2QQCA

E109q mutant of pyruvoyl-dependent arginine decarboxylase from methanococcus jannashii
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
PLHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVNLIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (Pvl
publication title Structures of the N47A and E109Q mutant proteins of pyruvoyl-dependent arginine decarboxylase from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Lyase
total genus 6
structure length 46
sequence length 46
chains with identical sequence C, E, G, I, K
ec nomenclature ec 4.1.1.19: Arginine decarboxylase.
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2qqcA00
2B0UC 2NU3I 1FYBA 1HPTA 1OMTA 1PPFI 1CT4I 1CGJI 2KMPA 1YU6C 1R0RI 1LR9A 2BUSA 1CE3A 1IW4A 1LR8A 1TUSA 2KMQA 2SGEI 2SGQI 1YTPA 1SGPI 1IY5A 1OYVI 3HH2C 2SGDI 1UVFA 1N13A 1SGQI 1UVGA 3QTLD 1MT1A 1SGYI 1TBQR 1PJUA 1Y1CA 2JZMA 1SGDI 2N52A 4OVOA 2GKRI 2P6AC 2NU2I 4HGUA 1H0ZA 1BUSA 2NU0I 1SGRI 1HJAI 1Y1BA 1DS3I 1CHOI 2KCXA 1CT2I 1OVOA 1M8CA 1TBRR 2GKTI 3SEKC 1HDLA 2KMOA 2F3CI 1DS2I 3OVOA 2ERWA 2N71A 1CGII 1M8BA 5DAEA 4SGBI 5JHWC 1CT0I 2M5XA 1TGSI 2SGPI 2GKVA 3SGBI 4GI3C 1BMOA 2NU1I 3SGQI 2JXDA 1TURA 1Z7KB 2OVOA 3B4VC 1NUBA 2V53A 2QQCA 1AN1I 2ARPF 1SGNI 2NU4I 2SGFI 2WCYA 1OMUA 1TIHA 1LR7A 1CSOI 1KMAA 2QQDA 2N17A 2XRCA 1PCEA 2JYYA 3TJQA 1IY6A 2KMRA 1UUCA 2LEOA 1SGEI
chains in the Genus database with same CATH superfamily
2B0UC 1WKXA 1ULNA 1K7UA 2NU3I 5CCLA 1P9GA 2E5RA 1XBTA 4JCVE 2ROWA 1FYBA 1HPTA 1OMTA 1PPFI 1U5KA 4E1RA 3R5DA 2CWHA 2V1CC 5HQ8A 2L7XA 1CT4I 3UEJA 2ENZA 3UGLA 1CGJI 9WGAA 1TOTA 5E3QA 2KMPA 3OXGA 1YU6C 1R0RI 1LR9A 2BUSA 3TO9A 1CE3A 4MPIA 1PTRA 4A24A 1FY7A 1IW4A 1LR8A 2DKVA 3OL0A 2GVIA 2L8EA 2J9RA 1TUSA 2B8TA 2KMQA 2SGEI 4B6DA 1Z2IA 1XX6A 3VE5A 3TO6A 2SGQI 4UXHA 3VDUA 1YTPA 3UGDA 1SGPI 3MEKA 2Y0MA 3FSYA 1OYVI 1IY5A 2RIJA 3HH2C 2SGDI 1UVFA 1N13A 5E3RA 1SGQI 1UVGA 2J87A 1FARA 2K9HA 2OD1A 3QTLD 5EX0A 4L9MA 1MT1A 3FSXA 1P9ZA 4DNCA 2QQEA 1SGYI 2ELIA 1RFHA 2ORVA 1TBQR 1PJUA 1Y1CA 2RC4A 1FAQA 1V1IA 2FNFX 2DB6A 2JZMA 5FUVA 2X52A 1SGDI 2N52A 4FKDA 4OVOA 5FUXA 3UEYA 4AMLA 2OZUA 2GKRI 2P6AC 2NU2I 4HGUA 1TBNA 3QWPA 1BUSA 1H0ZA 1KBFA 3UOEA 2NU0I 2PQ8A 2YQPA 1SGRI 2CJSC 1HJAI 1Y1BA 1ULMA 1DS3I 2LUYA 1HEVA 1CHOI 2KCXA 1CT2I 1OVOA 3UFFA 1XA6A 2JA1A 4UXIA 1PTQA 3OXFA 1W4RA 1WTJA 1M8CA 1TBRR 3E2IA 2GKTI 7WGAA 3TO7A 3SEKC 2WVJA 5E3PA 1HDLA 2KMOA 1NXUA 2F3CI 1DS2I 2WGCA 1MJ9A 3OVOA 2ERWA 2N71A 2ORWA 1VDDA 3PDNA 5FUWA 1MJBA 1WGCA 1Y8FA 3BJIA 2DIPA 2UVOA 1CGII 3KY9A 1M8BA 5DAEA 1X74A 2A20A 2JW6A 2UZ3A 4SGBI 4E1PA 5JHWC 1CT0I 2M5XA 1TGSI 2N1AB 5FUYA 2YUUA 3RU0A 2SGPI 3VDPA 3UGIA 5CCMA 2GKVA 2QQ0A 2W0TA 3SGBI 4GI3C 1S20A 1BMOA 2NU1I 1K7TA 2OU2A 3SGQI 2JXDA 1TURA 1TBOA 1Z7KB 2V1CA 1ULKA 3QAHA 2OVOA 3B4VC 3TOBA 2CWGA 2E73A 1NUBA 2V53A 2QQCA 3R5CA 4WP4A 5EX3A 2VRWB 1W3SA 3R5AA 1AN1I 1MJAA 2ARPF 1Q9BA 1SGNI 3E59A 2X3TA 2NU4I 3TOAA 3FC3A 2QPOA 1X4SA 2GIVA 2ENNA 1K7VA 5J8FA 1R79A 2ODDA 2SGFI 2WCYA 1OMUA 1WGTA 3GOXA 1TIHA 3R5BA 1LR7A 1KBEA 1CSOI 2QQDA 5J8CA 2N17A 1KMAA 1UHAA 2XRCA 3OXLA 5HI7A 1V1HA 1PCEA 4UXJA 2CWFA 2JYYA 3TJQA 3CXLA 3D00A 1IY6A 2KMRA 1UUCA 2LB7A 2LEOA 1SGEI
chains in the Genus database with same CATH topology
2B0UC 2NU3I 5CCLA 2E5RA 1XBTA 4JCVE 2ROWA 1FYBA 1HPTA 1OMTA 1PPFI 1U5KA 4E1RA 5HQ8A 2V1CC 2L7XA 1CT4I 3UEJA 2ENZA 3UGLA 1CGJI 1TOTA 2KMPA 3OXGA 1YU6C 1R0RI 2BUSA 1LR9A 1CE3A 1PTRA 4A24A 1IW4A 1LR8A 3OL0A 2GVIA 2L8EA 2J9RA 1TUSA 2B8TA 2KMQA 2SGEI 4B6DA 3VE5A 1XX6A 2SGQI 4UXHA 3VDUA 1YTPA 3UGDA 1SGPI 3MEKA 1IY5A 1OYVI 3HH2C 2SGDI 1UVFA 1N13A 1SGQI 1UVGA 2J87A 1FARA 2K9HA 2OD1A 3QTLD 5EX0A 4L9MA 1MT1A 2QQEA 1SGYI 2ELIA 1RFHA 2ORVA 1TBQR 1PJUA 1Y1CA 1FAQA 1V1IA 2FNFX 2DB6A 2JZMA 5FUVA 1SGDI 2N52A 4FKDA 4OVOA 5FUXA 3UEYA 2GKRI 2P6AC 2NU2I 4HGUA 1TBNA 3QWPA 1BUSA 1H0ZA 1KBFA 2NU0I 2YQPA 1SGRI 2CJSC 1HJAI 1Y1BA 2LUYA 1DS3I 1CHOI 2KCXA 1CT2I 1OVOA 3UFFA 1XA6A 2JA1A 4UXIA 1PTQA 3OXFA 1W4RA 1M8CA 1TBRR 3E2IA 2GKTI 3SEKC 2WVJA 1HDLA 2KMOA 2F3CI 1DS2I 3OVOA 2ERWA 2N71A 2ORWA 1VDDA 3PDNA 5FUWA 1Y8FA 3BJIA 2DIPA 3KY9A 1CGII 1M8BA 5DAEA 2A20A 1X74A 2JW6A 2UZ3A 4SGBI 4E1PA 5JHWC 1CT0I 2M5XA 1TGSI 2N1AB 5FUYA 2YUUA 3RU0A 2SGPI 3VDPA 3UGIA 5CCMA 2GKVA 2QQ0A 2W0TA 3SGBI 4GI3C 1BMOA 2NU1I 3SGQI 2JXDA 1TURA 1TBOA 1Z7KB 2V1CA 2OVOA 3B4VC 2E73A 1NUBA 2V53A 2QQCA 5EX3A 2VRWB 1W3SA 1AN1I 2ARPF 1SGNI 3E59A 3FC3A 2NU4I 2QPOA 1X4SA 2ENNA 1R79A 2ODDA 2SGFI 2WCYA 1OMUA 3GOXA 1TIHA 1LR7A 1KBEA 1CSOI 2QQDA 1KMAA 2N17A 2XRCA 3OXLA 5HI7A 1V1HA 1PCEA 4UXJA 2JYYA 3TJQA 3CXLA 3D00A 1IY6A 2KMRA 1UUCA 2LEOA 1SGEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B0U C;  2NU3 I;  1FYB A;  1HPT A;  1OMT A;  1PPF I;  1CT4 I;  1CGJ I;  2KMP A;  1YU6 C;  1R0R I;  1LR9 A;  2BUS A;  1CE3 A;  1IW4 A;  1LR8 A;  1TUS A;  2KMQ A;  2SGE I;  2SGQ I;  1YTP A;  1SGP I;  1IY5 A;  1OYV I;  3HH2 C;  2SGD I;  1UVF A;  1N13 A;  1SGQ I;  1UVG A;  3QTL D;  1MT1 A;  1SGY I;  1TBQ R;  1PJU A;  1Y1C A;  2JZM A;  1SGD I;  2N52 A;  4OVO A;  2GKR I;  2P6A C;  2NU2 I;  4HGU A;  1H0Z A;  1BUS A;  2NU0 I;  1SGR I;  1HJA I;  1Y1B A;  1DS3 I;  1CHO I;  2KCX A;  1CT2 I;  1OVO A;  1M8C A;  1TBR R;  2GKT I;  3SEK C;  1HDL A;  2KMO A;  2F3C I;  1DS2 I;  3OVO A;  2ERW A;  2N71 A;  1CGI I;  1M8B A;  5DAE A;  4SGB I;  5JHW C;  1CT0 I;  2M5X A;  1TGS I;  2SGP I;  2GKV A;  3SGB I;  4GI3 C;  1BMO A;  2NU1 I;  3SGQ I;  2JXD A;  1TUR A;  1Z7K B;  2OVO A;  3B4V C;  1NUB A;  2V53 A;  2QQC A;  1AN1 I;  2ARP F;  1SGN I;  2NU4 I;  2SGF I;  2WCY A;  1OMU A;  1TIH A;  1LR7 A;  1CSO I;  1KMA A;  2QQD A;  2N17 A;  2XRC A;  1PCE A;  2JYY A;  3TJQ A;  1IY6 A;  2KMR A;  1UUC A;  2LEO A;  1SGE I; 
#chains in the Genus database with same CATH topology
 2B0U C;  1WKX A;  1ULN A;  1K7U A;  2NU3 I;  5CCL A;  1P9G A;  2E5R A;  1XBT A;  4JCV E;  2ROW A;  1FYB A;  1HPT A;  1OMT A;  1PPF I;  1U5K A;  4E1R A;  3R5D A;  2CWH A;  2V1C C;  5HQ8 A;  2L7X A;  1CT4 I;  3UEJ A;  2ENZ A;  3UGL A;  1CGJ I;  9WGA A;  1TOT A;  5E3Q A;  2KMP A;  3OXG A;  1YU6 C;  1R0R I;  1LR9 A;  2BUS A;  3TO9 A;  1CE3 A;  4MPI A;  1PTR A;  4A24 A;  1FY7 A;  1IW4 A;  1LR8 A;  2DKV A;  3OL0 A;  2GVI A;  2L8E A;  2J9R A;  1TUS A;  2B8T A;  2KMQ A;  2SGE I;  4B6D A;  1Z2I A;  1XX6 A;  3VE5 A;  3TO6 A;  2SGQ I;  4UXH A;  3VDU A;  1YTP A;  3UGD A;  1SGP I;  3MEK A;  2Y0M A;  3FSY A;  1OYV I;  1IY5 A;  2RIJ A;  3HH2 C;  2SGD I;  1UVF A;  1N13 A;  5E3R A;  1SGQ I;  1UVG A;  2J87 A;  1FAR A;  2K9H A;  2OD1 A;  3QTL D;  5EX0 A;  4L9M A;  1MT1 A;  3FSX A;  1P9Z A;  4DNC A;  2QQE A;  1SGY I;  2ELI A;  1RFH A;  2ORV A;  1TBQ R;  1PJU A;  1Y1C A;  2RC4 A;  1FAQ A;  1V1I A;  2FNF X;  2DB6 A;  2JZM A;  5FUV A;  2X52 A;  1SGD I;  2N52 A;  4FKD A;  4OVO A;  5FUX A;  3UEY A;  4AML A;  2OZU A;  2GKR I;  2P6A C;  2NU2 I;  4HGU A;  1TBN A;  3QWP A;  1BUS A;  1H0Z A;  1KBF A;  3UOE A;  2NU0 I;  2PQ8 A;  2YQP A;  1SGR I;  2CJS C;  1HJA I;  1Y1B A;  1ULM A;  1DS3 I;  2LUY A;  1HEV A;  1CHO I;  2KCX A;  1CT2 I;  1OVO A;  3UFF A;  1XA6 A;  2JA1 A;  4UXI A;  1PTQ A;  3OXF A;  1W4R A;  1WTJ A;  1M8C A;  1TBR R;  3E2I A;  2GKT I;  7WGA A;  3TO7 A;  3SEK C;  2WVJ A;  5E3P A;  1HDL A;  2KMO A;  1NXU A;  2F3C I;  1DS2 I;  2WGC A;  1MJ9 A;  3OVO A;  2ERW A;  2N71 A;  2ORW A;  1VDD A;  3PDN A;  5FUW A;  1MJB A;  1WGC A;  1Y8F A;  3BJI A;  2DIP A;  2UVO A;  1CGI I;  3KY9 A;  1M8B A;  5DAE A;  1X74 A;  2A20 A;  2JW6 A;  2UZ3 A;  4SGB I;  4E1P A;  5JHW C;  1CT0 I;  2M5X A;  1TGS I;  2N1A B;  5FUY A;  2YUU A;  3RU0 A;  2SGP I;  3VDP A;  3UGI A;  5CCM A;  2GKV A;  2QQ0 A;  2W0T A;  3SGB I;  4GI3 C;  1S20 A;  1BMO A;  2NU1 I;  1K7T A;  2OU2 A;  3SGQ I;  2JXD A;  1TUR A;  1TBO A;  1Z7K B;  2V1C A;  1ULK A;  3QAH A;  2OVO A;  3B4V C;  3TOB A;  2CWG A;  2E73 A;  1NUB A;  2V53 A;  2QQC A;  3R5C A;  4WP4 A;  5EX3 A;  2VRW B;  1W3S A;  3R5A A;  1AN1 I;  1MJA A;  2ARP F;  1Q9B A;  1SGN I;  3E59 A;  2X3T A;  2NU4 I;  3TOA A;  3FC3 A;  2QPO A;  1X4S A;  2GIV A;  2ENN A;  1K7V A;  5J8F A;  1R79 A;  2ODD A;  2SGF I;  2WCY A;  1OMU A;  1WGT A;  3GOX A;  1TIH A;  3R5B A;  1LR7 A;  1KBE A;  1CSO I;  2QQD A;  5J8C A;  2N17 A;  1KMA A;  1UHA A;  2XRC A;  3OXL A;  5HI7 A;  1V1H A;  1PCE A;  4UXJ A;  2CWF A;  2JYY A;  3TJQ A;  3CXL A;  3D00 A;  1IY6 A;  2KMR A;  1UUC A;  2LB7 A;  2LEO A;  1SGE I; 
#chains in the Genus database with same CATH homology
 2B0U C;  2NU3 I;  5CCL A;  2E5R A;  1XBT A;  4JCV E;  2ROW A;  1FYB A;  1HPT A;  1OMT A;  1PPF I;  1U5K A;  4E1R A;  5HQ8 A;  2V1C C;  2L7X A;  1CT4 I;  3UEJ A;  2ENZ A;  3UGL A;  1CGJ I;  1TOT A;  2KMP A;  3OXG A;  1YU6 C;  1R0R I;  2BUS A;  1LR9 A;  1CE3 A;  1PTR A;  4A24 A;  1IW4 A;  1LR8 A;  3OL0 A;  2GVI A;  2L8E A;  2J9R A;  1TUS A;  2B8T A;  2KMQ A;  2SGE I;  4B6D A;  3VE5 A;  1XX6 A;  2SGQ I;  4UXH A;  3VDU A;  1YTP A;  3UGD A;  1SGP I;  3MEK A;  1IY5 A;  1OYV I;  3HH2 C;  2SGD I;  1UVF A;  1N13 A;  1SGQ I;  1UVG A;  2J87 A;  1FAR A;  2K9H A;  2OD1 A;  3QTL D;  5EX0 A;  4L9M A;  1MT1 A;  2QQE A;  1SGY I;  2ELI A;  1RFH A;  2ORV A;  1TBQ R;  1PJU A;  1Y1C A;  1FAQ A;  1V1I A;  2FNF X;  2DB6 A;  2JZM A;  5FUV A;  1SGD I;  2N52 A;  4FKD A;  4OVO A;  5FUX A;  3UEY A;  2GKR I;  2P6A C;  2NU2 I;  4HGU A;  1TBN A;  3QWP A;  1BUS A;  1H0Z A;  1KBF A;  2NU0 I;  2YQP A;  1SGR I;  2CJS C;  1HJA I;  1Y1B A;  2LUY A;  1DS3 I;  1CHO I;  2KCX A;  1CT2 I;  1OVO A;  3UFF A;  1XA6 A;  2JA1 A;  4UXI A;  1PTQ A;  3OXF A;  1W4R A;  1M8C A;  1TBR R;  3E2I A;  2GKT I;  3SEK C;  2WVJ A;  1HDL A;  2KMO A;  2F3C I;  1DS2 I;  3OVO A;  2ERW A;  2N71 A;  2ORW A;  1VDD A;  3PDN A;  5FUW A;  1Y8F A;  3BJI A;  2DIP A;  3KY9 A;  1CGI I;  1M8B A;  5DAE A;  2A20 A;  1X74 A;  2JW6 A;  2UZ3 A;  4SGB I;  4E1P A;  5JHW C;  1CT0 I;  2M5X A;  1TGS I;  2N1A B;  5FUY A;  2YUU A;  3RU0 A;  2SGP I;  3VDP A;  3UGI A;  5CCM A;  2GKV A;  2QQ0 A;  2W0T A;  3SGB I;  4GI3 C;  1BMO A;  2NU1 I;  3SGQ I;  2JXD A;  1TUR A;  1TBO A;  1Z7K B;  2V1C A;  2OVO A;  3B4V C;  2E73 A;  1NUB A;  2V53 A;  2QQC A;  5EX3 A;  2VRW B;  1W3S A;  1AN1 I;  2ARP F;  1SGN I;  3E59 A;  3FC3 A;  2NU4 I;  2QPO A;  1X4S A;  2ENN A;  1R79 A;  2ODD A;  2SGF I;  2WCY A;  1OMU A;  3GOX A;  1TIH A;  1LR7 A;  1KBE A;  1CSO I;  2QQD A;  1KMA A;  2N17 A;  2XRC A;  3OXL A;  5HI7 A;  1V1H A;  1PCE A;  4UXJ A;  2JYY A;  3TJQ A;  3CXL A;  3D00 A;  1IY6 A;  2KMR A;  1UUC A;  2LEO A;  1SGE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...