2QQ3A

Crystal structure of enoyl-coa hydrates subunit i (gk_2039) other form from geobacillus kaustophilus hta426
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
255
Chain Sequence
FVSIAARQEGAVGIIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGRAFAAGADIQEMAKDDPIRLEWLNQFADWDRLSIVKTPMIAAVNGLALGGGFELALSCDLIVASSAAEFGFPEVNLGVMPGAGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSPELLMEETMRLAGRLAEQPPLALRLIKEAVQKAVDYPLYEGMQFERKNFYLLFASEDQKEGMAAFLEKRKPRFQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Enoyl-CoA Hydrates Subunit I (gk_2039) Other Form From Geobacillus Kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Lyase
molecule keywords Enoyl-CoA hydratase subunit I
total genus 91
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 2qq3A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2qq3A01
3QYRA 3H81A 3GF3A 5CTBA 1EF9A 3TVUA 2VX2A 1FC6A 1K32A 4ELSA 1WDKA 3QXIA 4RYFH 3KTIA 3TVWA 2ZL0A 4U0GH 2A81A 4JFCA 1UYSA 3L3SA 2VSUC 2VSSA 3KTJA 3TLFA 3TV5A 4ZDBA 1JXZA 4OLQA 5FUSA 1DCIA 4ZDDA 3Q0GA 1NZYA 1FC9A 2ZQRA 3R9QA 1N6DA 5G1RA 4JYLA 4ELXA 4JWVA 5KJPA 4QFEA 1HNOA 3KTGA 1PIXA 3QREA 1MJ3A 2EJ5A 4F47A 2Q34A 3TT7A 3GMAA 2Q2XA 1UIYA 3T3WA 1YG8A 3GF7A 4KD6A 3PE8A 4OMRA 4I52A 1J7XA 4FN7A 2QQ3A 3VIVA 3P2LA 4GM2A 4OG1A 3BPPA 3IAVA 1EY3A 3U9SB 1FC7A 2W3PA 4IZBA 4FB8A 3H0JA 4K2NA 3RRVA 2VSUF 4ZU2A 4WCZA 3QK8A 1XNWA 5DZKH 4JOTA 5E0SA 3MYBA 1ON3A 3IBBA 4G2RA 5C90A 5MGBA 1TYFA 2F9YA 3U9RB 2VSSE 1DUBA 4JCRA 3GLMA 4L8KA 5DZKA 3BF0A 1RJNA 4JCTA 3ZWBA 4NEKA 4MI2A 4IZCA 4I42A 3SLLA 3LAOA 5DU8A 3P85A 5E0NX 3TZ3A 3ZW8A 4JJTA 2WTBA 3KTHA 3DJAA 4WZ8B 3ST9A 3FDUA 5C9GA 4FZWA 3H02A 4JCQA 1RJMA 4HC8A 2X58A 3K50A 1K39A 3ISAA 5G1QA 4Q0GA 4KWBA 5E0SH 2VSSF 2IEXA 3PZKA 5INGA 4B3IA 3NJDA 1UYRA 2CE3A 1ON9A 1OD4A 1X0UA 4ZDEA 4YLHA 3QMJA 2F9IB 2PPYA 3LKEA 3TT6A 5CTCA 4QIIA 2J5GD 3HLN1 4FN8A 1EF8A 4JYJA 4KNPA 2J5II 2X24A 4NNQA 3KQFA 4QIJA 4U1AA 5DL1A 4EMPA 4U0GA 4JVTA 3T8BA 3H0QA 3NJBA 3QKAA 5INIA 1XX4A 2FBMA 5DUFA 3I47A 4FJWD 4ELWA 2J5SA 4JSBA 4ZDCA 3H0SA 4LK5A 2ZQQA 4I4ZA 5DTPA 4KPKA 5INFA 1W2XA 2ZL3A 5KDRB 3KTKA 1SZOA 5DU6A 1HZDA 3BEZA 2BZRA 5JBWA 3ZW9A 1UYVA 3K8XA 2F9IA 4FNBA 3PGQA 3OMEA 2UZFA 3H0UA 4WYOB 1OD2A 4IZDA 4EMMA 3R9SA 3WG5A 4B3JA 2VSUE 2D3TA 4FZWC 3RSTA 4ZDFA 3ZWAA 4B3HA 3QXZA 4JCSA 4K3WA 3OT6A 3MOYA 3MT6A 2ZL4A 2A7KA 2NP9A 3JU1A 3GKBA 5DU4A 2F6QA 2C8TA 3Q1TA 2VREA 4Z0MA 5DUCA 2F6IA 3V5EA 2F9YB 2DUBA 4GHNA 3ZWCA 5FIFA 3DORA 3G64A 2PG8A 1HNUA 3HE2A 1Y7OA 3RSIA 1WZ8A 1YG6A 3R9TA 3MFMA 1NZYB 1Q51A 3QWDA 1XNVA 1PJHA 4L6WA 4FNDA 3M6NA 2J5GA 5DKPA 3FF6A 3T8AA 1FCFA 1O8UA 3N6RB 3P5MA 5DTWA 3V5IA 3R6HA 1WDMA 5KDRA 4Q1IA 4U18A 1SG4A 3HRXA 3HINA 1XNYA 3M6MA 2Q35A 3STAA 2J5IB 3HP0A 2A7SA 4RCNA 1TG6A 4DI1A 2HW5A 3R0OA 1UYTA 4U0HA 4MOUA 5G1SA 2J5IA 3TDCA 1VRGA 2PBPA 3PEAA 4ASIA 3Q0JA 1Q52A 3IB9A 4HNKA 2GTRA 3SWXA 3T89A 2ZL2A 3U9TB 1WDLA 4EMLA 4RYFA 1N6FA 1XO6A 5JBXA 4K29A 4MXIA 5IKLB 2VSUA 1N6EA 4U19A 2CBYA 3Q7HA 3TRRA 2FW2A 3T88A 3OC7A 2FZSA 2DEOA
chains in the Genus database with same CATH superfamily
3QYRA 3H81A 3GF3A 5CTBA 1EF9A 3TVUA 2VX2A 1FC6A 1K32A 4ELSA 1WDKA 3QXIA 4RYFH 3KTIA 3TVWA 2ZL0A 4U0GH 2A81A 4JFCA 1UYSA 3L3SA 2VSUC 2VSSA 3KTJA 3TLFA 3TV5A 4ZDBA 1JXZA 4OLQA 5FUSA 1DCIA 4ZDDA 3Q0GA 3L8JA 1NZYA 1FC9A 2ZQRA 4J2UA 3R9QA 1N6DA 5G1RA 4JYLA 3ADDA 4ELXA 4JWVA 5KJPA 4QFEA 1HNOA 3KTGA 3W8IB 1PIXA 3QREA 1MJ3A 2EJ5A 4F47A 2Q34A 3TT7A 3GMAA 2Q2XA 1UIYA 3T3WA 4GEHB 1YG8A 3GF7A 4KD6A 3PE8A 4OMRA 4I52A 1J7XA 4FN7A 2QQ3A 3VIVA 3RQEA 3P2LA 4GM2A 4OG1A 3BPPA 3IAVA 1EY3A 3U9SB 1FC7A 2W3PA 4IZBA 4FB8A 3H0JA 4K2NA 3RRVA 2VSUF 4ZU2A 4HDTA 4WCZA 3QK8A 1XNWA 5DZKH 4JOTA 5E0SA 3MYBA 1ON3A 3IBBA 4G2RA 5C90A 5MGBA 1TYFA 2F9YA 3U9RB 2VSSE 3O4XE 1DUBA 4JCRA 3GLMA 4L8KA 5HUQA 5DZKA 3BF0A 1RJNA 4JCTA 3ZWBA 4NEKA 4MI2A 3A4LA 2YJGA 4IZCA 4I42A 3SLLA 3LAOA 5DU8A 3IRBA 3P85A 5E0NX 3TZ3A 3ZW8A 4JJTA 2WTBA 3KTHA 3DJAA 3RQFA 4WZ8B 3ADCA 3ST9A 3FDUA 5C9GA 4FZWA 3H02A 4JCQA 1RJMA 4HC8A 1Y64B 2X58A 3K50A 1K39A 3ISAA 5G1QA 1UX4A 4Q0GA 1UX5A 4KWBA 5E0SH 2VSSF 2IEXA 3PZKA 3W8HB 5INGA 4B3IA 3NJDA 1UYRA 2CE3A 1ON9A 1OD4A 1X0UA 4ZDEA 4YLHA 3QMJA 2F9IB 2PPYA 3LKEA 3TT6A 5CTCA 4QIIA 2J5GD 3HLN1 4FN8A 1EF8A 4JYJA 4KNPA 2J5II 2X24A 4NNQA 3KQFA 4QIJA 3RQGA 4U1AA 5DL1A 4EMPA 4U0GA 4JVTA 3T8BA 3H0QA 3NJBA 3QKAA 5INIA 1XX4A 2FBMA 5DUFA 3I47A 4FJWD 4ELWA 2J5SA 3BPTA 4JSBA 4ZDCA 3H0SA 4LK5A 2ZQQA 4I4ZA 5DTPA 4KPKA 5INFA 1W2XA 2ZL3A 5KDRB 3KTKA 1SZOA 5DU6A 1HZDA 3BEZA 2BZRA 5JBWA 3ZW9A 1UYVA 3K8XA 2F9IA 4FNBA 3AM1A 3PGQA 3OMEA 2UZFA 3H0UA 4WYOB 1OD2A 4IZDA 4EMMA 3R9SA 3WG5A 4B3JA 2VSUE 2D3TA 4FZWC 3RSTA 4ZDFA 3ZWAA 4B3HA 3QXZA 4JCSA 3AJMA 4K3WA 3OT6A 3MOYA 3MT6A 2ZL4A 2A7KA 2NP9A 3JU1A 3GKBA 5DU4A 2F6QA 2C8TA 3Q1TA 2VREA 4Z0MA 5DUCA 2F6IA 3V5EA 2F9YB 2DUBA 4GHNA 3ZWCA 5FIFA 3DORA 3G64A 2PG8A 3L8IA 1HNUA 3HE2A 1Y7OA 3RSIA 1WZ8A 1YG6A 3R9TA 3MFMA 1NZYB 1Q51A 3QWDA 1XNVA 1PJHA 4L6WA 4FNDA 3M6NA 2J5GA 5DKPA 3FF6A 3T8AA 1FCFA 1O8UA 3N6RB 3P5MA 5DTWA 3V5IA 3R6HA 1WDMA 5KDRA 4Q1IA 4U18A 1SG4A 3HRXA 3HINA 1XNYA 3A4MA 3M6MA 2Q35A 3STAA 2J5IB 3HP0A 2A7SA 4RCNA 1TG6A 4DI1A 2HW5A 3R0OA 1UYTA 4U0HA 4MOUA 5G1SA 2J5IA 3TDCA 1VRGA 2PBPA 3PEAA 4ASIA 3Q0JA 1Q52A 3IB9A 4HNKA 2GTRA 3SWXA 3T89A 2ZL2A 3U9TB 1WDLA 4EMLA 4RYFA 1N6FA 1XO6A 5JBXA 4K29A 4NARA 4MXIA 5IKLB 2VSUA 2P63A 1N6EA 4U19A 3ADBA 2CBYA 3Q7HA 3TRRA 3A4NA 2FW2A 3T88A 3OC7A 2FZSA 2DEOA
chains in the Genus database with same CATH topology
3QYRA 3H81A 3GF3A 5CTBA 1EF9A 3TVUA 2VX2A 1FC6A 1K32A 4ELSA 1WDKA 3QXIA 4RYFH 3KTIA 3TVWA 2ZL0A 4U0GH 2A81A 4JFCA 1UYSA 3L3SA 2VSUC 2VSSA 3KTJA 3TLFA 3TV5A 4ZDBA 1JXZA 4OLQA 5FUSA 1DCIA 4ZDDA 3Q0GA 1NZYA 1FC9A 2ZQRA 4J2UA 3R9QA 1N6DA 5G1RA 4JYLA 4ELXA 4JWVA 5KJPA 4QFEA 1HNOA 3KTGA 1PIXA 3QREA 1MJ3A 2EJ5A 4F47A 2Q34A 3TT7A 3GMAA 2Q2XA 1UIYA 3T3WA 1YG8A 3GF7A 4KD6A 3PE8A 4OMRA 4I52A 1J7XA 4FN7A 2QQ3A 3VIVA 3P2LA 4GM2A 4OG1A 3BPPA 3IAVA 1EY3A 3U9SB 1FC7A 2W3PA 4IZBA 4FB8A 3H0JA 4K2NA 3RRVA 2VSUF 4ZU2A 4HDTA 4WCZA 3QK8A 1XNWA 5DZKH 4JOTA 5E0SA 3MYBA 1ON3A 3IBBA 4G2RA 5C90A 5MGBA 1TYFA 2F9YA 3U9RB 2VSSE 1DUBA 4JCRA 3GLMA 4L8KA 5HUQA 5DZKA 3BF0A 1RJNA 4JCTA 3ZWBA 4NEKA 4MI2A 2YJGA 4IZCA 4I42A 3SLLA 3LAOA 5DU8A 3P85A 5E0NX 3TZ3A 3ZW8A 4JJTA 2WTBA 3KTHA 3DJAA 4WZ8B 3ST9A 3FDUA 5C9GA 4FZWA 3H02A 4JCQA 1RJMA 4HC8A 2X58A 3K50A 1K39A 3ISAA 5G1QA 4Q0GA 4KWBA 5E0SH 2VSSF 2IEXA 3PZKA 5INGA 4B3IA 3NJDA 1UYRA 2CE3A 1ON9A 1OD4A 1X0UA 4ZDEA 4YLHA 3QMJA 2F9IB 2PPYA 3LKEA 3TT6A 5CTCA 4QIIA 2J5GD 3HLN1 4FN8A 1EF8A 4JYJA 4KNPA 2J5II 2X24A 4NNQA 3KQFA 4QIJA 4U1AA 5DL1A 4EMPA 4U0GA 4JVTA 3T8BA 3H0QA 3NJBA 3QKAA 5INIA 1XX4A 2FBMA 5DUFA 3I47A 4FJWD 4ELWA 2J5SA 3BPTA 4JSBA 4ZDCA 3H0SA 4LK5A 2ZQQA 4I4ZA 5DTPA 4KPKA 5INFA 1W2XA 2ZL3A 5KDRB 3KTKA 1SZOA 5DU6A 1HZDA 3BEZA 2BZRA 5JBWA 3ZW9A 1UYVA 3K8XA 2F9IA 4FNBA 3PGQA 3OMEA 2UZFA 3H0UA 4WYOB 1OD2A 4IZDA 4EMMA 3R9SA 3WG5A 4B3JA 2VSUE 2D3TA 4FZWC 3RSTA 4ZDFA 3ZWAA 4B3HA 3QXZA 4JCSA 4K3WA 3OT6A 3MOYA 3MT6A 2ZL4A 2A7KA 2NP9A 3JU1A 3GKBA 5DU4A 2F6QA 2C8TA 3Q1TA 2VREA 4Z0MA 5DUCA 2F6IA 3V5EA 2F9YB 2DUBA 4GHNA 3ZWCA 5FIFA 3DORA 3G64A 2PG8A 1HNUA 3HE2A 1Y7OA 3RSIA 1WZ8A 1YG6A 3R9TA 3MFMA 1NZYB 1Q51A 3QWDA 1XNVA 1PJHA 4L6WA 4FNDA 3M6NA 2J5GA 5DKPA 3FF6A 3T8AA 1FCFA 1O8UA 3N6RB 3P5MA 5DTWA 3V5IA 3R6HA 1WDMA 5KDRA 4Q1IA 4U18A 1SG4A 3HRXA 3HINA 1XNYA 3M6MA 2Q35A 3STAA 2J5IB 3HP0A 2A7SA 4RCNA 1TG6A 4DI1A 2HW5A 3R0OA 1UYTA 4U0HA 4MOUA 5G1SA 2J5IA 3TDCA 1VRGA 2PBPA 3PEAA 4ASIA 3Q0JA 1Q52A 3IB9A 4HNKA 2GTRA 3SWXA 3T89A 2ZL2A 3U9TB 1WDLA 4EMLA 4RYFA 1N6FA 1XO6A 5JBXA 4K29A 4NARA 4MXIA 5IKLB 2VSUA 1N6EA 4U19A 2CBYA 3Q7HA 3TRRA 2FW2A 3T88A 3OC7A 2FZSA 2DEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYR A;  3H81 A;  3GF3 A;  5CTB A;  1EF9 A;  3TVU A;  2VX2 A;  1FC6 A;  1K32 A;  4ELS A;  1WDK A;  3QXI A;  4RYF H;  3KTI A;  3TVW A;  2ZL0 A;  4U0G H;  2A81 A;  4JFC A;  1UYS A;  3L3S A;  2VSU C;  2VSS A;  3KTJ A;  3TLF A;  3TV5 A;  4ZDB A;  1JXZ A;  4OLQ A;  5FUS A;  1DCI A;  4ZDD A;  3Q0G A;  1NZY A;  1FC9 A;  2ZQR A;  3R9Q A;  1N6D A;  5G1R A;  4JYL A;  4ELX A;  4JWV A;  5KJP A;  4QFE A;  1HNO A;  3KTG A;  1PIX A;  3QRE A;  1MJ3 A;  2EJ5 A;  4F47 A;  2Q34 A;  3TT7 A;  3GMA A;  2Q2X A;  1UIY A;  3T3W A;  1YG8 A;  3GF7 A;  4KD6 A;  3PE8 A;  4OMR A;  4I52 A;  1J7X A;  4FN7 A;  2QQ3 A;  3VIV A;  3P2L A;  4GM2 A;  4OG1 A;  3BPP A;  3IAV A;  1EY3 A;  3U9S B;  1FC7 A;  2W3P A;  4IZB A;  4FB8 A;  3H0J A;  4K2N A;  3RRV A;  2VSU F;  4ZU2 A;  4WCZ A;  3QK8 A;  1XNW A;  5DZK H;  4JOT A;  5E0S A;  3MYB A;  1ON3 A;  3IBB A;  4G2R A;  5C90 A;  5MGB A;  1TYF A;  2F9Y A;  3U9R B;  2VSS E;  1DUB A;  4JCR A;  3GLM A;  4L8K A;  5DZK A;  3BF0 A;  1RJN A;  4JCT A;  3ZWB A;  4NEK A;  4MI2 A;  4IZC A;  4I42 A;  3SLL A;  3LAO A;  5DU8 A;  3P85 A;  5E0N X;  3TZ3 A;  3ZW8 A;  4JJT A;  2WTB A;  3KTH A;  3DJA A;  4WZ8 B;  3ST9 A;  3FDU A;  5C9G A;  4FZW A;  3H02 A;  4JCQ A;  1RJM A;  4HC8 A;  2X58 A;  3K50 A;  1K39 A;  3ISA A;  5G1Q A;  4Q0G A;  4KWB A;  5E0S H;  2VSS F;  2IEX A;  3PZK A;  5ING A;  4B3I A;  3NJD A;  1UYR A;  2CE3 A;  1ON9 A;  1OD4 A;  1X0U A;  4ZDE A;  4YLH A;  3QMJ A;  2F9I B;  2PPY A;  3LKE A;  3TT6 A;  5CTC A;  4QII A;  2J5G D;  3HLN 1;  4FN8 A;  1EF8 A;  4JYJ A;  4KNP A;  2J5I I;  2X24 A;  4NNQ A;  3KQF A;  4QIJ A;  4U1A A;  5DL1 A;  4EMP A;  4U0G A;  4JVT A;  3T8B A;  3H0Q A;  3NJB A;  3QKA A;  5INI A;  1XX4 A;  2FBM A;  5DUF A;  3I47 A;  4FJW D;  4ELW A;  2J5S A;  4JSB A;  4ZDC A;  3H0S A;  4LK5 A;  2ZQQ A;  4I4Z A;  5DTP A;  4KPK A;  5INF A;  1W2X A;  2ZL3 A;  5KDR B;  3KTK A;  1SZO A;  5DU6 A;  1HZD A;  3BEZ A;  2BZR A;  5JBW A;  3ZW9 A;  1UYV A;  3K8X A;  2F9I A;  4FNB A;  3PGQ A;  3OME A;  2UZF A;  3H0U A;  4WYO B;  1OD2 A;  4IZD A;  4EMM A;  3R9S A;  3WG5 A;  4B3J A;  2VSU E;  2D3T A;  4FZW C;  3RST A;  4ZDF A;  3ZWA A;  4B3H A;  3QXZ A;  4JCS A;  4K3W A;  3OT6 A;  3MOY A;  3MT6 A;  2ZL4 A;  2A7K A;  2NP9 A;  3JU1 A;  3GKB A;  5DU4 A;  2F6Q A;  2C8T A;  3Q1T A;  2VRE A;  4Z0M A;  5DUC A;  2F6I A;  3V5E A;  2F9Y B;  2DUB A;  4GHN A;  3ZWC A;  5FIF A;  3DOR A;  3G64 A;  2PG8 A;  1HNU A;  3HE2 A;  1Y7O A;  3RSI A;  1WZ8 A;  1YG6 A;  3R9T A;  3MFM A;  1NZY B;  1Q51 A;  3QWD A;  1XNV A;  1PJH A;  4L6W A;  4FND A;  3M6N A;  2J5G A;  5DKP A;  3FF6 A;  3T8A A;  1FCF A;  1O8U A;  3N6R B;  3P5M A;  5DTW A;  3V5I A;  3R6H A;  1WDM A;  5KDR A;  4Q1I A;  4U18 A;  1SG4 A;  3HRX A;  3HIN A;  1XNY A;  3M6M A;  2Q35 A;  3STA A;  2J5I B;  3HP0 A;  2A7S A;  4RCN A;  1TG6 A;  4DI1 A;  2HW5 A;  3R0O A;  1UYT A;  4U0H A;  4MOU A;  5G1S A;  2J5I A;  3TDC A;  1VRG A;  2PBP A;  3PEA A;  4ASI A;  3Q0J A;  1Q52 A;  3IB9 A;  4HNK A;  2GTR A;  3SWX A;  3T89 A;  2ZL2 A;  3U9T B;  1WDL A;  4EML A;  4RYF A;  1N6F A;  1XO6 A;  5JBX A;  4K29 A;  4MXI A;  5IKL B;  2VSU A;  1N6E A;  4U19 A;  2CBY A;  3Q7H A;  3TRR A;  2FW2 A;  3T88 A;  3OC7 A;  2FZS A;  2DEO A; 
#chains in the Genus database with same CATH topology
 3QYR A;  3H81 A;  3GF3 A;  5CTB A;  1EF9 A;  3TVU A;  2VX2 A;  1FC6 A;  1K32 A;  4ELS A;  1WDK A;  3QXI A;  4RYF H;  3KTI A;  3TVW A;  2ZL0 A;  4U0G H;  2A81 A;  4JFC A;  1UYS A;  3L3S A;  2VSU C;  2VSS A;  3KTJ A;  3TLF A;  3TV5 A;  4ZDB A;  1JXZ A;  4OLQ A;  5FUS A;  1DCI A;  4ZDD A;  3Q0G A;  3L8J A;  1NZY A;  1FC9 A;  2ZQR A;  4J2U A;  3R9Q A;  1N6D A;  5G1R A;  4JYL A;  3ADD A;  4ELX A;  4JWV A;  5KJP A;  4QFE A;  1HNO A;  3KTG A;  3W8I B;  1PIX A;  3QRE A;  1MJ3 A;  2EJ5 A;  4F47 A;  2Q34 A;  3TT7 A;  3GMA A;  2Q2X A;  1UIY A;  3T3W A;  4GEH B;  1YG8 A;  3GF7 A;  4KD6 A;  3PE8 A;  4OMR A;  4I52 A;  1J7X A;  4FN7 A;  2QQ3 A;  3VIV A;  3RQE A;  3P2L A;  4GM2 A;  4OG1 A;  3BPP A;  3IAV A;  1EY3 A;  3U9S B;  1FC7 A;  2W3P A;  4IZB A;  4FB8 A;  3H0J A;  4K2N A;  3RRV A;  2VSU F;  4ZU2 A;  4HDT A;  4WCZ A;  3QK8 A;  1XNW A;  5DZK H;  4JOT A;  5E0S A;  3MYB A;  1ON3 A;  3IBB A;  4G2R A;  5C90 A;  5MGB A;  1TYF A;  2F9Y A;  3U9R B;  2VSS E;  3O4X E;  1DUB A;  4JCR A;  3GLM A;  4L8K A;  5HUQ A;  5DZK A;  3BF0 A;  1RJN A;  4JCT A;  3ZWB A;  4NEK A;  4MI2 A;  3A4L A;  2YJG A;  4IZC A;  4I42 A;  3SLL A;  3LAO A;  5DU8 A;  3IRB A;  3P85 A;  5E0N X;  3TZ3 A;  3ZW8 A;  4JJT A;  2WTB A;  3KTH A;  3DJA A;  3RQF A;  4WZ8 B;  3ADC A;  3ST9 A;  3FDU A;  5C9G A;  4FZW A;  3H02 A;  4JCQ A;  1RJM A;  4HC8 A;  1Y64 B;  2X58 A;  3K50 A;  1K39 A;  3ISA A;  5G1Q A;  1UX4 A;  4Q0G A;  1UX5 A;  4KWB A;  5E0S H;  2VSS F;  2IEX A;  3PZK A;  3W8H B;  5ING A;  4B3I A;  3NJD A;  1UYR A;  2CE3 A;  1ON9 A;  1OD4 A;  1X0U A;  4ZDE A;  4YLH A;  3QMJ A;  2F9I B;  2PPY A;  3LKE A;  3TT6 A;  5CTC A;  4QII A;  2J5G D;  3HLN 1;  4FN8 A;  1EF8 A;  4JYJ A;  4KNP A;  2J5I I;  2X24 A;  4NNQ A;  3KQF A;  4QIJ A;  3RQG A;  4U1A A;  5DL1 A;  4EMP A;  4U0G A;  4JVT A;  3T8B A;  3H0Q A;  3NJB A;  3QKA A;  5INI A;  1XX4 A;  2FBM A;  5DUF A;  3I47 A;  4FJW D;  4ELW A;  2J5S A;  3BPT A;  4JSB A;  4ZDC A;  3H0S A;  4LK5 A;  2ZQQ A;  4I4Z A;  5DTP A;  4KPK A;  5INF A;  1W2X A;  2ZL3 A;  5KDR B;  3KTK A;  1SZO A;  5DU6 A;  1HZD A;  3BEZ A;  2BZR A;  5JBW A;  3ZW9 A;  1UYV A;  3K8X A;  2F9I A;  4FNB A;  3AM1 A;  3PGQ A;  3OME A;  2UZF A;  3H0U A;  4WYO B;  1OD2 A;  4IZD A;  4EMM A;  3R9S A;  3WG5 A;  4B3J A;  2VSU E;  2D3T A;  4FZW C;  3RST A;  4ZDF A;  3ZWA A;  4B3H A;  3QXZ A;  4JCS A;  3AJM A;  4K3W A;  3OT6 A;  3MOY A;  3MT6 A;  2ZL4 A;  2A7K A;  2NP9 A;  3JU1 A;  3GKB A;  5DU4 A;  2F6Q A;  2C8T A;  3Q1T A;  2VRE A;  4Z0M A;  5DUC A;  2F6I A;  3V5E A;  2F9Y B;  2DUB A;  4GHN A;  3ZWC A;  5FIF A;  3DOR A;  3G64 A;  2PG8 A;  3L8I A;  1HNU A;  3HE2 A;  1Y7O A;  3RSI A;  1WZ8 A;  1YG6 A;  3R9T A;  3MFM A;  1NZY B;  1Q51 A;  3QWD A;  1XNV A;  1PJH A;  4L6W A;  4FND A;  3M6N A;  2J5G A;  5DKP A;  3FF6 A;  3T8A A;  1FCF A;  1O8U A;  3N6R B;  3P5M A;  5DTW A;  3V5I A;  3R6H A;  1WDM A;  5KDR A;  4Q1I A;  4U18 A;  1SG4 A;  3HRX A;  3HIN A;  1XNY A;  3A4M A;  3M6M A;  2Q35 A;  3STA A;  2J5I B;  3HP0 A;  2A7S A;  4RCN A;  1TG6 A;  4DI1 A;  2HW5 A;  3R0O A;  1UYT A;  4U0H A;  4MOU A;  5G1S A;  2J5I A;  3TDC A;  1VRG A;  2PBP A;  3PEA A;  4ASI A;  3Q0J A;  1Q52 A;  3IB9 A;  4HNK A;  2GTR A;  3SWX A;  3T89 A;  2ZL2 A;  3U9T B;  1WDL A;  4EML A;  4RYF A;  1N6F A;  1XO6 A;  5JBX A;  4K29 A;  4NAR A;  4MXI A;  5IKL B;  2VSU A;  2P63 A;  1N6E A;  4U19 A;  3ADB A;  2CBY A;  3Q7H A;  3TRR A;  3A4N A;  2FW2 A;  3T88 A;  3OC7 A;  2FZS A;  2DEO A; 
#chains in the Genus database with same CATH homology
 3QYR A;  3H81 A;  3GF3 A;  5CTB A;  1EF9 A;  3TVU A;  2VX2 A;  1FC6 A;  1K32 A;  4ELS A;  1WDK A;  3QXI A;  4RYF H;  3KTI A;  3TVW A;  2ZL0 A;  4U0G H;  2A81 A;  4JFC A;  1UYS A;  3L3S A;  2VSU C;  2VSS A;  3KTJ A;  3TLF A;  3TV5 A;  4ZDB A;  1JXZ A;  4OLQ A;  5FUS A;  1DCI A;  4ZDD A;  3Q0G A;  1NZY A;  1FC9 A;  2ZQR A;  4J2U A;  3R9Q A;  1N6D A;  5G1R A;  4JYL A;  4ELX A;  4JWV A;  5KJP A;  4QFE A;  1HNO A;  3KTG A;  1PIX A;  3QRE A;  1MJ3 A;  2EJ5 A;  4F47 A;  2Q34 A;  3TT7 A;  3GMA A;  2Q2X A;  1UIY A;  3T3W A;  1YG8 A;  3GF7 A;  4KD6 A;  3PE8 A;  4OMR A;  4I52 A;  1J7X A;  4FN7 A;  2QQ3 A;  3VIV A;  3P2L A;  4GM2 A;  4OG1 A;  3BPP A;  3IAV A;  1EY3 A;  3U9S B;  1FC7 A;  2W3P A;  4IZB A;  4FB8 A;  3H0J A;  4K2N A;  3RRV A;  2VSU F;  4ZU2 A;  4HDT A;  4WCZ A;  3QK8 A;  1XNW A;  5DZK H;  4JOT A;  5E0S A;  3MYB A;  1ON3 A;  3IBB A;  4G2R A;  5C90 A;  5MGB A;  1TYF A;  2F9Y A;  3U9R B;  2VSS E;  1DUB A;  4JCR A;  3GLM A;  4L8K A;  5HUQ A;  5DZK A;  3BF0 A;  1RJN A;  4JCT A;  3ZWB A;  4NEK A;  4MI2 A;  2YJG A;  4IZC A;  4I42 A;  3SLL A;  3LAO A;  5DU8 A;  3P85 A;  5E0N X;  3TZ3 A;  3ZW8 A;  4JJT A;  2WTB A;  3KTH A;  3DJA A;  4WZ8 B;  3ST9 A;  3FDU A;  5C9G A;  4FZW A;  3H02 A;  4JCQ A;  1RJM A;  4HC8 A;  2X58 A;  3K50 A;  1K39 A;  3ISA A;  5G1Q A;  4Q0G A;  4KWB A;  5E0S H;  2VSS F;  2IEX A;  3PZK A;  5ING A;  4B3I A;  3NJD A;  1UYR A;  2CE3 A;  1ON9 A;  1OD4 A;  1X0U A;  4ZDE A;  4YLH A;  3QMJ A;  2F9I B;  2PPY A;  3LKE A;  3TT6 A;  5CTC A;  4QII A;  2J5G D;  3HLN 1;  4FN8 A;  1EF8 A;  4JYJ A;  4KNP A;  2J5I I;  2X24 A;  4NNQ A;  3KQF A;  4QIJ A;  4U1A A;  5DL1 A;  4EMP A;  4U0G A;  4JVT A;  3T8B A;  3H0Q A;  3NJB A;  3QKA A;  5INI A;  1XX4 A;  2FBM A;  5DUF A;  3I47 A;  4FJW D;  4ELW A;  2J5S A;  3BPT A;  4JSB A;  4ZDC A;  3H0S A;  4LK5 A;  2ZQQ A;  4I4Z A;  5DTP A;  4KPK A;  5INF A;  1W2X A;  2ZL3 A;  5KDR B;  3KTK A;  1SZO A;  5DU6 A;  1HZD A;  3BEZ A;  2BZR A;  5JBW A;  3ZW9 A;  1UYV A;  3K8X A;  2F9I A;  4FNB A;  3PGQ A;  3OME A;  2UZF A;  3H0U A;  4WYO B;  1OD2 A;  4IZD A;  4EMM A;  3R9S A;  3WG5 A;  4B3J A;  2VSU E;  2D3T A;  4FZW C;  3RST A;  4ZDF A;  3ZWA A;  4B3H A;  3QXZ A;  4JCS A;  4K3W A;  3OT6 A;  3MOY A;  3MT6 A;  2ZL4 A;  2A7K A;  2NP9 A;  3JU1 A;  3GKB A;  5DU4 A;  2F6Q A;  2C8T A;  3Q1T A;  2VRE A;  4Z0M A;  5DUC A;  2F6I A;  3V5E A;  2F9Y B;  2DUB A;  4GHN A;  3ZWC A;  5FIF A;  3DOR A;  3G64 A;  2PG8 A;  1HNU A;  3HE2 A;  1Y7O A;  3RSI A;  1WZ8 A;  1YG6 A;  3R9T A;  3MFM A;  1NZY B;  1Q51 A;  3QWD A;  1XNV A;  1PJH A;  4L6W A;  4FND A;  3M6N A;  2J5G A;  5DKP A;  3FF6 A;  3T8A A;  1FCF A;  1O8U A;  3N6R B;  3P5M A;  5DTW A;  3V5I A;  3R6H A;  1WDM A;  5KDR A;  4Q1I A;  4U18 A;  1SG4 A;  3HRX A;  3HIN A;  1XNY A;  3M6M A;  2Q35 A;  3STA A;  2J5I B;  3HP0 A;  2A7S A;  4RCN A;  1TG6 A;  4DI1 A;  2HW5 A;  3R0O A;  1UYT A;  4U0H A;  4MOU A;  5G1S A;  2J5I A;  3TDC A;  1VRG A;  2PBP A;  3PEA A;  4ASI A;  3Q0J A;  1Q52 A;  3IB9 A;  4HNK A;  2GTR A;  3SWX A;  3T89 A;  2ZL2 A;  3U9T B;  1WDL A;  4EML A;  4RYF A;  1N6F A;  1XO6 A;  5JBX A;  4K29 A;  4NAR A;  4MXI A;  5IKL B;  2VSU A;  1N6E A;  4U19 A;  2CBY A;  3Q7H A;  3TRR A;  2FW2 A;  3T88 A;  3OC7 A;  2FZS A;  2DEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...