2QQ0A

Thymidine kinase from thermotoga maritima in complex with thymidine + appnhp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
169
Chain Sequence
b'SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKTMIVSHVEAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEEIDVGGQEKYIAVCRDCYNTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidine kinase
publication title Quaternary structure change as a mechanism for the regulation of thymidine kinase 1-like enzymes.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 56
structure length 169
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2qq0A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qq0A01
3VR1A 4XD7D 1UM8A 3ZZUA 2CE7A 1DADA 3ICEA 3DKPA 4TMVA 2JIZA 3TRFA 4HB0A 1NBMA 2CCGA 2R44A 2BMJA 5E7JA 4LJ6A 3KZ1E 4BFSA 2X2EA 4A9AA 2O0JA 2QMUA 4TQ9A 4TWZA 1DAFA 2IYUA 1KI6A 1XXHA 3QF4B 1ZIOA 1UBFA 4MGKR 1JI0A 3GQBA 5FL3A 4PSAA 3L8ZA 3RS3A 1LY1A 3BJIA 4DRZA 3VNUA 2OCPA 4FD2A 2ZRJA 1G8FA 2WIAA 1NVVR 3ZQJA 4Q48A 4AC9A 3PCRB 4QJ4A 3UG7A 4D0GA 4AK9A 3LDAA 4O2RA 1GL9B 4TYPA 2ZJAA 2XZLA 4LPSA 4DDVA 1EFUA 4E07A 4YXWD 4XVRA 1G3IA 4BEBA 2F1HA 1TF5A 121PA 1JJ7A 5JBQA 4KFSA 2ZQ5A 1FPMA 2WVJA 1W36B 3K0FA 1K5DA 1IHUA 1N0WA 1I4TD 1NY6A 4URZR 4OK3A 4Z51A 3AH8A 4ARZB 5JCZA 2QAGC 4L15A 2WWHA 1K8RA 2FMXA 3GJ7A 5CM9C 1G6OA 1XB2A 2QORA 3OIYA 4N0DA 3IPYA 2ENZA 1OPXA 1FTNA 1P60A 2GJKA 2BWJA 1W4CA 2H1LA 2ZTSA 1JBKA 4NDZA 5K8TA 3KJIA 3A1UA 4A6PA 4EJSB 1IY1A 3ADDA 4M9XA 2YUUA 3CPJB 3BIFA 2BBOA 2ZYVX 1N0VC 1MRSA 3AF1A 4OQXA 1AS2A 1FX0A 4RKEA 3RSOA 5JI2E 4YMUA 3SR0A 2H18A 1MT0A 3PV0A 3OIWA 1KK3A 4HAZA 2GDJA 2WJGA 2ZPTX 4I1SA 3SE0A 2JLUA 4Y0AA 3TSOA 3T1VA 4CF7A 2LKCA 1KI4A 4M9QA 3UXMA 5JZVA 2GJAA 2NTYC 3FTQA 3H1TA 4URYR 1E1QA 3NHAA 2J5XA 5FI0B 1B0UA 4NBSA 2GF0A 1RIFA 4IDPA 3QG1A 4IFEA 3WMGA 3RC3A 4FINA 4JLOA 1Q20A 1DO0A 5FOTA 4D81A 4MDFA 4Q4HA 1Z6GA 4A2QA 3C41J 3AVXA 2ZJBA 3QG5A 2G83A 2WWXA 4LX0A 1E6CA 1T8UA 4NYJQ 4OL0A 5JS7A 2GEVA 2R9VA 4P4SA 1N5LA 1ZIPA 4BECA 2ZM5A 5IK2D 3K8YA 5EQTA 2R65A 2RH5A 3LX8A 4LYAA 4HYYA 4JKIA 4A1FA 1Z2AA 1J99A 4TQUS 1OXTA 2CMKA 1G5PA 2OT3B 3IBYA 1D8TA 1W47A 3BFXA 3JZAA 5FOWA 2WJYA 2CVHA 2CK3A 4LWZA 5TMPA 1NJGA 1R0XA 2WAXA 2B7BA 3IQWA 1QHSA 2ZJ2A 3QKSA 3FMFA 1G8HA 1Q0UA 2FFAA 5DN6D 4MQBA 3U3MA 2BVNA 2XAUA 4JJZA 1TF7A 2ZRPA 3B85A 3MWYW 4LBWA 1JEEA 2ZVQX 4QNRA 4LV6A 1ZM7A 4Q4LA 1FQKA 2ZS7A 3T06B 1KK2A 1ZC4A 4XWKA 4CEJA 3PR1A 1W44A 1N6RA 2C98A 3FFBA 1T0HB 2GCOB 5C1BA 1JR6A 4DJTA 2XOKA 3WMEA 3LQRA 3ND8A 4D2IA 1G291 1EXMA 5CDFE 1VHLA 2AD1A 4D4KA 3AVVA 1ZM2A 3DKVA 3FFAA 3CIOA 5F3WB 3H84A 4HLUC 4R98A 4GL2A 3AGPA 1W0KA 4BLOA 1PLKA 1DE0A 1OFUX 2B6HA 4PHHA 2QP4A 1FW6A 2PH1A 2WPDD 1SVKA 1Z6TA 2DB3A 2GXSA 3SC3A 621PA 3BD9A 3RYTC 4WZ6A 2ASEA 1VCIA 4W5WA 1JEDA 3B78A 2GHIA 2AHOA 1QHXA 5EXXA 3LVRE 3B2EA 1X1RA 1TL7C 2H17A 2XEXA 2J0UB 1M34E 2BMDA 5KO2A 4KSBA 2J1LA 1TADA 2BJVA 1KO5A 1KAGA 3DOFA 4DBLC 3P20A 5AR1A 4UXHA 4G1UC 4AIIA 3EX7C 2FNFX 4DDUA 2R6FA 2QQ0A 2W83A 4JMPA 4LJ7A 3S1AB 4UNPA 5EXTA 1KO8A 3BWDD 1M8PA 3VX3A 1Q22A 2KBEA 2ZRFA 4URUR 4DSUA 5JEDA 3QXSA 5D3MB 3T5GA 2RGEA 4Q7MB 4XIGS 1N3BA 3UATA 5JECA 2NO1A 4PXAA 2RAPA 2EYQA 3GLGE 1XRJA 4UXJA 1R4AA 1CJUC 3BH7A 2V1UA 1J2JA 5FOVA 1CP2A 2HCBA 2PMDA 1AS3A 2C9OA 1E3MA 2ERYA 2PZFA 1HE1C 3LVQE 1YZNA 4TSFD 2RHMA 1W4RA 3W90A 3IPXA 3U61B 1E2LA 2IC5A 2HLDA 3QF4A 1OH7A 2Q9AA 2QENA 4JT4A 2G9NA 2Q9CA 4LBYA 3TVDA 3FDIA 1UEJA 1H8HA 2KE5A 4R7ZA 4F4IA 3N70A 5FBRB 4IFBA 2IYSA 2J41A 5KTYA 5J4HA 1II8B 4IEIA 4C2TA 4MKGA 2BM0A 3W9YA 4DEXA 1DAGA 1F60A 1BO6A 3I5XA 3EA0A 2QPTA 1XEWX 1QVRA 1U0HC 1KO1A 2AK2A 2FSGA 1FL9A 1H8EA 2CL7X 2ATVA 3RNLA 3RS0A 5JRZA 5AJYA 4F4JA 1GVNB 1KI2A 4BLPA 4FMCF 4LYHA 4DLVA 2ORIA 1YKSA 4HB4A 1IJFA 4A0HA 1Z0IA 2WM9B 2PEYA 1EK0A 4ZPXA 1XEFA 2O8BA 1SHZA 5HCNA 1UDXA 1P9WA 4EQ6B 3U6KA 4FMDF 2E1RA 2ODNA 2FNAA 3E2IA 1XA6A 1Z47A 4O25A 3ZVLA 5FI1B 1SVLA 3PUVA 4NYJR 4QFMA 3X1YA 4DCSA 1GIAA 1F48A 4EJSA 3U60B 4BLQA 2DYKA 3IHWA 1OIWA 4Z1MD 4NYIQ 4DCNA 3PVSA 1GNPA 2RGCA 5G53C 3IO3A 2JLSA 5E95A 2FG5A 3PXGA 2HUPA 3CRQA 2QY9A 4Q1FA 1Y3AA 2QRZA 4ZO4A 2ZEJA 3SHFA 3MAAC 4A8JC 4RFSB 1KSFX 3L43A 1HV8A 3KX2A 3M4YA 2RKOA 4L9WA 3QEOA 4Q7JB 3MLEA 5FTLA 1AA9A 2ZR0A 1U90A 2A78A 1RRPA 4LOAA 3R8CA 5UKDA 4PZYA 2F43B 1TF2A 4DWJA 3AVQA 2MMCA 2FA9A 4Z8XA 3EZFA 2XX3A 4IOJA 2XB4A 4ILEA 1XEXA 3PEYA 5J5CA 3LX5A 1KMHB 2WJIA 3TNFA 1S9HA 2YWHA 4G3XA 3KKQA 4LJ8A 4Q9KA 2GCNA 4B74A 2NO7A 1FUUA 3GJ0A 1LV7A 2F3TA 2UZIR 4URVR 4TL7A 2JJ1A 1P3JA 1W5TA 2Q9BA 1UADA 4Q1EA 1ZUNB 2JCSA 4XJXA 1HUQA 2G0NA 2C2HA 4WIAA 4EPTA 4HB3A 2VSXA 2WSSD 2YYZA 4V0MA 5CM8B 1OH8A 3K70D 4C4PA 1OB5A 2KSQA 4F7WA 1YE8A 3ZS9A 1RVDA 5DI9A 1F6BA 2G77B 1QF9A 1ZW6A 1JXOA 3A1WA 3ZQ6A 4ON9A 2EWWA 2QTHA 1TUIA 4P4TA 4QHTA 4M8NE 3SI7A 3R20A 4DCVA 2GCOA 1DG3A 3B6EA 4IXMA 4TYWA 4US2R 1RRFA 2JLZA 5LB2A 4UJ5A 3U5ZB 1SVWA 3SZRA 4C0KA 1M7BA 3EASA 1UAAA 3W5IA 3NWJA 5J4YA 2NZ8A 1TEXA 5DGXA 1L2TA 1U8AA 2WZQA 4LUCA 4XTCS 2IYVA 2JA1A 5GVSA 1ESNA 3R7WB 4QJ5A 3KDSE 2ZRLA 2VP2A 5KNCA 4MGZR 3REFA 2C96A 2P6RA 5H1YA 1P2UA 2FPKA 2ZYUX 2FFHA 4PFSA 5KDDA 1SHKA 5FBQB 4OI2A 5G41A 1VIAA 2CL6X 2V3CC 3U44B 2OESA 2O8DB 2IHBA 4K46A 3CPEA 1NL3A 2IS6A 1YRAA 5JLJA 1JQLB 4HZIA 2CHVA 4MRSA 3TUIC 1OV4A 3G0HA 1OE0A 2ORWA 1ZM9A 4A82A 1IM2A 1AQYA 4V0LA 4Q01A 4IOLA 4ITRC 1GWNA 3TGPA 2QM8A 3BB4A 3QKTA 4QBIA 5JWOA 2J0UA 1CJVC 3MJHA 5TDHA 4EFNA 1UEIA 1HYQA 4RZ3A 5HR5A 1CJKC 3RSLA 3WNCA 1NMZA 3GLGB 3N2IA 1DAEA 1Z22A 1OB2A 1U99A 3I73A 5G40A 4PSKA 4BGDA 4LYFA 4AYWA 5HPYB 2VO1A 4KVGA 3RDPA 2UKDA 4LGMA 3OZXA 3SU8A 2IWRA 1W2HA 1BH2A 2QP3A 4M1SA 2ZXUA 4CT4B 4M9ZA 1XD9A 3SJZA 4QJ3A 2QBYB 3AB3A 5C4GB 4MA4A 2V9PA 1EX6A 5FBWB 3PQCA 3SJCA 5CITA 4QM7A 4Q4AB 3NC1C 5FTKA 2WWGA 1HURA 3GEEA 1FAQA 5BW8A 3ADKA 5FL7A 3WRYC 1S3SA 4HLCA 1E4VA 1KIMA 1NN3A 3EZ2A 4PHTA 3DPUA 4M1YA 2ZITA 3FE2A 2J9RA 4URXR 1PV4A 1ZBDA 1P6XA 4TLCA 2CL0X 4FCWA 4AI6A 4Q47A 2JDID 1OKKD 1II8A 2CEAA 4DLUA 4F92B 1U9IA 3V9PA 4LYJA 3KQHA 3WP1B 2E87A 2B7CA 3NVAA 3CX6A 4ZV4A 2ZVPX 2WIBA 3CF6R 2CBZA 2DFNA 2JJ8A 3MCAA 4YMSA 1XJCA 2IBMA 3NTUA 1JALA 5EXSA 1G21E 2WMOB 1E2FA 2IYWA 1R7RA 1AM4D 2ZUBA 1VPLA 2NZJA 1LFDB 1R2QA 221PA 3NBFA 4JLKA 1ZNWA 2AKAB 1R0YA 2QUZA 2IYRA 1N6PA 1U2RA 1Z6YA 4QOSA 5AUQA 1RYFA 2ZJYA 1XD8A 4QC2A 1CR2A 3UMFA 1ZUIA 4JL6A 4DLTA 2ZSBA 3SEAA 1XTJA 4EPYA 2QNRA 3VMFA 1G4UR 1LW7A 1T9HA 3KXIA 3ZIAA 4JJKA 4B71A 1COWD 3K09A 2FN4A 5AWFC 5BQ5A 2VLIA 2CHGA 3T1TA 4DLWA 4HUTA 1CXZA 2ZE8A 3B1ZA 3CO5A 2BEJA 4IEEA 1TTTA 3VR6A 2XTZA 2DR3A 4BFVA 3VQTA 3Q3JB 4BFTA 4NTZA 2YWGA 3MMPA 4I99A 4RFSA 4TLEA 4JL5A 2QMOA 4A0FA 1GZSA 3OAAA 4OQLA 2OLKA 2QU8A 3B1VA 2IUSA 5FUXA 4NCIA 4PC3A 4GNKA 2WSMA 2KJQA 5H68A 3RAPR 1YZLA 4ZDIA 3Q5EA 2ELIA 2QE7A 3FKSA 4Q03A 3WBKA 5J4LA 3WP0A 3B9QA 4P3YA 1GILA 2Z4RA 4II7A 4AKIA 4CW7A 3A1VA 4I1OA 2O8EB 2IF2A 5E3HA 3VR5A 3CBQA 3V4FA 4IDNA 3ADBA 1WBBA 1FOEB 1N6OA 4B3BA 1SXJE 4B2PA 2OG2A 4JLMA 2Q3HA 2IYZA 3RRYA 4X8HA 1WBDA 5DH9A 2PLRA 4LC1A 4TYYA 3P1JA 4BLRA 3WYAA 1GSIA 4HB2A 2ATXA 4D4JA 2H16A 2GWHA 1WDTA 3RLFA 1E1RD 4JZKA 1AK2A 3I4LA 1TEVA 3JVVA 4IVPA 1MO6A 5DYGA 4B76A 5EUMA 5F98A 3GLFE 2XGJA 1M6NA 3VKWA 4LHWA 1T4GA 1ZYUA 1ONBA 1E4YA 1QG2A 4CEHA 3FMIA 3OE7A 4V0KA 3CLVA 4UNNA 5EP2A 421PA 2W6IA 1E9CA 2JLVA 3VX4A 4YC7A 2GXQA 4GPTA 2ZSEA 4L5BA 3RS7A 3SDZA 2J7PD 4FCVA 4POAA 2FFBA 4UNQA 2QRNA 1T3HA 4ZKDA 3NHBA 2IEZA 3NBXX 5GJCA 1R0ZA 4NP6A 4FCTA 2FE4A 1N6NA 4LBZA 4TL6A 2RGNA 4WW0A 2A5YB 5LD2B 1IQPA 4KV9A 3ZZTA 1G8PA 5JSZA 1YZTA 1Q1EA 2ECKA 1XJQA 4YDSA 2C9YA 2NPIA 2OSBA 1TMKA 3AVYA 3AP1A 1KI1A 3AUXA 1Q3HA 1EFRD 2A3RA 3HU3A 2HJVA 4H1UA 3T1OA 4G01B 3A1TA 1GP2A 3R7WA 1NN1A 4B3GA 1QZXA 3CF2A 2LCFA 2ZSFA 1UJ2A 2OCBA 4YLGA 4CDGA 1XCGB 2ZI6A 2RGBA 4C7OB 2EVWX 3U7FB 2NQ2C 3CRMA 3U44A 4RFVA 4BWYA 2CNWA 2O8DA 3ZYCA 3CR7A 4D6PA 3BH0A 4GOJA 2W0MA 1MABB 4RZXA 1NJFA 4G5QA 4IDHA 4OHZA 3THXB 2XZOA 1SKYE 1ZJ6A 3AGQA 4MYCA 3PEWA 4UXIA 2ENNA 2IX3A 1P2VA 3HPRA 5EE9A 2NO6A 3TUJC 4QGFA 3AVTA 4W9MC 4G5OA 3Q72A 2HYIC 1EFHA 4A36A 1K5GA 2JLYA 1KI8A 4O3MA 2OFXA 2AFIE 1MH1A 4DXAA 2ZJZA 5KSZA 1TU3A 4WAUA 1US8B 4JIMA 1W36C 1IXSB 1VCMA 4A15A 4HEJA 1Z5ZA 3AM1A 4B35A 4EPRA 2UVQA 3QXHA 1QG4A 4NCKA 4LSGA 2GJ9A 3EW9A 1Y8FA 4BFWA 5EP1A 5JJIA 2RCNA 2WJVA 4BRWA 1KDPA 1XNJA 3SN6A 1XCMA 1G9XA 4NCHA 1F2UB 1GM5A 2OFWA 4Q66C 3EZ6A 5CJPA 2QBYA 5EE5B 5CJ2A 5JWHA 1UBCA 5HTKA 3OEEA 3FGNA 4HDOB 4EJSC 1KK0A 2Z4SA 1JR3E 3CUEF 1S8FA 4Q4AA 1NLYA 2PBRA 3RABA 1FNNA 1W1WA 2HT6A 2ZU6A 1AKEA 1E2QA 4Q7KA 5EUQB 1KI9A 1G1MA 2Z83A 1OYWA 1SXJC 4K8OA 3O8CA 1E2JA 3ZDQA 3KL4A 4I81A 4ABYA 3QXXA 1P5ZB 1ZP6A 4TTQA 4PZZA 1ODFA 1YZQA 3QNUA 2N46A 2ZR9A 4TTRA 2H7VA 3VU9B 4DB2A 2BEKA 1E79A 3VNVA 721PA 4DSTA 3A4LA 1VG0B 3MFYA 4MH0R 4TL8A 4Q21A 4M1OA 2VA8A 3WY9A 2GAAA 2FSIA 1SQ5A 2DHRA 3SS8A 2ERXA 3M1IA 3DZDA 1XTQA 4AYXA 2GVZC 5DISB 1OLOA 4E03A 1NLZA 1VTKA 1LVGA 4X8MA 2WMNB 3FHOA 4JSTA 1ZCAA 4I1VA 2ZRDA 3AKDA 2FZLA 4LBVA 4XSHA 3IBGA 5JS8A 2EWVA 1BMFD 2MSCB 1KJYA 3G82C 3WYGA 2IL1A 1H65A 4OKSA 3CM0A 1E2EA 3I32A 2DFTA 5FFMA 1DOAA 2ZUCA 3EPKA 4TN1A 4Q9LA 4O0MA 4PO1A 1P75A 1P9NA 2ZSDA 4F91B 5LBIA 1RFLA 2X77A 1L7VC 1N6KA 2IXFA 2ZU0C 4MITA 2DWQA 3GLHE 5DHAA 3SFVA 3LAWA 4KLNA 2ZI7A 1D9ZA 4JLJA 4FMCB 1JAIA 3BFVA 3P27A 3K9GA 2ZRBA 1Z63A 2QP9X 3TR5A 3TW8B 4N0EA 2GXAA 5HZHA 2FH5B 4C0JA 2DFLA 4FMDB 1CBUA 1DTSA 5EE0A 4B2IA 3QKRB 3H86A 4TQAA 4WA7A 4OHXA 2ZI4A 3GPLA 3MWKA 3DMNA 3QF7A 1DEKA 3U7GA 2VQSA 5FR2A 1Q1ZA 3C15C 4A4DA 4DEYA 1CLUA 4NHOA 2OHFA 4R2HA 4UKDA 3IDQA 3PUZA 2Z43A 2PX0A 2GEDA 2FJUA 1E99A 1ZM3A 4OI1A 3I3SR 1G8GA 2P5SA 3C7KA 3HP1A 4NKRA 3BERA 4P33A 3TW4A 1E96A 2FOLA 3MUFA 5FPHA 5KSYA 2ZRGA 1EGAA 3I1FA 4TZ6A 1CR1A 1Z0AA 3RWOA 1GOTA 2C77A 5JHGB 2D4HA 4PTLA 1KZ7B 2CLSA 2O5VA 2ZI5A 4DHEA 5JJLA 4NZYA 3THOA 2NGRA 2G0TA 2QAGB 1KI7A 2YOHA 4IVRA 4X8LA 4I4LA 3BB3A 4RVCA 1W0JA 3TIFA 1P4SA 1XEWY 2G1JA 1QHYA 1KBFA 3A37A 2PJZA 5HZKA 4D25A 1KO7A 1NVXQ 4B48A 1DVRA 2VIIA 1IY2A 1GKIA 2CLDX 5HE9A 1Z0DA 2FZ4A 3AQ4A 2W2TA 4URWR 4WZBE 2UZ3A 3H4MA 4JYCA 3TAUA 4XD7A 1WQ1R 3E5HA 2OE2A 3U3RA 1CTQA 2WWFA 3GLIE 3K0AB 5KUTA 5F9FA 3SBDA 2IS4A 1SXJD 2W00A 2IYYA 3MJRA 4OBEA 3CWQA 4AG6A 5BN3A 1NVUQ 5FUWA 1HEIA 4TYQA 3IIKA 3C16C 2PZGA 2IW3A 4XH9B 3VHXA 4KLZA 2P65A 3TQFA 1N2CE 3F8TA 2JJ2D 3P4YA 2BKEA 4C7OA 1TNDA 4S35A 2BIFA 2XSZD 1JPNA 1P61B 4FW9A 4Q1AA 1ZNXA 2A30A 3BH6A 3B8HA 4HUQA 3T12A 1MABA 2ZRCA 3CWZA 3IEUA 3THXA 1E0KA 2DY1A 3W3AA 1U9IC 2G6BA 3FMPB 4C3ZA 1E9FA 4JS0A 2F7SA 1NSTA 3C4JA 1D6JA 5L3QB 1ZVQA 4ZCLA 4R2IA 4YXWA 4DLSA 1NF3A 2QA5A 2Z5FA 5J40A 3OFND 4BEJA 1F5NA 2Z0MA 4OQNA 4BUJA 1G7CA 3IUYA 3CB4A 2FX3A 2NOAA 4Q7LA 1OIVA 4MKIA 3B9PA 5HKKD 4KHZA 1NI3A 2XZPA 1L4YA 1X6VA 2J46A 4ASUD 2WAYA 4TT3D 2OILA 2QL6A 4DZZA 3FVQA 4F38A 2O52A 1S1CA 5G3ZA 3EIEA 4OK6A 3CX8A 3K9HA 4BLSA 1E9EA 2J0SA 3VKHA 3K09C 1DAMA 3UGIA 4MYTA 1W48A 1G6HA 4P0TA 1IXZA 4XOIA 5DLQC 3T61A 2C99A 3PJRA 3K0CA 1D9XA 1YZUA 3P32A 2GVIA 3HDTA 1A5TA 3HYRA 2A5JA 4L16A 1FQJA 1FNMA 2YNMA 1T5IA 4AKEA 3RANA 3VU9A 1O87A 2OBMA 3D8BA 3W6NA 1NBME 2BHRA 2J3EA 2VF8A 4IJMA 3VR4A 1JB1A 2BBTA 2Z6VA 2YWEA 1ZD8A 2QPAA 1E9RA 5EE3A 2PT7A 4ACBA 2LKDA 3JZMA 1E2DA 4WOPA 1XXHE 3A4NA 5M04A 2HEIA 2W58A 2L0XA 1P2TA 1JECA 4WZAE 4ARZA 2JEOA 1EWQA 5AUOB 5IK2A 1JR3D 4EAQA 1XPOA 3WNBA 4ZCIA 3QBVA 2NO0A 4PAMA 4PC6A 3CR8A 1D2EA 4QGGA 3FMOB 4KO8A 2B21A 4M0LA 4PO8A 3IIMA 1XTIA 1XZPA 3QKUA 3Q85A 2QMHA 2WOJA 1E2MA 1DBSA 4DT1B 5DE3A 1FMLA 3SHWA 3VR2A 1KHTA 5A0FA 4EFMA 3ONWA 3NEYA 2D3WA 3K70B 1KY2A 4LV8B 2CJWB 3CZQA 5DN6A 1PVOA 4B47A 4LK2A 3NKVA 1W7AA 1T3LA 3DZ8A 2VRWB 2OCAA 3T1QA 3A36A 1QRAA 4YQFA 4C0QC 4US0R 4DIDA 1T3SA 2C8VA 5DIFA 3ICQB 4IDOA 5ELXA 1R5BA 3C5CA 4RJLA 1KAOA 1TQ2A 1TBNA 3OEHD 2EU8A 3CW2A 4MRPA 1YZGA 5SZIA 5SZHB 4KYIB 1UKYA 3DVLA 3LW8A 1PUJA 2IYXA 3UANA 1GL6A 3BBPA 3I72A 5AUNB 2JLXA 1S1MA 2V4ZA 5G3YA 4E09A 4TMZA 2WPDA 3K0SA 4JLPA 2QI9C 3TBKA 2ZS8A 4YMVA 5AUPB 3QIAA 1PUIA 3HJNA 1M7HA 3MRSA 1IN4A 4IXNA 4RD3A 3JVUA 1VG1A 4OHYA 3LNCA 3ZJYA 3RS4A 4ACAA 4P4UA 1XMJA 3P26A 3CRVA 4RKFA 1DG1G 1KJWA 1G3RA 3QY0A 3W5JA 3SYNA 2OBLA 2RGAA 3ND9A 5GJVC 5FBVB 1XD2B 5J47A 3F3YA 2R6CA 2XJ9A 3H2YA 3OIVA 3ZGXA 2CLCX 2QAGA 1Z29A 3CXLA 2QTVB 4M53A 3LBNA 3TUZC 1E2HA 3NC0C 3ZLJA 4V0NA 3HR7A 3KB2A 2W6JD 5FOXA 4XVUA 3TK1A 2AKYA 4AYTA 4ZI2A 1WP9A 4LHVA 5BWMA 3NXSA 4NYMQ 3HPQA 3U2QA 2ZAOA 2CCJA 2XXAB 3GP8A 3R9XA 3CNNA 3N2EA 2ZRKA 3F5FA 3CONA 1LS1A 4BPBA 2V7QD 1DAIA 3MWLA 3PITA 5FH9A 1V5WA 3MWJA 4M1MA 1IY0A 4TSFA 2XNDD 5HCIA 4A8JB 1Z2CA 5C2JB 2PCLA 1OXUA 2VP0A 3WHLA 2C04A 3FPAA 3BJIC 4NPHA 4B43A 4UNSA 2OAQ1 2BCGY 1DO2A 4JVNA 3T34A 8OHMA 4KBFA 3TH5A 3FKSD 1J70A 1U0JA 3CNOA 3FB4A 4JLDA 5A4JA 1OHHD 3QENA 2WTUA 3ZVMA 1P2SA 2ZI9A 5P21A 2R8RA 1VYUA 4EPWA 2VHTA 4PQYA 2N1BA 3ZH9B 1UF9A 4AURA 4B6FA 1JPJA 1W4AA 2JASA 1KNXA 3DHWC 3VAAA 3CZPA 1X8JA 2ZROA 3EARA 1NP6A 1GKUB 1OF1A 3S1AA 2JLQA 4NU0A 3KKNA 1XZQA 1T5LA 3BE4A 3GJ5A 3HU1A 1UPTA 5D3MA 3OHMA 2K5UA 4H9GA 3NIBA 3THWB 4KVAA 3EWAA 4QL3A 4AY2A 3SJBA 4U7DA 4KU4A 1AS0A 1TAGA 2D62A 1N6LA 4PQRA 4RD4A 3EXAA 1CRQA 1X8LA 1OXVA 2D2FA 5TXGA 3LRPA 1AZTA 4RSGA 4N1AA 3EAQA 3RS5A 2WOOA 2QM7A 3KJHA 5B64A 1N25A 1XTSA 2P6NA 2YWFA 3PUXA 4Z1MA 3RRZA 2FF7A 3QPUA 1ZD1A 1Z0JA 1WMSA 3HU2A 1MOZA 2OFOA 4QM6A 2PCJA 1R8QA 3K0EA 4LC0A 2ODEA 2FFQA 1NSFA 1ZM4A 3B13B 4ZI3A 4KSCA 3W8NA 3MGCA 3LO5A 4QHYA 2GKSA 5L3SB 4MGIR 2GAOA 1RRGA 3QEJA 4HLUA 1BKDR 2VSOA 1KI6B 1O3YA 2Q3FA 2XTMA 4TZ0A 5FPSA 1E2NA 4YONB 1A4RA 1XMIA 4JSYA 1G7RA 4Q4JB 2A2ZA 1ZINA 2P6UA 1KK1A 4RD0A 4Y0VA 1LS6A 2IXGA 2HT1A 5FBLB 3CF0A 4ESHA 3WHKA 1IJEA 1J7KA 5JEEA 3QOFA 1JXMA 4UJ3A 2WWYA 1Z0FA 4EQ6A 2OZEA 3B60A 4FIDA 5JMTA 3ECCA 4PPFA 1TX4B 4GMXA 3LD9A 2ODWA 2REOA 2G88A 2C9CA 2W0SA 4KJZA 1RFHA 3KQLA 4DT1A 4KCGA 1Z28A 2B8TA 2WSSA 4QGAA 1N0UA 4H1VA 1YR6A 2EFCB 1WCV1 2BMFA 5AJZA 4DSOA 4KI0A 5CK5A 4LZZA 1EESA 1RKBA 2RGDA 2ZETA 2LWIA 1VG8A 3UEYA 2YOGA 3UMSA 3EPLA 1RZ3A 1UDWA 1CS4C 2JIZD 5L3RA 1NBMD 2WKRA 2F6RA 5FTJA 2ZRAA 1E9BA 3CH5A 2D06A 3E1SA 3D31A 1W5SA 3BRWD 4PO9A 2HJGA 1EX7A 3QXCA 5KYKA 2AD5A 4Q9JA 3QE0A 4AKHA 1W4BA 1IN7A 2P3SA 4B3DA 2YC2C 1P7CA 3TE6A 2F1IA 2J87A 1ZC3A 3A6PC 2Q0HA 4IDQA 2VP6A 4C0LA 2VP9A 3KQUA 2F43A 3R9WA 1X86B 1N6IA 1AKYA 3MG9A 4LI0A 3Q9LA 4LJYA 1G3MA 2MSDB 2VP5A 4NYMR 1KMHA 4Q1DA 2BC9A 1XPRA 2FSFA 2CVFA 5KNBA 4PPQA 2SHKA 2EFHB 2GK7A 2WHXA 3DEFA 3DL0A 3UFFA 4Q4HB 5SZKB 3IEVA 3RVBA 4C30A 2J0QA 2CHQA 4LCBA 2IXEA 3U7HB 3PIRA 1RRCA 1ZUHA 1W49A 4HDQB 4X8OA 4TMTA 2IYQA 3IIJA 4P4SB 2J59A 2IS1A 4GOXA 1EG7A 2REBA 3EZ7A 4QRHA 5EP4A 5FTNA 1ZRHA 1XD2A 3UKDA 4ERNA 1SKQA 3GJXC 5KSOA 1E98A 3J81k 2IS2A 3IO5A 2ZJ8A 4MRNA 5GJBA 1GTVA 5CDFA 3CPHA 4GSYA 4AKGA 5J4KA 3QKSB 2GETA 2H5EA 3O8DA 2NG1A 2ODBA 3U3JA 1MRNA 4DLYA 1QBKC 2FGJA 3QQ5A 1I4LD 4TMWA 3CKLA 3EG5A 4C0AC 4IW3B 2XXAA 4JLBA 2V1XA 4V0ME 2QT1A 3M6AA 4MUAA 5DHFA 3QSYA 1LF0A 2QGNA 1T91A 1NMYA 3FHCB 3WYFA 1YQTA 5BYKA 4CEJB 1U8ZA 3HYTA 1E1QD 1G18A 4TLDA 5BXQC 5JFGA 1TPZA 3NBZC 1XPUA 1W2GA 3I8SA 2R62A 3IKJA 3AF0A 1XU4A 2G3YA 1S4QA 1KO4A 3UMRA 4BLTA 1G7TA 2D2EA 2JATA 1NVWQ 4Q9IA 1VECA 1UFQA 2P0EA 3BC1A 2WJHA 3LW7A 2JDIA 1OKKA 1T0JB 2PX3A 2D74A 1CU1A 1Z0KA 2FEMA 2PL3A 2RGGA 1QHHB 3C5HA 2F1JA 3KXKA 1CRPA 2VL7A 4Z54A 1SGWA 2HF8A 5CLLA 3W6PA 1E9SA 3B1YA 3GLGA 3Q7QA 5H70A 1ETUA 4XWOA 1KSJA 4BRUA 4KXFB 1NRJB 5C18A 1Z6AA 2CK3D 2YINC 4KBGA 5IDVA 2ZRHA 4FKDA 2Q21A 4RCZA 821PA 3L2OB 3SJAA 1X3SA 2HXSA 2QT0A 3GCGA 1UKZA 2F1RA 3EWSA 5GVRA 2ANCA 3THWA 5HE8A 4GZLA 2EW1A 3BK7A 1KDRA 4QNMA 4EUNA 4OI0A 3PG5A 5A5GA 2ZUDA 2BJWA 1G4AE 3VR3A 5B57C 1COWA 2VPPA 2XOKD 4RY2A 1AGRA 2H57A 1G20E 1GNRA 2AR7A 4PAQA 4B6DA 2EFGA 1M2OB 1Q12A 2GESA 3PENA 2E9SA 3ETLA 2QQEA 4TL9A 5KPDA 1J8YF 5F9HA 2WICA 3BORA 5KHOC 1UKEA 2IK8A 2A5GA 4Q18A 1S3GA 4V03A 1W0KD 3SNHA 1PJRA 5TV2A 2YKGA 6Q21A 2WV9A 4ZIRB 2QG6A 5L3SA 1N5JA 4GDFA 4FI3C 3KXLA 1XP8A 1JQJC 3OESA 1KDTA 5LPNA 1E0AA 5CB8A 4LHZA 3OIUA 1QHNA 2W2XA 5JI3E 4Q4JA 1YZKA 4HZUB 4Q5IA 4PX9A 3GFOA 4D82A 3UEJA 4YMTA 2FV8A 3KKOA 1R5NA 2GZAA 3AP3A 4PHGA 4GI7A 3RS2A 4BASA 2F3RA 1E2IA 4MKHA 2IUTA 3FWYA 3AF3A 4DLZA 3RRNA 4PC2A 2VEDA 1QHIA 2DB6A 4DUGA 2QGZA 3CX7A 4LJ9A 4QBGB 3X2SA 1E1RA 2I1QA 3R8FA 1R10A 4DLRA 3B1XA 1EFTA 1RYHA 1PZNA 4OK5A 4MRVA 5EZ5A 2DBYA 3QVVA 3M0EA 3DMDA 1YR8A 4D26A 2O8BB 3GMTA 2V8OA 2J45A 4GZMA 1WE2A 4IOMA 3VTKA 2BKUA 2A5DA 2VYFA 1Y63A 4G0NA 4A2WA 4BFYA 1NY5A 2J7PA 1AGPA 4CGZA 3RHFA 3LBIA 4MKFA 1VG9B 4FWIB 1Q44A 3ZS8A 1KYIA 2QAJA 5E7IA 1GFIA 1R6BX 3B1WA 2WJJA 1XBTA 2HLDD 1G3UA 2ZR7A 4LHXA 1JNYA 4BZQA 1GRNA 1CF4A 4IHQA 1H8HD 3DDCA 1A2KC 1SXJB 4OQFA 2FWRA 4OYHA 1Q57A 2P2LA 3LFUA 4R71A 1SVSA 2ZYWX 2IYLD 1VMAA 1EFRA 2GEUA 4JLAA 3UIEA 4JL8A 2A7QA 2O8EA 2NPFA 2GILA 4PAOA 1D2NA 2IYTA 4PC7A 3L8YA 4QBFA 1E9DA 3NDBB 3GLFB 4WXRA 1NG9A 5FOSA 2ZJOA 4B3CA 2GZHA 2AFHE 2CDNA 3VFDA 2NIPA 1H8ED 2YC4C 4QGHA 3K9LA 2BCJQ 1W36D 2B92A 1SVMA 3CRW1 3SBEA 4FWTA 4BFUA 4E22A 1Z08A 1XEXB 5KDLA 1CIPA 2F9LA 1PLJA 4JLVA 1IN8A 4IVQA 4NCNA 4DCTA 4GOKA 2ZE6A 3GJ3A 1QVAA 2R6GA 3KTAB 3LA6A 3L82B 2OXCA 3N5CA 5FUVA 1KOFA 4CT5A 2KWIA 1NIPA 3T35A 4M2LA 4BZPA 3AVPA 1GNQA 3X1ZA 3PFIA 2E73A 5KNDA 2VHJA 1A82A 1AZSC 4EPVA 2ONJA 2G1KA 3GEIA 5B30A 3RWMB 3V00A 5BYJA 3DO6A 4C0HA 2ANBA 4DVGA 2O8FB 3H0KA 3TSZA 4DCUA 5C46F 4PC1A 3BOSA 4P32A 3A1SA 1IOZA 1Z6XA 4N3NA 3SOPA 4B3XA 4MDEA 1TQDA 2XITA 4V02A 4KFUA 2HV8A 4MRRA 1GITA 1SKYB 3THYB 1M7GA 1Q21A 3NG1A 3PEVA 4CRWB 5B58C 1RC8A 4NMMA 1RE0A 2IF0A 1ZU5A 3DM9B 5AK0A 5FTMA 1G64A 1G8YA 2OV2A 2OXRA 1T8TA 1E32A 1RJ9B 2EQBA 1SVOA 3HWSA 3PUWA 4HAWA 1RW4A 4Q1BA 2GA8A 2GRJA 2KI5A 3KJGA 2Q6TA 4OHVA 3PUYA 3QBTA 5DSZA 3AVOA 4A92A 1XCPA 1R5OA 2FPMA 1VKJA 1QHHA 1C1YA 3I61A 3QUSA 3TQCA 1FP6A 1E9AA 3NDPA 2JJ1D 4JT2A 4C0SA 3GD7A 1N6HA 1US8A 2R6AA 4PPGA 3NH9A 2GBLA 2HF9A 2FEOA 4U02A 1BIFA 4NE2A 1KJZA 3DM5A 5DI3B 3REGA 4G5GA 2F9MA 1S0UA 3FKQA 2QPOA 3E70C 4OJQA 4RD2A 1NLFA 2CE2X 4BFXA 3EPHA 2X1VA 1NKSA 1SZPA 1YR9A 3RC8A 3TR0A 4OQMA 2Y8EA 4PZLA 4B2LA 4O2LA 3IQXA 5KU1A 3FHTA 1BMFA 4W7SA 4A6XA 1F2UA 5IHPA 1OW3B 3WBJA 3AUYA 2OAP1 4MUBA 1P9RA 3GEHA 1NKTA 1QHGA 2HXYA 3K70C 3FOZA 2GJSA 2N42A 1U81A 3KB1A 4RD1A 1G7SA 3AKEA 3IILA 3Q5DA 2AXPA 4GMDA 3KQKA 4PPNA 2OUKA 3WRXC 1W46A 1NIJA 4EFLA 2ZAMA 4A0RA 2XB2A 5KPJA 3UK6A 1HQCA 2FPLA 4AG5A 3O8RA 4BFZA 2BOVA 3QPVA 5K8IA 5LDDC 1G17A 1HY3A 2DFKB 4EKDA 3LXXA 1BS1A 3KFXA 2VHQA 3BS4A 4ZIRA 1WB9A 3I62A 1II9A 4D0LB 2AWNA 1KKLA 1L4UA 1OIXA 2GK6A 2KB0A 3VKGA 2VHUA 4L9SA 5KDOA 5CLQA 5H8WA 1XFAA 2C5LA 4Q9HA 3AEZA 1ANKA 1G16A 1JJVA 3HR8A 4HZUA 1KBEA 1OJLA 3K1JA 3QXJA 5FPKA 2ORVA 1QDEA 1HA3A 4TYNA 5IT5A 4Z8YA 1Z8FA 1J8MF 2JLWA 4TTPA 2FGKA 1M74A 4GP6A 1HT2E 3TAHA 2AX4A 2DPXA 3GLHB 4HATA 2ZE7A 3D3QA 1NMXA 4KODA 4NONA 4EIWA 2ZE5A 3C14C 3UWOA 2FDCA 1Z06A 1DARA 1S2MA 4D4MA 2A5FA 3IGFA 2PMKA 1LNZA 5EP3A 2O0KA 1F2TB 2TMKA 3QVUA 2QROA 4MYUA 5TY0A 5BN5A 1RPZA 2Q3MA 2QZ4A 3BXZA 2VH5R 4B32A 5FPYA 3O8BA 4CEIB 1CR4A 5TARA 3A58B 1EFCA 5LB4A 2RGNC 4HAVA 2PEZA 1GRRA 4A2PA 3KJEA 4DDTA 4RCYA 2OCYC 2EFDB 5GJWC 4XVQA 3U3KA 1ZCBA 2EFEB 5FL7D 1I2DA 4L9MA 4OJKA 4IRUB 4G5RA 1OXXK 1YVDA 1ZU4A 2RGXA 3QKRA 4TMXA 3GFTA 4M1KA 2C03A 2O8CB 4C0BA 2AWOA 5TB5A 5JJKA 4EPXA 2GF9A 1OXSC 1CKEA 1SXJA 2ZANA 1E2GA 2C78A 1AQUA 3A8TA 2D7CA 1R0WA 1KDOA 1KSHA 1OSNA 1V43A 4HAXA 4YDHB 2DCUA 4A0GA 4GP7A 1CJMA 1Z3IX 2BM1A 1Z07A 2HYDA 1BOFA 2RB4A 3UPUA 4LRWA 4CIDA 3AF4A 4DDWA 1VYTA 3ZZ0A 1ZAKA 1CR0A 2JJ2A 3GLFA 1FP7A 2XSZA 2DWOA 5E4FA 1HH4A 3B82A 3K53A 3SFZA 4B73A 1TUEA 1LTQA 5JCPA 1E69A 2ROWA 1ESMA 3LLUA 1CJTC 1MKYA 1VCNA 1JAHA 2ZJ5A 3BAFA 4JVSB 2IT1A 1XMVA 5IF9A 3QPWA 3I8XA 4B75A 2HCJB 4J0QA 4NL4H 1HQYE 1E2PA 1KY3A 2GXUA 4FMBB 2DWPA 1EWRA 1VDZA 2YV5A 4JVMA 2D7DA 2OEPA 2OLJA 2IA5A 3OFNA 3KTAA 4B6EA 4D80A 1WRBA 1YU9A 4M9SA 4R9UC 5GADl 4JKYA 3NH6A 3GLIB 4UNRA 3ZIAD 3SYLA 1AN0A 3L0PA 4F4CA 5HKKA 2ZSAA 4GRAA 4XWAA 5DNYB 3U6BA 4ASUA 2J0VA 2P67A 2V6IA 1GRQA 1I4DD 4TT3A 1NNEA 4CEHB 4JBWA 2O8FA 1GKYA 3K0AA 3PEUA 3AVUA 1GG2A 5F2EA 3W8RA 1N5KA 1SVIA 3Q8XB 1DS6A 4Q1CA 2O0HA 2I4IA 1MV5A 2R2AA 2X19A 2XJ4A 2GNOA 1FUKA 4GT1A 1FFHA 1G41A 3TKLA 3THYA 2VHCA 3OAAD 2WWIA 3TMKA 2QSZA 2AK3A 2JLRA 4ZCMA 5JSZB 5D3QA 1ZMXA 3SYKA 1UKVY 3LBHA 1DAHA 3ASYA 2QE7D 1IAQA 3TSWA 1OFIA 1RJ9A 3LWNA 4OI4A 5L3VA 4PR0A 1KI3A 2MSEB 1KMQA 1WF3A 4KYUA 3IHLA 5KSPA 5JRJA 1TQ4A 4DB4A 4JVLA 5L3QA 1B23P 3A4MA 3O47A 3UG6A 4LPKA 4M1TA 5CYPA 2C95A 3D6TB 1L8QA 4I1UA 2WKPA 4K81B 4OHWA 4QBHA 4U5XA 2BMEA 4KITB 4BE7B 4ZDWA 4Q00A 1YJ5A 1MO5A 5CIWA 1NG1A 4DLXA 4LJAA 2YZ2A 3CRRA 3ASZA 2CCKA 5DI3A 4GBMA 1KKMA 1IN5A 1JR3A 1OFTA 1PLLA 3KKPA 3OE7D 2PZEA 3MSXA 2W6ID 2ZRNA 1G19A 4HDCA 2PJRA 3K9NA 4LHYA 3DOEA 1WA5A 2BBSA 4JYBA 1KZGB 3TLXA 3EZ9A 4QKQA 521PA 3TJZA 4HI0E 4CYMA 3U4QB 3B7GA 5AJXA 5FR1A 3F0TA 2VF7A 3BGWA 2ONKA 3NBYC 1E2KA 1XMSA 3LY5A 2VSFA 1K6MA 2ZYTX 3W3ZB 5DYIA 1YHNA 3GJ6A 1IONA 3LV8A 5JHHB 1XDBA 5TVKA 3UWKA 1J90A 1U8YA 2YVUA 2IEYA 4M4SA 1C4OA 3X1WA 4DKXA 1P73A 3KY9A 1XXHB 2QMEA 1BYUA 3AV0B 2OO7A 3KUCA 3OEHA 4GFDA 4Q19A 5DO9A 3CNLA 2EYUA 2GCPA 2B8WA 4WBSA 5J4VA 1FTSA 5ANRB 4WVFA 4FXPA 2CNWD 1DELA 4KFTA 2X8AA 1A1VA 1TU4A 4UQOA 3I92A 1CULC 4ZDKA 2V6JA 4FN5A 4V0OA 2WBLC 3EPJA 1E0JA 3ZD7A 1NN0A 2HDNB 4JBXA 1WXQA 2YJTD 5B2ZA 1YR7A 2PLFA 4G5SA 2A9KA 1P72A 5CB6A 4NYIR 5L8VA 1S9DA 1OYYA 1HE8B 2CXXA 1AIPA 4XSGA 1OH6A 3MD0A 5KOYA 1GL7A 3K0FB 4HAYA 2JGNA 1HTWA 4HSEA 5K8LA 3GLHA 4CZ2A 2JAQA 1FMJA 3ADCA 4C9BA 1G5TA 1C9KA 2XNSA 3T5DA 4CVNA 4L4UA 4QG7A 3WXMA 4BQSA 1LF5A 3EC2A 4XTRA 4DIEA 2F55A 2CJWA 2YHSA 2FSHA 2REXB 4HLQB 1A2BA 4LV5B 1F2TA 4RZUA 4L8GA 4US1R 1U0LA 2VRWA 2WWWA 1S96A 5FOUA 3EIQA 4KAXA 3W6OA 3NEJA 1NVVQ 3OEED 2RHDA 4P31A 2IUUA 3U3OA 4DC9A 4CEIA 1VIYA 2W6JA 3SQXA 3AKYA 4Q02A 2MMGA 5CK4A 2AXNA 4QXAA 4TMKA 5CYOA 5K8UA 5LD2C 3B5JA 4KFRA 5SZJA 1FX0B 1GUAA 3GFPA 3FYHA 3KUDA 1OFHA 3P4XA 4PHFA 4ESVA 4C2UA 3W34A 2O8CA 1D5CA 2R6DA 3BFKA 4MYHA 1XF9A 2V7QA 3U7EB 1UBGA 1XWIA 2V54A 4TLAA 1X8KA 1U98A 1PTRA 1G5RA 1E79D 1Z83A 1R79A 2XNDA 3OF5A 5CIQA 3EA5A 4E5UA 2GTPA 2P5TB 3BB1A 1LB1B 4S2EA 3KQNA 3ZD6A 1I2MA 1Q1QA 2W2VA 1XX6A 1OT3A 4D4LA 4D0NA 4LDJA 4HLDA 1XTKA 1FARA 4RZ2A 2AL7A 1HT1E 1OHHA 3X1XA 3WNDA 5EE1A 5FUYA 4ZDJA 1GAJA 5EXPA 1OH5A 2GJ8A 1KTVA 2J7KA 1UBEA 3D7MA 1N5IA 3L0IB 4PSVA 4LJ4A 3KFVA 3SQWA 3L0OA 2GBLC 2I3BA 2OBNA 4MGYR 1SULA 3KKMA 2BBWA 1KNQA 1XTRA 2YOFA 2I1VB 3LQQA 4LY6A 1VHTA 1DPFA 2H8KA 1MR3F 3AKCA 3GJ4A 4DUGD 3GLIA 4M21A 1P62B 1FZQA 3EIHA 2ZRIA 2FU5C 2QTFA 3QI2A 4IKEA 4YMWA 4WXPA 1E94E 2X2FA 1KSGA 2NO9A 2QEQA 1VCOA 2BV3A 2OM2A 3GJ8A 1NN5A 3CH4B 3LH5A 1IBRA 4AD8A 4ZKEA 1Q1BA 3I5YA 3UGLA 4U00A 1DAKA 2WKQA 3T15A 4QHSA 4BZXA 4A8JA 5C4MA 3WMFA 3LXRA 4JBYA 4PANA 3K0CC 4TLBA 3VHLB 1Q3TA 3Q7PA 3V4RA 1M1YE 4JLNA 4W5JA 4B44A 4LJ5A 1D2MA 3AP2A 3ZVRA 5EZ6B 4F93B 4DSNA 5AJWA 2ZI3A 2IWHA 1ZD9A 1PTQA 1ZNZA 5IRCD 2V55B 1KGDA 2ZS9A 3L0SA 2BDTA 1IXRC 1ZNYA 1MO3A 2QSYA 4AWXA 1AJEA 2VBCA 2GVDC 3G5UA 1A7JA 1MO4A 4B3FX 5EJEA 1T6NA 4B34A 1GDDA 1CEEA 3R9IA 5E7MA 2XTNA 1IN6A 2VP4A 3AVWA 3AF2A 3RRMA 4HUQB 2ZRMA 3EC1A 4NH0A 1BYIA 4RD6A 1TBOA 1YRBA 1E0SA 5FPTA 5BN4A 1XJ0A 1R8SA 2RMKA 3QJYA 3X1DA 4PQFA 4M1WA 2ZREA 2KBFA 4IOKA 1VYVA 1II0A 4HAUA 5AJVB 2NMVA 2H92A 1X1SA 2AN9A 3ZVNA 2PT5A 3C8UA 4M22A 1W0JD 1ELOA 5JWRA 4B33A 2GZDA 2QN6A 2VTKA 2ZIAA 4NCJA 3LLMA 3UGDA 3TVTA 1F3OA 2IHYA 4EDHA 3U4QA 4W5HA 1G3QA 1U94A 1TQ6A
chains in the Genus database with same CATH superfamily
3Q3EA 2XBUA 1OA0A 2Q3CA 4E5KA 1TJPB 3U56A 2JIZA 3MB5A 5JHWC 2AXQA 2UVPB 3K1AB 1KFBB 3QVSA 3RYIB 3USES 1CZKA 5HIKA 5IZCC 5E7JA 2KX7A 9ABPA 1G59A 4BFSA 2P8JA 4I8IA 4C88A 3BRWA 1FDWA 3T95A 5AYVA 3EQZA 1G2IA 3UJ6A 2QMUA 3HY6A 4CGYA 4TQ9A 5U9CA 4RK6A 4IHJF 4TWZA 1XQVA 2B99A 3AILA 3QF4B 4DAOA 1KU0A 3KTOA 4IDFA 4U2FA 1UBFA 3H4TA 3GQBA 1YR2A 1JDBB 2Q4DA 4TKVA 2ALJA 5FKJA 2A20A 4TOIA 3EXEA 2TECE 3T41A 4QJ4A 4AC9A 1E2BA 3UG7A 4D0GA 3CQ9A 4H6VA 3LDAA 1E2UA 1PGJA 1RAIA 2XZLA 1E5DA 3I2YX 4DDVA 4EK9A 1EFUA 4E07A 1G63A 5ILOA 1C8BA 3P9CA 3UPTA 2J3QA 1T43A 1BHO1 2OHXA 4BEBA 3JAKB 1Y1SA 121PA 3PE3A 4LXYA 2I6QA 4D92A 4A0SA 4RETA 1RJFA 1M8CA 1ECCA 1VBNA 4KFSA 4F5EA 5B6JA 1PCXA 2ZLBA 1FPMA 2WVJA 3K7EA 3PEFA 3PRJA 2ROQA 1W36B 1Z8HA 3Q6NA 5H3HA 4KACA 1NY6A 1T0BA 1U1EA 3OQPA 2VNKA 2A35A 3AH8A 4KG7A 4KN6A 4KQIA 4ARZB 1VP9A 5A6VA 3JQGB 2QD4A 5JCZA 1XN1A 4L15A 5CT4A 4EKEA 5CH5A 2CMDA 2H2DA 1I0LA 4KP7A 3VHQA 2ZZMA 3QEAZ 5F35A 2ENZA 5CFPA 1TURA 1ISFA 3IIIA 2F59A 1WW8A 4WFQA 5FDFA 3IP3A 3SR4A 5LNK1 1W4CA 2P3QA 2ZTSA 3HA7A 5TGDA 5EFZA 2NTVA 3KJIA 3CLRC 1IATA 4JQSA 3W8EA 3DEZA 1IY1A 4NFYA 4R9SA 3ANYB 3T3PB 3BK1A 3ADDA 3HJBA 4WX2B 3UT0A 5AOBA 2FYTA 1AC5A 1U0SY 3BIFA 1TKRA 2W48A 4YCAA 1RJWA 1MNQA 5EPOA 1FX0A 4DBLE 3GCZA 3Q3HA 3EC7A 4RKEA 3WRYA 6ABPA 4TWJA 1EFAA 1V1MB 2H18A 3GPIA 5AKZA 2ZPTX 2JLUA 2ZUFA 4Y0AA 1GGFA 1RQGA 3TSOA 3NV9A 2G9VA 3VTFA 2GJAA 3TFOA 1MG5A 2WF6A 4NJOA 1C0PA 2FEPA 4NSNA 1J4AA 4URYR 2EEPA 2J5XA 2VTEA 4CU5A 4NBSA 4IDPA 1GFSA 3QOYA 4PBSA 2B35A 4TS1A 2IKSA 1BG6A 3QG1A 1DCFA 5EX3A 1CZOA 3KCQA 4IFEA 4YB8A 3WMGA 2YDYA 3B6MA 3H4IA 4JR1A 4D81A 1KAMA 2BAGA 4C4TA 4Q4HA 1Z6GA 2D13A 2H29A 4FN4A 2V6FA 4N5DA 2ZJBA 3SQMA 4EOGA 9WGAA 4HWPA 2VCHA 3VR4H 1E6CA 3PHBE 4YWHA 2A8YA 3EZYA 1NAIA 1L4GA 1R6XA 3FSGD 5H59A 1N3YA 2R9VA 1R4NA 4P4SA 2ZM5A 1YUMA 4W82A 1PQPA 2ZIXA 3OURA 5EQTA 2PNJA 5IT4A 4KO4S 3CPSA 2EJTA 3NWBA 4LYAA 4PIPA 2HMVA 3KKLA 4I4TF 3Q8MA 1CUBA 1IVNA 3F5QA 3H0CA 4TQUS 5JPDA 5ALQA 3MM4A 1U1DA 3ESRA 5DASA 2PWZA 2XCRB 1W47A 1ZJYA 3BFXA 3C3DA 2DLDA 5ECYA 5EN4A 4LWZA 4Z4EA 1R0XA 1YVUA 1RM0A 2B7BA 1SA0A 2ZJ2A 3HY4A 1ULSA 4RF3A 1IVYA 3ZXXA 5DN6D 2P2NA 3U3MA 2W6ZA 3P9IA 1DBPA 2JHGA 4JJZA 1TF7A 3V8NA 2D1YA 1RP1A 2PLAA 3B85A 3OQHA 4LBWA 4D3ZA 5E6UA 2ZVQX 1UL1X 5EQJB 3LLCA 3LHKA 4MS4B 1TKAA 1FQKA 3KSBC 4EI8A 2I8AA 1ZC4A 4FDUA 3RU2A 2ARKA 2V53A 3PR1A 2VH2A 3QLJA 1L3BA 2FJPA 1L5SA 3B20A 4IUDS 4RQTA 3OLQA 1G291 2VF2A 4KTVE 1BD3A 2QIPA 2BEVB 1GQYA 3BQ9A 5ESXA 1HJAI 4ID9A 4QXMA 3BF7A 5AW5A 4D4KA 3LBAA 4JCCA 3FFAA 3RB8A 2B34A 1TDJA 4HLUC 4K6GA 1NWHA 2PWBA 3DE6X 3OJXA 4ZRDA 1WQ4A 1I32A 3HV0A 2HHAA 1DE0A 4ND4A 1OFUX 3SJUA 4MQUA 1R0RE 2HBYA 3WISA 2WPDD 3IAAA 2NU9B 2OVOA 3GFSA 1YOVA 1FFBA 1FDVA 4JMLA 2DB3A 2CY0A 3SC3A 1KWGA 4I0WB 5FTWA 3I9KA 2O2SA 2VPIA 3DR3A 1QORA 1USVA 1CF2O 3B78A 3KB6A 5CEJA 4U0KA 2WTBA 2QT9A 2GHIA 1Y5LA 2JFGA 3O0DA 5JCJD 5B12A 5C1PA 1P19A 1RAEA 1AXEA 1NXWA 2J0UB 4B3HA 2BMDA 1FTQA 4NZMA 1QAOA 1E7MA 1CC1S 1TADA 2J1LA 1V9SA 5ABPA 1KWKA 2PLWA 3DOFA 3H8SA 1VJ0A 4DBLC 5A9SA 3TLMA 5EKUA 3S7ZA 4UXHA 3EX7C 2FNFX 3MINA 3L3BA 4MQFA 4UARA 3UJ7A 2QQ0A 2WP0A 4NE9A 2NU8A 2SKCA 4LJ7A 4CM8A 1QIFA 1CY0A 1V6AA 4DLLA 4F96A 4Q3BA 2GPNA 2ZRFA 2BTQB 2O3JA 1WF6A 3BCUA 4P83A 3UB4A 3V8EA 3ZY2A 4DSUA 1UFOA 3UATA 2ZDGA 5JECA 4Q7MB 1N3BA 4X1IB 1LPNA 4DJDC 4U6QA 3BH7A 1J2JA 2VAVA 2VUTA 3K30A 3KXPA 2QX9A 3EXIB 5FOVA 4Q1VA 5CD9A 5HRAA 4LF9B 5CCLA 4RM2A 5A2GA 3ZY4A 4Z4GA 2C9OA 1RD4A 2PZFA 1YL5A 3SIXA 4BRSA 2GVNA 1YZNA 5EMHA 3I04M 1A7KA 3W90A 1A5AB 3IPXA 2HL6A 3V5NA 2VDWB 4BIIA 1HNWB 2IC5A 2LW7A 4P7FA 1K6IA 2I3DA 3ISJA 4U2DA 4AZWA 2BFFB 2Q9AA 5JAUA 2HHCA 5EEGA 1B74A 2X76A 4JH0A 5M29A 5IBPA 1DKMA 4MX8A 2G40A 3OL0A 4QOFA 3N8NA 3UUWA 3N70A 4HWOA 2GPWA 2ZW9A 2XCOA 2IZ5A 2J41A 3RT9A 2Y0EA 5J4HA 2ATEA 3JQAD 3VA7A 1GLGA 1II8B 3DONA 4IJWA 3QIVA 2PFGA 3EMBA 2PSEA 3HVUA 4FEGA 3AYZB 2BM0A 5TPWB 2B36A 3E7PA 3UW3A 4UUQA 2AW3A 4CLOA 2V9ZA 2VI5A 3DXYA 1IHDA 3MS4A 1U0HC 3RJ5A 3FVRA 4ZYYA 3RNLA 3BWCA 2E5WA 4IQFA 1RRVA 3O4VA 1NBIA 1GVNB 4CKBA 4RBNA 2BUAA 4PU0A 1YTUA 2II6A 4IDAA 2SCUB 1P74A 4DLVA 4CBVA 3BWBA 4HB4A 1IJFA 1YS9A 1O54A 2BP7B 2PEYA 3OJOA 1ONNA 2YWBA 4QUAA 5AKIA 1XN4A 1XZIA 2VDKB 5F5XA 1UDXA 5HCNA 3M3PA 1RWMA 3H9QA 1I5EA 2P6PA 4KRYA 2HGZA 4CCYA 1Q7TA 3U6KA 4NAVA 5D1HA 4EVQA 2ODNA 3L1HA 1O7JA 3QA9A 4YH1A 1XA6A 2Q4TA 4IZOA 4LDNA 2HF2A 5A71A 1DJOA 1K7YA 4NYJR 4QFMA 2QSUA 5U1PA 3X1YA 1GIAA 4N82A 3U60B 4ND8A 4KPYA 2DYKA 4GGMX 3IHWA 1OIWA 4ZV7A 1F12A 1PT6A 1SZCA 3GOQA 1FDUA 3P19A 3PVSA 1TM3E 3EEFA 1PCEA 4WLNA 2JLSA 4BTVA 3N76A 1L7DA 2AFHB 1YDWA 1U11A 2C82A 1Y3AA 2KW5A 2QY9A 3NBFA 1BDMA 2ZEJA 4FLEA 4ZO4A 5JVDA 2C1EA 2Q3JA 2E82A 2LXNA 4JODA 3L43A 1HV8A 3D0OA 2RKOA 4RLQA 1FW8A 4B7XA 2OHHA 1RWVA 3MLEA 4RVOA 1C8LA 1U8FO 3HCFA 4NEHB 2O8DA 1AA9A 1M3SA 1A9XB 1RRPA 2IEDA 2L7XA 5UKDA 1HWYA 3PTZA 4PZYA 3BT7A 2XKAA 4DWJA 2IH2A 1XDZA 1Z9BA 2X8BA 4DR7B 2VPQA 4GYYA 3OQMA 2R79A 4OFZA 2J3HA 4IIJB 4PLWA 5BNFA 4AX8A 5IKMA 4MV1A 2XB4A 3LBFA 1IWOA 3M6VA 4IEFB 3QKWA 5JZVA 3V7YA 3JXEA 1KMHB 1ZN7A 4QT0A 3TNFA 5FYQA 2EOAA 4QQ8A 1RABA 3OBBA 3KKQA 4DCCA 2GCNA 3F5SA 5H9WA 1FUUA 2BF4A 3HCPA 2F3TA 3ZDYB 4ER5A 5DHUA 1AQIA 3KSUA 4N5IX 4QUEA 1P3JA 3I0ZA 5TQ0A 2AH5A 4BJ5A 1BA3A 2Q9BA 2X9NA 5IANA 1BCSB 1ZUNB 1QVVA 3GC6A 1JRLA 3G2KA 4XJXA 1TOAA 5HIAA 1HZJA 5CVDA 4EPTA 1GAEO 2NNWB 4J90A 2RK6A 2YYZA 5JOQA 1NXUA 4S1PA 5HHTA 4EG0A 5I4BA 4F2WA 1HRKA 2KSQA 4JI5B 3TLGB 1YE8A 3I6BA 4F7WA 2PGOA 1RVDA 2X40A 4KIFA 5DI9A 1NUAA 3SC6A 5BQFA 1F6BA 2ZKLA 2DR2A 4E51A 1VHJA 2NV6A 1QF9A 1ZW6A 4K0RA 3I39X 3I45A 5AI9A 2QTHA 1SBQA 1O6FA 3E0XA 3D2BA 3ICVA 1NJ8A 3RF7A 3STVA 2JL1A 2AG8A 1O96B 1GYPA 1TA9A 2NU2I 2GCOA 2OECA 1EE2A 2VPXA 1RRFA 3NHPA 4KWIA 2O7NA 2HX1A 2PRZA 2JLZA 5TMEA 1PWYE 4FKMA 1O1YA 2C2OA 1M7BA 2BZ1A 5J4YA 2NZ8A 3EGCA 4EY5A 5DGXA 3UOEA 1DUIA 1PFKA 1YACA 1XC7A 2GLXA 2IYVA 3SP1A 4CM3A 4F0JA 2JAWA 3ZV4A 1YV9A 4D0RA 1ORHA 4XWTA 4JQZA 4QJ5A 4TUYB 2ZRLA 5LIPA 3TR6A 5BY2A 4Q37A 2FLVA 2JFBA 1T29A 3G02A 1YZ3A 2UUPA 5KDDA 5FBQB 2QV0A 3PPWA 4X91A 3W77A 2E89A 4UTXA 2GBFA 2OESA 2O8DB 3FNIA 4H1TA 4K46A 1WW3A 5GIPE 3CVYA 1WUTA 2IS6A 3KSAC 4HZIA 1ST2A 4D3DA 2Z5VA 4MRSA 5DSXA 5C34B 2W8BB 4PG4A 3G0HA 2ORWA 4QPCA 4TV8F 4CCWA 3COPA 3QHPA 3HO1A 1CYEA 3CR3C 4BQPA 4EMBA 3ETJA 5CDSA 1USKA 4P2GA 3CUSA 2WGCA 4RGBA 4Q01A 3RUDA 1REQB 3TGPA 2QM8A 3A2MA 3QKTA 4YJGA 1PEDA 5JWOA 4RTSA 1CJVC 1Q5PA 4MYRA 5EHNA 1CE8B 4PZPA 2QTNA 1IQUA 1IY9A 1O57A 2HPVA 1CJKC 1UM9B 4MEAA 3RSLA 3HFGA 4HDMA 1BXKA 3ZNQA 3N59A 2JG3A 1Z22A 3JS5A 2GKOA 2HAEA 3T7IA 5CNKA 3H8WA 4Y2PA 5CH8A 4BGDA 5HPYB 4K05A 2BI4A 3IKTA 4ZTZB 4QARA 1PYGA 1ADJA 1W2HA 2VWQA 1BH2A 1A9OA 1QX4A 5E1BA 2QP3A 3A14A 1BVYF 2EP5A 3A27A 2CMFA 3WRVA 2W98A 1DMRA 4DGSA 4AMLA 1EM8A 4M9ZA 4QOIA 5J2UA 2ZXUA 3H3JA 4WDQA 4QJ3A 1O0BA 3FDZA 5DLDA 1SBNE 3AB3A 1BROA 4KK4A 5DTJA 5I01A 1ZY2A 2QN9A 3J7TA 3LUHA 3WIDA 2Y1CA 3HJFA 2FHPA 3L1VA 1Y8QA 4FBGA 3ZCPA 4H6XA 5FBWB 4ENQA 3F3KA 4I55B 2O0MA 2P35A 2XNCA 4ZJYA 1G5FA 3IJ5A 3P96A 2WF7A 3NC1C 1T2DA 1GQ2A 3LC7O 1SOVA 3DL4A 1CUYA 1MIOA 1FFDA 2VXCA 3N8IA 4BNFA 3V55A 3ISVA 3OM9A 1PV1A 1KIMA 2QL9A 4S3MA 4XGIA 4YRAA 2N0SA 3LUDA 5L7TA 4PHTA 1LUAA 3H16A 4AP9A 1TA0A 3DPUA 4M1YA 4R1UA 1QDLB 2CHFA 1NVTA 2J9RA 3A1DA 4LDAA 4NDAA 1PV4A 3LUJA 1SD2A 2AJTA 1O95C 1WP4A 4INZA 4MJLA 5AK6A 2J3LA 1U0EA 2ZQZA 1L6IA 4Q47A 2JDID 1UJ5A 1XZBA 3ZQKA 1XDSA 3QUQA 1U9IA 3OQIB 3PI7A 2ZJ0A 1TBQR 4RY8A 3WP1B 4B4VA 4B4OA 2XR1A 3AR7A 2G9UA 2P6AC 3C5EA 5DKFA 5ER6A 4ZT2A 1L4KA 1M83A 2PA3A 2QW0X 3CF6R 2CBZA 3AFHA 3ELYA 2JJ8A 3NQ41 1RQNA 1XJCA 4M0DA 1EBFA 4WMLA 4X54A 5E9AA 2Z1DA 1M75A 5EXSA 3TZLA 3VO8A 4F4UA 1E2FA 1Y42X 1R7RA 2EC5A 3AFIA 3PTLA 4RNCA 3A6ZA 3JCZA 4GE0A 3UJ9A 3VZBA 2W6QA 4JLKA 2ICAA 3RM3A 1OY1A 3WL7A 5EWJB 2OOKA 1GXSA 3L6EA 5D3KA 4UREA 4YQEA 4CHGA 2IY7A 4JI2B 2VJMB 4QOSA 4WLFA 2ZJYA 1XD8A 4QC2A 3V8PA 4EHDA 3TTUA 3QFCA 4E4RA 4UOZA 2XTJA 4F60A 2ZSBA 2IP4A 3QA3E 3SEAA 2XVMA 1W0CA 1Z3CA 3ADOA 3P0EA 3VMFA 2G36A 1MFPA 3C6XA 3M1YA 1HOTA 1OLXA 1PEAA 2QPLA 3EGDA 4JJKA 2FN4A 2PZAA 5AWFC 3I2JA 5KYUA 1KOLA 1E1DA 1GGMA 4MGHA 4F04A 4RIGA 2I7TA 1E58A 2RI0A 3D4BA 4K6MA 2QD3A 3DBOB 4PCUA 4WLEA 4ZC1A 4HUTA 3B1ZA 4HWTA 2PGLA 3WRXA 1EXDA 3FCAA 3GEBA 3T7SA 3H3XA 2XD9A 3RUCA 2EX4A 2QVZX 4A23A 4BFTA 4NTZA 5JNUA 3UMMA 3MHTA 1N5RA 2QYHA 4I99A 1IG0A 3OKAA 2E2WA 4GU5A 3HM2A 3WDSA 2E5FA 2Z8ZA 3CN7A 4PPYA 3CFYA 2FEKA 1F8FA 2C3UA 4KGZA 2W4IA 2YBEA 3B1VA 2Z1NA 1PR2A 4AJIA 4GNKA 5HNKA 3OZSA 4ZZ2A 2WSMA 1PW7A 3BKXA 4WACA 2QE7A 3VU0A 3C97A 4RMNA 2PAFA 3WBKA 3WP0A 4ENTA 2BL4A 2Z4RA 5JYCA 4CW7A 4I1OA 2O8EB 1G8AA 1NONA 2IF2A 2C5AA 1IYZA 3H13A 4P3XA 4DJ5X 3ADBA 2VDMB 1YL6A 2ACVA 1EUDA 2R7AA 4HF7A 3PJEA 2Q3HA 2IYZA 3GLUA 3QE4A 4HX2A 3RPEA 1DXQA 3R77A 4QTZA 2FWMX 2OCLA 5CNJA 4YVFA 4D4JA 3RAFC 3RLFA 3E3OA 2AB0A 4CN9A 1K1EA 5L45A 1FYDA 1K7EB 2BFNA 4NARA 5K2MA 5F98A 1C3VA 3PYMA 1M6NA 3AG6A 3F4BA 2VKQA 4NK4A 1EZ1A 1E4YA 1MJAA 3ON5A 4KWTA 2W6MA 4L2IA 1L9XA 4FONA 1Q91A 2W6IA 421PA 3VX4A 4C29A 2VXYA 4LE2A 4ZHSA 2BHLA 2OCKA 2NUAB 2J7PD 2OORA 1BXRA 3QE3A 4FCVA 1R8YA 1SQGA 2QRNA 4POAA 5DBGA 3H4VA 1T3HA 4ZKDA 2IEZA 4W6QA 1R0ZA 2CXRA 3STWA 1L5QA 5B3AA 4YRMA 2QVLA 4KDEA 4LBZA 2JGDA 5EG5A 4FYHA 2AOXA 3ZHSA 4CQMA 2H3EA 1IQPA 2YWJA 5JSZA 2FCAA 1S2LA 3FPSA 4O2BA 1LX6A 1SGQI 2VJAA 3B6IA 1LU9A 4REOA 1RS0A 4X84A 3ANSA 4OXQA 5AQEA 1YL7A 4NJEB 1EFRD 2A3RA 1TVKA 4H1UA 1UJ6A 1NN1A 1ZVVA 1WLSA 3CUWA 2P77A 4FYXA 1CK4A 4A5OA 1R88A 3VHXB 2MCFA 3LWDA 4PGMA 2OCBA 4PYLA 3FRJA 4YLGA 4CDGA 4DF3A 4X62B 3QW4B 4C7OB 2C7GA 4HGZA 3T7AA 3TMYA 1KBOA 1EDEA 4D6PA 1T8WA 1JEJA 3CR7A 5E1DA 5IEJA 3FPLA 3UH0A 3V97A 2W0MA 4R1SA 4EHJA 1I4OA 3L18A 1L5OA 1RZRA 4ND1A 2IX3A 4C01A 1RXYA 2AGVA 5EE9A 2NO6A 4Z9FA 4DQUA 1M72A 1PG5A 1XZFA 1D1SA 3K9WA 3Q72A 3ZK9A 2HYIC 1U3WA 5E1MA 4A36A 4C78A 4O3MA 2WF9A 2AFIE 1SGDI 2JGMA 2FOXA 1QB7A 1FSZA 1MH1A 5MFPA 2B9VA 1P91A 2R8YA 4Z6KA 1PL7A 3JQ9C 1US8B 1LQUA 2IW1A 4H7KA 4JIMA 3K8QA 4OM7A 3AM1A 2ZBFA 3DL7A 4B35A 3CIFA 1S5PA 2FWIA 2BFWA 4TTVA 4X1KB 3JASA 3ORRA 3H11A 2JD0A 4NV0A 5T8KC 5BWLA 1Y8FA 2H4WA 2IHKA 4KMSA 4G1MB 4ER6A 3LCCA 4D41A 1VE1A 2GK4A 3A4TA 3ONEA 3SN6A 3HKBB 3IOYA 5LC1A 5K6AA 3F7NA 2N71A 3HB4X 4R8MA 3ZXSA 1MD9A 5KNDH 5K5EA 3NYIA 4W5QA 2QBYA 1KIFA 1LI5A 1N2ZA 3JZFA 4FFNA 2XHZA 3NNSA 1G8MA 4H3HB 4PFQA 4TLLB 3RVQA 2NVOA 2PGAA 4YWJA 3WK5A 2VK2A 3GX1A 3CUEF 3KOUA 3COVA 1ZMTA 1NULA 3I6MA 4UVDA 3DAFA 1U2QA 2ZU6A 3KYCB 5EUQB 5JH7F 2Z3VA 1J5PA 4MAMA 1VKOA 4RHFA 1SUPA 5AW7A 4K8OA 1OX5A 4UPEA 3MD9A 4YO8A 3ZDQA 1JIKA 4EVRA 1V9CA 1N33B 2P75A 2PM8A 2WVGA 2ZXFA 2J3IA 3ANNA 1WCYA 1YZQA 4TTRA 1M1NB 3H6HA 1LCIA 4BNHA 1KJIA 2BEKA 2FR8A 1PSWA 3ZU5A 721PA 1E89A 3E7XA 5JNTA 5JZBA 4X7RA 4Q21A 1NZDA 2HFJA 5SV2A 3GZNA 2YVLA 4B7ZA 4BRZA 4M46A 5J4LA 4UU8A 2FSIA 1X1BA 2B82A 4L3OA 2DHRA 2P6OA 2PKEA 3NDRA 2ERXA 3QLEA 1XTQA 4AYXA 2QL7A 3BRQA 4H0FA 4Z99A 1OLOA 2I6SA 3ZCSA 1VTKA 2ET6A 2K7ZA 3H5OA 1LVGA 2GWRA 2XUFA 4LXHA 1UDAA 3PNPA 2A9RA 3FHOA 1LK5A 4JSTA 1ZCAA 4CG0A 1E7QA 4XWWA 1MOQA 2FZLA 3DEHA 1EJBA 4MWTA 4ZQBA 3L4BA 3VGJA 1BMFD 3PCTA 4R2MA 3A9RA 4B45A 3G82C 2BEWA 3KQPA 5KWJA 4OKSA 1H65A 3CM0A 3DC7A 4E08A 3NFYA 2ZAYA 3AFGA 1NW6A 2Q2WA 3GVPA 3LY9A 2ZUCA 4MW1A 4EG5A 4JJAA 1SRQA 5AOAA 5L4NA 4TN1A 1N3IA 2QL5A 4B4WA 2ZUWA 1C7ZA 4TRMA 4NFLA 4YBRA 3OQVA 1D1QA 4FQ5A 4NVRA 1V11B 5GM2A 3DBIA 3GGJA 3KU1A 1GHTA 3GN1A 3IB6A 4J6FA 3G2NA 1YU6C 4C4YA 5AVTA 3GLHE 4BQRA 3B2QA 4BNDB 4NBRA 4WY2A 1O4WA 2HZ7A 2H8GA 3RIXA 1BC5A 4F85A 2YJ6A 4M0UA 3Q9NA 2WSLA 2AF4C 1JZTA 2FRVA 5EQDA 3TR5A 1XK6A 4L4ZA 2QTWB 4N0EA 5HZHA 2NVBA 1H93A 3IQGX 4C0JA 1PL0A 4FMDB 3R4CA 2NU1I 5EE0A 1CY8A 1TM2A 4TQAA 2I55A 3ZLVA 3KHTA 2ZYDA 1YQWA 2ZK7A 5EXEA 3DWEX 1PQUA 4RZQA 1GN8A 2FWBA 4E15A 1F7VA 1B8NA 1Z7KB 1Q1ZA 4A4DA 4BVGA 2XBLA 3LUPA 5ALMA 2XAAA 3TX2A 3ZWCA 2E6UX 3H9GA 4Y67A 2FJUA 1E99A 1ZM3A 5DHTA 1V7PC 3I3SR 3N3AC 3FNRA 1C41A 4D9GA 4R16A 1I7QB 4E33A 2YFYA 4NKRA 3HL0A 3BE6A 4LE0A 3UAGA 3VC2A 3TW4A 2DBZA 1CUVA 3MUFA 1CSOI 1J42A 1QKJA 3U4DA 2A9QA 3EVGA 1CRLA 3NRJA 2P4SA 3UCFA 4D9BA 5DNEA 2FWAA 1IK6A 1YBMA 1YCFA 1MJ9A 4IV5A 1DWPA 4B0OA 1ZL2A 4L74A 4O5OA 3M6WA 2C77A 3PDWA 3RWOA 2D4HA 3L0YA 1UAGA 4PTLA 4ZOLF 3T5MA 2O7SA 3V2UA 3VNQA 4DHEA 3F7TA 5PNTA 3C8DA 4MV8A 4U7JA 4G5YA 3ZD8A 3IEMA 1C3LA 4QU8A 2XMDA 4IVRA 2OR3A 3BB3A 4H7IA 2HJRA 2VQEB 4Q12A 2GCGA 2SECE 3HXLA 4MV0A 1WO8A 3WV4A 3TIFA 1P4SA 4PCVA 1QP7A 1TCVA 1XZHA 4YMLA 5KOHB 4N54A 1KO7A 1JHXA 4B48A 2CLDX 3DMTA 1JG3A 3AQ4A 1JSRA 1U7ZA 2W2TA 3PYXA 4DV7B 3WGUA 4QXQA 4GOOD 3TAUA 3WIOA 2JYYA 2OE2A 4CKEA 4C7MA 1E77A 2GPYA 3ASUA 4DLKA 3SBDA 4G0OA 3MMZA 1NXXA 2YQ5A 4GSKA 3V33A 2P7IA 3I37X 3VDXA 3AMVA 3D6MA 3IRUA 3KP1A 3VAYA 4GVLA 1SXQA 2VLBA 2XECA 3UFXB 4B87A 2IW3A 5HSGA 4BNWA 1PV2A 4FILA 2JCVA 1Y6JA 3F8TA 2YXNA 3KWLA 3L93A 2VJKA 1Y81A 4TV9F 3ROXA 1TJ4A 4S35A 5DWVA 2YDXA 4UEQA 1PT9A 1ZNXA 2VPWA 3BH6A 3KUKA 4G8DA 5TF0A 1S6YA 1UBOS 1Y8ZA 1R9MA 2AMVA 1YZFA 3T12A 3CWZA 3IEUA 2FZKA 2GSDA 4J2TA 4F97A 3R6GA 2XCTB 1SGNI 3JQAB 3Q2KA 2ACKA 5CYFA 3W3AA 1YC5A 5L9AA 3FMPB 2G6BA 5F12A 2F7SA 3C4JA 1RR6A 1WXFA 4N6GA 1ZVQA 2BFOA 4ZCLA 4YXWA 3VPCA 3FOWA 2PX2A 1NF3A 1R27A 2Z5FA 3PKZA 2PWAA 4O4HB 2J09A 3DAGA 1PPFI 1AUOA 4E4YA 2Z0MA 3GH3A 3ONFA 5FWXA 3G2PA 1FYFA 1N57A 5LZ5A 4RH0A 5T4BA 1JSLA 2ETXA 2FX3A 3A2KA 4JI1B 4IS3A 4Q15A 4Q7LA 3EXHB 4TLMB 5LSAA 3A6KA 1OIVA 4LNHA 3TQIA 1XJWA 5DBHX 3O82A 4ZT5A 1RCUA 4MCHA 3U3XA 1NI3A 2F00A 2FLKA 4HQNA 4YLEA 1E3DA 1EUCB 2OAEA 2C3MA 1XSEA 4ASUD 4N3AA 3FWNA 3A06A 3CSSA 4FHFA 4N0MA 4OHUA 3E5NA 4BE4A 4EB6A 1T5TA 1DJLA 3EIEA 1JFLA 5CH3A 2XQGA 3AFMA 4BLSA 4BNUA 4K9PA 3ZGVA 1OU4A 3K09C 3WFJA 1DAMA 3KJNA 4UEWA 1LQ2A 3HQ4O 2CMGA 2NUPA 3GXBA 1G6HA 1G5IA 3G9TA 5A9TA 1NVMB 4RA9B 3I9MA 3ZU6A 5DLQC 2C99A 1U6IA 1OAKA 1JKFA 3OE5A 1ZMBA 4R1MA 4R3WA 4QSHA 4D8UA 5BORA 4RTQA 1U9CA 3GUUA 1RADA 3UQYS 2G9RA 3OICA 1FVXA 1WPQA 4BCDA 1W75A 4CODB 2J4DA 4LA4A 1SCUB 2EZ4A 3NHKA 3QX8A 1WUHS 2G4VA 3HDHA 1YH3A 3DHYA 3UB2A 3F71A 3GB9A 1FNMA 4B8YA 1ACJA 5D6NA 3DFFA 4AROA 2HV9A 4K26A 2H4YA 4L50A 5FLXA 1Q92A 1D0SA 2R6R1 2ZPAA 4N7MA 3TCNA 3TD2A 2AHRA 3VU9A 3D8BA 4DYVA 2I7XA 3P5SA 4MSUA 1NBME 3JYNA 4U9IS 4BZZA 3EDMA 1PR4A 4PSCA 4F72A 3WAGA 3GLVA 1Z4PX 2QUJA 1ZD8A 4UE2A 3LT1A 3IKMB 2GAFA 2IV3A 2QPAA 3P9ZA 3RSZA 1IEQA 3NTVA 3CO0S 2GM4A 3EH1A 1LQTA 1JSXA 4HFMA 3VKFA 1CVIA 1IE3A 3WG9A 2I2DA 1F14A 4QDKA 5TF4A 3CA8A 4KEAA 4ARIA 1C7QA 2P62A 5AUOB 2NU4I 1JR3D 1KKUA 5IK2A 3PX7A 2G67A 2JFYA 2AR9A 2IU4A 4PC6A 4F21A 1D2EA 2ZT8A 3P9KA 3RFVA 5BRAA 2W2KA 5JAPA 5M5BA 1TT5B 3IIMA 1EA7A 1U2ZA 2PRYA 1XZPA 3C8ZA 4GRDA 4LZNA 4E5YA 2PXCA 3QKUA 5FUQA 1FFYA 2QMHA 2FW1A 1NT2A 5T4EA 2WOJA 1U9ZA 4U8GA 4BFLA 2IVZA 1DBSA 3IV6A 4B2YA 2PGNA 3SHWA 5H3LA 4NNOA 1AT1A 1RWNA 3GRYA 1BE0A 4HNHA 3E59A 4A7PA 3QX7A 2YXPX 2J6IA 3H8VA 1PVOA 4LZAA 3W4JA 4C4SA 2AC7A 3I6YA 1UPFA 1XKQA 2BR5A 4UU1A 3PRHA 1T3LA 3DZ8A 2VRWB 4FJ2A 4DRYA 3EH2A 3B51X 2BH9A 3HXMA 3A36A 3NBUA 4QECA 1QRAA 4YQFA 3R1IA 3R23A 2C07A 2C8VA 4WFIA 3ICQB 3QITA 5ELXA 2Q8PA 4FFBA 4QUDA 1TBNA 1J8VA 3PDNA 1QH8B 4MUYA 5LU9A 2AX3A 3SVTA 3Q9UA 2YWDA 4HR7A 3T7CA 5IYZB 1TYCA 1ARZA 3DBVO 3VH2A 3TPFA 4EUEA 4KYIB 4HH0A 1E3WB 1Z17A 3IXLA 2PBFA 1U7XA 2C5BA 3H2BA 2PRIA 4I5DA 1T0PA 4BIMA 4MMZB 3TD6A 3MSCA 3NTLA 5FEMA 2CB0A 2NSJA 4E1BA 4DILA 3ZCVA 4NCAA 5FCDA 2Q49A 3PGLA 4KIWA 2FOIA 3MA0A 1F6DA 4TMZA 2V1CC 4D6YA 2J6BA 1LLCA 2H0QA 1MJFA 3K0SA 2V6BA 2OZUA 3NJRA 3NHMA 3O3MB 3NHYA 1PUIA 3FZNA 3NR2A 4ZAFA 1OI7A 1DV2A 2QE6A 1DC8A 2R2GA 3JVUA 4NBKA 3LNCA 2WPNA 3WK6A 2XUZA 3FTNA 4EG7A 3LT2A 5YASA 4TSKA 4YAGA 1MX1A 1XMJA 4G86A 1DG1G 3TQQA 2JRLA 5CA0F 4R2WA 3MTBA 4C5CA 2VDNB 1UZUA 2QGFA 3CSDA 4U7WA 3W5JA 3LHFA 5GJVC 3WLIA 5J47A 3DJYA 3F3YA 3H2YA 3ZBTA 1QSGA 3ZKWA 4I50F 3ZNOA 1BJRE 1Z29A 3E23A 4N9QA 3LBNA 3IT1A 1E2HA 4MVJA 4DMCA 3DDZX 3P2MA 4D97A 4X61A 2AKYA 1MJHA 3CU5A 1QIKA 2C3OA 3U2QA 2XMCA 3FI0A 4RIEA 4ND5A 4P86A 2GJ4A 1BDJA 2PS9A 3GP8A 4R7TA 2ZM6B 1XLVA 2F3CI 2YUIA 5C5IA 2ZRKA 3ZZMA 2FN9A 3HUUA 3JQDA 3MEQA 4UHDA 4ZXFA 3HLYA 1MHTA 4LF4B 3OD1A 5DM0A 5KVSA 1MVOA 1U5BB 5C2JB 1IY0A 4A8JB 1C7JA 3FWZA 1MJGA 4QDXA 4R1OA 3TL6A 3LK7A 4AJKA 3SXJA 1UZNA 1XLUA 2C04A 1H2EA 3PC4A 4WJLA 5EZSA 5JZSA 4UFPA 3B52X 3CCCA 1PQYA 2AN5A 2F3SA 1GPKA 2BCGY 2AEEA 2ZXEA 2QOEA 3O7WA 3EF3A 3RUAA 3SNKA 1N77A 2F8TA 1XNGA 3PHCA 5LKAA 2R84A 4KXMA 3TQRA 4CF5A 4ESOA 3FYUC 4TS3A 3KUXA 4JLDA 1Y9DA 1OHHD 2QUIA 3M6UA 4Y2JA 3RC9A 3ZHVA 3RHZA 2E1PA 2Z9BA 1P2SA 2R8RA 4P53A 1JKIA 2QWXA 4EPWA 4B3IA 1V5EA 2VHTA 4JWKA 4PQYA 3UMBA 4DSAA 2IEGA 1RI3A 2XQVA 5K0JA 2IUYA 1J09A 1W4AA 3FUUA 1VL1A 1PJ2A 1YVEI 3ZE1B 1XDDA 1IY6A 3A9UA 1ISMA 1X8JA 1NP6A 1GKUB 1FVFA 4XM0A 5DNAA 3N2ZB 3S1AA 2XE6A 3LP5A 4N5NA 4BMDA 4M8LA 1A5BB 4NU0A 1XZQA 1UMBA 4XQ0A 3C87A 5J1SB 3RBVA 2WAOA 1UPTA 1LV8A 3ECAA 5GGYA 3QBJA 2XB9A 4C89A 4EL0A 1WKXA 5LU8A 2YX1A 5DX1A 1T5BA 3EWAA 4KVAA 4MXDA 4CM4A 4PIMA 2IU3A 4TM8A 3GD5A 1ZUWA 1ICIA 4BDSA 4QATA 4LX8A 4D43A 1JZSA 4H1WA 5H7XA 2L19A 5BUCA 8LDHA 2IYPA 2D62A 2GUGA 2EKPA 1T6BY 1HZZA 3ROGA 2V7TA 1CRQA 1F7UA 3PRKE 4N8DA 4U9UA 4MQ4A 3TTVA 3WLQA 2X7HA 4REQB 4ZAXA 5CVJA 2EBWA 3QHQA 2E4UA 3EAQA 4N1AA 4E7OA 4EITA 3C6MA 1HRDA 2P6NA 1ZI6A 3DAYA 3FRIA 4Z1MA 2X22A 3RRZA 3KK0A 3DDNA 5DGIA 3VO1A 3HU2A 1CFZA 4XUCA 5JRDS 2ZTHA 3PNMA 4OMCA 2X6QA 3SZMA 2ODEA 5A4AA 1NSFA 4MUNA 4KSCA 1Y1BA 4PRLA 4R8RA 1NNSA 1Z7BA 4P82A 2HQOA 4QHYA 3R74A 4CMIA 4YT2A 1AV7A 2WYUA 1N7GA 1XZAA 3QWFA 1FLVA 2VSOA 4HLUA 5TEWA 2ZBDA 2O06A 3X2EA 5JSUA 4GX5A 1O3YA 5G02A 4BNVA 2R00C 2XTMA 1E2NA 4TKVB 3ABQB 1ZHFA 3MOIA 1XMIA 1YUBA 2OP0A 2VUHB 3PDJA 5IULC 1R3UA 2PO7A 2QLBA 5BOS<