2QQ3A

Crystal structure of enoyl-coa hydrates subunit i (gk_2039) other form from geobacillus kaustophilus hta426
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
255
Chain Sequence
b'FVSIAARQEGAVGIIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGRAFAAGADIQEMAKDDPIRLEWLNQFADWDRLSIVKTPMIAAVNGLALGGGFELALSCDLIVASSAAEFGFPEVNLGVMPGAGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSPELLMEETMRLAGRLAEQPPLALRLIKEAVQKAVDYPLYEGMQFERKNFYLLFASEDQKEGMAAFLEKRKPRFQGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase subunit I
publication title Crystal Structure Of Enoyl-CoA Hydrates Subunit I (gk_2039) Other Form From Geobacillus Kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Lyase
total genus 91
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 2qq3A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2qq3A01
4I4ZA 4HC8A 2PG8A 4OMRA 5DU8A 2J5IA 3KTHA 1UYVA 4ELSA 1EF8A 3U9TB 3TT6A 3IAVA 2IEXA 3HINA 2FZSA 2ZL3A 1HZDA 4FN8A 5DUCA 1X0UA 3MYBA 3ISAA 4GHNA 4L8KA 2HW5A 4Q1IA 1HNOA 3GLMA 3DORA 3I47A 2VSUC 4QIIA 2J5GD 4NNQA 3H81A 4FNBA 5E0SA 2F9IA 4L6WA 2J5SA 1UYSA 3T8AA 3IB9A 4Z0MA 4JCQA 1OD4A 4JCTA 1K32A 2X58A 2A7KA 3GF3A 5G1SA 4B3HA 1NZYB 5E0SH 3MOYA 3HRXA 1YG8A 4JSBA 4FZWA 1O8UA 3PEAA 3TVWA 5KJPA 3TLFA 2J5IB 2PPYA 3MT6A 3K50A 4OG1A 2ZL0A 4FB8A 3Q7HA 3QXIA 4MI2A 3TVUA 3K8XA 5DTWA 4JYLA 2WTBA 3P85A 1NZYA 1WDKA 1HNUA 2FW2A 4RYFA 2F9IB 4QIJA 3QWDA 4HNKA 2J5GA 5FUSA 4ASIA 4U0HA 4U0GA 4ZDEA 3TZ3A 3DJAA 3SLLA 2J5II 2VSUE 1Q51A 3BF0A 4RYFH 3H0QA 3PZKA 3Q0GA 1JXZA 2F6QA 4U0GH 5INGA 2Q35A 2ZL4A 3Q0JA 4JJTA 2X24A 1XNWA 2Q2XA 2VSUA 5DZKA 3BPPA 2EJ5A 4FN7A 3R6HA 2VSSE 1SZOA 3P2LA 2ZQRA 5DZKH 3VIVA 4GM2A 3TT7A 5DU4A 2VSUF 4KNPA 3G64A 2VSSA 3H0UA 3PGQA 3NJBA 4JWVA 4ZDCA 3H0SA 3TV5A 4B3IA 2PBPA 1DUBA 4K29A 4EMPA 3ZW9A 3BEZA 2A81A 3KTGA 5CTBA 3ZWCA 3QXZA 4K3WA 3QKAA 2ZL2A 2VSSF 5C90A 2NP9A 4Q0GA 5E0NX 3QMJA 4ZDDA 4IZCA 3R9QA 4RCNA 1PJHA 3H02A 3T3WA 1EY3A 1DCIA 1TG6A 2W3PA 3V5IA 3ZW8A 3MFMA 4EMMA 1N6FA 4F47A 5JBWA 3GMAA 1XX4A 1ON9A 4JFCA 3KQFA 2UZFA 3ZWAA 3FF6A 2F6IA 3HLN1 2QQ3A 3R9SA 1UYTA 1RJNA 4JYJA 5G1QA 2DUBA 3KTKA 5DUFA 4ZDBA 1XO6A 4IZBA 1N6EA 3KTIA 2DEOA 3T88A 2Q34A 4MXIA 4U1AA 1W2XA 3IBBA 2VREA 4OLQA 1WDLA 3LKEA 3H0JA 2VX2A 5C9GA 1SG4A 5G1RA 1XNYA 3LAOA 4NEKA 4FJWD 5DU6A 4I52A 4KD6A 3HP0A 1YG6A 3Q1TA 4DI1A 1TYFA 4K2NA 1WZ8A 2CBYA 3M6NA 1OD2A 3OT6A 3HE2A 4EMLA 3U9SB 4G2RA 4ELXA 3ZWBA 3RSIA 3NJDA 4KWBA 1UYRA 4U19A 3V5EA 5KDRA 3JU1A 4ELWA 3ST9A 4IZDA 3FDUA 3WG5A 1XNVA 1PIXA 4ZDFA 1MJ3A 1N6DA 4FNDA 3TDCA 2ZQQA 4U18A 3R0OA 5IKLB 1Y7OA 2F9YB 4B3JA 1UIYA 1FC9A 4JCRA 3T89A 4YLHA 3GF7A 3P5MA 5CTCA 5DL1A 4WZ8B 3OC7A 3T8BA 2C8TA 4QFEA 4ZU2A 4WCZA 3OMEA 3QK8A 3M6MA 2FBMA 4FZWC 3L3SA 4LK5A 3GKBA 1WDMA 4JCSA 3QREA 1FCFA 3RRVA 2A7SA 3RSTA 3KTJA 3SWXA 3STAA 4JVTA 5JBXA 2GTRA 5INIA 5FIFA 3U9RB 1FC7A 4JOTA 4MOUA 1VRGA 4WYOB 1RJMA 1J7XA 5MGBA 1ON3A 5DTPA 5KDRB 4KPKA 2BZRA 3R9TA 2F9YA 1K39A 2D3TA 5DKPA 3N6RB 4I42A 1EF9A 3PE8A 3TRRA 1Q52A 5INFA 3QYRA 1FC6A 2CE3A
chains in the Genus database with same CATH superfamily
4I4ZA 4HC8A 2PG8A 4OMRA 5DU8A 2J5IA 3KTHA 1UYVA 4ELSA 1EF8A 3U9TB 3TT6A 2YJGA 3IAVA 2IEXA 3HINA 2FZSA 2ZL3A 1HZDA 4FN8A 5DUCA 1X0UA 3IRBA 3MYBA 3AJMA 3ISAA 4GHNA 4L8KA 2HW5A 4Q1IA 1HNOA 3GLMA 3DORA 3I47A 3O4XE 2VSUC 4QIIA 2J5GD 4NNQA 3H81A 4FNBA 5E0SA 2F9IA 4L6WA 2J5SA 1UYSA 3T8AA 3IB9A 3ADDA 4Z0MA 4JCQA 1OD4A 4JCTA 1K32A 2X58A 2A7KA 3GF3A 5G1SA 4B3HA 1NZYB 5E0SH 3L8IA 3MOYA 3HRXA 1YG8A 4JSBA 4FZWA 1O8UA 3PEAA 3TVWA 5KJPA 3TLFA 2J5IB 2PPYA 3MT6A 3ADCA 3K50A 4OG1A 2ZL0A 4FB8A 3Q7HA 3QXIA 4MI2A 3TVUA 3K8XA 5DTWA 4JYLA 4NARA 2WTBA 3P85A 1Y64B 1NZYA 1WDKA 1HNUA 2FW2A 4RYFA 2F9IB 4HDTA 4QIJA 3QWDA 4HNKA 2J5GA 5FUSA 4ASIA 4U0HA 4U0GA 4ZDEA 3TZ3A 3DJAA 3SLLA 2J5II 2VSUE 1Q51A 3BF0A 4RYFH 3H0QA 3PZKA 3Q0GA 3A4LA 1JXZA 2F6QA 4U0GH 5INGA 2Q35A 2ZL4A 3Q0JA 4JJTA 2X24A 1XNWA 2Q2XA 2VSUA 5DZKA 3BPPA 2EJ5A 4FN7A 3RQFA 3R6HA 2VSSE 1SZOA 3P2LA 2ZQRA 5DZKH 3VIVA 4GM2A 3TT7A 5DU4A 2VSUF 4KNPA 3G64A 2VSSA 3H0UA 3PGQA 3NJBA 4JWVA 4ZDCA 3H0SA 3TV5A 4B3IA 2PBPA 1DUBA 4K29A 4EMPA 3ZW9A 3BEZA 2A81A 3KTGA 5CTBA 3ZWCA 3QXZA 4K3WA 3QKAA 2ZL2A 2VSSF 5C90A 2NP9A 4Q0GA 5E0NX 3QMJA 1UX5A 4ZDDA 4IZCA 3R9QA 4RCNA 1PJHA 3H02A 3T3WA 1EY3A 1DCIA 1TG6A 2W3PA 3V5IA 3ZW8A 3MFMA 4EMMA 1N6FA 4F47A 5JBWA 3GMAA 1XX4A 1ON9A 4JFCA 3KQFA 2UZFA 3ZWAA 3FF6A 2F6IA 3HLN1 2QQ3A 3W8IB 3R9SA 1UYTA 1RJNA 4JYJA 5G1QA 2DUBA 3KTKA 5DUFA 4ZDBA 1XO6A 4IZBA 1N6EA 3KTIA 2DEOA 3T88A 2Q34A 4MXIA 3A4MA 4U1AA 1W2XA 3IBBA 2VREA 4OLQA 1WDLA 3LKEA 3H0JA 2VX2A 5C9GA 1SG4A 5G1RA 1XNYA 5HUQA 3LAOA 4NEKA 4FJWD 5DU6A 4I52A 4KD6A 3HP0A 1YG6A 3Q1TA 4DI1A 1TYFA 4K2NA 1WZ8A 2CBYA 3M6NA 1OD2A 3OT6A 3HE2A 4EMLA 3ADBA 3U9SB 4G2RA 4ELXA 3ZWBA 3RSIA 3NJDA 4GEHB 4KWBA 4J2UA 1UYRA 4U19A 3V5EA 5KDRA 3JU1A 4ELWA 3ST9A 4IZDA 3FDUA 3WG5A 1XNVA 1PIXA 4ZDFA 1MJ3A 1N6DA 4FNDA 3TDCA 2ZQQA 4U18A 3R0OA 5IKLB 1Y7OA 3A4NA 2F9YB 4B3JA 1UIYA 1FC9A 4JCRA 3T89A 4YLHA 3GF7A 3P5MA 5CTCA 5DL1A 4WZ8B 3OC7A 3T8BA 2C8TA 4QFEA 4ZU2A 4WCZA 3OMEA 3QK8A 3M6MA 3W8HB 2FBMA 4FZWC 3L3SA 4LK5A 3GKBA 1WDMA 4JCSA 3BPTA 3QREA 1FCFA 3RRVA 2A7SA 3RSTA 3KTJA 3SWXA 2P63A 4JVTA 3STAA 5JBXA 2GTRA 5INIA 5FIFA 3U9RB 1FC7A 4JOTA 4MOUA 3AM1A 1VRGA 4WYOB 1RJMA 1J7XA 5MGBA 3L8JA 1ON3A 5DTPA 5KDRB 4KPKA 2BZRA 3R9TA 2F9YA 1K39A 2D3TA 5DKPA 3N6RB 1UX4A 4I42A 1EF9A 3PE8A 3RQGA 3TRRA 1Q52A 5INFA 3RQEA 3QYRA 1FC6A 2CE3A
chains in the Genus database with same CATH topology
4I4ZA 4HC8A 2PG8A 4OMRA 5DU8A 2J5IA 3KTHA 1UYVA 4ELSA 1EF8A 3U9TB 3TT6A 2YJGA 3IAVA 2IEXA 3HINA 2FZSA 2ZL3A 1HZDA 4FN8A 5DUCA 1X0UA 3MYBA 3ISAA 4GHNA 4L8KA 2HW5A 4Q1IA 1HNOA 3GLMA 3DORA 3I47A 2VSUC 4QIIA 2J5GD 4NNQA 3H81A 4FNBA 5E0SA 2F9IA 4L6WA 2J5SA 1UYSA 3T8AA 3IB9A 4Z0MA 4JCQA 1OD4A 4JCTA 1K32A 2X58A 2A7KA 3GF3A 5G1SA 4B3HA 1NZYB 5E0SH 3MOYA 3HRXA 1YG8A 4JSBA 4FZWA 1O8UA 3PEAA 3TVWA 5KJPA 3TLFA 2J5IB 2PPYA 3MT6A 3K50A 4OG1A 2ZL0A 4FB8A 3Q7HA 3QXIA 4MI2A 3TVUA 3K8XA 5DTWA 4JYLA 4NARA 2WTBA 3P85A 1NZYA 1WDKA 1HNUA 2FW2A 4RYFA 2F9IB 4HDTA 4QIJA 3QWDA 4HNKA 2J5GA 5FUSA 4ASIA 4U0HA 4U0GA 4ZDEA 3TZ3A 3DJAA 3SLLA 2J5II 2VSUE 1Q51A 3BF0A 4RYFH 3H0QA 3PZKA 3Q0GA 1JXZA 2F6QA 4U0GH 5INGA 2Q35A 2ZL4A 3Q0JA 4JJTA 2X24A 1XNWA 2Q2XA 2VSUA 5DZKA 3BPPA 2EJ5A 4FN7A 3R6HA 2VSSE 1SZOA 3P2LA 2ZQRA 5DZKH 3VIVA 4GM2A 3TT7A 5DU4A 2VSUF 4KNPA 3G64A 2VSSA 3H0UA 3PGQA 3NJBA 4JWVA 4ZDCA 3H0SA 3TV5A 4B3IA 2PBPA 1DUBA 4K29A 4EMPA 3ZW9A 3BEZA 2A81A 3KTGA 5CTBA 3ZWCA 3QXZA 4K3WA 3QKAA 2ZL2A 2VSSF 5C90A 2NP9A 4Q0GA 5E0NX 3QMJA 4ZDDA 4IZCA 3R9QA 4RCNA 1PJHA 3H02A 3T3WA 1EY3A 1DCIA 1TG6A 2W3PA 3V5IA 3ZW8A 3MFMA 4EMMA 1N6FA 4F47A 5JBWA 3GMAA 1XX4A 1ON9A 4JFCA 3KQFA 2UZFA 3ZWAA 3FF6A 2F6IA 3HLN1 2QQ3A 3R9SA 1UYTA 1RJNA 4JYJA 5G1QA 2DUBA 3KTKA 5DUFA 4ZDBA 1XO6A 4IZBA 1N6EA 3KTIA 2DEOA 3T88A 2Q34A 4MXIA 4U1AA 1W2XA 3IBBA 2VREA 4OLQA 1WDLA 3LKEA 3H0JA 2VX2A 5C9GA 1SG4A 5G1RA 1XNYA 5HUQA 3LAOA 4NEKA 4FJWD 5DU6A 4I52A 4KD6A 3HP0A 1YG6A 3Q1TA 4DI1A 1TYFA 4K2NA 1WZ8A 2CBYA 3M6NA 1OD2A 3OT6A 3HE2A 4EMLA 3U9SB 4G2RA 4ELXA 3ZWBA 3RSIA 3NJDA 4KWBA 4J2UA 1UYRA 4U19A 3V5EA 5KDRA 3JU1A 4ELWA 3ST9A 4IZDA 3FDUA 3WG5A 1XNVA 1PIXA 4ZDFA 1MJ3A 1N6DA 4FNDA 3TDCA 2ZQQA 4U18A 3R0OA 5IKLB 1Y7OA 2F9YB 4B3JA 1UIYA 1FC9A 4JCRA 3T89A 4YLHA 3GF7A 3P5MA 5CTCA 5DL1A 4WZ8B 3OC7A 3T8BA 2C8TA 4QFEA 4ZU2A 4WCZA 3OMEA 3QK8A 3M6MA 2FBMA 4FZWC 3L3SA 4LK5A 3GKBA 1WDMA 4JCSA 3BPTA 3QREA 1FCFA 3RRVA 2A7SA 3RSTA 3KTJA 3SWXA 3STAA 4JVTA 5JBXA 2GTRA 5INIA 5FIFA 3U9RB 1FC7A 4JOTA 4MOUA 1VRGA 4WYOB 1RJMA 1J7XA 5MGBA 1ON3A 5DTPA 5KDRB 4KPKA 2BZRA 3R9TA 2F9YA 1K39A 2D3TA 5DKPA 3N6RB 4I42A 1EF9A 3PE8A 3TRRA 1Q52A 5INFA 3QYRA 1FC6A 2CE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I4Z A;  4HC8 A;  2PG8 A;  4OMR A;  5DU8 A;  2J5I A;  3KTH A;  1UYV A;  4ELS A;  1EF8 A;  3U9T B;  3TT6 A;  3IAV A;  2IEX A;  3HIN A;  2FZS A;  2ZL3 A;  1HZD A;  4FN8 A;  5DUC A;  1X0U A;  3MYB A;  3ISA A;  4GHN A;  4L8K A;  2HW5 A;  4Q1I A;  1HNO A;  3GLM A;  3DOR A;  3I47 A;  2VSU C;  4QII A;  2J5G D;  4NNQ A;  3H81 A;  4FNB A;  5E0S A;  2F9I A;  4L6W A;  2J5S A;  1UYS A;  3T8A A;  3IB9 A;  4Z0M A;  4JCQ A;  1OD4 A;  4JCT A;  1K32 A;  2X58 A;  2A7K A;  3GF3 A;  5G1S A;  4B3H A;  1NZY B;  5E0S H;  3MOY A;  3HRX A;  1YG8 A;  4JSB A;  4FZW A;  1O8U A;  3PEA A;  3TVW A;  5KJP A;  3TLF A;  2J5I B;  2PPY A;  3MT6 A;  3K50 A;  4OG1 A;  2ZL0 A;  4FB8 A;  3Q7H A;  3QXI A;  4MI2 A;  3TVU A;  3K8X A;  5DTW A;  4JYL A;  2WTB A;  3P85 A;  1NZY A;  1WDK A;  1HNU A;  2FW2 A;  4RYF A;  2F9I B;  4QIJ A;  3QWD A;  4HNK A;  2J5G A;  5FUS A;  4ASI A;  4U0H A;  4U0G A;  4ZDE A;  3TZ3 A;  3DJA A;  3SLL A;  2J5I I;  2VSU E;  1Q51 A;  3BF0 A;  4RYF H;  3H0Q A;  3PZK A;  3Q0G A;  1JXZ A;  2F6Q A;  4U0G H;  5ING A;  2Q35 A;  2ZL4 A;  3Q0J A;  4JJT A;  2X24 A;  1XNW A;  2Q2X A;  2VSU A;  5DZK A;  3BPP A;  2EJ5 A;  4FN7 A;  3R6H A;  2VSS E;  1SZO A;  3P2L A;  2ZQR A;  5DZK H;  3VIV A;  4GM2 A;  3TT7 A;  5DU4 A;  2VSU F;  4KNP A;  3G64 A;  2VSS A;  3H0U A;  3PGQ A;  3NJB A;  4JWV A;  4ZDC A;  3H0S A;  3TV5 A;  4B3I A;  2PBP A;  1DUB A;  4K29 A;  4EMP A;  3ZW9 A;  3BEZ A;  2A81 A;  3KTG A;  5CTB A;  3ZWC A;  3QXZ A;  4K3W A;  3QKA A;  2ZL2 A;  2VSS F;  5C90 A;  2NP9 A;  4Q0G A;  5E0N X;  3QMJ A;  4ZDD A;  4IZC A;  3R9Q A;  4RCN A;  1PJH A;  3H02 A;  3T3W A;  1EY3 A;  1DCI A;  1TG6 A;  2W3P A;  3V5I A;  3ZW8 A;  3MFM A;  4EMM A;  1N6F A;  4F47 A;  5JBW A;  3GMA A;  1XX4 A;  1ON9 A;  4JFC A;  3KQF A;  2UZF A;  3ZWA A;  3FF6 A;  2F6I A;  3HLN 1;  2QQ3 A;  3R9S A;  1UYT A;  1RJN A;  4JYJ A;  5G1Q A;  2DUB A;  3KTK A;  5DUF A;  4ZDB A;  1XO6 A;  4IZB A;  1N6E A;  3KTI A;  2DEO A;  3T88 A;  2Q34 A;  4MXI A;  4U1A A;  1W2X A;  3IBB A;  2VRE A;  4OLQ A;  1WDL A;  3LKE A;  3H0J A;  2VX2 A;  5C9G A;  1SG4 A;  5G1R A;  1XNY A;  3LAO A;  4NEK A;  4FJW D;  5DU6 A;  4I52 A;  4KD6 A;  3HP0 A;  1YG6 A;  3Q1T A;  4DI1 A;  1TYF A;  4K2N A;  1WZ8 A;  2CBY A;  3M6N A;  1OD2 A;  3OT6 A;  3HE2 A;  4EML A;  3U9S B;  4G2R A;  4ELX A;  3ZWB A;  3RSI A;  3NJD A;  4KWB A;  1UYR A;  4U19 A;  3V5E A;  5KDR A;  3JU1 A;  4ELW A;  3ST9 A;  4IZD A;  3FDU A;  3WG5 A;  1XNV A;  1PIX A;  4ZDF A;  1MJ3 A;  1N6D A;  4FND A;  3TDC A;  2ZQQ A;  4U18 A;  3R0O A;  5IKL B;  1Y7O A;  2F9Y B;  4B3J A;  1UIY A;  1FC9 A;  4JCR A;  3T89 A;  4YLH A;  3GF7 A;  3P5M A;  5CTC A;  5DL1 A;  4WZ8 B;  3OC7 A;  3T8B A;  2C8T A;  4QFE A;  4ZU2 A;  4WCZ A;  3OME A;  3QK8 A;  3M6M A;  2FBM A;  4FZW C;  3L3S A;  4LK5 A;  3GKB A;  1WDM A;  4JCS A;  3QRE A;  1FCF A;  3RRV A;  2A7S A;  3RST A;  3KTJ A;  3SWX A;  3STA A;  4JVT A;  5JBX A;  2GTR A;  5INI A;  5FIF A;  3U9R B;  1FC7 A;  4JOT A;  4MOU A;  1VRG A;  4WYO B;  1RJM A;  1J7X A;  5MGB A;  1ON3 A;  5DTP A;  5KDR B;  4KPK A;  2BZR A;  3R9T A;  2F9Y A;  1K39 A;  2D3T A;  5DKP A;  3N6R B;  4I42 A;  1EF9 A;  3PE8 A;  3TRR A;  1Q52 A;  5INF A;  3QYR A;  1FC6 A;  2CE3 A; 
#chains in the Genus database with same CATH topology
 4I4Z A;  4HC8 A;  2PG8 A;  4OMR A;  5DU8 A;  2J5I A;  3KTH A;  1UYV A;  4ELS A;  1EF8 A;  3U9T B;  3TT6 A;  2YJG A;  3IAV A;  2IEX A;  3HIN A;  2FZS A;  2ZL3 A;  1HZD A;  4FN8 A;  5DUC A;  1X0U A;  3IRB A;  3MYB A;  3AJM A;  3ISA A;  4GHN A;  4L8K A;  2HW5 A;  4Q1I A;  1HNO A;  3GLM A;  3DOR A;  3I47 A;  3O4X E;  2VSU C;  4QII A;  2J5G D;  4NNQ A;  3H81 A;  4FNB A;  5E0S A;  2F9I A;  4L6W A;  2J5S A;  1UYS A;  3T8A A;  3IB9 A;  3ADD A;  4Z0M A;  4JCQ A;  1OD4 A;  4JCT A;  1K32 A;  2X58 A;  2A7K A;  3GF3 A;  5G1S A;  4B3H A;  1NZY B;  5E0S H;  3L8I A;  3MOY A;  3HRX A;  1YG8 A;  4JSB A;  4FZW A;  1O8U A;  3PEA A;  3TVW A;  5KJP A;  3TLF A;  2J5I B;  2PPY A;  3MT6 A;  3ADC A;  3K50 A;  4OG1 A;  2ZL0 A;  4FB8 A;  3Q7H A;  3QXI A;  4MI2 A;  3TVU A;  3K8X A;  5DTW A;  4JYL A;  4NAR A;  2WTB A;  3P85 A;  1Y64 B;  1NZY A;  1WDK A;  1HNU A;  2FW2 A;  4RYF A;  2F9I B;  4HDT A;  4QIJ A;  3QWD A;  4HNK A;  2J5G A;  5FUS A;  4ASI A;  4U0H A;  4U0G A;  4ZDE A;  3TZ3 A;  3DJA A;  3SLL A;  2J5I I;  2VSU E;  1Q51 A;  3BF0 A;  4RYF H;  3H0Q A;  3PZK A;  3Q0G A;  3A4L A;  1JXZ A;  2F6Q A;  4U0G H;  5ING A;  2Q35 A;  2ZL4 A;  3Q0J A;  4JJT A;  2X24 A;  1XNW A;  2Q2X A;  2VSU A;  5DZK A;  3BPP A;  2EJ5 A;  4FN7 A;  3RQF A;  3R6H A;  2VSS E;  1SZO A;  3P2L A;  2ZQR A;  5DZK H;  3VIV A;  4GM2 A;  3TT7 A;  5DU4 A;  2VSU F;  4KNP A;  3G64 A;  2VSS A;  3H0U A;  3PGQ A;  3NJB A;  4JWV A;  4ZDC A;  3H0S A;  3TV5 A;  4B3I A;  2PBP A;  1DUB A;  4K29 A;  4EMP A;  3ZW9 A;  3BEZ A;  2A81 A;  3KTG A;  5CTB A;  3ZWC A;  3QXZ A;  4K3W A;  3QKA A;  2ZL2 A;  2VSS F;  5C90 A;  2NP9 A;  4Q0G A;  5E0N X;  3QMJ A;  1UX5 A;  4ZDD A;  4IZC A;  3R9Q A;  4RCN A;  1PJH A;  3H02 A;  3T3W A;  1EY3 A;  1DCI A;  1TG6 A;  2W3P A;  3V5I A;  3ZW8 A;  3MFM A;  4EMM A;  1N6F A;  4F47 A;  5JBW A;  3GMA A;  1XX4 A;  1ON9 A;  4JFC A;  3KQF A;  2UZF A;  3ZWA A;  3FF6 A;  2F6I A;  3HLN 1;  2QQ3 A;  3W8I B;  3R9S A;  1UYT A;  1RJN A;  4JYJ A;  5G1Q A;  2DUB A;  3KTK A;  5DUF A;  4ZDB A;  1XO6 A;  4IZB A;  1N6E A;  3KTI A;  2DEO A;  3T88 A;  2Q34 A;  4MXI A;  3A4M A;  4U1A A;  1W2X A;  3IBB A;  2VRE A;  4OLQ A;  1WDL A;  3LKE A;  3H0J A;  2VX2 A;  5C9G A;  1SG4 A;  5G1R A;  1XNY A;  5HUQ A;  3LAO A;  4NEK A;  4FJW D;  5DU6 A;  4I52 A;  4KD6 A;  3HP0 A;  1YG6 A;  3Q1T A;  4DI1 A;  1TYF A;  4K2N A;  1WZ8 A;  2CBY A;  3M6N A;  1OD2 A;  3OT6 A;  3HE2 A;  4EML A;  3ADB A;  3U9S B;  4G2R A;  4ELX A;  3ZWB A;  3RSI A;  3NJD A;  4GEH B;  4KWB A;  4J2U A;  1UYR A;  4U19 A;  3V5E A;  5KDR A;  3JU1 A;  4ELW A;  3ST9 A;  4IZD A;  3FDU A;  3WG5 A;  1XNV A;  1PIX A;  4ZDF A;  1MJ3 A;  1N6D A;  4FND A;  3TDC A;  2ZQQ A;  4U18 A;  3R0O A;  5IKL B;  1Y7O A;  3A4N A;  2F9Y B;  4B3J A;  1UIY A;  1FC9 A;  4JCR A;  3T89 A;  4YLH A;  3GF7 A;  3P5M A;  5CTC A;  5DL1 A;  4WZ8 B;  3OC7 A;  3T8B A;  2C8T A;  4QFE A;  4ZU2 A;  4WCZ A;  3OME A;  3QK8 A;  3M6M A;  3W8H B;  2FBM A;  4FZW C;  3L3S A;  4LK5 A;  3GKB A;  1WDM A;  4JCS A;  3BPT A;  3QRE A;  1FCF A;  3RRV A;  2A7S A;  3RST A;  3KTJ A;  3SWX A;  2P63 A;  4JVT A;  3STA A;  5JBX A;  2GTR A;  5INI A;  5FIF A;  3U9R B;  1FC7 A;  4JOT A;  4MOU A;  3AM1 A;  1VRG A;  4WYO B;  1RJM A;  1J7X A;  5MGB A;  3L8J A;  1ON3 A;  5DTP A;  5KDR B;  4KPK A;  2BZR A;  3R9T A;  2F9Y A;  1K39 A;  2D3T A;  5DKP A;  3N6R B;  1UX4 A;  4I42 A;  1EF9 A;  3PE8 A;  3RQG A;  3TRR A;  1Q52 A;  5INF A;  3RQE A;  3QYR A;  1FC6 A;  2CE3 A; 
#chains in the Genus database with same CATH homology
 4I4Z A;  4HC8 A;  2PG8 A;  4OMR A;  5DU8 A;  2J5I A;  3KTH A;  1UYV A;  4ELS A;  1EF8 A;  3U9T B;  3TT6 A;  2YJG A;  3IAV A;  2IEX A;  3HIN A;  2FZS A;  2ZL3 A;  1HZD A;  4FN8 A;  5DUC A;  1X0U A;  3MYB A;  3ISA A;  4GHN A;  4L8K A;  2HW5 A;  4Q1I A;  1HNO A;  3GLM A;  3DOR A;  3I47 A;  2VSU C;  4QII A;  2J5G D;  4NNQ A;  3H81 A;  4FNB A;  5E0S A;  2F9I A;  4L6W A;  2J5S A;  1UYS A;  3T8A A;  3IB9 A;  4Z0M A;  4JCQ A;  1OD4 A;  4JCT A;  1K32 A;  2X58 A;  2A7K A;  3GF3 A;  5G1S A;  4B3H A;  1NZY B;  5E0S H;  3MOY A;  3HRX A;  1YG8 A;  4JSB A;  4FZW A;  1O8U A;  3PEA A;  3TVW A;  5KJP A;  3TLF A;  2J5I B;  2PPY A;  3MT6 A;  3K50 A;  4OG1 A;  2ZL0 A;  4FB8 A;  3Q7H A;  3QXI A;  4MI2 A;  3TVU A;  3K8X A;  5DTW A;  4JYL A;  4NAR A;  2WTB A;  3P85 A;  1NZY A;  1WDK A;  1HNU A;  2FW2 A;  4RYF A;  2F9I B;  4HDT A;  4QIJ A;  3QWD A;  4HNK A;  2J5G A;  5FUS A;  4ASI A;  4U0H A;  4U0G A;  4ZDE A;  3TZ3 A;  3DJA A;  3SLL A;  2J5I I;  2VSU E;  1Q51 A;  3BF0 A;  4RYF H;  3H0Q A;  3PZK A;  3Q0G A;  1JXZ A;  2F6Q A;  4U0G H;  5ING A;  2Q35 A;  2ZL4 A;  3Q0J A;  4JJT A;  2X24 A;  1XNW A;  2Q2X A;  2VSU A;  5DZK A;  3BPP A;  2EJ5 A;  4FN7 A;  3R6H A;  2VSS E;  1SZO A;  3P2L A;  2ZQR A;  5DZK H;  3VIV A;  4GM2 A;  3TT7 A;  5DU4 A;  2VSU F;  4KNP A;  3G64 A;  2VSS A;  3H0U A;  3PGQ A;  3NJB A;  4JWV A;  4ZDC A;  3H0S A;  3TV5 A;  4B3I A;  2PBP A;  1DUB A;  4K29 A;  4EMP A;  3ZW9 A;  3BEZ A;  2A81 A;  3KTG A;  5CTB A;  3ZWC A;  3QXZ A;  4K3W A;  3QKA A;  2ZL2 A;  2VSS F;  5C90 A;  2NP9 A;  4Q0G A;  5E0N X;  3QMJ A;  4ZDD A;  4IZC A;  3R9Q A;  4RCN A;  1PJH A;  3H02 A;  3T3W A;  1EY3 A;  1DCI A;  1TG6 A;  2W3P A;  3V5I A;  3ZW8 A;  3MFM A;  4EMM A;  1N6F A;  4F47 A;  5JBW A;  3GMA A;  1XX4 A;  1ON9 A;  4JFC A;  3KQF A;  2UZF A;  3ZWA A;  3FF6 A;  2F6I A;  3HLN 1;  2QQ3 A;  3R9S A;  1UYT A;  1RJN A;  4JYJ A;  5G1Q A;  2DUB A;  3KTK A;  5DUF A;  4ZDB A;  1XO6 A;  4IZB A;  1N6E A;  3KTI A;  2DEO A;  3T88 A;  2Q34 A;  4MXI A;  4U1A A;  1W2X A;  3IBB A;  2VRE A;  4OLQ A;  1WDL A;  3LKE A;  3H0J A;  2VX2 A;  5C9G A;  1SG4 A;  5G1R A;  1XNY A;  5HUQ A;  3LAO A;  4NEK A;  4FJW D;  5DU6 A;  4I52 A;  4KD6 A;  3HP0 A;  1YG6 A;  3Q1T A;  4DI1 A;  1TYF A;  4K2N A;  1WZ8 A;  2CBY A;  3M6N A;  1OD2 A;  3OT6 A;  3HE2 A;  4EML A;  3U9S B;  4G2R A;  4ELX A;  3ZWB A;  3RSI A;  3NJD A;  4KWB A;  4J2U A;  1UYR A;  4U19 A;  3V5E A;  5KDR A;  3JU1 A;  4ELW A;  3ST9 A;  4IZD A;  3FDU A;  3WG5 A;  1XNV A;  1PIX A;  4ZDF A;  1MJ3 A;  1N6D A;  4FND A;  3TDC A;  2ZQQ A;  4U18 A;  3R0O A;  5IKL B;  1Y7O A;  2F9Y B;  4B3J A;  1UIY A;  1FC9 A;  4JCR A;  3T89 A;  4YLH A;  3GF7 A;  3P5M A;  5CTC A;  5DL1 A;  4WZ8 B;  3OC7 A;  3T8B A;  2C8T A;  4QFE A;  4ZU2 A;  4WCZ A;  3OME A;  3QK8 A;  3M6M A;  2FBM A;  4FZW C;  3L3S A;  4LK5 A;  3GKB A;  1WDM A;  4JCS A;  3BPT A;  3QRE A;  1FCF A;  3RRV A;  2A7S A;  3RST A;  3KTJ A;  3SWX A;  3STA A;  4JVT A;  5JBX A;  2GTR A;  5INI A;  5FIF A;  3U9R B;  1FC7 A;  4JOT A;  4MOU A;  1VRG A;  4WYO B;  1RJM A;  1J7X A;  5MGB A;  1ON3 A;  5DTP A;  5KDR B;  4KPK A;  2BZR A;  3R9T A;  2F9Y A;  1K39 A;  2D3T A;  5DKP A;  3N6R B;  4I42 A;  1EF9 A;  3PE8 A;  3TRR A;  1Q52 A;  5INF A;  3QYR A;  1FC6 A;  2CE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...