2QQ0A

Thymidine kinase from thermotoga maritima in complex with thymidine + appnhp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
169
Chain Sequence
SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKTMIVSHVEAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEEIDVGGQEKYIAVCRDCYNTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidine kinase
publication title Quaternary structure change as a mechanism for the regulation of thymidine kinase 1-like enzymes.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 56
structure length 169
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2qq0A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qq0A01
1XTIA 3ZQ6A 2OSBA 1N6PA 721PA 5JS7A 2BV3A 2NMVA 1KGDA 1T91A 2BIFA 2FOLA 3FMOB 1EG7A 4QHYA 3O8BA 2VIIA 1OHHA 3K0FB 2PH1A 4P4SB 4Q7JB 2EFGA 1KSGA 1U94A 5JJLA 1Z6XA 2HLDD 3IO3A 3WRXC 1E9RA 3TE6A 1UFQA 3RLFA 3GLHB 5DH9A 3EPJA 4EPWA 1OIWA 3KB1A 1CLUA 1FX0B 4E09A 1Q1ZA 4HUQB 3Q7PA 4NDZA 2GEUA 1XTKA 2HDNB 2C03A 1TEXA 2IF2A 5P21A 4X8LA 1S9DA 2H1LA 3PCRB 5JLJA 2HCJB 4DZZA 4XJXA 3ND9A 3AVOA 1FTNA 1EK0A 4IFEA 2RGCA 2BKEA 2O8FA 4NBSA 4LCBA 5DI3B 4ITRC 3DZ8A 1UAAA 4ESVA 2RMKA 4LHXA 4BLPA 3I4LA 1EFUA 2X2EA 4AURA 2BBTA 1ZJ6A 4FCVA 1JPJA 3IHLA 4C2TA 2FEOA 2G0TA 3UMFA 1S0UA 3TMKA 3C5HA 3W8RA 4DJTA 5HCIA 3K0FA 1T6NA 4DWJA 4FXPA 2JATA 4TQ9A 2QEQA 4C0BA 2O8CB 2LKCA 2Q0HA 3VMFA 2F6RA 2HJGA 2PEYA 1X8LA 1E32A 4CT5A 3OEEA 1E69A 1FMLA 1ZW6A 3GLHA 1OT3A 1YZLA 4JBYA 1GZSA 1E9AA 1AZSC 1FX0A 2ZU0C 4HUQA 1SVKA 4R98A 3FFAA 3CH5A 3A1SA 4ZIRB 4QGGA 1G1MA 1NIJA 3BFKA 1G3UA 1GL9B 3KKQA 3TJZA 3TSOA 3O8CA 4AKGA 1DAHA 2NO6A 5K8IA 4WW0A 1Z0IA 4Q21A 4M1SA 3SHFA 3GLFE 5DI3A 1U8AA 1QHSA 3GFTA 3NH9A 3THYA 1Q1EA 1ZM3A 3EASA 4IKEA 4NZYA 3V4FA 4A6PA 3CRRA 2Q21A 3LBHA 2JGNA 4E03A 3EWSA 4UNSA 3SBEA 4RD2A 3PJRA 2WSMA 2QAGA 5K8LA 3QXSA 4I1UA 2O8CA 4B48A 4NYMR 1XF9A 4K8OA 4ESHA 3QKRB 2VSXA 1XCGB 3O8DA 3Q5EA 2ZS7A 3B9QA 4UNPA 4NCHA 2DB3A 1Q57A 2ZJ2A 2O5VA 5DYGA 3NXSA 2IHYA 3VR2A 1KDTA 1LB1B 1MV5A 2IYVA 1VYTA 4KO8A 3SZRA 5EE0A 2F7SA 1WBDA 3I73A 2ZYVX 4EIWA 2G3YA 4ZPXA 1KOFA 1FUUA 3SBDA 3W5IA 1K5GA 4TMWA 2GJKA 4IDOA 2CK3D 2ERYA 4OYHA 4V03A 3C4JA 3MJHA 4JKIA 3FOZA 4RKEA 3K0CC 3SE0A 4AYXA 3JZAA 1YU9A 2JASA 3LFUA 1HE8B 3VKGA 2OAP1 1G7CA 5AJWA 2P2LA 4M22A 5EXPA 4IJMA 3QKUA 3EIQA 4X8MA 5FR2A 2P5TB 3NEYA 3B13B 4YMUA 1P9WA 4D4LA 2BWJA 1SXJD 1HV8A 4TYQA 4DLRA 2AX4A 3QKRA 1UPTA 1W5TA 4RKFA 5J4LA 2J41A 4D4MA 3I32A 2GXQA 1XTSA 5C2JB 4BLSA 4KFUA 1X8KA 5KUTA 1ZM2A 2R9VA 2ZJ5A 4PR0A 2WV9A 1U90A 1ZYUA 2A2ZA 1KMQA 1QG4A 2VEDA 2DY1A 2V6JA 1Y63A 2Z0MA 2VHCA 3HU3A 2D62A 3SDZA 4DLWA 4M1YA 4YXWD 1GG2A 3IIJA 3AVVA 2BMFA 4RVCA 2ELIA 3LAWA 2KBFA 4MKFA 4MRRA 3CB4A 1IY0A 4LC1A 1W46A 2ZYWX 1BH2A 2OFWA 2V7QD 1SXJB 4CYMA 2WJGA 2A7QA 1KIMA 1G7RA 1SKYE 4Q1DA 1A1VA 3CIOA 4LYFA 2VL7A 1E6CA 4M9QA 2GVZC 5LD2C 4BWYA 2WJHA 4D26A 1KO4A 5DISB 2RB4A 1WDTA 4M1OA 3AF3A 3IIMA 3ZZ0A 2ZM5A 2BBSA 4G5SA 1UKYA 4TTRA 3VX4A 1KK0A 1E2KA 1Z2CA 2ODNA 3CXLA 2ZRPA 1AS2A 2D7CA 1Z0FA 4LI0A 3D6TB 3CWZA 2FN4A 3A1UA 3QVVA 2ZR9A 4QBFA 4C0QC 2CK3A 3SFVA 3G0HA 2PJRA 2ZR0A 3HU2A 5BQ5A 2OE2A 5FUWA 3CBQA 2IF0A 1CP2A 1ZP6A 1XU4A 4Q19A 4URWR 1G8YA 2ZVQX 5J4HA 4BE7B 1JAHA 4NCJA 2IXEA 4DHEA 1O87A 2IS2A 1XZPA 1RVDA 3QPUA 2QZ4A 4FCTA 3MSXA 5TDHA 3ZZTA 4F4CA 1UBGA 2ZJOA 3GLFB 4OI2A 3UANA 2CL0X 5A5GA 2FZ4A 1Q44A 4ARZA 2G77B 1YZGA 2QP3A 2VTKA 1UM8A 4HYYA 3NDPA 4V0LA 4LJ8A 3FE2A 3EZ2A 5CM8B 4PC3A 5EP3A 4FIDA 2ZRHA 2R65A 3HYRA 1HT1E 4F93B 4Q7LA 5AR1A 3B85A 5CJ2A 2ZUDA 2C95A 5FL3A 4YXWA 3UMSA 2QN6A 3UGDA 3VHXA 4BZQA 1G5RA 2GRJA 3T1TA 3LV8A 4B44A 2JLRA 1FQKA 1Z28A 1E9BA 2AR7A 1OFUX 2RGNC 5G3YA 1DOAA 1DAFA 2V7QA 1DE0A 4D81A 3L0SA 2BHRA 3HDTA 3HWSA 3ZDQA 4V0OA 5HE9A 2EW1A 2FEMA 4M21A 2ATVA 2BJVA 2XAUA 2GF9A 1C4OA 4MA4A 1KI1A 4TYPA 4LOAA 4JSYA 2YKGA 1GILA 4RD6A 1AQUA 4Q1BA 3SN6A 2CNWD 3T35A 3GLFA 1UF9A 1XEWX 3T1OA 2AXPA 1E99A 2Q9BA 1U0LA 2ZS9A 1CR1A 3CF0A 4FCWA 4PC1A 1VG0B 4UNQA 4MKHA 3R9IA 5AWFC 1KI2A 1Z0KA 2FGKA 4OK6A 1GNPA 4DBLC 3U4QB 3AF2A 5JWRA 3K0EA 3IPXA 3I5YA 2WVJA 4CEJA 3BWDD 4XOIA 1N0WA 5J4KA 4XWKA 2ONKA 4FWIB 3QEOA 5AJZA 2JLXA 1AS3A 2NZ8A 2GILA 3A1TA 5FPHA 2NPIA 3TVTA 3KQUA 2WTUA 2XXAB 1UKEA 4Q48A 5JBQA 5CB8A 3VR5A 3QBVA 5BWMA 3BFXA 3KXIA 1SVWA 1QBKC 1WA5A 5DIFA 1E98A 3AKYA 2VSOA 1L2TA 4TLEA 2VHJA 2I3BA 4HLQB 1XWIA 3E2IA 3QENA 1OPXA 1JPNA 2FF7A 1X6VA 2XB2A 5CM9C 4XVRA 2JEOA 5KPDA 4PPNA 1W36C 3FKQA 1OJLA 1NNEA 3RABA 3AB3A 5KU1A 4UNRA 3IBYA 2ORWA 1KO1A 2D4HA 3VKWA 2IS6A 1G64A 1S1CA 1W0KD 2IBMA 3U4QA 3EIEA 4JZKA 5KDLA 4LBVA 2AK3A 4JLPA 3BC1A 5B64A 1VCMA 4TMTA 5AUOB 3KZ1E 3B8HA 3QKSA 4TMZA 3ICEA 3PEUA 1QG2A 2I1VB 4Z54A 3LX5A 4B6FA 121PA 4XVUA 3GJ7A 3M6AA 4RFSB 5EP4A 5IK2A 3C5CA 3L8YA 1P2SA 2ODBA 1AN0A 2ZI9A 2CNWA 1A5TA 4WZBE 2B21A 4QGAA 4Q7KA 4PZYA 3U3JA 3QPVA 3B60A 1IXZA 1TQ2A 1Z5ZA 2F3TA 2EFDB 1A2KC 1OFIA 2ZRKA 1GVNB 2HYIC 4JL6A 2GZDA 1NVVR 3B1WA 4ACBA 2NG1A 1K8RA 3K0CA 3O8RA 4V0KA 3DM5A 4Q47A 4TL6A 1GSIA 4OHZA 5FTKA 3UWOA 1YRBA 4DDTA 1P62B 2WPDA 3TAUA 1KK3A 4IEIA 1FOEB 1Q20A 4JT2A 4ZCIA 5B58C 1NY5A 2SHKA 4R2HA 3MFYA 4D4KA 3JVVA 3UIEA 4UQOA 3X2SA 5LD2B 3QG5A 3EC2A 4A0RA 5BN4A 4GBMA 4KFSA 4FWTA 4DEXA 3HU1A 4JJKA 2JLYA 3IEUA 1T5IA 4D82A 3OHMA 5JSZB 1JR6A 2BJWA 2I4IA 3KUCA 4OQMA 2ZS8A 4BQSA 3LX8A 3VFDA 1ZC3A 2QBYB 1SVMA 1VG8A 3NC1C 2ZAOA 4B3GA 2CLCX 3W8NA 221PA 1CULC 1X8JA 2C9YA 5E4FA 4DSUA 5FPSA 2E87A 2XITA 1YQTA 2IT1A 4MGIR 1Q0UA 4TLCA 4EJSC 2FSHA 4ZKEA 4ZI3A 2O8EA 4GOKA 3BS4A 4KLNA 2E1RA 3GQBA 3K9NA 4QJ4A 2XZLA 4DSOA 3KQNA 2JDID 4LSGA 5KNBA 1KAOA 2D2FA 3CX8A 4F91B 2OILA 1YR6A 4QBHA 1JEEA 3LW7A 3EZ6A 5HE8A 4M1WA 2WOJA 3PUZA 4RZUA 5C1BA 1ONBA 4B43A 3GJ4A 2ODEA 3W6OA 3DMDA 1VECA 1Z2AA 1D6JA 1M8PA 4GT1A 3IQWA 2ZRMA 2W58A 5FL7D 8OHMA 3ECCA 4LBZA 4DCSA 3IGFA 5KHOC 3PEVA 4I81A 2VF8A 4JYBA 3LXXA 1KHTA 3B82A 4JVSB 2Z83A 5FTNA 4GL2A 1I4TD 4II7A 3RSOA 4OQLA 3WYAA 1NMZA 2FMXA 3L2OB 1NSTA 3ADCA 1UBEA 4HSEA 1T8TA 3TR0A 2IYLD 2V3CC 5JS8A 3L82B 2J5XA 2ZI4A 3I1FA 1CJMA 2P67A 3AF1A 1W49A 5EP2A 1M2OB 1CRPA 2G9NA 4MRSA 2NO1A 2ORVA 4HATA 1Q1BA 1TAGA 4TQAA 1OB2A 4P32A 1NVUQ 4TZ6A 1II8B 1W36D 2VRWB 4TWZA 2X2FA 3ZD7A 2JLSA 1OXVA 4B6DA 4C0HA 4ASUD 3AP3A 1KI6B 2O8DB 2Z43A 1GNRA 2OAQ1 5H1YA 2REXB 2BCGY 1WRBA 3VQTA 2JJ1D 5JFGA 1ZAKA 2WMOB 2DWPA 2RGNA 4MGZR 2N1BA 2D2EA 3BGWA 3H86A 3UK6A 2KSQA 1ZNWA 1J99A 1XNJA 3OF5A 3VTKA 4YONB 5DN6D 5GVRA 3RAPR 4TMXA 5KNDA 1W47A 4DUGA 2XEXA 1HURA 4DLTA 2JDIA 1OSNA 4Q9KA 4IOKA 1D2MA 2GCOB 2Q3HA 1DO0A 1P2TA 4AK9A 2QPOA 1EWRA 2OBNA 2C9CA 4B6EA 1W36B 1HUQA 3GMTA 5C46F 3CWQA 2QY9A 3UG6A 2MSCB 1E0AA 2O0JA 5KPJA 3LQRA 3RS5A 4KLZA 2IUUA 4HB0A 1AJEA 4W5JA 4TZ0A 2IUSA 3LY5A 4F92B 5FL7A 1II8A 2PMDA 2J87A 4KSCA 4E22A 4CEHA 2VRWA 1N0UA 4IOLA 2EFCB 2Q3FA 2ZRCA 1KI6A 3WMEA 4JKYA 2O8DA 2WJJA 3MG9A 5FR1A 1AM4D 1CJUC 1RIFA 3RS3A 3U61B 3RSLA 3JZMA 4OHYA 5JCPA 3P4YA 2ZE7A 3B6EA 4JL5A 4N0EA 2YINC 4B2PA 1JJ7A 1KMHB 1AS0A 4RZ3A 4X8OA 1FQJA 1NVVQ 1ZUIA 2ZJYA 2Y8EA 4Q18A 4BFWA 1DPFA 1NLFA 1RYHA 4G5QA 4PAQA 4IXMA 3LBNA 4OI0A 2HEIA 3K9HA 2WIAA 4DKXA 2GCOA 1Q21A 1YE8A 4HB3A 5JRJA 3DPUA 4JYCA 3NH6A 2GDJA 1O3YA 4I1VA 1X1SA 2IUTA 3B1YA 1AKEA 2PEZA 4QL3A 4KYUA 1KAGA 5CJPA 4ASUA 2VP5A 3WYFA 3WBKA 1SKQA 2ZSDA 1JR3E 1T3SA 1P9RA 3SJCA 2JJ1A 3I92A 3NBXX 4XWAA 2WAYA 2YOFA 3BH6A 3NTUA 3QXCA 5DYIA 5FI0B 3SYKA 3AKDA 2A3RA 3A6PC 4FINA 1EWQA 4KFTA 3THXA 5GVSA 5KO2A 2GAOA 2JLUA 4LY6A 3BBPA 5DN6A 1XB2A 1N6OA 3KXKA 4GFDA 5B2ZA 2J0UA 2JLWA 1LF5A 2N42A 4AKIA 2CCKA 4KVAA 1KMHA 4M53A 3DMNA 3VKHA 4D2IA 3QXJA 1IAQA 2IYUA 4DT1A 3IILA 2GEDA 2GVIA 1AQYA 2D06A 5DHFA 5H68A 1KDPA 1WXQA 1OFHA 2ANBA 1ZNXA 1P5ZB 3I8XA 3BB1A 1S9HA 1ZD9A 2OLJA 2H7VA 2RHMA 2YWFA 2PLRA 4B74A 1G9XA 1JXOA 2FSGA 3U7FB 1NLZA 3VHLB 3P27A 2EU8A 1XEXB 2WIBA 3DO6A 3LH5A 3OFND 2J46A 3QBTA 2IYYA 3BD9A 2A9KA 3MGCA 1YZUA 4GPTA 5C4GB 3RANA 3AVXA 2F9MA 4M1MA 3CF6R 4EJSB 1IN4A 2Q9AA 2GKSA 1KDRA 3GFPA 3L0IB 4NCNA 2XNDD 1CJKC 1AKYA 4QNMA 3P26A 2GTPA 4GMXA 4DCTA 1XA6A 4GOJA 2FFBA 4L16A 3PXGA 1SXJC 1YHNA 3H4MA 4HB4A 3TH5A 5HR5A 3LNCA 1T3LA 1JI0A 4JLBA 2CL6X 2HXYA 1Z6YA 3KB2A 1E2MA 1N5IA 1E2FA 4L4UA 4Q9IA 5FOWA 3ZZUA 3EC1A 3K0AA 4O0MA 2WKPA 1MRNA 3AUXA 2FFHA 2IW3A 1D9XA 2VHUA 5KDOA 4A15A 3VNUA 4LJ9A 3MJRA 3R20A 4D25A 1HEIA 1E4VA 2FPLA 2W0SA 4MYCA 4NH0A 4RJLA 1NN0A 3KKOA 3SFZA 1RPZA 1RRPA 2ANCA 1IXSB 1KZGB 2BEKA 5K8UA 3J81k 2JJ2D 4EJSA 1DG1G 3LXRA 4AKHA 2O0KA 1VYVA 3K8YA 2D3WA 4C3ZA 2DCUA 4LHWA 4MRPA 3G82C 5GJBA 4PQRA 1LFDB 4WBSA 4JVMA 3WMFA 2DBYA 2FDCA 3Q9LA 5FBRB 1XZQA 4B33A 1JR3D 1RE0A 1EFHA 1EX7A 1X3SA 4PHHA 1FMJA 3PITA 4PSAA 3TSWA 1ZRHA 4JMPA 1FZQA 4TYYA 1UKZA 1SXJE 3NBZC 3OFNA 3TW8B 2OT3B 1YJ5A 3CX6A 5F2EA 3TLXA 3TR5A 1R0YA 2XTNA 4PO9A 2Q6TA 2WWHA 1R5NA 2GVDC 2KI5A 2QP9X 3FPAA 2CLSA 3LQQA 1ESNA 5GJCA 2D74A 4PZZA 5LB2A 2JA1A 2WWWA 3BB4A 4LHVA 2FG5A 2LWIA 4P4SA 1E79D 2C99A 1DTSA 2XNDA 3B1XA 3F0TA 1MH1A 4IW3B 4S2EA 1CF4A 3JVUA 2ZUCA 3N70A 4Q4LA 4B2LA 1LVGA 3KFXA 4HLDA 3O47A 3R7WB 1TMKA 1JQJC 1TQDA 5A0FA 3BRWD 4R9UC 1U9IC 5KYKA 3ZQJA 2QM8A 4YLGA 1F60A 1XJ0A 4HAYA 1R10A 3Q72A 1GDDA 2P65A 2W2TA 1WE2A 3V9PA 1GTVA 1IM2A 1NN1A 3AF4A 1D2EA 3R9WA 1P60A 1DAGA 4US1R 4L9MA 1OYYA 2KBEA 2W2XA 5BN5A 3GPLA 1PLKA 5CK5A 1LW7A 4DB2A 3SR0A 2NGRA 4KCGA 4QHTA 2ZXUA 2WKRA 1KO5A 3SS8A 3TAHA 3W6NA 5FPYA 2JJ2A 4C0KA 3U7HB 1ZNZA 5ELXA 3IDQA 2ZI6A 2HLDA 1FPMA 2F1IA 1GKIA 4OK5A 3PEWA 1AGPA 1TUEA 2J59A 2HJVA 3AP1A 1Z6GA 4C4PA 2B92A 2VHTA 5E95A 1OB5A 3UATA 2RHDA 4IDNA 2MSDB 1R4AA 5HZKA 4CRWB 1KI8A 1JR3A 2VP2A 4IDQA 5J4YA 1F2TB 2NTYC 3MD0A 1TQ6A 3TRFA 3SJBA 4N1AA 3A37A 4IRUB 4LJAA 4ZIRA 2CE2X 2Z4RA 5SZHB 2P6NA 4I1SA 2P6RA 1RYFA 2ZRBA 4C0AC 4RCZA 4NYIR 4D4JA 2XJ4A 4XTRA 4JL8A 4JSTA 2N46A 3TQCA 1SVIA 1CU1A 5GADl 3CPHA 2ZYTX 3SJAA 4IEEA 2DFNA 1E79A 4EPRA 1ZUNB 3HP1A 5E7IA 2G6BA 4ZCMA 4HAWA 1P72A 2OG2A 2ZE8A 1XXHE 2LKDA 1W0JD 2DFLA 1R8SA 1G3MA 1VG1A 4DDVA 3TK1A 3FMIA 3WXMA 1T4GA 4BLOA 4ZO4A 2ATXA 4XD7D 2J7PD 4HAUA 2PZFA 1CRQA 2R6DA 1KK1A 3TBKA 5JZVA 1F2TA 3CPEA 3SNHA 4RCYA 1E2QA 4FW9A 5H8WA 2J0VA 5EQTA 5ANRB 4DLXA 2HYDA 1K6MA 5JMTA 4B75A 4Q4JB 2R6CA 3FTQA 4W5WA 3BFVA 2ZETA 2ZIAA 1NF3A 4DLUA 4I4LA 1NVWQ 4DCUA 4CEIB 3EAQA 2FA9A 2CJWB 3QUSA 4FMCF 2WJIA 2B8TA 5JEEA 1P75A 1ZD1A 1Z83A 3H1TA 1KYIA 5J5CA 1PVOA 5HZHA 3DKPA 4QBGB 1E0KA 3WHLA 2RGAA 2C78A 3Q5DA 2VP6A 3CR8A 1G7SA 3PFIA 4A0FA 1XFAA 2HF9A 5SZIA 2Q3MA 1EX6A 5HKKD 2ZEJA 1TEVA 2GEVA 6Q21A 2AFIE 2OCPA 3GJ0A 1YRAA 2WOOA 1U0HC 2PJZA 2CHQA 3B2EA 4H1VA 2YC2C 4W5HA 1COWD 2GK6A 2C98A 3SYLA 1E9FA 1U8ZA 4JLKA 4TMVA 4Q4JA 2IEYA 2ZI3A 5EXXA 2FU5C 3KKNA 4LGMA 5FUYA 4J0QA 3AQ4A 2CJWA 1OXSC 2BC9A 3N2EA 3QIAA 3QNUA 2WWFA 3VR6A 4XWOA 2JCSA 4MQBA 2GA8A 4QM7A 3ZJYA 2V4ZA 2ZRJA 4D0GA 2XZOA 1LF0A 1W0JA 5DHAA 3C8UA 3AGPA 3UXMA 3SQXA 3CUEF 1OIVA 2EWVA 1AA9A 1IQPA 1SXJA 3W9YA 2MSEB 4XD7A 3UGIA 1LV7A 2J7PA 4JVNA 2OCAA 4B32A 3CRMA 4FMCB 2AN9A 2GZAA 4URUR 4BFVA 1FP6A 1W44A 4V0MA 5EXSA 2XB4A 5CIQA 3IQXA 1M7HA 1R0ZA 1OLOA 2GJ8A 3PG5A 3CLVA 1GKUB 3HR8A 1VKJA 1HT2E 3F5FA 4G01B 3OEHD 4QM6A 4DIEA 2C9OA 2IX3A 1F2UB 1G3RA 2R6AA 4Q00A 5AUPB 5LB4A 2ZJBA 4H9GA 4A9AA 2X77A 4HDQB 1GL6A 5TB5A 1WQ1R 2K5UA 1E2NA 2EFHB 5F3WB 4KBFA 5JEDA 2B6HA 3GEHA 4RZXA 3W3ZB 3KL4A 1PZNA 2REOA 4ZDWA 2ZVPX 1V5WA 3PUVA 2E9SA 3CNLA 4F4JA 4US0R 1IN7A 5M04A 3D31A 3CH4B 2HCBA 3LWNA 3EZ9A 5HKKA 4MRVA 4C0SA 3NHAA 3DL0A 2ZANA 4QGHA 4XVQA 1Q22A 2ZI7A 2ORIA 2QRNA 3GD7A 4JLOA 4NKRA 4XSGA 1MABB 4EDHA 4QJ5A 1Z6TA 3CRQA 4ACAA 2RGBA 3LVQE 1WB9A 1R0XA 2YWEA 1H8HD 1ODFA 5LBIA 1COWA 4D6PA 1MT0A 4NYMQ 3PIRA 4PSVA 1JJVA 2VP0A 1XXHB 2QTVB 4KJZA 3CZPA 1LTQA 3EPLA 2MMGA 4C30A 1H65A 2QPAA 2V9PA 4TLBA 2FJUA 2R6FA 3KX2A 5EP1A 1F2UA 3M0EA 2ZRDA 3BAFA 3S1AB 2O0HA 1IXRC 1XD2B 3PVSA 1N6KA 1WMSA 2PMKA 4NYIQ 2RCNA 2A78A 3LDAA 1C9KA 1OV4A 3B1ZA 2AHOA 1BOFA 1NG1A 1CEEA 4CF7A 3VX3A 1SVLA 3HPQA 1U9IA 2AKYA 3G5UA 5FTLA 821PA 1N5JA 3GEEA 3EX7C 4OQXA 4BRUA 4BASA 1GL7A 1QVRA 4PC2A 5L3QB 1KY3A 1E2GA 5FOTA 3N5CA 4AIIA 4URVR 4LYHA 1G18A 3M1IA 2RAPA 3TUZC 5FUXA 2CBZA 2H18A 4CT4B 2IWRA 2GJAA 2GNOA 3P4XA 4JIMA 3CPJB 1HE1C 2X19A 2YWHA 2QMOA 4A8JB 3OEHA 1D9ZA 3NBYC 1JAIA 1XXHA 3TSZA 3U6BA 2VHQA 3QXXA 4QG7A 3HJNA 2CVHA 3AKCA 1NSFA 1TU4A 1W5SA 1XMSA 2GESA 2QORA 3R8CA 4LV5B 1RRFA 3EARA 4A6XA 1CBUA 2FFAA 4YDSA 1R8QA 4KU4A 2XXAA 1J2JA 4HAZA 1EESA 1XD2A 3QXHA 1HQCA 1TTTA 2F3RA 3L8ZA 3DZDA 4P3YA 4B76A 4B3XA 3PUWA 1V43A 1OIXA 3OIUA 1NL3A 3H0KA 4URYR 4YC7A 1RC8A 2EWWA 3UPUA 1H8HA 4BGDA 4KITB 2H8KA 4MDEA 4QBIA 4ZKDA 2PT5A 4UXHA 3KXLA 1PLLA 2ZR7A 3SJZA 2YWGA 4C7OB 2XNSA 4MH0R 3AH8A 3UGLA 5CYPA 3HPRA 4CDGA 1G19A 5FBLB 4EPYA 2ZRFA 3KDSE 2RH5A 3WHKA 2YYZA 3NHBA 3K9LA 4BFTA 3FHCB 4DLZA 3LO5A 4PHFA 1QHHB 1UJ2A 2HV8A 1R79A 4BFZA 1WCV1 3TW4A 1U2RA 3RRYA 4EQ6B 3U5ZB 1RZ3A 5FUVA 1VIYA 4QHSA 4TTPA 3VR4A 2DR3A 3AP2A 5AK0A 2ZROA 4RFSA 1G7TA 4NMMA 1OE0A 4JJZA 1E2PA 2CMKA 4LV8B 3LW8A 3HR7A 3EIHA 4QXAA 2O52A 5KSZA 4B2IA 3GCGA 3WP0A 4NCKA 1ZCBA 1RFLA 5FBQB 2F55A 4UJ5A 1IN5A 1W4BA 2ZPTX 3WY9A 1XRJA 1W0KA 3K1JA 5B30A 1IY1A 4TL8A 3RHFA 2IHBA 3FHOA 1W4AA 3ASZA 3KTAB 1VIAA 5IF9A 3M4YA 3DDCA 1U99A 4V0NA 2ZSAA 3MWKA 2ENZA 4ZV4A 4O3MA 5AJVB 3C16C 3P32A 4XSHA 1NBME 1TL7C 4CVNA 1P7CA 2A5GA 4Q9LA 3R8FA 5DLQC 4EQ6A 1N6LA 2A5FA 2EYQA 4UKDA 3QG1A 2YC4C 3EA5A 3OAAD 4LHZA 1XD8A 1P6XA 2YUUA 2ZRNA 5A4JA 2UZ3A 1SQ5A 5JSZA 3RC3A 3TIFA 421PA 3NVAA 4E5UA 1E3MA 2ZRLA 4F38A 2G1JA 4IDPA 4EUNA 1RRCA 1A7JA 2QBYA 4KODA 1S4QA 4A4DA 2L0XA 1DAMA 2QMUA 2F1RA 1S3SA 4QRHA 5IHPA 2C5LA 2BMJA 2J45A 4WA7A 4IDHA 2ZSEA 2QA5A 4PPQA 1AIPA 3B1VA 1Y3AA 5H70A 4OHWA 1IY2A 1E1RD 1NMYA 2WMNB 4JLMA 5EJEA 3W3AA 1E2DA 3ZS8A 3NWJA 3WP1B 2P0EA 4YMVA 4PXAA 4OQFA 1B0UA 4LJ4A 4C0JA 2QM7A 3RWMB 2DFKB 4CIDA 2W0MA 2H16A 3AVQA 3K0SA 2C04A 3W34A 1G291 1FNMA 3FB4A 4RZ2A 1H8ED 2BCJQ 3AVYA 3MLEA 4BLRA 1QHNA 5EUQB 4DSTA 4WIAA 3DM9B 1OH8A 1GIAA 5AUNB 1RW4A 2XTMA 1IN6A 4TMKA 3U7EB 2RGGA 1JNYA 4Q1FA 3KY9A 1OF1A 1GP2A 1VG9B 5KSOA 3DHWC 4K46A 1DEKA 4PPGA 3RS7A 4ILEA 2XTZA 4G5RA 2ZQ5A 1M34E 3OAAA 2FV8A 1ZC4A 5AJYA 2ZU6A 5FBWB 3U44B 4TTQA 4AC9A 2DFTA 3B78A 1FW6A 4FI3C 3BOSA 1NVXQ 2X8AA 2WWGA 4MYTA 4MYHA 4NCIA 3U3MA 3GLIE 2GJSA 5CIWA 2DHRA 5L3SB 3D3QA 3EXAA 1KO7A 1NBMD 3IPYA 5L8VA 1EFTA 2FNAA 2V54A 5L3RA 3RS2A 2ENNA 1RJ9B 4XH9B 1X1RA 4M2LA 2W6ID 1SHKA 3VR1A 3GLGE 2XZPA 1EXMA 3MAAC 1F48A 1G16A 2GBLC 3CNNA 3ZVMA 1XMIA 1L4UA 2VO1A 1KJYA 3H2YA 4FMDF 4G3XA 1XP8A 2YHSA 1E1RA 4Q1AA 2O8BB 2QQEA 4ZDIA 3U7GA 3FHTA 3GJXC 1ANKA 4NONA 1A2BA 1PUJA 2PZGA 2FNFX 4FKDA 4RFVA 3BJIC 1KJZA 4LZZA 2IYRA 3BIFA 4I1OA 3X1XA 2ZI5A 2ODWA 3W5JA 3AVTA 5B57C 3PENA 1G8HA 3RRZA 4DEYA 1II0A 1NMXA 1ZD8A 2REBA 4U5XA 1SHZA 2C2HA 4DB4A 1H8EA 3AKEA 5FPTA 2A5DA 4JVLA 1VCIA 1OXXK 4D0NA 2BBOA 1KKMA 1L8QA 1IHUA 1YR9A 1G6OA 2GWHA 4LRWA 1J7KA 3EWAA 5L3SA 2YZ2A 1PUIA 2CHVA 4PSKA 5BW8A 4GP7A 4OI4A 1SVSA 4R2IA 4TQUS 5CLLA 4G5GA 5D3MB 4Z8YA 3BXZA 4LDJA 3AVUA 2OFOA 1CTQA 1G4AE 2QT1A 2GJ9A 2VQSA 3RWOA 1RJ9A 4RY2A 2IYWA 1CR0A 3KJEA 3K70D 4LV6A 1KBEA 4LBWA 4B35A 1P2VA 4B47A 1GM5A 3UMRA 2IXGA 3WNDA 2RGXA 4NTZA 4XIGS 2QRZA 3GJ3A 1US8B 4A2WA 5IDVA 2GXSA 3FFBA 3CRW1 3Q7QA 3NBFA 4AG6A 4LJ6A 4R71A 1Z0DA 3RS0A 3T61A 3P1JA 1QVAA 2PZEA 2VA8A 1DAIA 5JJKA 2ZRIA 3VU9B 2XGJA 3ADBA 4FMDB 2IYXA 4PPFA 4WXPA 1NBMA 2FWRA 2TMKA 1MO6A 2OFXA 3GP8A 1Z22A 1YVDA 1HH4A 3K70B 1TF2A 1J8YF 4EFNA 4P31A 2BDTA 3RRNA 2IC5A 2OXCA 3E70C 5D3MA 1DADA 1P73A 1NJGA 4PC7A 2V1UA 4LC0A 2QGNA 4Q1CA 1QHXA 3RRMA 1G21E 4B3FX 3ZVNA 3CW2A 3CZQA 3I5XA 2GCPA 4LYAA 2G88A 1D8TA 1UEJA 4KHZA 3QSYA 4RD4A 1EFCA 3THWB 1I2DA 5DI9A 5SZKB 1E2HA 1TNDA 2GXUA 4URXR 3IKJA 5TV2A 1US8A 4MITA 3ZYCA 1OH5A 3SI7A 4HLUC 5DSZA 2IL1A 1TPZA 1L4YA 4ERNA 1NN3A 3AM1A 1M74A 1E0JA 2WJYA 2BM0A 2KB0A 1NRJB 4HAXA 4M9XA 4GZLA 2DWOA 1E9EA 3VNVA 3VU9A 3WRYC 1KI7A 3OE7D 2ZE6A 1XEXA 1S8FA 3CKLA 4PZLA 2JLZA 1E2EA 4OI1A 5FFMA 3NEJA 3IIKA 5C18A 2GXAA 1Z0JA 3OEED 4LBYA 1B23P 1SZPA 4A2QA 3AV0B 1M7BA 1N5KA 2X1VA 4URZR 4BFXA 1D2NA 1G41A 2EFEB 2QSZA 3MRSA 5UKDA 3IO5A 1BMFD 5BYJA 3ND8A 1OXTA 3GLIB 4EFLA 3A1VA 2EVWX 4GNKA 1Z63A 2XX3A 2O8FB 4EPTA 1MO4A 1QF9A 4Q9HA 4PAMA 2H5EA 1ZNYA 1P4SA 3LBIA 3C15C 1C1YA 1OFTA 1Z3IX 3THWA 4K81B 5EE1A 1XBTA 1ETUA 4MKGA 3WMGA 3LRPA 2BOVA 3GLGB 2FX3A 1SULA 2AFHE 2AD1A 1BS1A 2PBRA 2P3SA 1OKKD 4HLCA 5J4VA 1KI3A 1JALA 4GMDA 3ASYA 1BKDR 1YZTA 4OJKA 4BECA 4LWZA 4V0ME 3OIYA 4NE2A 1CR4A 5CITA 1S2MA 1DAKA 2IYZA 2AD5A 4NU0A 1WP9A 1I2MA 4OL0A 1CXZA 3P20A 2HF8A 2NO0A 3TUIC 4AY2A 5E3HA 5CDFE 1P61B 2XSZD 1N2CE 3PQCA 2VBCA 3GLIA 2QNRA 5L3VA 1QDEA 2DB6A 5BYKA 2J7KA 3KJIA 5DNYB 4M1KA 2PLFA 2G83A 3THYB 4L9SA 5BN3A 1XMJA 2HUPA 1UADA 4AG5A 1G3QA 2LCFA 1MRSA 1W48A 3V4RA 3GLGA 2J9RA 2W00A 2QAGB 2BVNA 3OE7A 2VF7A 1HY3A 2ZITA 3FVQA 5JHGB 4PQYA 4RSGA 1VHLA 4LPKA 1W4CA 1OXUA 3GJ5A 1A4RA 1NN5A 3AEZA 1UBFA 4NPHA 5TARA 2IWHA 1Q3HA 5DE3A 3W6PA 3FKSD 3BORA 2ZREA 2Z6VA 5LPNA 4RD1A 4YQFA 3I61A 2PCJA 1BMFA 2HT1A 1FUKA 3L0OA 4Q02A 1GNQA 1E2JA 1L7VC 3WNCA 2QE7D 1OW3B 1GKYA 1LNZA 3K09C 2IYQA 1QHGA 3T34A 3KJGA 3Q3JB 4JLJA 4BUJA 4C0LA 5FBVB 2OEPA 4DDUA 2G1KA 1T3HA 3RC8A 2VP9A 3R7WA 4D80A 2ZJ8A 4NP6A 4MRNA 1NJFA 4BZPA 2XJ9A 5KOYA 2EQBA 4YMWA 2YVUA 1OKKA 3U3KA 3PEYA 1HA3A 1TUIA 3MWLA 2WJVA 2JJ8A 1JECA 3BB3A 2W2VA 1NG9A 4ZI2A 2QSYA 1KNXA 4UJ3A 3E1SA 3A58B 2WSSD 4A8JC 1TX4B 5IT5A 4HZUB 3SOPA 4B3BA 3U6KA 2GBLA 3DVLA 4OHVA 4H1UA 5FOUA 2OCBA 2XSZA 2A5YB 1AK2A 1JXMA 3T1QA 3QKTA 5EXTA 3BJIA 3THOA 2KWIA 1J8MF 1GFIA 2UZIR 3ADDA 4BEBA 2ZUBA 3U3RA 1T9HA 4F4IA 5JJIA 1UEIA 3T15A 3W90A 3MCAA 3A36A 4HDCA 4DRZA 3HYTA 2QTHA 4MGYR 1KZ7B 1Z0AA 3LLMA 3FKSA 4KXFB 4RD3A 2ROWA 1E4YA 1G20E 1LS6A 4L5BA 1E9DA 2F43B 4POAA 4QFMA 3RNLA 1S96A 4HZUA 3RS4A 4PAOA 2UVQA 4AKEA 2QE7A 4HI0E 1M7GA 3LD9A 1E2IA 4NHOA 1G8GA 4TT3D 5JI2E 1E94E 1M1YE 1MO3A 4LPSA 1XCPA 1KDOA 1T0HB 2V55B 2YV5A 4KAXA 4WZAE 5D3QA 2CVFA 3REGA 1EFRD 2AK2A 3CRVA 3NDBB 4W7SA 3FDIA 4DLVA 2RKOA 4QGFA 3KFVA 2FZLA 1IBRA 2OXRA 4N3NA 5DO9A 1N6IA 3U2QA 3EZ7A 2H57A 1ZU5A 3ZH9B 2W6JD 4Z1MD 2G0NA 2D7DA 1Q3TA 2WSSA 1ZM9A 1OYWA 4CEIA 4RD0A 5FOXA 4DIDA 5KNCA 1I4LD 1YZQA 3WYGA 4ARZB 1G17A 3I8SA 1F5NA 3H84A 5HTKA 1Z8FA 2C96A 5KTYA 3C7KA 1M6NA 1UBCA 2F43A 1IN8A 2VPPA 3B7GA 1YR7A 5CK4A 1SGWA 2B7CA 1QZXA 4Z51A 1CKEA 4KSBA 2QPTA 2R8RA 4PQFA 4U00A 4GSYA 1JQLB 2WICA 3SEAA 1ZBDA 3CNOA 4KVGA 4HLUA 4X8HA 4US2R 3K53A 4AD8A 2JIZD 3DKVA 2WZQA 3A1WA 1HQYE 2AL7A 4QNRA 2OCYC 2KJQA 4JLDA 3TQFA 2ZRAA 3FMFA 1ELOA 4Q7MB 4HEJA 1OH7A 4LJ7A 5CDFA 3EPKA 5JWOA 1Z07A 4WAUA 4A2PA 1FARA 4M9SA 2J0SA 4IXNA 4M1TA 4LJYA 3AUYA 5JHHB 4PANA 1MR3F 3UEYA 1G3IA 4TT3A 1XJCA 1ZIOA 1G8FA 3V00A 1S3GA 3BK7A 1BIFA 3PV0A 1TADA 4AYWA 1EFRA 4YMTA 1PTRA 1VMAA 4JBWA 3VAAA 4CEJB 2ZE5A 1E1QD 2JAQA 3REFA 3GJ8A 5BXQC 3ZIAD 1D5CA 1RKBA 4S35A 2VH5R 5AJXA 2NPFA 5FTJA 4A0HA 4KFRA 3TVDA 2J0QA 4UXJA 4OHXA 5HCNA 2RGEA 4E07A 3UG7A 1KKLA 4NYJR 2CCJA 2W6JA 2ZSFA 4Z1MA 5F98A 1F6BA 4A36A 1X86B 1XJQA 1XEFA 2MMCA 3BH0A 3UKDA 4DC9A 4DLSA 5IK2D 2QI9C 4P4TA 1KNQA 1DAEA 1T8UA 4BZXA 1XPOA 3T1VA 5JI3E 1DARA 1W2HA 5IRCD 2C77A 2QROA 4HDOB 4QOSA 4AWXA 3L0PA 3EG5A 4GRAA 2BM1A 3F8TA 3E5HA 1S1MA 2BEJA 3ONWA 3PR1A 2A30A 1XPRA 1YKSA 2VYFA 3CONA 5CYOA 3UEJA 5E7JA 1GRNA 4EPVA 2JIZA 1N6HA 5J47A 1GAJA 1IJFA 1TU3A 2NOAA 2GF0A 4Q4AB 4R7ZA 4WZ6A 4YDHB 1FP7A 1MABA 1QRAA 2CCGA 4YMSA 1R2QA 3NC0C 5J40A 3QKSB 2WAXA 1KBFA 3ADKA 4BPBA 2IS1A 2WPDD 2WWXA 2GZHA 1EGAA 2OBLA 2QAJA 3BE4A 3KKMA 2AXNA 1N25A 3EZFA 1CJVC 4MUBA 1ZINA 4WVFA 4PO8A 1K5DA 4Q01A 3VR3A 5F9FA 1P9NA 2OESA 4L15A 4PO1A 5E7MA 1Z08A 1YR8A 1BO6A 5EE3A 2PT7A 1NKTA 5G40A 4OBEA 3KJHA 5EUMA 3NG1A 2DWQA 1N6NA 1R5BA 2JLQA 5TY0A 1J70A 1N6RA 4LJ5A 2J1LA 3QE0A 3K09A 2QMEA 3S1AA 4DXAA 4MYUA 4FMBB 1DO2A 4HZIA 1NI3A 1Q1QA 5SZJA 4MDFA 1E1QA 1XCMA 3ZIAA 1XTQA 1SKYB 4IOMA 2AWOA 4TN1A 3X1WA 3ICQB 1KK2A 2NQ2C 2OM2A 5C4MA 1QHYA 5L3QA 2FPKA 4Q4AA 1W4RA 1U81A 4GP6A 1WBBA 3QOFA 2CL7X 5FH9A 1BYIA 2YNMA 2QP4A 4U02A 3IBGA 5EZ6B 1E9CA 4TL7A 1DELA 4A8JA 3LVRE 1TF5A 2ZAMA 4PFSA 3OESA 2NIPA 3WBJA 1HTWA 4TSFD 3GFOA 2GCNA 1KY2A 1XX6A 2BMEA 4IVRA 5KSYA 1PJRA 4PC6A 4Q1EA 3QJYA 1N5LA 5JWHA 3T5GA 4TL9A 2BBWA 1JBKA 2WBLC 1ZIPA 1Z47A 3B5JA 3QEJA 1R6BX 5TMPA 1XTJA 3CX7A 4OK3A 4BRWA 4C2UA 1AZTA 3L43A 1XDBA 3IEVA 1A82A 2GAAA 2R44A 4BLTA 3NIBA 2CE7A 2NO7A 1KO8A 4A0GA 2O8EB 4DLYA 1CJTC 1U0JA 1GRRA 4G0NA 4G5OA 4IFBA 3ZGXA 1LY1A 1II9A 3DOFA 1GOTA 4GI7A 1XMVA 4C9BA 4C7OA 4WOPA 1G5TA 1ZVQA 3QI2A 3KQKA 2Q9CA 1RRGA 4MGKR 4AYTA 4NL4H 1J90A 2HXSA 1JEDA 5HPYB 2P6UA 1GUAA 1R0WA 5JCZA 3K70C 2ZSBA 2OHFA 2VP4A 2ZYUX 2QQ0A 3A4LA 4JS0A 2ASEA 4Y0AA 1QHHA 2XOKD 2NO9A 1NP6A 3CO5A 2QL6A 1G5PA 4OJQA 4AI6A 3DOEA 4DCNA 1GWNA 2E73A 4O2LA 3D7MA 4A1FA 1ZM7A 3KKPA 4B73A 2F1HA 2GK7A 1ZU4A 2ECKA 4CW7A 4D0LB 4GDFA 1FL9A 2IS4A 4LYJA 4JLAA 1NKSA 3EA0A 4Q66C 3D8BA 2CXXA 1VDZA 3N2IA 4HUTA 4W9MC 2IXFA 5AUQA 1VPLA 4DVGA 2QU8A 4GZMA 3RDPA 1KSHA 2QMHA 4M4SA 4QKQA 1E0SA 4UXIA 3K9GA 2GHIA 5G3ZA 3CM0A 1GITA 1DVRA 3QVUA 2C8VA 5EE9A 4DUGD 1G4UR 4M0LA 3FMPB 4TSFA 4P33A 1T0JB 2IK8A 3KTAA 1YZKA 4B3DA 1I4DD 5EE5B 4NYJQ 1CS4C 5CLQA 4OQNA 3GEIA 1KJWA 1ZMXA 4LHYA 4DDWA 4MKIA 1KI4A 2OZEA 4IHQA 4PHGA 3SU8A 2CLDX 4B3CA 2EYUA 1BYUA 1U98A 2KE5A 3IUYA 4TLAA 1DS6A 2HT6A 3ZS9A 3TGPA 4UNNA 3UFFA 621PA 2CDNA 2ZJZA 3IHWA 2FE4A 5FTMA 1XD9A 3KQLA 4BEJA 1UKVY 4QC2A 1IOZA 2QENA 3Q8XB 4M9ZA 4ABYA 2V8OA 4O25A 1P2UA 2DYKA 1LS1A 3X1YA 2WM9B 1ESMA 1DG3A 2OLKA 2ZJAA 3T12A 5TXGA 3EPHA 2VLIA 2A5JA 2OUKA 4BLQA 5JRZA 1Q12A 2NZJA 2ONJA 1FAQA 2XOKA 3SYNA 4EKDA 2FFQA 5DGXA 2B7BA 5JECA 4Q03A 2V1XA 4A82A 5LDDC 3I72A 4PTLA 1FFHA 2IA5A 5GJWC 4CEHB 2FH5B 4LUCA 4EPXA 3ZD6A 1QHIA 2WHXA 3OIWA 1UDXA 3OIVA 3PUYA 3SHWA 4IVPA 3TKLA 5EZ5A 2Z5FA 3QPWA 2H92A 2Z4SA 2QUZA 4PX9A 4HB2A 1TBOA 3AVWA 4A92A 4XTCS 4CGZA 1IONA 2DPXA 2I1QA 4ZDJA 2OBMA 5KSPA 2WWYA 2FSFA 3MUFA 4TYWA 4BFUA 2QAGC 1TF7A 1G6HA 2R62A 3SQWA 3TNFA 4U7DA 2WWIA 3BERA 3CR7A 4IVQA 4JLVA 4Q9JA 2P5SA 3ZVLA 1Y8FA 3AF0A 1SVOA 1VTKA 1GRQA 4O2RA 3R9XA 1MKYA 2RGDA 1OH6A 4B34A 2ERXA 1E9SA 4ON9A 2BKUA 4G1UC 5G41A 4JT4A 3GLHE 1PLJA 1XPUA 2R6GA 4Q4HB 4IOJA 4KV9A 3KUDA 3T06B 4LK2A 3EW9A 1E2LA 4GOXA 2PX3A 3SC3A 3WNBA 3NKVA 4LX0A 4N0DA 2V6IA 4P0TA 3U3OA 3THXB 1YZNA 3U44A 3RVBA 1AGRA 1ZUHA 1VCNA 3QY0A 4B71A 4JLNA 1FNNA 4WXRA 2J0UB 4Y0VA 2OV2A 3A4NA 1MOZA 2FPMA 3LA6A 3Q85A 4DT1B 4TLDA 5KDDA 2FGJA 5TVKA 1T5LA 2QG6A 3QQ5A 5FPKA 2ZTSA 3AGQA 1TBNA 3U60B 4Q5IA 4BFSA 3KQHA 2F1JA 3ZLJA 1W1WA 1R5OA 1ZCAA 4Z8XA 1XEWY 4MUAA 1IJEA 4FD2A 5FOVA 1N0VC 4DCVA 3OZXA 2O8BA 2J3EA 4ZDKA 3ETLA 1KTVA 2IEZA 1Z6AA 2QT0A 1WF3A 4Q4HA 4I99A 4F7WA 3BH7A 3X1ZA 4EFMA 2F9LA 3MMPA 3FWYA 1ZM4A 1KSFX 1W2GA 5CB6A 5K8TA 3X1DA 1OHHD 2H17A 3QF7A 4M8NE 2QGZA 2ZRGA 3QF4B 4FN5A 4JBXA 3I3SR 2QTFA 1KI9A 5G53C 3A4MA 4KYIB 3TUJC 2YJTD 3I62A 2OO7A 4EAQA 2W6IA 3UWKA 4L9WA 2BMDA 2AWNA 4OKSA 2CHGA 2UKDA 4KBGA 3K0AB 4V02A 5F9HA 1NLYA 1NY6A 2FSIA 3F3YA 3FYHA 4HAVA 2GETA 2CEAA 3CF2A 1UDWA 2YOGA 1PV4A 3DEFA 1W7AA 3RYTC 4KI0A 2B8WA 3MWJA 1CIPA 1NIPA 3AVPA 2PX0A 1Z29A 1R7RA 4QJ3A 2AKAB 2PCLA 2PL3A 3B9PA 1XTRA 2IYSA 2JLVA 1N3BA 3ZVRA 1JB1A 1P3JA 4CZ2A 1KSJA 5FOSA 3LLUA 2IYTA 3C14C 521PA 3GJ6A 2WKQA 3QF4A 3T5DA 4P4UA 2VSFA 1DBSA 1CR2A 3A8TA 1E96A 1PTQA 1TQ4A 1VYUA 3FGNA 4L8GA 1U8YA 1Z06A 4TYNA 3PUXA 5FI1B 4DSNA 1HYQA 1FTSA 3MWYW 1RFHA 2YOHA 1VCOA 2W83A 4PHTA 1VHTA 2R2AA 3C41J 5GJVC 1G8PA 4BFYA 1MO5A 1F3OA 4ZCLA
chains in the Genus database with same CATH superfamily
2B94A 1C3OA 4ZODA 2CZGA 3ZQ6A 3MT9A 1FNCA 3NGXA 1EIWA 3N05A 1DOHA 4BC1A 2CV1A 3ASVA 4LWOA 3GJQA 2NMVA 2XUIA 1L5FA 4LFCB 4KR2A 2WG0A 3PCTA 3Q2KA 2QY6A 4G1EB 2HPAA 3ZLUA 3ASUA 1HPLA 2VIIA 2NADA 2PH1A 4Q7JB 1Z2NX 4MUNA 5HBGA 3HRHA 3PKJA 4K9LA 3DVSX 4IV8A 3KL2A 3M7IA 3NALA 4ZC1A 5IM4A 1E66A 4H0CA 3TE6A 3E9ZA 4AF8A 4EB0A 4Y30A 3R3UA 5DMXA 1BHQ1 2ZBQA 5EKDA 1WWKA 1CUFA 2WKWA 2ZBVA 1KZ4A 3KM0A 3KB1A 2FWNA 1CLUA 2FEAA 1FX0B 2G9UA 2GHRA 2D2IA 2RGYA 5AM3A 1Q1ZA 1ZFNA 5LQCA 2GEUA 1SEVA 1QO0D 1UZUA 2BUBA 2C03A 3FOAA 3NAMA 1IHOA 1GGMA 3LECA 2IF2A 4FHCA 4U63A 3RFCA 4EH1A 4X8LA 5FWXA 4Y2JA 3V7FA 1YQWA 2JIDA 2RDMA 4BYMA 1BW9A 4O8ZA 2A9VA 3D0RA 3ND9A 1Z25A 3L7OA 1GCOA 3CMCO 3NTXA 2DBQA 5JV5A 4UVGA 2QLLA 3TL3A 1UWVA 2V74B 2J67A 3JQGA 4P3OA 2PUJA 4FNAA 4PICA 2RMKA 2VWGA 3LUPA 4BKMA 1U7OA 2XNHA 5AHRA 4ESVA 1U7PA 2XGGA 2O5CA 1A8HA 4BFCA 2OR3A 1GGJA 2BBTA 3ZJUA 2FEOA 3UMFA 3W8RA 1S0UA 3TMKA 2ZBPA 2B6NA 2P9YA 5HCIA 3S40A 3TLYA 1RM4A 4B7ZA 4FXPA 1C14A 2JATA 4RA9A 4TQ9A 4DWJA 2O8CB 2LKCA 3S70A 4X9XA 3DBVO 5JAUA 2PEYA 3NAGA 3QMVA 4CT5A 3V2GA 1AK9A 3SEZA 3KCQA 1QIHA 4CMBA 1OT3A 1AKMA 3RC7A 3NU1A 2QS9A 3VU0A 1LK5A 4JOSA 1W4LA 4GMGA 1YU6A 1SCQA 3ZY5A 3E8MA 5DLDA 4H59A 3FFAA 3CH5A 1NW4A 2EJBA 2IRWA 4M7RA 4QGGA 1QS0A 2NACA 1G3UA 1GL9B 2ZK7A 3KYDA 4HX5A 3TSOA 1AB6A 1MGOA 1O89A 2B98A 4H18A 4J29A 4KWTA 2IPMA 3QE2A 1CRWG 3G49A 4U39A 5DCYA 1SUSA 3N53A 3LC0A 5EEGA 1HL7A 3KWJA 5IC4A 4GWGA 1QHSA 3NH9A 1Q1EA 3QOXA 4GRDA 1USUA 3EASA 3LTEA 2FE1A 2X3TA 4IKEA 4NZYA 4IXDA 4OQZA 3O83A 4A6PA 3FTEA 2PX5A 2CXRA 4EHFA 1BDBA 4OHKA 4UNSA 4MOWA 5J43A 1PNTA 2FVYA 2UZ1B 5CP8A 4CM8B 2VVTA 2CNNA 3R5TA 5E3QA 3QXSA 4I1UA 2DX7A 3IKVA 4UUOA 1L5HA 2PKQP 2GLXA 3BWCA 4YV2A 4IMIB 4QLAA 2VSXA 1XCGB 3F5QA 3Q5EA 4R83A 1N9ZA 2NNLD 3MBKA 4NCHA 4WDQA 4AZTA 1YKFA 3MIIA 1YO6A 2ZJ2A 1AKRA 1KDTA 3IMGA 1V6CA 2H4WA 5KX5F 4QBTA 3CUUA 1PL6A 3U9SA 1C0PA 2ZYVX 5BOSA 5IHXA 4CXMA 1X7WB 3RO7A 4ZPXA 1KOFA 5A4DA 1FUUA 3IRVA 2NYRA 1DC8A 3R4CA 1DS3I 1UK7A 2HA5A 2CK3D 4FZ3A 1I32A 4IRMA 3JYOA 1KOLA 1OAAA 2A5LA 3MTQA 1NKVA 3C4JA 3MJHA 3OBBA 4RLHA 2AV6A 3WDSA 3K0CC 3U48A 5A4IS 1OZHA 3JZAA 1H2XA 1YU9A 3BILA 3CLUC 1DUIA 4UMDA 3PZBA 4KQXA 1X1BA 3TR6A 1G7CA 1R9MA 5AJWA 4M22A 5EXPA 4BJ3A 3BDAA 4ZVVA 2XRFA 3QKUA 2HX1A 3GNTA 3IPCA 4NJMB 1INLA 3AJRA 5I51A 4H16A 5EXDA 5GONF 1SXJD 2AMFA 1U8TA 1V1HA 2IVZA 3OFSA 3GZTB 4RKFA 1LCIA 4V1CB 1XTSA 2EEPA 1DV2A 3ZDBA 1JSRA 2IZ5A 4KRFA 3BCSA 2X40A 2Z9BA 1MIOB 5ULLA 1Q3KA 5KJFA 3FBTA 4PR0A 1DC4A 2PXCA 2WV9A 3QWFA 1PN3A 3BBLA 4MVJG 1LBEA 4O08A 5HF8A 1KMQA 1U7TA 4D8XA 2DY1A 1KPHA 3OH8A 1Y63A 2C7OA 3SDZA 3HU3A 2D62A 2WINI 3PLRA 3WB2A 1P1RA 5F1OA 3UAZA 1WKCA 1EG2A 2BMFA 2R751 1TOAA 4LF6B 4PV7A 4RVCA 2CNLA 1L7DA 2C94A 2R5WA 5A6SA 3RASA 4J0CA 3CB4A 4W1RA 3V2HA 3MEQA 3RVPA 1Z4OA 5CCDA 4CYMA 2WJGA 2W6MA 1YJBA 1Q14A 1A1VA 3CIOA 4RF5A 5P8WA 1R0BA 4MUEA 4D46A 1L1RA 2VOJA 4X7RA 2G9QA 2C7QA 1KO4A 3TI7A 5DISB 3WFZA 2RB4A 1PR3A 4GX5A 4ZK2A 1H93A 2FHSA 4TTRA 4YT5A 3VX4A 1FVOA 1E2KA 3BKXA 2E0IA 2ZRPA 1AS2A 2D7CA 4CKXA 4D4HA 1P0FA 2Q3JA 3IA7A 2UXDB 3A1UA 1Z2OX 2ZR9A 3MMZA 2VDOB 4JJFA 1F0NA 2G82A 3IR5A 5D6NA 3VHXB 5LDGA 4A7PA 1A9QA 3BHMA 1G42A 2OE2A 4DLPA 2C4WA 5FUWA 1RWKA 2I2CA 4NFYA 1LU9A 3T5CA 2IF0A 1P7ZA 1U9YA 1CP2A 1UOQA 5IXYA 4OQ4A 3RF6A 2RHJA 2R1VA 5BSTA 4CNQA 5IMBA 3TN7A 1JAHA 1MJGM 4MMYB 3GK3A 1LLFA 1O87A 1RVDA 4YCBA 4KVZA 5LQKA 2CB0A 1QGUA 3DT8A 1UK9A 3KOOA 4PN7A 3CB2A 4FCTA 5F21A 5LXTB 4M0CA 3ZHZA 1HYEA 2B4AA 1HNZB 1Y1QA 5TEWA 1RXUA 2WT8A 3E8SA 3I37X 2O7QA 4NESA 2C88A 1XI2A 1EJ0A 2XMZA 3FVRA 4JR0A 4KUGA 4CTJA 3ICPA 3VSEA 3IJEB 3NDPA 4JP1A 2GEBA 4V0LA 3FE2A 3QUAA 2XADA 3RBXA 4PC3A 4FIDA 1IVSA 3UTCA 1XLTA 1GO2A 1HT1E 3JYPA 1QR2A 2Z58A 3B85A 2O6HA 4MJLA 5L53A 8MHTA 3K8OE 3ANLA 3BYZA 1GPH1 1A7UA 2ZUDA 4YO8A 2OXFA 3W7AA 1EU1A 4J94A 3QYAA 5EZYB 4ZCPA 4BZQA 1G5RA 3LV8A 4B44A 2R87A 3RYHB 3CR3C 2DUWA 2GZMA 3K0BA 5LZ7A 2G28A 4LY9A 4RK1A 2VATA 4K9KA 2PZKA 1DAFA 1KIAA 1V37A 1H2BA 2BHRA 3HDTA 3HWSA 4HNSA 2X1HA 3A6DA 4RVUA 2DCMA 5HE9A 2EW1A 1TZJA 1VIVA 2FEMA 3S2GA 1C4OA 5T4HA 1IBMB 2YKGA 3UYKA 1VKZA 2QN3A 3ONFA 4O33A 4Q1BA 2H52A 3GAZA 2Z98A 1NWHA 2AXPA 5FLXA 2UUOA 2ZS9A 1CR1A 4FCWA 4FE4A 4PC1A 3I42A 3DBLB 1N7IA 2ISSD 4MKHA 3R9IA 2WF6A 5AWFC 3SZ3A 1EEXB 1V8OA 1Z0KA 3DMHA 2QZJA 2X6TA 4KQKA 4OK6A 1R0RI 1GNPA 1M8CA 2I22A 5CUQA 4DBLC 3D4NA 1FU7A 4MV4A 3U4QB 3OQOA 2VQ3A 4EQZA 3OU7A 3WQHA 3IPXA 1QGZA 1BSVA 4GW3A 1GRCA 3BWDD 4MQMA 2QYTA 5J4KA 1VA5A 1XMXA 1CYDA 3QEOA 3CLUD 4X71A 4JBIA 4H6PA 4K9QA 4RQBA 4CM6A 2NZ8A 4IV5A 1ODCA 1M0EA 4D44A 2HC9A 1ACLA 4FYPA 4GYJA 3K1AA 5BMOA 2QE6A 3FF1A 1UMDB 3MWEB 2XMSA 4Z0HO 2VAWA 3N8KA 1GLNA 3KXIA 4DV6B 5DIFA 1QYRA 1P0IA 4P4NA 4RU1A 3AKYA 3UFXB 3CNQS 5I7WA 1GZ7A 2GTIA 5A3QA 1XWIA 3CZ5A 1DIGA 1QE5A 3M33A 4UE2A 4F60A 2X7JA 1X92A 4YRSA 2XZDA 1X8XA 1VBKA 2R79A 1X6VA 3HBJA 4J3FA 2HA6A 2NT3A 2JEOA 3IQGX 4KWCA 4D9HA 2WG2A 1RWPA 3NHRA 1W36C 4BRZA 4XXHA 4EY4A 2FWJA 2HK7A 1NNEA 1KFEB 4HQKA 1FXWF 4WN9A 2GD1O 4F85A 8GPBA 3K71B 1VRCA 3DDNA 3GXOA 2ORWA 5FHQA 5SV2A 3S99A 3FPHA 3VKWA 3VOBA 1GQ2A 1S1CA 2JFGA 4C4XA 1CUGA 1VL1A 2DUUA 1F8YA 2C3PA 4JZKA 5KDLA 2AK3A 4P0QB 2J5KA 3KZVA 4JLPA 3QVOA 2FWBA 4L8FA 4TMTA 3M1AA 3V9AA 3IV7A 4CR6A 4ZRDA 4CIYA 2FLWA 1NXPA 3TTSA 2F3SA 1QG2A 1MG0A 2PQ0A 3PEUA 3LX5A 4XVUA 1GPMA 2VA9A 3EXHA 3ICOA 3M6AA 3I1IA 5C8YB 3AXSA 2ODBA 5EFOA 3K2IA 3SJ7A 3V1KA 5CLIA 2B21A 3SKYA 4Q7KA 4P98A 4PZYA 3KAKA 3U3JA 3ZV5A 2QX8A 4DIMA 4X3CA 5HDBB 2JI7A 3ZBUA 5KOHA 4IWYA 1H4TA 2EFDB 1L5RA 1OFIA 3MJSA 2Q6KA 3MWDA 1WXEA 1PR9A 4MAMA 2IY7A 2SGPI 1V11B 2ZB4A 4NJOA 2KMRA 3ACBA 4M3NA 3OC0A 2M32A 4RCVA 1S2OA 3DM5A 4Q47A 1EA5A 3F9CA 4WJKB 3E35A 3AHGA 3BDVA 3G68A 3I2KA 1SD5A 1AXGA 1G2PA 1XA4A 1YRBA 3MWFA 4Y9UA 5EIHA 3TAUA 2H1VA 4JT2A 2GM4A 2RAFA 3EBLA 3GOHA 4R2HA 4D4KA 3U09A 3JVVA 1CD5A 5LNK6 3PDIB 3F8WA 5ITZA 4S2UA 1WY7A 2H0AA 3MAJA 4F6RB 3H5OA 4YDQA 1RC0A 2NU7B 5LD2B 1T4MA 1Y3IA 3EC2A 1T0PA 2KLHA 4A0RA 5BN4A 3V5NA 3W7BA 5JJCA 3V33A 2WAMA 1RYMA 5CFRA 4QRDA 2M98A 4DR4B 1VJTA 2JLYA 4D82A 5JSZB 2M1XA 1PF7E 4OXIA 1JR6A 4ERXA 1IMJA 4OQMA 5A7FA 3RV3A 2GCIA 3DCIA 2QIOA 3LX8A 4R1PA 2H7YA 4CFZA 3WLMA 2WU1A 1EINA 1VG8A 3O26A 1R18A 1QU2A 3W8NA 1ZSVA 2PIDA 3FZEA 5A3VA 3R3YA 4YRAA 4BB6A 5FPSA 3HLYA 4J7XA 4YCJA 1MB9A 3AI2A 1FLDA 4RV5A 3PX3A 2Z3ZA 4FB4A 2DKFA 3KSRA 3WV5A 3OPYB 2GNPA 3E8XA 1O08A 1DQPA 1A9XA 4GOKA 2DTXA 3TNYA 4KLNA 3WK4A 1MD9A 3R6WA 5GIPE 3GQBA 3K9NA 5LU8A 2X8WA 3OKCA 2PKWA 2NSYA 5DDIP 4Y6RA 1YSCA 3M4JA 3R8XA 3F4LA 3TSAA 4ENTA 1SXGA 3DEKA 3T3HA 3MGBA 3VR4H 4LSGA 3KQNA 1WX1A 4F4HA 4BNWA 3ZCQA 4F91B 1FDTA 3SSAA 3IPLA 1VB3A 3SY8A 3H5TA 2YYAA 2WCYA 2A33A 5BMVB 5CVTA 1P4AA 1XKLA 2ZIXB 4BNDB 3L7DA 3OOWA 2J9GA 4MPRA 3KPUA 3ZE1B 3KU4A 3RIEA 3GJ4A 2WJ6A 1QYWA 2ODEA 4RPKA 3W6OA 4EGFA 1VGVA 3EULA 4RK5A 3RYIB 3V7NA 2W58A 8OHMA 4LBZA 4PZAA 5TQ0A 4U2DA 2X5JO 3IGFA 3DEZA 5KHOC 2QTLA 3PEVA 4C4ZA 3JPYA 1Y1TA 5F52A 2HA4A 5FTNA 2H1HA 1ZNQO 3AR5A 3ZE0B 3DTYA 3H9CA 1N32B 1Z2PX 2QK4A 1NMZA 4X65B 2FMXA 1NSTA 1UBEA 2YZGA 3RT9A 3GFBA 1Z4QA 3TL2A 4I6EA 2IYLD 5WRFA 4EA6A 5ICSA 3VDPA 2Z1DA 3IXMA 4QBKA 4OVOA 1TJ5A 4C0WA 5FO0A 1K7XB 1CJMA 4N82A 4O1IA 4CM4B 4REQA 1DTWB 3ON5A 5CBPA 1W49A 2EIHA 3EH2A 3M49A 3O93A 5EP2A 1EUYA 5KYYB 1XZBA 4HN2A 3EDRA 4JEMA 4OJMX 1QK3A 4MRSA 5IVHA 5A5DA 1M66A 4TQAA 2C7RA 2Q49A 1OB2A 3RVRA 1L4LA 3RSQA 1II8B 3BWBA 4ZQBA 1W36D 3QKWA 3FMGA 2VRWB 2X2FA 2BI8A 1ZJZA 4JU9A 4DL9A 1RPNA 2JD0A 3UH1A 4C0HA 3ZD7A 5H0IA 1BE8A 3HJHA 4QAJA 5H1YA 5CA0A 2PZ8A 3VSDA 2F00A 3JYLA 2REXB 5DN9A 5JFGA 1WRBA 2IDJA 1E6LA 1G9TA 4MGZR 1K1EA 2X86A 2M2IA 2XDYA 2QUBA 3I34X 4MV1A 1XNJA 4DCGA 4K6CA 3O0DA 3CZMA 2F3QA 4Y2VA 2ZTUA 4HEHA 3GG9A 3IS3A 3OCVA 4TMXA 3H1PA 3NRJA 5IFKA 4OLHA 2PKCA 3WKDA 2XEXA 4JJIA 7ABPA 3ZGZA 4IOKA 1UPUA 3PNSA 1EK2A 3SDSA 4BKOA 2C92A 4G5YA 4NAHA 4PYRA 3TQQA 1A9PA 1ZIXA 1AZLA 1NT4A 5TJHA 4G1BA 1RWQA 5HOEA 3UG6A 2W42A 4L95C 3NP7A 2BMAA 4FEYA 3HG7A 1H2AS 2DMRA 1D2HA 2OC4A 3H9UA 3LQRA 4KLZA 5A7HA 4AW9A 1QF6A 3QVXA 1T1GA 4QXPA 4F92B 4SGBI 2PMDA 3Q10A 4KSCA 5CR9A 3NNSA 4E22A 3BFPA 3GRFA 4HUJA 1GN8A 2FY8A 2V4UA 4IOLA 4NOJA 4PS0A 4TUYB 7REQB 1CQJA 2O8DA 3G5MA 3MG9A 4N54A 3NQ41 4IIJA 1AM4D 3RS3A 4TKVA 4OHYA 1CFJA 1AUVA 4EW2A 1I13A 2ZE7A 4JU8A 2M6SA 4ALNA 4C5BA 4CM5A 4B2PA 1JJ7A 1AS0A 1M1XB 2CLHB 2WF9A 3LIPA 1ZUIA 4RXMA 4QGSA 4NH4A 1E2UA 4I4NA 3WLNA 2ONCA 5LP6B 1RKUA 1JKJB 4PAQA 2XT0A 4Y6LA 1VQ1A 2VTBA 3H1EA 1Q0SA 1UDCA 1JDZA 3N3BC 1QFZA 4N40A 5SYMA 1SBZA 3LC7O 3GFVA 3DPUA 3UMGA 1HM5A 1JEQA 2GWRA 3RU3A 2M6LA 3D7NA 2GS9A 1X1SA 3JD3A 3SQLA 2PFSA 1PK7A 1AKEA 3B1YA 4QL3A 4TM8A 4KYUA 1KAGA 5GY7A 2FQ1A 4O02B 3WBKA 2ZSDA 1T3SA 3JY6A 2FP4A 2PWBA 4LOJA 2HJHA 4MZDA 1SZCA 4AUKA 5DWVA 3E2PA 4EKIA 3SYKA 1YS6A 3KNZA 1QIFA 4MROA 4N7RA 3JZIA 3A6PC 1KAMA 5IJWA 4KFTA 3THXA 4ZAFA 5GVSA 2JHPA 4ARUA 1O94C 4GO1A 1Q84A 4LY6A 2QSUA 4F71A 3BK2A 5DN6A 5THXA 4ZTBA 2JLWA 1LF5A 3MSCA 5D01A 4Z7JA 3JQ7B 2ZUWA 2C61A 4YUXA 1ZUWA 4AKIA 4BGIA 4DQXA 3WGIA 1ISRA 2ZW9A 3G8DA 2SGEI 1MP0A 4QIHA 4I5EA 1EGHA 1QZTA 3P5BA 3FETA 2BRUC 2GEDA 3FNBA 2V6FA 3V34A 1XAJA 1T9ZA 1JDNA 3PL1A 3JAMA 5H68A 3WBFA 1E1KA 4ZAVA 3W6ZA 1ZNXA 3TQCA 1R6XA 1Y1RA 1ZD9A 1UXIA 4M0DA 5FBZA 4YREA 3VXKA 4B74A 3Q40A 1IUNA 5D85A 3KZOA 3SSOA 4LJLA 2JCYA 2WIBA 1Y81A 2P6AC 4J3JA 3NBQA 4G8BA 3BD9A 3RANA 2CY0A 3M9WA 1IU9A 4UZFA 2D0IA 1DX9A 4EY6A 3D0QA 3AVXA 3OJEA 2I29A 1I3OA 5ICGA 1QG6A 1IN4A 4F6CA 2RB5A 3OQMA 3DZIA 1QP8A 3QBDA 3R75A 3Q3EA 4BVEA 1WXXA 1OBOA 4JNCA 1B93A 1KDRA 3K2EA 3L0IB 4J4BA 3KPVA 1UXHA 4HRYA 2GTPA 1JVSA 3UHOA 3BT7A 1L9KA 3L6DA 1KS9A 1W88A 2FFBA 3OL0A 1ZMTA 2QLBA 3AY3A 2B0JA 3TDMA 3NXKA 3PNYA 4JA2A 3TH5A 1I7QB 2UYOA 3LNCA 4XDGA 2UVOA 1IAVA 5B3LA 2WHPA 1MFZA 1WABA 1G8AA 3LUJA 1N8TA 1D1SA 4R5HA 1CVIA 4ZRNA 3DLCA 1YE5A 3L7YA 1MRNA 1WG8A 2JAOA 4UEKA 3BD6A 1PX0A 3V1TC 2H0QA 3TD6A 5IBRA 4YCCA 2VHUA 5KDOA 4Q9DA 1E3LA 1USGA 2WFLA 2WFZA 2Y3IA 3BJZA 1RHKA 1KH3A 3N8HA 2FKAA 4P7KA 4X92A 2G0AA 4DV4B 3FXAA 2R00A 2QJFA 2WJ3A 1U28A 2ZWPA 1RPZA 3RVNA 1NDQA 1IXSB 1QBGA 4M9CA 2W48A 3T7TA 5K8UA 1Z74A 3J81k 2JJ2D 4EJSA 2QM3A 5G4KA 3DOUA 2X52A 1DJPA 3NDRA 3VYSB 5DZSA 1IJBA 4E7PA 2IGBA 3E1KA 3G2HA 3L79A 4AB1A 2PSJA 4KGDA 4C3ZA 3D3WA 1V5GA 5HQTA 3DCJA 1D4OA 3HV2A 3OLQA 4HQ0A 3C3AA 2MR5A 4B6RA 5GJBA 4EA7A 1LFDB 4EEXA 4PGHA 4QOEA 2FW0A 3QPCA 4ALLA 4PZDA 3H4IA 2DBYA 3MAGA 1AMOA 4L50A 4MLDA 4RS3A 1N2SA 4B33A 1FQOA 2JH9A 1EX7A 4XWTA 2QUAA 2LD4A 3D0OA 4PLCA 4WCFB 3L8GA 1GGHA 1ZRHA 2JYYA 1NQOA 1F51E 3NBZC 4X1YB 2WP8J 3AR6A 2BN4A 3CX6A 4L4ZA 4M49A 5F2EA 3W8FA 1R0YA 3MJCA 4NE7A 3EGDB 3AR3A 5KHLB 3DAGA 3KOXA 1VSUA 2KI5A 4Z6KA 4QODA 1UFRA 2D74A 2DUJA 3ECSA 3N3AC 2XMGA 2P2NA 2PUEA 2XCTB 2BTEA 2O2CA 3H83A 3IFSA 1KEPA 5FUQA 2XH8A 3RSCA 3TMAA 2XNDA 2VAPA 3BUSA 4Y9RA 2ET6A 4H1WA 1VBFA 1UC4B 1PNRA 2CYAA 3JVUA 2ZUCA 4NG4A 2P75A 3BHJA 3N70A 3O2JA 4G5HA 1YRLA 4OATA 4Q4LA 1RYDA 4MRAA 1ZJ4A 1G6Q1 4HQOA 3NVMB 4R9UC 3VJLA 1GXSA 3FOFC 3U16A 4BMYA 4ND8A 4MW1A 4BO4A 1GDDA 2X9LA 2XA1A 2XYPA 3AIIA 3LKVA 3DZJA 2V7BA 1NN1A 1MLDA 2HV9A 2P40A 3AF4A 5EJ8A 3DLIA 4NS1A 3R9WA 5BN5A 2W2XA 4EW6A 4UVHA 7GPBA 3VZSA 1PLKA 1NVDA 3VNQA 5K9ZA 1LW7A 4J16C 1ML4A 5D5PA 2VDMB 4KCGA 3ODGA 1VGRA 2CUKA 4FFVA 3NHYA 2IZOA 4K6KA 3U7HB 3QEMB 1A9YA 1ZGGA 2HLDA 1FPMA 4L08A 4QOHA 3E9NA 1GKIA 2QUJA 2FSSA 4R8MA 4GBJA 4BL5A 1ZJYA 4LDPA 1AGPA 1C9JA 1R64A 1W581 4QA9A 4DA7A 2Q1SA 5IKXA 3MJVA 2XF2A 4BMZA 4ZYVA 1NUSA 1VE3A 4WBNA 4IZHA 5E95A 5EIFA 4F12A 4UE6A 4PVDA 3UXYA 4O4HA 4U9UA 1KI8A 2HRCA 4IDQA 1F2TB 4QTTB 4LRQA 1TQ6A 1JJIA 3BWEA 4PCVA 3VVMA 5ILOA 5KTPA 4M7OA 3VTZA 3QTLA 1Q0QA 3GXBA 5EHGA 4LJAA 4NAUA 3WLEA 1QHFA 1PBTA 2CE2X 3F5DA 3GC6A 3IPRA 5SZHB 3P7MA 4O2AA 4PXSA 5IT9A 1ZONA 4NYIR 1JXQA 4A03A 3OEYA 1C3XA 3GBVA 3SP1A 4TLLB 4CUZA 3SGLA 2IH2A 1QVVA 4R3WA 3CPHA 5EZSA 1E18A 1WEHA 2OGSA 2NNWB 1M75A 4JQCA 1V16B 4EPRA 2HTEA 2H8GA 3IBSA 1JJBA 5KVCA 5E7IA 2WE8A 3UN1A 2F4NA 3UKOA 4FMPA 2GAIA 2UZ1A 1EUDB 2LKDA 1D4FA 4CM8A 4MR7B 4U6SA 1R8SA 1NMEA 1TPYA 3U4GA 5JISA 3PA6A 3FMIA 4P54A 1DX6A 3BRWA 2QVGA 4BLOA 5C8VA 4ZO4A 1CDZA 1C4WA 1X7DA 4FFBB 1Z45A 4KQGA 2Q3BA 1CT9A 4DJEC 1KK1A 1XPOA 5H8WA 3A3KA 3SNHA 4RCYA 5IH3A 4FW9A 2J0VA 2P9JA 3C3WA 4UU8A 1AQIA 5ANRB 4YJFA 3HCCA 4MVJH 4E1AA 3HVIA 1IBLB 4JB2A 2YIMA 2R6CA 1IOVA 4N7MA 4QQ8A 4I4LA 1J2UA 3FSYA 2XQFA 1W75A 4M7WA 3O1IC 3BMNB 4OQDA 2XAAA 2I6QA 4Y7CA 5IAAA 4DV5B 3BWYA 2WJIA 2YUIA 4Y2RA 2JGMA 2GSDA 3LYHA 3IAUA 5KAPA 3R7FA 1ZD1A 4CV1A 1TM5E 3H1TA 3E22A 1KYIA 1XVIA 4J07A 3EWNA 2P3LA 2WA2A 2X5KO 4GSKA 4CMEC 3EIWA 4AJIA 3GT4A 4RKQA 2RGAA 3ZJ4A 3UMBA 3Q5DA 2ERWA 3BGDA 1G8MA 1DPGA 2DJIA 2MCFA 1A0OA 4I55F 4A0FA 5SZIA 3S2YA 4DJ5X 1J9EA 1A8QA 2Q3MA 1TM4E 3H5VA 3L18A 4RMIA 1SGRI 2E5FA 1P4GA 4P86A 4QQKA 4AS1A 4JI4B 2WAOA 5LFAA 4KKVA 4MA5A 4R54A 1T9GS 3DHYA 2WOOA 2RONA 5AIAA 1U0HC 2P9TA 2PJZA 2CHQA 3B2EA 3NHJA 2YC2C 4H1VA 4TS4A 2PKEA 1E9FA 1MIOA 1ORRA 2I62A 1C81A 2IXTA 2JIQA 3PT5A 4O2BF 1N2CB 1VZ3A 4TMVA 1N8NA 4PLHA 4DMUB 2VCHA 1W94A 1JAZA 2J3JA 1QRDA 1TKCA 5FUYA 1UC8A 4J0QA 1PWXA 3UV3A 3LDUA 1TJ4A 1CK4A 2CJWA 3AQ4A 3N2EA 2O23A 3QIAA 4UDYX 3VR6A 4C3UA 4E5DA 2VNAA 3JZDA 4KDRA 1PHRA 3DQZA 2YWXA 2JCSA 4HFMA 4R5MA 2B4RO 2MOKA 4TMYA 4FJ2A 2AXEA 4UBNA 2V4ZA 5JCJA 1HMYA 4KREA 3TZKA 1EVJA 5DHAA 3RBAA 3MUOA 1DWPA 3C8UA 1KEKA 5E0OA 1JDBB 3FWNA 3AU8A 1ZH6A 3FPFA 1AA9A 2PRZA 4G4IA 4BJ1A 2CKDA 1DXOA 1LPAB 2MSEB 1DJNA 1DNPA 5KINB 4DDMA 2QX9A 4F2WA 3A2NA 3OQIB 2IY8A 2QXUA 2GZAA 4BFVA 4F6LA 1DEHA 1QDLB 3LX4A 2XB4A 4GWLA 3KQWA 2VF4X 4C2TA 2YHUA 1M7HA 4A1OA 4FNMA 3CLVA 1GKUB 4D6XA 3NJ8A 1VKJA 1THMA 1RRKA 2WI8A 3VC1A 2FUNB 3DYVA 4IR7A 2ZUFA 1Y6RA 4HN9A 2WHEA 4QM6A 2C9OA 3K15A 2XOEA 2WWVD 1TRKA 1E1NA 5DNUA 5FWNA 4NPAA 2IX3A 2IQ5A 2R6AA 1P0MA 3F3SA 4NC9A 4OXYA 3RC9A 5KNCH 4LDQA 3HP7A 4XQCA 5F77A 1QFMA 3HKEB 5TB5A 4WFKA 5DP2A 1BS2A 1NW5A 1GGKA 1I4WA 2K5UA 4GVXA 4Q0MA 2GUWA 5FNVF 3WLSA 3ZCPA 1WZIA 1Y1LA 3R3JA 1B4DA 3DULA 3CNLA 2OC9A 2VT3A 4US0R 4WY5A 4JUBA 3LWNA 2A14A 1E89A 3HLKA 3NHAA 2FPGB 3QW2A 4I9NA 4KTVE 2ZI7A 3F96A 4UCFA 3U3ZA 1MH9A 2EDAA 2JC3A 4QJ5A 1SY7A 1FNDA 2OB2A 4A73A 1GQQA 1YZ3A 3LVQE 4ACAA 4LFBB 4I50F 3SF8B 4UZSA 1H8HD 1WGCA 3UYLA 5E8JA 4LWPA 5EWJB 3N74A 4PLZA 4RE6A 1F4VA 1SXIA 3GJZA 4I14A 3BMQA 3PIRA 4L51A 2W5UA 4BTVA 3PEEA 3OF3A 5BT9A 1VKNA 1VOTA 4CCYB 3EAGA 2F3PA 2I6UA 1E7RA 3TZQA 2ECQA 4TLBA 2CVQA 4EGAA 4CQNA 4AK9A 1SXPA 5EZYA 3WTBA 4CQMA 1LQ2A 2WYUA 4M0MA 4YJKA 1U3DA 2GA9A 3OJCA 5TNXA 1BTOA 2CEKA 3JD1A 3MK31 5LWQA 1B8OA 3K0HA 3FB1A 1OV4A 1QKJA 1UMBB 2YRXA 3JWPA 4Y6SA 1RAFA 2RBEA 5FTWA 1K2WA 1VSQA 1X74A 1QV6A 3TIGA 1MOPA 4C6RA 3HPQA 2VYNA 3IX7A 3G5UA 4ICIA 5CLGA 3GEEA 5FTLA 1JYSA 4H3KB 4K9PA 3DS8A 4OQXA 1I9CA 4PC2A 5K0LA 1KY3A 3HEMA 2GTHA 5L3QB 1E2GA 1C8BA 2R86A 3LVBA 2JCBA 3MMNA 2JIMA 4KPUA 1A1SA 4LYHA 5I4IA 1XZKA 2IZ0A 4HTAA 5CA1F 1V2GA 1KXZA 2X19A 5DT9A 3EDOA 1ZN7A 4FBGA 1NV9A 1D9ZA 1N4DA 5HW0A 4X41A 3MYRA 1JAIA 4WZAB 4ZO8A 1PWYE 4ZHQB 4QICA 3BX1A 1VFPA 3EVDA 3U6BA 3QEKA 4OFZA 1J2EA 2A9FA 2CVHA 1PT6A 1NSFA 1P1IA 1TU4A 1YDGA 1W5SA 1D2GA 1BDJA 1XMSA 2ZAYA 2ZIZA 1XZIA 3D1JA 4C78A 5B4VA 4FQ7A 4LV5B 4EHDA 2IH5A 1GU7A 4FSDA 1F06A 4A6XA 2I71A 2VNIA 4PGFA 5DHSA 1HWYA 1XD2A 4RSRA 5KJ1A 2YMMA 5EEHA 1FDIA 1O5IA 2XRMA 3D81A 3P45A 5L9AA 1X70A 4P3YA 3DZDA 4AQDA 3GAMA 1Y98A 2EX0A 4WLEA 3PNVA 3S29A 2J08A 3A7DA 3FX2A 1V43A 3HMKA 4R1QA 4BNJA 1XKTA 3KLNA 3UFXA 6LDHA 2W6NA 3H0KA 4YC7A 2P91A 2EWWA 1L4FA 4BGDA 1MDBA 1MX1A 3EA4A 2I9PA 3HJAA 3SQOA 3ZWPA 2RIRA 2H8KA 4FYJA 4UXHA 1BUSA 1EK6A 1PLLA 2ZDGA 2ZR7A 3TLAA 3PPVA 4U2CA 1TMYA 1BU8A 4IMJB 4Z1OA 3KDSE 2RH5A 1CQIA 1ESZA 1V41E 3VR5H 3WOVA 2YYZA 2PAAA 4PLTA 3MN1A 3IV6A 1A9OA 2FDRA 4NCXA 3EHEA 3OXFA 1VSVA 2C8KA 1CT4I 2BCEA 2DPLA 2HV8A 1QCZA 3FLAA 1URPA 3E81A 4UHCA 3UW3A 3VJKA 4QT0A 1E92A 3ZWCA 1WCV1 4OLBA 4TRJA 4I5FA 5BR1A 4EF6A 3N7UA 3U5ZB 1ZHOA 4QHSA 4TTPA 3DD5A 2OHOA 5CW2A 3HXPA 4B45A 4JXXA 3W3AD 1GPKA 4OHPA 1A95A 4F5ZA 4GKVA 1ZK2A 1KJIA 1P1BA 2DWCA 1W87A 4PFKA 4LV8B 4S0XA 1Z73A 3WJ2A 3EG9A 1MJBA 4HS4A 3EIHA 2NO5A 1M1NA 1NHWA 2AX3A 1E0DA 2Q5LA 4IKOA 2V7VA 4UUNA 1XTVA 4JJEA 4LE2A 2ZSUA 2ZUSA 1MOSA 2UXBB 1ZCBA 4ZOBA 2E5LB 3USZA 4JODA 5FBQB 1IN5A 4FILA 4FYXA 3RHFA 1M8BA 4YAUA 2R6ZA 3G9XA 2IZ6A 2ZJ7A 1DU4A 3FHOA 3H2BA 4J7AA 4JQOA 3WISA 3ZNNA 2OD7A 1U1IA 1V11A 4LMRA 3GCWA 4ZV4A 2WW8A 4V2IA 4DQLA 3JSAA 2O1WA 5K1ZA 4RQUA 1S01A 9LDBA 4O1MA 3IXLA 3VDUA 4XSHA 3DMTC 4MGHA 4CVNA 4GYWA 4TV9B 1IATA 2K6GA 1BE0A 2WG1A 4FE3A 5JSUA 1D7AA 3H2ZA 3KZNA 3H8WA 1CZLA 3SS9X 2G06A 3OPMA 4OB7A 3PUJA 1N6LA 2A5FA 2V59A 3IA2A 3JRWA 4M54A 4UKDA 3UAYA 5SYNA 1Z17A 2XUHA 1TIHA 4CIWA 2YC4C 5CBKA 4LHZA 1L4BA 3OCUA 2E5WA 2O7RA 3SC6A 3TO6A 1C4XA 3FGZA 3R2JA 3RK0A 4B9AA 3TOZA 1SQ5A 4D5GA 5HZGA 5JSZA 3P0EA 3TIFA 4XR4A 421PA 3NVAA 1CF2O 1C0EA 4CFSA 4F38A 4FHGA 3W9BA 5CTJA 4JN6B 3UJ8A 4EUNA 1RRCA 3GNQA 1MA3A 1A7JA 3OX2A 4ZOEA 1HEVA 3ROMA 1DAMA 4BVKA 2D1SA 3CA8A 4K1XA 4DYHA 2WTEA 2BGLA 3KV1A 1DG9A 4D9MA 2M6RA 1FDWA 1SVUA 3MVEA 5EX3A 4FIZA 1P44A 2J45A 2RC6A 2I80A 2IHVA 2HLPA 3PJGA 3EYWA 1FTQA 3HU5A 3LUBA 4YRDA 3LWZA 3VPBA 4EB3A 4B46A 5H70A 1Y6GA 4BDSA 3OHSX 2QZZA 3E4CA 3CZAA 3GMSA 3KKLA 3I3OA 2VSQA 5EJEA 5DNEA 3KQSA 5TT0A 2C5SA 1E2DA 2WNHA 3L77A 2YWCA 2P0EA 3NWJA 4JUCA 2ICAA 2HNAA 4OQYA 4PXAA 4M0UA 3WP1B 1CDOA 5C31A 3U39A 3KOWA 2Q5CA 2QM7A 3RWMB 1FBNA 1VDDA 4N48A 3THSA 1JIJA 2H16A 1WMDA 1L5MA 2C04A 3AW8A 3IP1A 3NAQA 3WADA 4BEVA 4BNDA 5ESWA 4KX3A 3QX8A 5B1YA 3FB4A 5E2IA 4M89A 1AO3A 5CJJA 1H8ED 2HU2A 1X2EA 4KK4A 3RU9A 2NZUG 3MLEA 3VO1A 1W4ZA 4YH1A 5KIAA 1B26A 5HI7A 2HWKA 3G3EA 4RDHA 3S2FA 2GKOA 1Q0ZA 3WGKA 4ZQGA 5BV1A 1QYIA 1SUWA