDNA 2G46A 4YPEA 3RAYA 1N3JA 5KJKA 1MVXA 3OPEA 3KMAA 3M53A 3OS5A 3KMTA 3IHXA 5EX0A 3FPDA 3OXGA 5TH7A 3K5KA 3F9YA 5F6LA 4YPUA 4NVQA 4RZ0A 1MT6A 5JHNA 1H3IA 5F59A 3RU0A 3OXLA 4YPAA 2JV0A 4MI5A 2O8JA 5KJMA 4MI0A 2R3AA 5CPRB 2W5YA 5EX3A 1MVHA 3TG5A 3RJWA 3MO5A 4C1QA 5CCMA 5KJNA 5F5EA 4E47A 5ARFA 3DB5A 4YNMA 3MEKA 3M58A 3QWPA 3TG4A
chains in the Genus database with same CATH superfamily
3SW9A 5CCLA 3RIBA 5KJLA 4I51A 1O9SA 3MO0A 5ARGA 4JLGA 3M54A 3S8PA 3M59A 3HNAA 4IJDA 5EG2A 3OOIA 4J8OA 4Z4PA 4QEPA 3SWCA 4BUPA 5AYFA 2BQZA 3OXFA 5TTFA 1ZKKA 4NJ5A 3QWWA 4H12A 3S7JA 2W5ZA 5LSXA 4JDSA 3VUZA 3M5AA 5JJ0A 4J83A 4YNPA 3MO2A 3QWVA 5HI7A 3S7BA 5T0MA 5T0KA 3CBOA 1MUFA 3F9XA 5T5GA 3BO5A 1N6CA 3VV0A 3M57A 1ML9A 3EP0A 4FMUA 5F6KC 4QENA 4IJ8A 5JIYA 3N71A 4O6FA 4WUYA 4J7IA 3KMJA 5TEGA 2F69A 3F9ZA 5JINA 2IGQA 5LSZA 4O30A 3RQ4A 3M56A 4AU7A 4YNDA 1N6AA 3CBMA 4J7FA 2QPWA 5HQ8A 3S7DA 3F9WA 3DALA 3CBPA 3S7FA 3M55A 1XQHA 2RFIA 4QEOA 1PEGA 4LDGA 3PDNA 2G46A 4YPEA 3RAYA 1N3JA 5KJKA 1MVXA 3OPEA 3KMAA 3M53A 3OS5A 3KMTA 3IHXA 5EX0A 3FPDA 3OXGA 5TH7A 3K5KA 3F9YA 5F6LA 4YPUA 4NVQA 4RZ0A 1MT6A 5JHNA 1H3IA 5F59A 3RU0A 3OXLA 4YPAA 2JV0A 4MI5A 2O8JA 5KJMA 4MI0A 2R3AA 5CPRB 2W5YA 5EX3A 1MVHA 3TG5A 3RJWA 3MO5A 4C1QA 5CCMA 5KJNA 5F5EA 4E47A 5ARFA 3DB5A 4YNMA 3MEKA 3M58A 3QWPA 3TG4A
chains in the Genus database with same CATH topology
3SW9A 5CCLA 3RIBA 5KJLA 4I51A 1O9SA 3MO0A 5ARGA 4JLGA 3M54A 3S8PA 3M59A 3HNAA 4IJDA 5EG2A 3OOIA 4J8OA 4Z4PA 4QEPA 3SWCA 4BUPA 5AYFA 2BQZA 3OXFA 5TTFA 1ZKKA 4NJ5A 3QWWA 4H12A 3S7JA 2W5ZA 5LSXA 4JDSA 3VUZA 3M5AA 5JJ0A 4J83A 4YNPA 3MO2A 3QWVA 5HI7A 3S7BA 5T0MA 5T0KA 3CBOA 1MUFA 3F9XA 5T5GA 3BO5A 1N6CA 3VV0A 3M57A 1ML9A 3EP0A 4FMUA 5F6KC 4QENA 4IJ8A 5JIYA 3N71A 4O6FA 4WUYA 4J7IA 3KMJA 5TEGA 2F69A 3F9ZA 5JINA 2IGQA 5LSZA 4O30A 3RQ4A 3M56A 4AU7A 4YNDA 1N6AA 3CBMA 4J7FA 2QPWA 5HQ8A 3S7DA 3F9WA 3DALA 3CBPA 3S7FA 3M55A 1XQHA 2RFIA 4QEOA 1PEGA 4LDGA 3PDNA 2G46A 4YPEA 3RAYA 1N3JA 5KJKA 1MVXA 3OPEA 3KMAA 3M53A 3OS5A 3KMTA 3IHXA 5EX0A 3FPDA 3OXGA 5TH7A 3K5KA 3F9YA 5F6LA 4YPUA 4NVQA 4RZ0A 1MT6A 5JHNA 1H3IA 5F59A 3RU0A 3OXLA 4YPAA 2JV0A 4MI5A 2O8JA 5KJMA 4MI0A 2R3AA 5CPRB 2W5YA 5EX3A 1MVHA 3TG5A 3RJWA 3MO5A 4C1QA 5CCMA 5KJNA 5F5EA 4E47A 5ARFA 3DB5A 4YNMA 3MEKA 3M58A 3QWPA 3TG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SW9 A;  5CCL A;  3RIB A;  5KJL A;  4I51 A;  1O9S A;  3MO0 A;  5ARG A;  4JLG A;  3M54 A;  3S8P A;  3M59 A;  3HNA A;  4IJD A;  5EG2 A;  3OOI A;  4J8O A;  4Z4P A;  4QEP A;  3SWC A;  4BUP A;  5AYF A;  2BQZ A;  3OXF A;  5TTF A;  1ZKK A;  4NJ5 A;  3QWW A;  4H12 A;  3S7J A;  2W5Z A;  5LSX A;  4JDS A;  3VUZ A;  3M5A A;  5JJ0 A;  4J83 A;  4YNP A;  3MO2 A;  3QWV A;  5HI7 A;  3S7B A;  5T0M A;  5T0K A;  3CBO A;  1MUF A;  3F9X A;  5T5G A;  3BO5 A;  1N6C A;  3VV0 A;  3M57 A;  1ML9 A;  3EP0 A;  4FMU A;  5F6K C;  4QEN A;  4IJ8 A;  5JIY A;  3N71 A;  4O6F A;  4WUY A;  4J7I A;  3KMJ A;  5TEG A;  2F69 A;  3F9Z A;  5JIN A;  2IGQ A;  5LSZ A;  4O30 A;  3RQ4 A;  3M56 A;  4AU7 A;  4YND A;  1N6A A;  3CBM A;  4J7F A;  2QPW A;  5HQ8 A;  3S7D A;  3F9W A;  3DAL A;  3CBP A;  3S7F A;  3M55 A;  1XQH A;  2RFI A;  4QEO A;  1PEG A;  4LDG A;  3PDN A;  2G46 A;  4YPE A;  3RAY A;  1N3J A;  5KJK A;  1MVX A;  3OPE A;  3KMA A;  3M53 A;  3OS5 A;  3KMT A;  3IHX A;  5EX0 A;  3FPD A;  3OXG A;  5TH7 A;  3K5K A;  3F9Y A;  5F6L A;  4YPU A;  4NVQ A;  4RZ0 A;  1MT6 A;  5JHN A;  1H3I A;  5F59 A;  3RU0 A;  3OXL A;  4YPA A;  2JV0 A;  4MI5 A;  2O8J A;  5KJM A;  4MI0 A;  2R3A A;  5CPR B;  2W5Y A;  5EX3 A;  1MVH A;  3TG5 A;  3RJW A;  3MO5 A;  4C1Q A;  5CCM A;  5KJN A;  5F5E A;  4E47 A;  5ARF A;  3DB5 A;  4YNM A;  3MEK A;  3M58 A;  3QWP A;  3TG4 A; 
#chains in the Genus database with same CATH topology
 3SW9 A;  5CCL A;  3RIB A;  5KJL A;  4I51 A;  1O9S A;  3MO0 A;  5ARG A;  4JLG A;  3M54 A;  3S8P A;  3M59 A;  3HNA A;  4IJD A;  5EG2 A;  3OOI A;  4J8O A;  4Z4P A;  4QEP A;  3SWC A;  4BUP A;  5AYF A;  2BQZ A;  3OXF A;  5TTF A;  1ZKK A;  4NJ5 A;  3QWW A;  4H12 A;  3S7J A;  2W5Z A;  5LSX A;  4JDS A;  3VUZ A;  3M5A A;  5JJ0 A;  4J83 A;  4YNP A;  3MO2 A;  3QWV A;  5HI7 A;  3S7B A;  5T0M A;  5T0K A;  3CBO A;  1MUF A;  3F9X A;  5T5G A;  3BO5 A;  1N6C A;  3VV0 A;  3M57 A;  1ML9 A;  3EP0 A;  4FMU A;  5F6K C;  4QEN A;  4IJ8 A;  5JIY A;  3N71 A;  4O6F A;  4WUY A;  4J7I A;  3KMJ A;  5TEG A;  2F69 A;  3F9Z A;  5JIN A;  2IGQ A;  5LSZ A;  4O30 A;  3RQ4 A;  3M56 A;  4AU7 A;  4YND A;  1N6A A;  3CBM A;  4J7F A;  2QPW A;  5HQ8 A;  3S7D A;  3F9W A;  3DAL A;  3CBP A;  3S7F A;  3M55 A;  1XQH A;  2RFI A;  4QEO A;  1PEG A;  4LDG A;  3PDN A;  2G46 A;  4YPE A;  3RAY A;  1N3J A;  5KJK A;  1MVX A;  3OPE A;  3KMA A;  3M53 A;  3OS5 A;  3KMT A;  3IHX A;  5EX0 A;  3FPD A;  3OXG A;  5TH7 A;  3K5K A;  3F9Y A;  5F6L A;  4YPU A;  4NVQ A;  4RZ0 A;  1MT6 A;  5JHN A;  1H3I A;  5F59 A;  3RU0 A;  3OXL A;  4YPA A;  2JV0 A;  4MI5 A;  2O8J A;  5KJM A;  4MI0 A;  2R3A A;  5CPR B;  2W5Y A;  5EX3 A;  1MVH A;  3TG5 A;  3RJW A;  3MO5 A;  4C1Q A;  5CCM A;  5KJN A;  5F5E A;  4E47 A;  5ARF A;  3DB5 A;  4YNM A;  3MEK A;  3M58 A;  3QWP A;  3TG4 A; 
#chains in the Genus database with same CATH homology
 3SW9 A;  5CCL A;  3RIB A;  5KJL A;  4I51 A;  1O9S A;  3MO0 A;  5ARG A;  4JLG A;  3M54 A;  3S8P A;  3M59 A;  3HNA A;  4IJD A;  5EG2 A;  3OOI A;  4J8O A;  4Z4P A;  4QEP A;  3SWC A;  4BUP A;  5AYF A;  2BQZ A;  3OXF A;  5TTF A;  1ZKK A;  4NJ5 A;  3QWW A;  4H12 A;  3S7J A;  2W5Z A;  5LSX A;  4JDS A;  3VUZ A;  3M5A A;  5JJ0 A;  4J83 A;  4YNP A;  3MO2 A;  3QWV A;  5HI7 A;  3S7B A;  5T0M A;  5T0K A;  3CBO A;  1MUF A;  3F9X A;  5T5G A;  3BO5 A;  1N6C A;  3VV0 A;  3M57 A;  1ML9 A;  3EP0 A;  4FMU A;  5F6K C;  4QEN A;  4IJ8 A;  5JIY A;  3N71 A;  4O6F A;  4WUY A;  4J7I A;  3KMJ A;  5TEG A;  2F69 A;  3F9Z A;  5JIN A;  2IGQ A;  5LSZ A;  4O30 A;  3RQ4 A;  3M56 A;  4AU7 A;  4YND A;  1N6A A;  3CBM A;  4J7F A;  2QPW A;  5HQ8 A;  3S7D A;  3F9W A;  3DAL A;  3CBP A;  3S7F A;  3M55 A;  1XQH A;  2RFI A;  4QEO A;  1PEG A;  4LDG A;  3PDN A;  2G46 A;  4YPE A;  3RAY A;  1N3J A;  5KJK A;  1MVX A;  3OPE A;  3KMA A;  3M53 A;  3OS5 A;  3KMT A;  3IHX A;  5EX0 A;  3FPD A;  3OXG A;  5TH7 A;  3K5K A;  3F9Y A;  5F6L A;  4YPU A;  4NVQ A;  4RZ0 A;  1MT6 A;  5JHN A;  1H3I A;  5F59 A;  3RU0 A;  3OXL A;  4YPA A;  2JV0 A;  4MI5 A;  2O8J A;  5KJM A;  4MI0 A;  2R3A A;  5CPR B;  2W5Y A;  5EX3 A;  1MVH A;  3TG5 A;  3RJW A;  3MO5 A;  4C1Q A;  5CCM A;  5KJN A;  5F5E A;  4E47 A;  5ARF A;  3DB5 A;  4YNM A;  3MEK A;  3M58 A;  3QWP A;  3TG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...