2QQRA

Jmjd2a hybrid tudor domains
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
118
structure length
118
Chain Sequence
GHMQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distinct binding modes specify the recognition of methylated histones H3K4 and H4K20 by JMJD2A-tudor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords JmjC domain-containing histone demethylation protein 3A
total genus 21
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qqrA01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2qqrA02
5FRMA 1G5VA 3SD4A 2RO0A 4Z02A 2HQXA 2DIQA 2O4XB 3E9FA 3OYCA 5C0MA 1H3ZA 2D9TA 4BDZA 5J26A 3OQ5A 2LVMA 1WJRA 3OS0A 3NTIA 3L2UA 1WGSA 2RHXA 2X4YA 2QQRA 3LH0A 3LGLA 4QVZA 2XDPA 1OI1A 4C5GA 2EQJA 5M9OA 3OYNA 2RJFA 4ZTJA 3OYAA 3META 2R58A 4C5HA 3C4SA 3S3NA 5KE3A 3MO8A 3QIIA 3OYJA 4EDUA 1N27A 3F70A 1OZ3A 4QW2A 3PMTA 2VYTA 5KCOA 3OS1A 3OY9A 4ZTFA 2RHIA 2L89A 4IUVA 3UWNA 4FL6A 5J39A 3O8VA 3LGFA 1MHNA 3DLMA 3KUFA 3S6WA 2BUDA 2X4WA 3OB9A 5CIUA 2CKKA 4C5IA 5KCHA 3OMGA 3OYIA 4RG2A 2EQUA 3S3MA 3M9QA 5D6XA 1OYXA 5KH6A 1WJSA 3ME9A 2JTFA 4A4GA 4BD3A 3L2WA 2L3RA 3ZEHA 4E7JA 3L2QA 3OYKA 3Q1JA 2RHUA 2G3RA 2RI3A 2R5MA 2BKDN 4FU6A 2GFUA 2RHYA 4E7IA 4E7KA 3OYGA 4IUPA 2MWPA 4PLLA 3P8DA 3PMIA 1XNIA 3OYBA 1SSFA 2GF7A 3H8ZA 4HCZA 5IAYA 3OYDA 4A4EA 4E7HA 2RI5A 2LRQA 2XK0A 3QBYA 2LCCA 3L42A 4BDYA 2DAQA 3QJ6A 2M1HA 4L59A 2EKOA 4Q5WA 4A4HA 2EFIA 2RJDA 2RI2A 3BDLA 3MP1A 4UC4A 3L2VA 3OMCA 5FRNA 4N4IA 5D6YA 4QQDA 2HQEA 4IURA 5D6WA 5FROA 2JZ2A 3E9GA 3L2RA 2PQWA 3DB3A 2LTOA 2F5KA 4N4GA 3PNWC 2R57A 2EQMA 2NLUA 3H6ZA 4PLIA 2M16A 3LX7A 2E6NA 2O4XA 2YRVA 3OYEA 2R5AA 2E5QA 3MEAA 2QQSA 2BIVA 3ASKA 3CEYA 3EAEA 4IUQA 4QQ6A 3UT1A 3OA6A 5IN1A 4B9WA 1OZ2A 3OYFA 2L8DA 3PFSA 3S3OA 3MEVA 4IUUA 3FLGA 3MP8A 2M0OA 4BE1A 2MWOA 3OYHA 4OVAA 3LYIA 3P8HA 2RHZA 4N4HA 3OYLA 2P0KA 3QKJA 2X4XA 1RI0A 2X35A 1WJQA 4IUTA 3FC3A 1KHCA 4II1A 2GFAA 3GOXA 4B9XA 3FEOA 2B8AA 4PL6A 4GY5A 2RJEA 2EQKA 3NTHA 2DIGA 2FHDA 2K3YA 4LD6A 3DB4A 4BE0A 3MP6A 5KE2A 3LLRA 4X34A 4QQGA 4NS5A 3FDRA 3OS2A 2WACA 4C5EA 4IKFA 5C6SA 2LDMA 4A4FA 4BACA 3MEWA 4BE2A 2IG0A 2RJCA 3MEUA 3OYMA 2K3XA 3NTKA 4CRIA 4E7LA
chains in the Genus database with same CATH superfamily
2NUPB 2BE7D 2K5IA 4M75E 4M75F 2OTJT 5J26A 4BY6B 3EGXB 4HVVA 4ZTJA 1OI1A 5CKDA 4N0AA 2A3LA 1FWZA 2C06A 2C0OA 4M77E 2E70A 3QJYA 3HRTA 2JM8A 4KGZB 5GMKl 1OULA 4J9GA 2GTOA 4J7IA 1WJSA 3HTRA 3M0TA 1UGQB 2ZPIB 2RF0A 2RHUA 2DJQA 2JM9A 1MNEA 2GFUA 2AKLA 2HL5C 3C95A 1K9MR 2XIDA 5GAN4 1AWWA 2KRSA 1D1BA 4DQ2A 1VQPQ 2DXCA 1PCXA 3TIWA 3QJ6A 5CAIA 4OB3B 1B34A 1UUEA 4Q5WA 4KODA 4TVRA 4M78F 1YJ9A 2GQVA 5IXFA 1X01A 1ACMB 1X43A 2JZ2A 3OW2A 3EGXA 3DB3A 3VUBA 2NLUA 2DPPB 5GAN7 2KYMA 5GAN2 3CC7A 1JJ2A 4M75B 1K73C 2J6OA 1UE9A 4OF1A 2PUOB 1EFNA 1YJ9T 2EKHA 1BIAA 2Q18X 4RKUE 1J3TA 1R0CB 2ROTA 2DL4A 4JRIA 2DILA 2MIOA 1UGPB 1D09B 2QG9B 3JB9I 2FHDA 1YJWQ 5L23A 1S72A 2IPOB 4C5EA 3X24B 4JJBA 1WXBA 3MEWA 4Z88A 2YUNA 3BDUA 2J06A 4EPCA 5GAN3 4LUEA 4VUBA 4AS1A 5C1BA 1HXDA 2YRCA 4N0AC 1NEGA 3M4GA 1VQLQ 1H3HA 3QZ5B 3JCMb 2VXEA 4FYWB 1I07A 2LJ3A 5GANf 3CMAA 3JB9F 2C0TA 2DRKA 3C4SA 1CKAA 4C92F 3PGGA 4IIOA 2P4TA 3EFOB 4GBQA 4M78A 1M90R 4CC7A 1K8AR 3CCST 2QTXA 2CZ7B 3OMGA 3M9QA 5D6XA 3REBB 5LL6S 4ZNXA 2F5TX 2L3RA 1KG1A 4E7JA 2K79A 2CP7A 4XAXB 2AK5A 2RPNA 4C8QB 1I1JA 3G7ZA 4J6WA 1K1ZA 1RAIB 4LDXA 4LNPA 3JCMJ 1KIKA 4ESRA 2RI5A 2FEIA 1WHKA 4LXCA 5CQXA 2YUOA 4M77C 4EMKA 3VRYA 1JJ2S 5GAMd 2M1HA 3CCMQ 1I81A 1PM3A 2ZZDA 4A4HA 1TS9A 4HCCA 3BDLA 1PSEA 5FRNA 2K7AA 2DA9A 4MMLA 2DD5A 2COWA 1B34B 3RKYA 3CBOA 4HVUA 3OYEA 4JPBW 4FYVB 2CYZB 2C0IA 1YJWT 1W2BS 3FLGA 3TSZA 5AYFA 2P0KA 2DRMA 3HRUA 4CC3A 3NPFA 5FU6B 1KHCA 1ZA2B 1D1CA 4RMOA 4C92B 3EGUA 2BE9B 3D7SB 1S72T 2XDDA 1JJ2P 1YWOA 3VV0A 3G71Q 1GFCA 1QVPA 1PKSA 2QQBA 2J6FA 3T9NA 4LN2A 2RK2A 4M7AF 1RAEB 4CC4B 1VQNA 1KD1C 3CXCS 3OSVA 2QDLA 2KGTA 2M02A 1EZZB 3OBWA 1WJRA 3E1SA 3LGLA 1ZSZC 2RJFA 1KQ2A 1ABQA 1AWOA 1BI2A 2EYWA 1Y57A 2ED0A 3S3NA 2F69A 4EDUA 5KYWA 3HFNA 1V1CA 1OOTA 2ESWA 3I56A 5LJ5g 2K2VA 1BU1A 3QQ7A 1OYXA 1U1SA 4DEYA 3JB9G 2KAFA 1KQSS 1YITQ 2GQIA 2RQUA 3L2QA 1PRLC 3UA6A 1WZOA 4LDWA 1LNXA 3WVEB 3TCJA 1YHQT 5CKHA 2QA4Q 2ZPHB 4PKCC 2OX7A 5IHIA 5CD1A 3CCQQ 4L59A 2EKOA 3GLXA 4XTYA 2CZ0B 1ZSZB 4M78E 1RUWA 3FPRA 2YLCA 2E65A 1WQ7A 3REAB 1W2BA 1AT1B 2KNBB 1SPKA 3UDCA 1MNDA 1QKWA 3H6ZA 2LC4A 2Z0WA 3EAEA 1M1GA 2MPXC 1E6HA 4QQ6A 1JXOA 3CCVT 3OYFA 9ATCB 4C8QG 1JO8A 2FRWA 2ZCFB 1ZQ1A 2ZPEB 4C8QC 1K73U 3DLLA 3PT9A 3GOXA 3MHXA 2KROA 4LDVA 3FEOA 2K3YA 4DBHA 1YJNQ 2QQAA 3NMZC 3ZFJA 1K9MU 1RAAB 4L6V5 2LDMA 5GMKi 2RQRA 1VQMA 2DK3A 2HAXA 4B6MA 1VQNT 1NBEB 2VUBA 2EYXA 1WHJA 4Z02A 4AG2C 1WLPB 2COZA 1VQ7Q 4JJCA 1NPRA 4NL3A 3OS0A 3TU4K 1KK7A 4AFSC 1VQOA 2XDPA 3QO3A 2YUPA 1UHCA 1Y96B 2LZ6B 1VQ7T 2VWFA 3QYGB 2IVWA 2D6FA 4RCBA 3FIFA 1LJOA 1UECA 4PNOA 1UDLA 3CCJA 3F70A 3TQ7P 4F7UA 3M0QA 1VYTA 2L89A 3UPUA 1N8RU 3CF2A 2OTLA 4JLIA 3BY7A 2ABLA 3KXTA 4J9DA 2DM1A 4J6XA 2G6FX 3JCMV 3VS7A 3MKDA 1X6BA 2FG0A 2G3RA 1RAFB 2R5MA 4LE9A 4HVWA 2EJ9A 3EH2A 3OYBA 2GNCA 4PJOG 1YHQA 1AWJA 2ENMA 3QBYA 4PJOC 1OX8A 4BDYA 4J9HA 1NPPA 1IGUA 4K11A 3I55T 1D0ZA 2XD0A 1FX7A 5A0DA 2OAWA 3L2RA 4OB1B 1OX9A 5C18A 3I5SA 3CCSQ 3PNWC 4KLNA 3RKWA 2HSEB 4DBRA 3LGAA 3GPLA 1I4K1 2O4XA 4DA4A 4OMPA 1TWBA 4XTXA 5FW9A 3MEVA 1QVGS 3MP8A 5ECAA 3OYHA 1SG5A 3UA7A 5LJ3d 2DEUA 3SHWA 3VJPA 2YDLA 5GANh 3FC3A 1WI7A 3JSCA 4A4KA 2VXFA 1KD1U 2M9UA 2HBPA 2JV2A 4C0GA 4NS5A 2HMAA 1UGVA 2PVGB 1YITT 1NJIR 2PWYA 2ED1A 4M75C 3OMCA 1ZBXA 4CRIA 2DX1A 1N8RR 4M7DB 1G5VA 3SDZA 1Y71A 4PJOF 2HQXA 5KYXA 4O5VA 1PHTA 3E9FA 2X51A 4F17A 2X3WD 2YLBA 3FJ5A 3RKXA 4OGEA 1R0BG 2DXBA 4KGXB 5CVIA 1ZUKA 2DVEA 3JCMP 3OYNA 2CP2A 3OYAA 2D8HA 3BE3A 1ZLMA 1NLOC 2JT4A 5AT1B 3PVLA 5KCOA 1TTHB 1S3SA 5GANe 1OPKA 2AT1B 3J7AF 1XOVA 2EVRA 5KH6A 1LCKA 2DETA 1AZEA 3ZL7C 5A0LA 3ZEHA 2VASA 3Q1JA 2JN0A 2RI3A 2LNVA 4OMLA 2XG8D 5CR2A 4PLLA 7AT1B 1GBQA 1EIFA 4HCZA 2XKOC 3OYDA 5KYUA 3V8LA 4AT1B 3CMAT 3CCEQ 3H0FA 1KC8C 1KFZA 5KYUB 5CKBA 2DEQA 5GAOr 4XU1A 2QAZA 2D8JA 2KMTA 2LNHB 4E7ZA 4KUDK 5GANg 1MV0B 2LTOA 1D3BB 2YWWA 3QG1A 1YWPA 1VQ5Q 4C8QE 4QKUA 4HT8A 2L5QA 3G1JA 3ASKA 3CD6T 1NG2A 3FPTA 1G83A 2PUKB 3TREA 4V2SA 2L8DA 3RNJA 2DZCA 4OVAA 4XTVA 2VGMA 2RB6A 2F1LA 1OU9A 1X2QA 4BE0A 3QQ8A 1K9AA 1RAGB 1ABOA 3TSWA 4QT7A 3OSSC 1PD0A 3FDRA 3FB9A 2O9SA 4BACA 4OMMA 2DL7A 3OYMA 2VVKA 2HNIA 3EFRA 2RO0A 2WSFE 1WPYA 2O4XB 4EMKB 3VRZA 3A8LB 3A8GB 2LX7A 1TUCA 1MMNA 1R7RA 1WGSA 2QEXA 1QMCA 2E12A 5HCKA 2COYA 3CC4Q 1C6VX 3EG2A 1KJWA 2OI3A 2P0QA 5J3BA 1HYOA 2D1XA 4M77D 2KRMA 3UWNA 3HP9A 3CC2A 2IIMA 5IXBA 3KUFA 3ZJTA 2RM4A 5GAOn 1OQKA 3QSUA 4RTUA 2JTFA 2CP3A 3CCVA 3AHUA 1W4SA 1YN8A 4JUVA 1YIJT 1WQWA 2OJ2A 4X9CA 2VV5A 3QDRB 2Q19X 3M57A 3A8OB 1IXDA 1M4ZA 2I2LA 1RACB 3M58A 1M30A 4C0DC 4MZPA 3CCRA 2Q1DX 2DERA 4M75D 2O31A 4XTUA 3G71T 1W6XA 4JRQA 4J9FA 2JS0A 4Y91A 8AT1B 2HQEA 4A53A 2A0FB 5CCBA 5GAMh 2K4YA 3JCMW 4N4GA 4ME7A 4Z8AA 3G6EA 2FPEA 2H3EB 4PLIA 3CD6A 4LUDA 3GF5A 3L1AA 3EG1A 4HXJA 1JEGA 3CXCA 1O54A 2DBKA 3RMQA 1NM7A 4FW1A 1VQOT 1G8XA 5DLQE 1I8FA 2KT1A 1WJQA 2MMPA 1R77A 2X35A 3HKSA 1CZ4A 1QVFP 3VU3C 2OTJA 1BCOA 2QDYB 2JJ9A 5KE2A 2RD1A 2DTOA 5IHNA 1NYGA 4M77B 3WVDB 5I11A 2ECZA 4BB7A 2CSIA 3X25B 3CMEA 1K4US 1G3YA 2YT6A 5A0GA 3VS0A 3V7CA 5FTNA 3CMAQ 3U23A 5DLOA 4RTTA 3CCUA 3JCMX 2K6DA 5CQYA 1SHGA 2PVOB 4M7AB 1QCFA 1VOMA 3QIIA 1YI2Q 1NE8A 1OPLA 2WSCE 3EH1A 1ZX6A 2DBMA 1QVFS 3MCAB 1HSQA 2RNAA 6AT1B 3VYHB 1VQ5T 2DE0X 3DLMA 1U5SA 2YUJA 1BB9A 4J6YA 4FSXA 4C0FA 1FYNA 4E2FB 4AQ7A 1JXMA 1QP2A 4J7FA 4E7IA 1MMAA 1MMGA 3JCMf 4P5NA 4E7KA 1QVGP 4M7AE 2EGEA 2LCLA 3L2ZA 3CCMA 3HFOA 4M7AD 3CBPA 2XK0A 2LQWA 3SB2A 1VQ7A 3C0CA 5B6CA 2OAUA 1T3LA 4F04B 5IH2A 1EX4A 2RMOA 2EGAA 4OP0A 1WNLA 1M90U 1G3WA 1N8RC 1VQ6T 2EYQA 2H8HA 1Q82U 3CCJT 3TEEA 1G3SA 3VKIA 1OEBA 2DO3A 2ZGWA 1NJIU 2R5AA 2E5QA 4ATOA 1KQSP 3OA6A 1H641 4B9WA 1VIFA 2DYIA 3NHNA 1JU5C 3GNGA 1KD1R 2MWOA 4RCCA 1VQKQ 4RV0A 2X4XA 3X28B 1F1BB 1PSFA 4ZN1A 4KO8A 3NTHA 4LD6A 2PNIA 3DB4A 1JRIA 1WHLA 2X4JA 2GGRA 3RMSA 2WACA 1ZC1A 3LHDA 2DVJA 3I55A 3RDVA 1WXTA 1SRMA 4JJNK 4FSSA 2EW3A 4HKEA 5CKEA 1UB4A 3JCMQ 3J81E 3QZ9B 5DY9A 3M0UA 3CCUT 3ZGZA 4L5GA 2EQJA 1Q7YU 1Q81U 2HCKA 4KRTA 1MUZA 3META 3JCMc 3P8BB 1T0JA 5HY6A 2YHTA 2RA2A 4XU2A 1KQSA 5GJWB 5J39A 4M7AC 3VS1A 4M78C 3S6WA 2X4WA 1VQ8T 1YITA 5KCHA 1QKXA 1K8AU 4RG2A 4C8QA 5LJ5j 3PIOA 4ELYC 1W1FA 3TVTA 2LW6A 2M51A 4J9CA 2B86A 2HEQA 4F16A 2W0ZA 4JZ4A 4FW2A 4AFQC 1WDXA 2YRDA 4F7UF 3EG0A 1GRIA 5D7UA 1IHVA 3IQLA 4C92G 2MCNA 2PQWA 1YJ9Q 2RQVA 4LDYA 4M77G 1VQ9A 1TUGB 2A7YA 2K2MA 1G3TA 1RABB 3ULRB 2KBTA 1X6GA 5IT9E 3UT1A 1X27A 3JCMe 1AZGB 3QUIA 5HK3A 3G4SQ 2M0OA 3LYIA 3P8HA 1SF9A 3X20B 2GCXA 1Q7YR 1Q81R 1UEBA 1RADB 4PL6A 5GAOp 4CQNA 3JB9J 4EIKA 2QI2A 3OYYA 4WCIA 2P4RA 2QASA 1BBZA 1D3BA 1D0XA 2V1RA 2EJFA 5EPPA 2QGFB 2DL3A 4M75A 3V7RA 3NTKA 5GAMe 4PJJA 4BUGA 2DXTA 1N6AA 1T0HA 3RBBB 3RUXA 5C0MA 2L3SA 4M78D 1TOVA 4HA8A 2BTTA 5FU7B 3CPWS 1YIJA 1E6GA 2RN8A 2X4YA 3JCMg 4QVZA 1VQLA 1KHIA 1VQPT 1Q86U 2Q1AX 4RTXA 3SWNB 1AD5A 4C5HA 2P84A 4KULA 1HJDA 1QDNA 4C8QF 4ZTFA 1GCQA 1XJWB 2A36A 5GJVB 1D1AA 1VQ8A 5I22A 1MHNA 5GMKe 2CKKA 2XU8A 3CC4T 2EQUA 2PJHB 1YJWA 3JCMh 3QWZA 1QW1A 3H9NA 3ZJUA 2FO0A 1YHQQ 1M3BA 1FMKA 2W10A 1NEBA 1AWXA 3LH5A 5L8RE 1MMDA 3KBGA 2F2WA 4E7HA 1VQ4T 3CCLT 2KXCA 1MV3A 3VS4A 4DBFA 4DBQA 1LVKA 2EWNA 2AIRB 5LJ5f 2EFIA 4ZGEB 1QVFA 2JW4A 2H3JA 2DJZA 3V7SA 2E3HA 1VQ9T 1BKBA 4M7DD 2MAMA 1X69A 2JNGA 5GMKm 5EG2A 3MEAA 4YTLA 1NLPC 2E41A 2WSEE 1RAHB 1Q82C 4BE1A 5LJ5h 4N4HA 3OYLA 4M78G 2CS7A 3I56T 2MI6A 3M5AA 1SKUB 3MP6A 4M7AA 4X34A 3EFOA 5GANj 4PJOE 1AVZC 2CT3A 2LT4A 2RJCA 3BW1A 3G71A 1WHGA 2J05A 2KR3A 2VKNA 5DM7R 3M4YA 5DYGA 1WYXA 4BDZA 1FMVA 5LJ3e 1E32A 4PJOA 3GNFB 1PNJA 4PFPA 4OMOA 1P92A 3CCMT 2K9GA 5CK9A 1M1KU 1K0XA 3HU2A 4XTWA 3V8JA 2HZYA 5KE3A 2NYSA 4Y28E 4OMQA 3OW2P 1Z9ZA 3PMTA 4OGCA 2RH2A 1X2KA 3THKA 1BCMA 4F7UG 3L2WA 3QC8A 2BZYA 1UFFA 3LWHA 3E19A 1W2BP 1RL2A 3URGA 4KGVB 4QVDA 3CCLA 5LJ5e 1K8AC 1M3CA 3H8ZA 3EG9A 1GCQC 1YBYA 2LCCA 5IHKA 1RLPC 2Y90A 5CCAA 2AKKA 1WIEA 3M53A 2V8JA 4UC4A 2DZ9A 4JRPA 4RTVA 4QQDA 1TU0B 4R56A 3VS3A 2KK4A 1X75C 2KXDA 3HHTB 4M77F 5LJ3h 4C8QD 3S3OA 4FCYA 3EGDA 2ZPFB 4LD9K 1VQ6Q 4ORZA 4LDUA 2O2OA 2V26A 4RTZA 2OTLT 1U3OA 2D0QB 4B9XA 1B3QA 2RJEA 4F14A 1ZBJA 1M2VA 4QQGA 1IREB 2EBPA 1K73R 2HSPA 2L3PA 3M54A 5LJ3f 1N9SA 1OU8A 4WF2A 5FRMA 1I5OB 4HT9A 3WXMB 4PFOA 1VUBA 1AEYA 4JRKA 3CCET 2RK1A 3CC7T 2SEMA 3LH0A 2VC8A 4C5GA 1U06A 1E7OA 1VYVA 3GIBA 2DF6A 1QVGA 1YNZA 1ZSGA 1SEMA 1OZ3A 2JTEA 4IUVA 2JMCA 2MM2A 1K9MC 2VGNA 3CCJQ 2BUDA 4FT2A 1IO6A 2F2VA 3C94A 4BD3A 2CZ1B 2EAYA 2NUTA 3A8MB 4C0DB 1KC8U 2KYBA 4PJNA 3CXCP 4IUPA 2MWPA 1Y96A 2ZPGB 3MJXA 4D6WA 4JS4A 3EG3A 1YFNA 2LRQA 2M0YA 3PIPA 4J9IA 3PE0A 3HPWA 4CI0C 1OV3A 1NYFA 1VQNQ 4MZTA 1XQHA 4N4IA 2Y4XA 3OW2S 5FROA 3G6EQ 3DKMA 4OB2B 2AZSA 2QTVA 4M7DC 3VUZA 3J80E 3CCSA 2KVQG 3VS2A 4C0ZA 3A5ZB 5GAOq 3PFSA 3OS5A 1Q86R 1QCNA 2KSSA 2MK5A 1B07A 1YCYA 1BI1A 3GBQA 1Y0MA 2FYKA 3PVQA 1W70A 3CQTA 1ZHIA 2GFAA 4X1VA 2DTIA 4GY5A 3M55A 3BQBA 3CMEQ 2DL5A 1PC0A 4XQ3A 4FT4A 4A4FA 2QGGA 5GAOl 2X9HA 4ZN3A 2JXBA 4AFUC 3SD4A 2DIQA 1ZSZA 3RIRA 1JBMA 2D9TA 3CC2T 4M7DA 2LVMA 2A28A 2K57A 5EQJB 2PZ1A 5CO7A 4IKFA 2QQRA 2JTMA 3QHSA 2YXYA 3EG9B 2K5FA 1CKBA 4FIBA 5LJ3j 2KDSA 3I56Q 1N9RA 1KQ1A 4BI3A 3OYJA 2MYSA 1QWFA 4QW2A 2ZPBB 4AMCA 2DD4A 1M90C 3O8VA 3R6NA 1Y07A 2B25A 1M1KC 2LT1A 4MMKA 2GBQA 2O9VA 1Y7XA 2KE9A 1Z9QA 5I21A 1UTIA 5FTKA 1VYUA 2DFUA 2FRYA 3ME9A 4MDWA 4A4GA 4BY6C 4ELZC 1ZUUA 3HU1A 2LMJA 3SEMA 3PMIA 1XNIA 2XICA 2DNUA 4KT0E 4R0KA 4A4EA 5GMKh 2JVVA 3CCQA 2E4HA 3HU3A 2DKGA 2DAQA 1VQMQ 4PJOD 3NGPA 1C0MA 2CUDA 1U8RA 2RJDA 4E6RA 4F7UB 1VQPA 5HK0A 5A2QE 5KYYB 4PK4A 2LX9A 4KDLA 1BI0A 2QYZA 2V8IA 5LJ3g 1YP5A 3JB9D 1V76A 3CCQT 4AFZC 2MF2A 1U1TA 1UGRB 1UHFA 4C92D 3CC7Q 2E3IA 1Q82R 1VQKA 1DJ7B 2FPDA 4NOYA 2NUZA 3QXEB 3UATA 1PWTA 3QKJA 2DXUA 2EQIA 4QVCA 1BI3A 1IRXA 4IUTA 3HRSA 4C92E 1WFWA 2PVDB 1M8MA 2HL3A 1VQ4A 2EGCA 1IZ6A 4M7AG 2RQWA 3I55Q 1VQKT 1M5Q1 3HL8A 4XU0A 1QQJA 4BE2A 3SFMA 1IGQA 1I5LA 1RI9A 3MPUB 1VA7A 5FU6C 3CPFA 3L2UA 4JJDA 4JDSA 2R58A 2QEXQ 5FTLA 2CREA 1M1FA 2HBWA 2OTLQ 2QK0A 1N27A 3G6ET 1TUDA 4KH0B 2ATCB 2RHIA 5KYNA 3JCMd 4FL6A 5DYIA 1KC8R 1R8OB 1GCPA 3INZA 1GL5A 3JB9H 1VIEA 2D0NA 1AHJB 4ZGDB 5FWCA 4X9DA 4XTZA 5CCXA 5GMKj 4FU6A 3OYGA 3P8DA 3M0SA 5IAYA 2J7IA 3L42A 4D8DA 3EGDB 3SWNA 2AHJB 3MB5A 2F2XA 1NZ9A 4J9EA 3RERA 1S1NA 3QYHB 1CZ5A 1MGQA 2YVLA 2CH4W 2F5KA 2MOXA 2DL8A 4RUGA 2HKNA 2CT4A 4J8OA 2A08A 3CPWP 5KYYA 3CC2Q 3G4SA 2BIVA 3AT1B 2JUFA 1YCSB 4PJLA 3E2UA 1N5ZA 3JV3A 1WHHA 1NJIC 5GLFA 4KUIA 3A1PA 3QWXX 3N5BB 1BIBA 4OB0B 3JAME 1G2BA 1B7TA 4HCBA 4O6JA 4PJMA 3RR6A 2JMAA 4JZ3A 1RLQC 2XMFA 4CC2A 3OQ5A 3CD6Q 5M9OA 1X6OA 5GAMj 4M7DF 1M2VB 5EC7A 4PJOB 3CCUQ 1KSWA 5GAN6 2BZ8A 1VQ8Q 2YUQA 1VQ6A 3ER0A 3OY9A 2VYTA 1VQ5A 2A37A 1SHFA 4C5IA 5CIUA 1UJYA 1M9SA 2HDAA 3OYIA 2P0PA 1LPLA 3H0IA 2CSQA 3EHQA 4A54A 2QA4T 3OYKA 2LQKA 2RHYA 1WX6A 4MDXA 3CCEA 1SSFA 2GF7A 3LWIA 3V8KA 1ARKA 1S72Q 4FYXB 1BK2A 2DMOA 5GAOm 1K76A 2CUBA 5FWBA 5ERGB 1WHMA 2NUPA 4DEXA 2QA4A 3L2VA 5D6YA 1GFDA 4IURA 3FJPA 4ANJA 1GBRA 2CDTA 2Q1CX 1QCSA 2NUTB 2LJ1A 2E1HA 4NL2A 3G4ST 2DLPA 4D8KA 4M7DG 5IN1A 2LCSA 2GTJA 2BZXA 1LOJA 3ZJVA 2JS2A 2XI9A 4FYYB 1QWEA 1RI0A 1IHWA 3M0RA 1QLYA 3M0PA 2EQKA 4KBMB 1O9SA 2X3XD 4OMFB 1T3SA 1GXIE 5C6SA 4Y92A 4RTYA 4Z89A 3EHRA 3MEUA 1Q86C 4PFZA 5FLXE 2KY9A 2KEAA 5GAN5 2LQNA 3CCRQ 2ROLA 4JS5A 3NTIA 4DOWA 3CC4A 3A8HB 4J9BA 5GAMf 1I9GA 1C1AA 2ZAEA 4C92A 1XTDA 4M78B 2E6ZA 1UJ0A 4XK8E 3OS1A 4M7DE 4KDIA 1HK9A 2V1QA 1TH7A 4GLMA 3CCVQ 3M59A 1UG1A 5I2SA 2EYYA 2E10A 1A0NB 3CCLQ 1M27C 1AOJA 1SSHA 2BKDN 2FB7A 3H41A 2OTJQ 4EMHA 4WTOB 1BYMA 2NWMA 2FL7A 1CR5A 5FTMA 1UGSB 3SWNC 2PTKA 3EFSA 4DOVA 2KI7A 2XHCA 2FZGB 4GLKA 2KRNA 2RI2A 1YI2T 2FZKB 1M2OA 5D6WA 2E64A 3I9QA 4KH1B 1WXUA 2HD0A 4M4ZA 2KQWA 4ZGJB 2R57A 3KFVA 1WA7A 1Q95G 1ZUYA 2M16A 4XU3A 5LJ5d 5KYWB 1VQLT 2FPFA 2QQSA 1WLFA 2KT8A 1VQ9Q 1PD1A 1OZ2A 4IUUA 1YI2A 3FPUA 4F7UE 2MM0A 3UF4A 3HSBA 3GP8A 4OMNA 2FZCB 4BI4A 8ATCB 2CGHA 3S3MA 1D0YA 2DIGA 2SRCA 4J83A 2J6KA 1K0SA 4JLGA 3LLRA 3O5ZA 1I0CA 3FRNA 3H0HA 2QXFA 3CCRT 2E5KA 2EJGA 1SRLA 2FVUA 2RQTA 2IG0A 3PTAA 4E7LA 2AZVA 3CMET 1JB0E 4MZMA 3OYCA 5FU7C 1H3ZA 2HKQB 4E7SA 3QDFA 4BI8B 1JQQA 5FTJA 1FXXA 2RHXA 1QCOA 2K3BA 3QPHA 2EYZA 2L0AA 3VS6A 2JOYA 3VYGA 3MO8A 3A98A 4A63B 1TG0A 4R55A 2VB6A 2DYBA 2Y4YA 1YJNT 1FMWA 4C92C 3QWYA 4EMGA 2YSQA 4J5YA 3LGFA 3OB9A 3CPWA 3CBMA 2QEXT 2LQ8A 1VQ4Q 4M75G 2L3QA 4AG1C 5GAN8 5KYXB 3BFMA 1H8KA 2CZ6B 3R6OA 5CKFA 1TXQA 2CP0A 2L2PA 1QP3A 2O01E 1M1KR 1YJNA 5GAMg 2V8KA 3C12A 2DTHA 4ARIA 4ARCA 3I5RA 1CSKA 2EIFA 2QQ9A 1YIJQ 1PG5B 1M8VA 2K5LA 3RESA 3MP1A 4E47A 1TSFA 1VQMT 2PU9B 3E9GA 1ZA1B 2I0NA 4M77A 4EMKC 1PKTA 2EQMA 4HCKA 1VQOQ 3LX7A 2E6NA 2YRVA 3ZBDA 2HQHA 3CEYA 3X26B 4IUQA 5GANd 3LW5E 2CP5A 1H92A 2EPDA 4FM4B 1Q7YC 1Q81C 3JRZA 4IIMA 2LP5A 1O75A 5I2MA 3VS5A 4RTWA 3NFCA 2RHZA 2CH4A 3I35A 2LJ0A 2CP6A 4II1A 1V29B 1IB8A 2O88A 2B8AA 4RG8A 3OBYA 1PRMC 2XDBA 1HD3A 5HKCA 3OS2A 1M3AA 3M56A 2K3XA
chains in the Genus database with same CATH topology
5GAMe 3SDZA 1Y71A 1G5VA 4PJOF 2HQXA 4BUGA 2DXTA 1N6AA 4O5VA 2K5IA 3E9FA 4M75E 4M75F 3RUXA 5C0MA 4M78D 5FU6C 3CPWS 4HA8A 5FU7B 2YLBA 5J26A 3RKXA 4BY6B 1YIJA 4OGEA 3CPFA 2DXBA 3L2UA 5CVIA 2X4YA 2DVEA 4QVZA 3JCMg 3JCMP 4ZTJA 1OI1A 3OYNA 5CKDA 1VQLA 1KHIA 1VQPT 3OYAA 4JDSA 4N0AA 2A3LA 1Q86U 2Q1AX 1FWZA 2C06A 2R58A 3SWNB 4M77E 2E70A 4C5HA 3QJYA 5FTLA 4KULA 3HRTA 1M1FA 1N27A 5KCOA 1QDNA 3G6ET 1S3SA 4C8QF 4ZTFA 2RHIA 5GANe 3JCMd 4FL6A 5GMKl 1VQ8A 5DYIA 1MHNA 5GMKe 1R8OB 2CKKA 2XU8A 3CC4T 2EQUA 3INZA 3J7AF 2PJHB 1XOVA 5KH6A 4J7IA 3JB9H 1VIEA 1YJWA 1WJSA 1AHJB 3JCMh 4ZGDB 5A0LA 3QWZA 1QW1A 1UGQB 4X9DA 4XTZA 2ZPIB 3ZEHA 5GMKj 2OTJT 5CCXA 3Q1JA 3ZJUA 2RHUA 2JN0A 2RI3A 2LNVA 2XG8D 4FU6A 2GFUA 5CR2A 3OYGA 4PLLA 3P8DA 3C95A 1EIFA 5L8RE 2XIDA 4HCZA 3KBGA 5GAN4 2XKOC 5IAYA 3OYDA 3V8LA 4E7HA 1VQ4T 3CCLT 2B25A 3L42A 3CMAT 4DQ2A 3SWNA 2DXCA 2AHJB 3MB5A 1NZ9A 3QJ6A 5CAIA 4OB3B 1KC8C 3TIWA 1B34A 2EWNA 5CKBA 2DEQA 4Q5WA 4KODA 5LJ5f 2EFIA 4XU1A 5GAOr 4TVRA 4ZGEB 4M78F 3RERA 1QVFA 1YJ9A 2GQVA 1X01A 2KMTA 2H3JA 3QYHB 1CZ5A 2JZ2A 2DJZA 3V7SA 3OW2A 4KUDK 1MGQA 2YVLA 3DB3A 5GANg 2LTOA 3VUBA 1VQ9T 2F5KA 1BKBA 4M7DD 2NLUA 2DPPB 2MAMA 5GAN7 1D3BB 3QG1A 5GAN2 3CC7A 4J8OA 1JJ2A 2JNGA 4M75B 4C8QE 5GMKm 1K73C 3NTKA 2L5QA 3MEAA 3ASKA 2BIVA 5EG2A 4YTLA 3G4SA 4HT8A 2PUKB 3CD6T 3FPTA 3TREA 2JUFA 4V2SA 4OF1A 2L8DA 2E41A 2PUOB 2WSEE 1YJ9T 2DZCA 1BIAA 1Q82C 2Q18X 4BE1A 4RKUE 5LJ5h 4OVAA 4N4HA 4XTVA 3OYLA 4M78G 2CS7A 2VGMA 1M1KC 1NJIC 3I56T 2MI6A 2RB6A 4JRIA 5GLFA 3M5AA 4KUIA 1UGPB 3JB9I 4BE0A 3QQ8A 2FHDA 3MP6A 4M7AA 4X34A 3OSSC 3FDRA 1S72A 5GANj 4PJOE 3FB9A 4C5EA 3X24B 3N5BB 1BIBA 4BACA 4OB0B 3MEWA 3JAME 2LT4A 3BDUA 2RJCA 3BW1A 4EPCA 3OYMA 4HCBA 3G71A 4O6JA 5GAN3 2HNIA 3EFRA 2RO0A 2WSFE 4VUBA 4AS1A 1WPYA 5C1BA 1HXDA 2O4XB 4EMKB 4N0AC 5DM7R 4KO8A 3M4YA 3A8LB 5DYGA 3M4GA 3A8GB 4BDZA 3OQ5A 5LJ3e 1E32A 4PJOA 3QZ5B 3GNFB 3JCMb 1R7RA 2VXEA 1WGSA 2QEXA 1P92A 3CCMT 5M9OA 5GANf 2E12A 1X6OA 5CK9A 5GAMj 3CMAA 1M1KU 3JB9F 4M7DF 3HU2A 4XTWA 3V8JA 4PJOB 2P0QA 5J3BA 5GAN6 3C4SA 5KE3A 4Y28E 1VQ6A 4M77D 3ER0A 4C92F 3OY9A 3PGGA 3PMTA 2VYTA 4OGCA 2P4TA 2RH2A 1VQ5A 3UWNA 3HP9A 4M78A 3CC2A 3CCST 3KUFA 4C5IA 3ZJTA 5CIUA 2RM4A 2QTXA 2CZ7B 4F7UG 1M9SA 3OMGA 5GAOn 3OYIA 2P0PA 3M9QA 5D6XA 5LL6S 3QSUA 2JTFA 2F5TX 3L2WA 2L3RA 4A54A 3QC8A 1KG1A 4E7JA 2QA4T 3OYKA 2LQKA 4XAXB 3LWHA 3E19A 3CCVA 3AHUA 1RL2A 2RHYA 3URGA 4C8QB 1W4SA 4QVDA 4JUVA 1YIJT 4MDXA 3G7ZA 4J6WA 1WQWA 3CCLA 4X9CA 5LJ5e 1SSFA 2GF7A 2VV5A 3H8ZA 3LWIA 3CCEA 3QDRB 3JCMJ 1K8AC 2Q19X 2RI5A 3V8KA 3M57A 3A8OB 1YBYA 1M4ZA 2I2LA 2LCCA 5CQXA 3M58A 4C0DC 2Y90A 4MZPA 4M77C 4EMKA 5CCAA 1JJ2S 3CCRA 5GAMd 2Q1DX 5GAOm 2M1HA 1I81A 2ZZDA 5ERGB 4M75D 4A4HA 3M53A 2V8JA 4HCCA 3BDLA 4UC4A 1PSEA 2DZ9A 4XTUA 3L2VA 3G71T 2QA4A 4JRQA 4Y91A 5D6YA 4JRPA 5FRNA 4QQDA 4MMLA 2HQEA 4IURA 3FJPA 4A53A 2DD5A 5CCBA 5GAMh 2K4YA 1B34B 3JCMW 4R56A 2Q1CX 1QCSA 4N4GA 4ME7A 3RKYA 2E1HA 3G6EA 3CBOA 4PLIA 2KK4A 4NL2A 1X75C 3G4ST 3CD6A 3OYEA 3GF5A 3L1AA 3CXCA 1O54A 3HHTB 4M77F 4M7DG 5LJ3h 2CYZB 3RMQA 5IN1A 4C8QD 3S3OA 1YJWT 2ZPFB 3FLGA 1VQOT 1W2BS 4LD9K 5DLQE 1LOJA 3ZJVA 4LDUA 5AYFA 2P0KA 1I8FA 2XI9A 3HRUA 1RI0A 2X35A 1WJQA 2MMPA 5FU6B 3HKSA 2OTLT 1KHCA 1CZ4A 4RMOA 2D0QB 4B9XA 3VU3C 2RJEA 2EQKA 4C92B 2OTJA 2QDYB 1S72T 2XDDA 5KE2A 4KBMB 4QQGA 3VV0A 1O9SA 2RD1A 4OMFB 2DTOA 1IREB 4M77B 3WVDB 1QVPA 4BB7A 5C6SA 1GXIE 2QQBA 3T9NA 3M54A 5LJ3f 1N9SA 2RK2A 4WF2A 3X25B 3MEUA 3CMEA 4M7AF 2OTLA 5FRMA 1VQNA 1Q86C 3WXMB 5FLXE 2KY9A 1KD1C 4HT9A 1G3YA 3CXCS 5GAN5 3OSVA 5A0GA 3V7CA 1VUBA 5FTNA 3OBWA 4JS5A 4JRKA 1WJRA 5DLOA 3CCET 3E1SA 3NTIA 4DOWA 2RK1A 3CC4A 3CC7T 3A8HB 3LH0A 3LGLA 2VC8A 5GAMf 3JCMX 3CCUA 4C5GA 1I9GA 5CQYA 2RJFA 1KQ2A 2PVOB 4C92A 1BI2A 1XTDA 4M78B 4M7AB 3GIBA 2E6ZA 1QVGA 3S3NA 3QIIA 2F69A 1NE8A 2WSCE 4EDUA 4XK8E 1OZ3A 3HFNA 3OS1A 4M7DE 4IUVA 3MCAB 1QVFS 3I56A 5LJ5g 2MM2A 3VYHB 2K2VA 1K9MC 2VGNA 3DLMA 1VQ5T 4KDIA 2BUDA 4FT2A 1HK9A 1TH7A 3QQ7A 2YUJA 1OYXA 3M59A 1U1SA 4J6YA 3C94A 4BD3A 2KAFA 3JB9G 4FSXA 1KQSS 5I2SA 2CZ1B 4C0FA 2E10A 2EAYA 3L2QA 3A8MB 4C0DB 4AQ7A 1KC8U 1QP2A 2BKDN 4J7FA 3JCMf 4E7IA 4P5NA 4E7KA 4IUPA 2MWPA 1Y96A 2ZPGB 4LDWA 2FB7A 4M7AE 4EMHA 4D6WA 4JS4A 1LNXA 2LCLA 3L2ZA 1BYMA 3CCMA 2FL7A 2LRQA 3CBPA 2XK0A 3HFOA 3TCJA 3WVEB 1UGSB 3SWNC 3SB2A 1YHQT 1CR5A 1VQ7A 5FTMA 5CKHA 3EFSA 2ZPHB 4PKCC 3PIPA 2OAUA 4DOVA 5B6CA 5CD1A 2XHCA 3HPWA 4CI0C 4L59A 2EKOA 3GLXA 4XTYA 2CZ0B 4GLKA 2RI2A 4M78E 3FPRA 2YLCA 2E65A 3OMCA 4MZTA 1XQHA 4N4IA 1YI2T 2Y4XA 3OW2S 1WQ7A 5D6WA 5FROA 1W2BA 4OP0A 2E64A 1WNLA 1M90U 1G3WA 3DKMA 1N8RC 1VQ6T 4OB2B 2HD0A 2EYQA 3UDCA 1Q82U 2KQWA 4ZGJB 2R57A 1G3SA 3TEEA 3VKIA 3H6ZA 3CCJT 2DO3A 2ZGWA 2M16A 2LC4A 4XU3A 1VQ8T 4M7DC 1NJIU 3VUZA 5LJ5d 2R5AA 2E5QA 3J80E 3CCSA 1VQLT 2QQSA 3EAEA 1M1GA 4ATOA 2KVQG 1WLFA 4QQ6A 3OA6A 1H641 3CCVT 4C0ZA 4B9WA 1OZ2A 3A5ZB 5GAOq 3OYFA 3PFSA 4LDXA 1VIFA 4C8QG 4IUUA 1YI2A 3GNGA 2ZCFB 4F7UE 1ZQ1A 2MM0A 3OS5A 3FPUA 2MWOA 2ZPEB 4C8QC 4RCCA 3HSBA 3GP8A 2KSSA 1YCYA 1BI1A 4RV0A 2X4XA 1K73U 3DLLA 2FYKA 4BI4A 3PT9A 3X28B 1ZHIA 3GOXA 2GFAA 3MHXA 1PSFA 2CGHA 2DTIA 3FEOA 4LDVA 4GY5A 4ZN1A 3S3MA 3NTHA 2DIGA 2K3YA 3M55A 4J83A 3DB4A 4JLGA 1JRIA 2QQAA 4LD6A 3LLRA 3ZFJA 3BQBA 2X4JA 3FRNA 3RMSA 1K9MU 2WACA 2QXFA 4L6V5 4XQ3A 2LDMA 4FT4A 4A4FA 3CCRT 5GMKi 5GAOl 2EJGA 1VQMA 1ZC1A 2FVUA 4ZN3A 3LHDA 2IG0A 2DK3A 3PTAA 2HAXA 1VQNT 3I55A 2VUBA 4E7LA 3SD4A 1JB0E 3CMET 4Z02A 2DIQA 3RIRA 4MZMA 3OYCA 4JJNK 5FU7C 4HKEA 1JBMA 2D9TA 1UB4A 5CKEA 3JCMQ 3CC2T 4M7AD 3J81E 3QZ9B 5DY9A 4M7DA 1NPRA 2LVMA 4NL3A 3CCUT 2K57A 3OS0A 4BI8B 5EQJB 3TU4K 5FTJA 1FXXA 3ZGZA 2RHXA 5CO7A 4IKFA 2QQRA 2JTMA 3QHSA 1VQOA 2XDPA 3QO3A 4L5GA 2EQJA 3QPHA 1Q7YU 1Q81U 1Y96B 2JOYA 3META 3JCMc 1VQ7T 2K5FA 3QYGB 2IVWA 2D6FA 3VYGA 4FIBA 3P8BB 5LJ3j 4RCBA 2KDSA 1LJOA 3FIFA 4PNOA 1N9RA 3MO8A 1KQ1A 4BI3A 3OYJA 5HY6A 2YHTA 3CCJA 4R55A 3F70A 2RA2A 4QW2A 2ZPBB 4XU2A 4F7UA 1KQSA 2Y4YA 1YJNT 2DD4A 2L89A 5J39A 4C92C 1M90C 3O8VA 4EMGA 4M7AC 3UPUA 1N8RU 3CF2A 4J5YA 1Y07A 3LGFA 3BY7A 4JLIA 4M78C 3S6WA 2X4WA 3KXTA 3OB9A 1YITA 2LT1A 4MMKA 4J6XA 5KCHA 3CPWA 3CBMA 1K8AU 4RG2A 1Y7XA 4C8QA 2QEXT 2LQ8A 5I21A 5LJ5j 4M75G 3JCMV 5FTKA 3ME9A 4MDWA 4A4GA 3PIOA 5GAN8 4ELYC 3BFMA 4BY6C 4ELZC 2CZ6B 2G3RA 3R6OA 2LW6A 5CKFA 2R5MA 3HU1A 1QP3A 2O01E 2EJ9A 3PMIA 1XNIA 3OYBA 4PJOG 1YJNA 2XICA 5GAMg 2V8KA 4KT0E 4A4EA 5GMKh 1YHQA 3C12A 2JVVA 2DTHA 3CCQA 3QBYA 4PJOC 4ARIA 4ARCA 3HU3A 2QQ9A 2DKGA 2EIFA 4BDYA 1NPPA 2DAQA 4PJOD 1M8VA 2K5LA 4F7UF 3RESA 1U8RA 2RJDA 3MP1A 3I55T 4F7UB 1VQPA 2XD0A 5HK0A 1FX7A 4E47A 5A0DA 5A2QE 4M7DB 1VQMT 2PU9B 4C92G 3E9GA 2LX9A 3L2RA 4OB1B 4KDLA 2PQWA 5C18A 1BI0A 2V8IA 5LJ3g 4M77A 4EMKC 3PNWC 4KLNA 2EQMA 4LDYA 4M77G 3RKWA 3JB9D 1VQ9A 3CCQT 3LGAA 3GPLA 1I4K1 3LX7A 2A7YA 2E6NA 1G3TA 2MF2A 2O4XA 2YRVA 1U1TA 3ZBDA 1UGRB 4DA4A 3CEYA 3X26B 4C92D 4IUQA 5IT9E 3UT1A 3JCMe 5GANd 1VQKA 4XTXA 1DJ7B 3LW5E 4NOYA 4FM4B 3QUIA 3MEVA 5HK3A 1Q7YC 3JRZA 3MP8A 1Q81C 3QXEB 1QVGS 2M0OA 1H3ZA 1O75A 5I2MA 3OYHA 3LYIA 3NFCA 3P8HA 2RHZA 3X20B 3QKJA 5LJ3d 2DXUA 2GCXA 3VJPA 4QVCA 1BI3A 4IUTA 5GANh 3FC3A 3JSCA 4II1A 1V29B 4A4KA 3HRSA 4C92E 1UEBA 2B8AA 4PL6A 3OBYA 4RG8A 2PVDB 2VXFA 5GAOp 1KD1U 2M9UA 2HBPA 1VQ4A 2XDBA 1IZ6A 2JV2A 4CQNA 3JB9J 4C0GA 4M7AG 4NS5A 2QI2A 2PVGB 3OYYA 5HKCA 3OS2A 3M56A 1VQKT 1D3BA 1YITT 1M5Q1 3HL8A 2EJFA 4XU0A 5EPPA 4BE2A 3SFMA 4M75A 3V7RA 1I5LA 2PWYA 4M75C 2K3XA 1ZBXA 4CRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FRM A;  1G5V A;  3SD4 A;  2RO0 A;  4Z02 A;  2HQX A;  2DIQ A;  2O4X B;  3E9F A;  3OYC A;  5C0M A;  1H3Z A;  2D9T A;  4BDZ A;  5J26 A;  3OQ5 A;  2LVM A;  1WJR A;  3OS0 A;  3NTI A;  3L2U A;  1WGS A;  2RHX A;  2X4Y A;  2QQR A;  3LH0 A;  3LGL A;  4QVZ A;  2XDP A;  1OI1 A;  4C5G A;  2EQJ A;  5M9O A;  3OYN A;  2RJF A;  4ZTJ A;  3OYA A;  3MET A;  2R58 A;  4C5H A;  3C4S A;  3S3N A;  5KE3 A;  3MO8 A;  3QII A;  3OYJ A;  4EDU A;  1N27 A;  3F70 A;  1OZ3 A;  4QW2 A;  3PMT A;  2VYT A;  5KCO A;  3OS1 A;  3OY9 A;  4ZTF A;  2RHI A;  2L89 A;  4IUV A;  3UWN A;  4FL6 A;  5J39 A;  3O8V A;  3LGF A;  1MHN A;  3DLM A;  3KUF A;  3S6W A;  2BUD A;  2X4W A;  3OB9 A;  5CIU A;  2CKK A;  4C5I A;  5KCH A;  3OMG A;  3OYI A;  4RG2 A;  2EQU A;  3S3M A;  3M9Q A;  5D6X A;  1OYX A;  5KH6 A;  1WJS A;  3ME9 A;  2JTF A;  4A4G A;  4BD3 A;  3L2W A;  2L3R A;  3ZEH A;  4E7J A;  3L2Q A;  3OYK A;  3Q1J A;  2RHU A;  2G3R A;  2RI3 A;  2R5M A;  2BKD N;  4FU6 A;  2GFU A;  2RHY A;  4E7I A;  4E7K A;  3OYG A;  4IUP A;  2MWP A;  4PLL A;  3P8D A;  3PMI A;  1XNI A;  3OYB A;  1SSF A;  2GF7 A;  3H8Z A;  4HCZ A;  5IAY A;  3OYD A;  4A4E A;  4E7H A;  2RI5 A;  2LRQ A;  2XK0 A;  3QBY A;  2LCC A;  3L42 A;  4BDY A;  2DAQ A;  3QJ6 A;  2M1H A;  4L59 A;  2EKO A;  4Q5W A;  4A4H A;  2EFI A;  2RJD A;  2RI2 A;  3BDL A;  3MP1 A;  4UC4 A;  3L2V A;  3OMC A;  5FRN A;  4N4I A;  5D6Y A;  4QQD A;  2HQE A;  4IUR A;  5D6W A;  5FRO A;  2JZ2 A;  3E9G A;  3L2R A;  2PQW A;  3DB3 A;  2LTO A;  2F5K A;  4N4G A;  3PNW C;  2R57 A;  2EQM A;  2NLU A;  3H6Z A;  4PLI A;  2M16 A;  3LX7 A;  2E6N A;  2O4X A;  2YRV A;  3OYE A;  2R5A A;  2E5Q A;  3MEA A;  2QQS A;  2BIV A;  3ASK A;  3CEY A;  3EAE A;  4IUQ A;  4QQ6 A;  3UT1 A;  3OA6 A;  5IN1 A;  4B9W A;  1OZ2 A;  3OYF A;  2L8D A;  3PFS A;  3S3O A;  3MEV A;  4IUU A;  3FLG A;  3MP8 A;  2M0O A;  4BE1 A;  2MWO A;  3OYH A;  4OVA A;  3LYI A;  3P8H A;  2RHZ A;  4N4H A;  3OYL A;  2P0K A;  3QKJ A;  2X4X A;  1RI0 A;  2X35 A;  1WJQ A;  4IUT A;  3FC3 A;  1KHC A;  4II1 A;  2GFA A;  3GOX A;  4B9X A;  3FEO A;  2B8A A;  4PL6 A;  4GY5 A;  2RJE A;  2EQK A;  3NTH A;  2DIG A;  2FHD A;  2K3Y A;  4LD6 A;  3DB4 A;  4BE0 A;  3MP6 A;  5KE2 A;  3LLR A;  4X34 A;  4QQG A;  4NS5 A;  3FDR A;  3OS2 A;  2WAC A;  4C5E A;  4IKF A;  5C6S A;  2LDM A;  4A4F A;  4BAC A;  3MEW A;  4BE2 A;  2IG0 A;  2RJC A;  3MEU A;  3OYM A;  2K3X A;  3NTK A;  4CRI A;  4E7L A; 
#chains in the Genus database with same CATH topology
 2NUP B;  2BE7 D;  2K5I A;  4M75 E;  4M75 F;  2OTJ T;  5J26 A;  4BY6 B;  3EGX B;  4HVV A;  4ZTJ A;  1OI1 A;  5CKD A;  4N0A A;  2A3L A;  1FWZ A;  2C06 A;  2C0O A;  4M77 E;  2E70 A;  3QJY A;  3HRT A;  2JM8 A;  4KGZ B;  5GMK l;  1OUL A;  4J9G A;  2GTO A;  4J7I A;  1WJS A;  3HTR A;  3M0T A;  1UGQ B;  2ZPI B;  2RF0 A;  2RHU A;  2DJQ A;  2JM9 A;  1MNE A;  2GFU A;  2AKL A;  2HL5 C;  3C95 A;  1K9M R;  2XID A;  5GAN 4;  1AWW A;  2KRS A;  1D1B A;  4DQ2 A;  1VQP Q;  2DXC A;  1PCX A;  3TIW A;  3QJ6 A;  5CAI A;  4OB3 B;  1B34 A;  1UUE A;  4Q5W A;  4KOD A;  4TVR A;  4M78 F;  1YJ9 A;  2GQV A;  5IXF A;  1X01 A;  1ACM B;  1X43 A;  2JZ2 A;  3OW2 A;  3EGX A;  3DB3 A;  3VUB A;  2NLU A;  2DPP B;  5GAN 7;  2KYM A;  5GAN 2;  3CC7 A;  1JJ2 A;  4M75 B;  1K73 C;  2J6O A;  1UE9 A;  4OF1 A;  2PUO B;  1EFN A;  1YJ9 T;  2EKH A;  1BIA A;  2Q18 X;  4RKU E;  1J3T A;  1R0C B;  2ROT A;  2DL4 A;  4JRI A;  2DIL A;  2MIO A;  1UGP B;  1D09 B;  2QG9 B;  3JB9 I;  2FHD A;  1YJW Q;  5L23 A;  1S72 A;  2IPO B;  4C5E A;  3X24 B;  4JJB A;  1WXB A;  3MEW A;  4Z88 A;  2YUN A;  3BDU A;  2J06 A;  4EPC A;  5GAN 3;  4LUE A;  4VUB A;  4AS1 A;  5C1B A;  1HXD A;  2YRC A;  4N0A C;  1NEG A;  3M4G A;  1VQL Q;  1H3H A;  3QZ5 B;  3JCM b;  2VXE A;  4FYW B;  1I07 A;  2LJ3 A;  5GAN f;  3CMA A;  3JB9 F;  2C0T A;  2DRK A;  3C4S A;  1CKA A;  4C92 F;  3PGG A;  4IIO A;  2P4T A;  3EFO B;  4GBQ A;  4M78 A;  1M90 R;  4CC7 A;  1K8A R;  3CCS T;  2QTX A;  2CZ7 B;  3OMG A;  3M9Q A;  5D6X A;  3REB B;  5LL6 S;  4ZNX A;  2F5T X;  2L3R A;  1KG1 A;  4E7J A;  2K79 A;  2CP7 A;  4XAX B;  2AK5 A;  2RPN A;  4C8Q B;  1I1J A;  3G7Z A;  4J6W A;  1K1Z A;  1RAI B;  4LDX A;  4LNP A;  3JCM J;  1KIK A;  4ESR A;  2RI5 A;  2FEI A;  1WHK A;  4LXC A;  5CQX A;  2YUO A;  4M77 C;  4EMK A;  3VRY A;  1JJ2 S;  5GAM d;  2M1H A;  3CCM Q;  1I81 A;  1PM3 A;  2ZZD A;  4A4H A;  1TS9 A;  4HCC A;  3BDL A;  1PSE A;  5FRN A;  2K7A A;  2DA9 A;  4MML A;  2DD5 A;  2COW A;  1B34 B;  3RKY A;  3CBO A;  4HVU A;  3OYE A;  4JPB W;  4FYV B;  2CYZ B;  2C0I A;  1YJW T;  1W2B S;  3FLG A;  3TSZ A;  5AYF A;  2P0K A;  2DRM A;  3HRU A;  4CC3 A;  3NPF A;  5FU6 B;  1KHC A;  1ZA2 B;  1D1C A;  4RMO A;  4C92 B;  3EGU A;  2BE9 B;  3D7S B;  1S72 T;  2XDD A;  1JJ2 P;  1YWO A;  3VV0 A;  3G71 Q;  1GFC A;  1QVP A;  1PKS A;  2QQB A;  2J6F A;  3T9N A;  4LN2 A;  2RK2 A;  4M7A F;  1RAE B;  4CC4 B;  1VQN A;  1KD1 C;  3CXC S;  3OSV A;  2QDL A;  2KGT A;  2M02 A;  1EZZ B;  3OBW A;  1WJR A;  3E1S A;  3LGL A;  1ZSZ C;  2RJF A;  1KQ2 A;  1ABQ A;  1AWO A;  1BI2 A;  2EYW A;  1Y57 A;  2ED0 A;  3S3N A;  2F69 A;  4EDU A;  5KYW A;  3HFN A;  1V1C A;  1OOT A;  2ESW A;  3I56 A;  5LJ5 g;  2K2V A;  1BU1 A;  3QQ7 A;  1OYX A;  1U1S A;  4DEY A;  3JB9 G;  2KAF A;  1KQS S;  1YIT Q;  2GQI A;  2RQU A;  3L2Q A;  1PRL C;  3UA6 A;  1WZO A;  4LDW A;  1LNX A;  3WVE B;  3TCJ A;  1YHQ T;  5CKH A;  2QA4 Q;  2ZPH B;  4PKC C;  2OX7 A;  5IHI A;  5CD1 A;  3CCQ Q;  4L59 A;  2EKO A;  3GLX A;  4XTY A;  2CZ0 B;  1ZSZ B;  4M78 E;  1RUW A;  3FPR A;  2YLC A;  2E65 A;  1WQ7 A;  3REA B;  1W2B A;  1AT1 B;  2KNB B;  1SPK A;  3UDC A;  1MND A;  1QKW A;  3H6Z A;  2LC4 A;  2Z0W A;  3EAE A;  1M1G A;  2MPX C;  1E6H A;  4QQ6 A;  1JXO A;  3CCV T;  3OYF A;  9ATC B;  4C8Q G;  1JO8 A;  2FRW A;  2ZCF B;  1ZQ1 A;  2ZPE B;  4C8Q C;  1K73 U;  3DLL A;  3PT9 A;  3GOX A;  3MHX A;  2KRO A;  4LDV A;  3FEO A;  2K3Y A;  4DBH A;  1YJN Q;  2QQA A;  3NMZ C;  3ZFJ A;  1K9M U;  1RAA B;  4L6V 5;  2LDM A;  5GMK i;  2RQR A;  1VQM A;  2DK3 A;  2HAX A;  4B6M A;  1VQN T;  1NBE B;  2VUB A;  2EYX A;  1WHJ A;  4Z02 A;  4AG2 C;  1WLP B;  2COZ A;  1VQ7 Q;  4JJC A;  1NPR A;  4NL3 A;  3OS0 A;  3TU4 K;  1KK7 A;  4AFS C;  1VQO A;  2XDP A;  3QO3 A;  2YUP A;  1UHC A;  1Y96 B;  2LZ6 B;  1VQ7 T;  2VWF A;  3QYG B;  2IVW A;  2D6F A;  4RCB A;  3FIF A;  1LJO A;  1UEC A;  4PNO A;  1UDL A;  3CCJ A;  3F70 A;  3TQ7 P;  4F7U A;  3M0Q A;  1VYT A;  2L89 A;  3UPU A;  1N8R U;  3CF2 A;  2OTL A;  4JLI A;  3BY7 A;  2ABL A;  3KXT A;  4J9D A;  2DM1 A;  4J6X A;  2G6F X;  3JCM V;  3VS7 A;  3MKD A;  1X6B A;  2FG0 A;  2G3R A;  1RAF B;  2R5M A;  4LE9 A;  4HVW A;  2EJ9 A;  3EH2 A;  3OYB A;  2GNC A;  4PJO G;  1YHQ A;  1AWJ A;  2ENM A;  3QBY A;  4PJO C;  1OX8 A;  4BDY A;  4J9H A;  1NPP A;  1IGU A;  4K11 A;  3I55 T;  1D0Z A;  2XD0 A;  1FX7 A;  5A0D A;  2OAW A;  3L2R A;  4OB1 B;  1OX9 A;  5C18 A;  3I5S A;  3CCS Q;  3PNW C;  4KLN A;  3RKW A;  2HSE B;  4DBR A;  3LGA A;  3GPL A;  1I4K 1;  2O4X A;  4DA4 A;  4OMP A;  1TWB A;  4XTX A;  5FW9 A;  3MEV A;  1QVG S;  3MP8 A;  5ECA A;  3OYH A;  1SG5 A;  3UA7 A;  5LJ3 d;  2DEU A;  3SHW A;  3VJP A;  2YDL A;  5GAN h;  3FC3 A;  1WI7 A;  3JSC A;  4A4K A;  2VXF A;  1KD1 U;  2M9U A;  2HBP A;  2JV2 A;  4C0G A;  4NS5 A;  2HMA A;  1UGV A;  2PVG B;  1YIT T;  1NJI R;  2PWY A;  2ED1 A;  4M75 C;  3OMC A;  1ZBX A;  4CRI A;  2DX1 A;  1N8R R;  4M7D B;  1G5V A;  3SDZ A;  1Y71 A;  4PJO F;  2HQX A;  5KYX A;  4O5V A;  1PHT A;  3E9F A;  2X51 A;  4F17 A;  2X3W D;  2YLB A;  3FJ5 A;  3RKX A;  4OGE A;  1R0B G;  2DXB A;  4KGX B;  5CVI A;  1ZUK A;  2DVE A;  3JCM P;  3OYN A;  2CP2 A;  3OYA A;  2D8H A;  3BE3 A;  1ZLM A;  1NLO C;  2JT4 A;  5AT1 B;  3PVL A;  5KCO A;  1TTH B;  1S3S A;  5GAN e;  1OPK A;  2AT1 B;  3J7A F;  1XOV A;  2EVR A;  5KH6 A;  1LCK A;  2DET A;  1AZE A;  3ZL7 C;  5A0L A;  3ZEH A;  2VAS A;  3Q1J A;  2JN0 A;  2RI3 A;  2LNV A;  4OML A;  2XG8 D;  5CR2 A;  4PLL A;  7AT1 B;  1GBQ A;  1EIF A;  4HCZ A;  2XKO C;  3OYD A;  5KYU A;  3V8L A;  4AT1 B;  3CMA T;  3CCE Q;  3H0F A;  1KC8 C;  1KFZ A;  5KYU B;  5CKB A;  2DEQ A;  5GAO r;  4XU1 A;  2QAZ A;  2D8J A;  2KMT A;  2LNH B;  4E7Z A;  4KUD K;  5GAN g;  1MV0 B;  2LTO A;  1D3B B;  2YWW A;  3QG1 A;  1YWP A;  1VQ5 Q;  4C8Q E;  4QKU A;  4HT8 A;  2L5Q A;  3G1J A;  3ASK A;  3CD6 T;  1NG2 A;  3FPT A;  1G83 A;  2PUK B;  3TRE A;  4V2S A;  2L8D A;  3RNJ A;  2DZC A;  4OVA A;  4XTV A;  2VGM A;  2RB6 A;  2F1L A;  1OU9 A;  1X2Q A;  4BE0 A;  3QQ8 A;  1K9A A;  1RAG B;  1ABO A;  3TSW A;  4QT7 A;  3OSS C;  1PD0 A;  3FDR A;  3FB9 A;  2O9S A;  4BAC A;  4OMM A;  2DL7 A;  3OYM A;  2VVK A;  2HNI A;  3EFR A;  2RO0 A;  2WSF E;  1WPY A;  2O4X B;  4EMK B;  3VRZ A;  3A8L B;  3A8G B;  2LX7 A;  1TUC A;  1MMN A;  1R7R A;  1WGS A;  2QEX A;  1QMC A;  2E12 A;  5HCK A;  2COY A;  3CC4 Q;  1C6V X;  3EG2 A;  1KJW A;  2OI3 A;  2P0Q A;  5J3B A;  1HYO A;  2D1X A;  4M77 D;  2KRM A;  3UWN A;  3HP9 A;  3CC2 A;  2IIM A;  5IXB A;  3KUF A;  3ZJT A;  2RM4 A;  5GAO n;  1OQK A;  3QSU A;  4RTU A;  2JTF A;  2CP3 A;  3CCV A;  3AHU A;  1W4S A;  1YN8 A;  4JUV A;  1YIJ T;  1WQW A;  2OJ2 A;  4X9C A;  2VV5 A;  3QDR B;  2Q19 X;  3M57 A;  3A8O B;  1IXD A;  1M4Z A;  2I2L A;  1RAC B;  3M58 A;  1M30 A;  4C0D C;  4MZP A;  3CCR A;  2Q1D X;  2DER A;  4M75 D;  2O31 A;  4XTU A;  3G71 T;  1W6X A;  4JRQ A;  4J9F A;  2JS0 A;  4Y91 A;  8AT1 B;  2HQE A;  4A53 A;  2A0F B;  5CCB A;  5GAM h;  2K4Y A;  3JCM W;  4N4G A;  4ME7 A;  4Z8A A;  3G6E A;  2FPE A;  2H3E B;  4PLI A;  3CD6 A;  4LUD A;  3GF5 A;  3L1A A;  3EG1 A;  4HXJ A;  1JEG A;  3CXC A;  1O54 A;  2DBK A;  3RMQ A;  1NM7 A;  4FW1 A;  1VQO T;  1G8X A;  5DLQ E;  1I8F A;  2KT1 A;  1WJQ A;  2MMP A;  1R77 A;  2X35 A;  3HKS A;  1CZ4 A;  1QVF P;  3VU3 C;  2OTJ A;  1BCO A;  2QDY B;  2JJ9 A;  5KE2 A;  2RD1 A;  2DTO A;  5IHN A;  1NYG A;  4M77 B;  3WVD B;  5I11 A;  2ECZ A;  4BB7 A;  2CSI A;  3X25 B;  3CME A;  1K4U S;  1G3Y A;  2YT6 A;  5A0G A;  3VS0 A;  3V7C A;  5FTN A;  3CMA Q;  3U23 A;  5DLO A;  4RTT A;  3CCU A;  3JCM X;  2K6D A;  5CQY A;  1SHG A;  2PVO B;  4M7A B;  1QCF A;  1VOM A;  3QII A;  1YI2 Q;  1NE8 A;  1OPL A;  2WSC E;  3EH1 A;  1ZX6 A;  2DBM A;  1QVF S;  3MCA B;  1HSQ A;  2RNA A;  6AT1 B;  3VYH B;  1VQ5 T;  2DE0 X;  3DLM A;  1U5S A;  2YUJ A;  1BB9 A;  4J6Y A;  4FSX A;  4C0F A;  1FYN A;  4E2F B;  4AQ7 A;  1JXM A;  1QP2 A;  4J7F A;  4E7I A;  1MMA A;  1MMG A;  3JCM f;  4P5N A;  4E7K A;  1QVG P;  4M7A E;  2EGE A;  2LCL A;  3L2Z A;  3CCM A;  3HFO A;  4M7A D;  3CBP A;  2XK0 A;  2LQW A;  3SB2 A;  1VQ7 A;  3C0C A;  5B6C A;  2OAU A;  1T3L A;  4F04 B;  5IH2 A;  1EX4 A;  2RMO A;  2EGA A;  4OP0 A;  1WNL A;  1M90 U;  1G3W A;  1N8R C;  1VQ6 T;  2EYQ A;  2H8H A;  1Q82 U;  3CCJ T;  3TEE A;  1G3S A;  3VKI A;  1OEB A;  2DO3 A;  2ZGW A;  1NJI U;  2R5A A;  2E5Q A;  4ATO A;  1KQS P;  3OA6 A;  1H64 1;  4B9W A;  1VIF A;  2DYI A;  3NHN A;  1JU5 C;  3GNG A;  1KD1 R;  2MWO A;  4RCC A;  1VQK Q;  4RV0 A;  2X4X A;  3X28 B;  1F1B B;  1PSF A;  4ZN1 A;  4KO8 A;  3NTH A;  4LD6 A;  2PNI A;  3DB4 A;  1JRI A;  1WHL A;  2X4J A;  2GGR A;  3RMS A;  2WAC A;  1ZC1 A;  3LHD A;  2DVJ A;  3I55 A;  3RDV A;  1WXT A;  1SRM A;  4JJN K;  4FSS A;  2EW3 A;  4HKE A;  5CKE A;  1UB4 A;  3JCM Q;  3J81 E;  3QZ9 B;  5DY9 A;  3M0U A;  3CCU T;  3ZGZ A;  4L5G A;  2EQJ A;  1Q7Y U;  1Q81 U;  2HCK A;  4KRT A;  1MUZ A;  3MET A;  3JCM c;  3P8B B;  1T0J A;  5HY6 A;  2YHT A;  2RA2 A;  4XU2 A;  1KQS A;  5GJW B;  5J39 A;  4M7A C;  3VS1 A;  4M78 C;  3S6W A;  2X4W A;  1VQ8 T;  1YIT A;  5KCH A;  1QKX A;  1K8A U;  4RG2 A;  4C8Q A;  5LJ5 j;  3PIO A;  4ELY C;  1W1F A;  3TVT A;  2LW6 A;  2M51 A;  4J9C A;  2B86 A;  2HEQ A;  4F16 A;  2W0Z A;  4JZ4 A;  4FW2 A;  4AFQ C;  1WDX A;  2YRD A;  4F7U F;  3EG0 A;  1GRI A;  5D7U A;  1IHV A;  3IQL A;  4C92 G;  2MCN A;  2PQW A;  1YJ9 Q;  2RQV A;  4LDY A;  4M77 G;  1VQ9 A;  1TUG B;  2A7Y A;  2K2M A;  1G3T A;  1RAB B;  3ULR B;  2KBT A;  1X6G A;  5IT9 E;  3UT1 A;  1X27 A;  3JCM e;  1AZG B;  3QUI A;  5HK3 A;  3G4S Q;  2M0O A;  3LYI A;  3P8H A;  1SF9 A;  3X20 B;  2GCX A;  1Q7Y R;  1Q81 R;  1UEB A;  1RAD B;  4PL6 A;  5GAO p;  4CQN A;  3JB9 J;  4EIK A;  2QI2 A;  3OYY A;  4WCI A;  2P4R A;  2QAS A;  1BBZ A;  1D3B A;  1D0X A;  2V1R A;  2EJF A;  5EPP A;  2QGF B;  2DL3 A;  4M75 A;  3V7R A;  3NTK A;  5GAM e;  4PJJ A;  4BUG A;  2DXT A;  1N6A A;  1T0H A;  3RBB B;  3RUX A;  5C0M A;  2L3S A;  4M78 D;  1TOV A;  4HA8 A;  2BTT A;  5FU7 B;  3CPW S;  1YIJ A;  1E6G A;  2RN8 A;  2X4Y A;  3JCM g;  4QVZ A;  1VQL A;  1KHI A;  1VQP T;  1Q86 U;  2Q1A X;  4RTX A;  3SWN B;  1AD5 A;  4C5H A;  2P84 A;  4KUL A;  1HJD A;  1QDN A;  4C8Q F;  4ZTF A;  1GCQ A;  1XJW B;  2A36 A;  5GJV B;  1D1A A;  1VQ8 A;  5I22 A;  1MHN A;  5GMK e;  2CKK A;  2XU8 A;  3CC4 T;  2EQU A;  2PJH B;  1YJW A;  3JCM h;  3QWZ A;  1QW1 A;  3H9N A;  3ZJU A;  2FO0 A;  1YHQ Q;  1M3B A;  1FMK A;  2W10 A;  1NEB A;  1AWX A;  3LH5 A;  5L8R E;  1MMD A;  3KBG A;  2F2W A;  4E7H A;  1VQ4 T;  3CCL T;  2KXC A;  1MV3 A;  3VS4 A;  4DBF A;  4DBQ A;  1LVK A;  2EWN A;  2AIR B;  5LJ5 f;  2EFI A;  4ZGE B;  1QVF A;  2JW4 A;  2H3J A;  2DJZ A;  3V7S A;  2E3H A;  1VQ9 T;  1BKB A;  4M7D D;  2MAM A;  1X69 A;  2JNG A;  5GMK m;  5EG2 A;  3MEA A;  4YTL A;  1NLP C;  2E41 A;  2WSE E;  1RAH B;  1Q82 C;  4BE1 A;  5LJ5 h;  4N4H A;  3OYL A;  4M78 G;  2CS7 A;  3I56 T;  2MI6 A;  3M5A A;  1SKU B;  3MP6 A;  4M7A A;  4X34 A;  3EFO A;  5GAN j;  4PJO E;  1AVZ C;  2CT3 A;  2LT4 A;  2RJC A;  3BW1 A;  3G71 A;  1WHG A;  2J05 A;  2KR3 A;  2VKN A;  5DM7 R;  3M4Y A;  5DYG A;  1WYX A;  4BDZ A;  1FMV A;  5LJ3 e;  1E32 A;  4PJO A;  3GNF B;  1PNJ A;  4PFP A;  4OMO A;  1P92 A;  3CCM T;  2K9G A;  5CK9 A;  1M1K U;  1K0X A;  3HU2 A;  4XTW A;  3V8J A;  2HZY A;  5KE3 A;  2NYS A;  4Y28 E;  4OMQ A;  3OW2 P;  1Z9Z A;  3PMT A;  4OGC A;  2RH2 A;  1X2K A;  3THK A;  1BCM A;  4F7U G;  3L2W A;  3QC8 A;  2BZY A;  1UFF A;  3LWH A;  3E19 A;  1W2B P;  1RL2 A;  3URG A;  4KGV B;  4QVD A;  3CCL A;  5LJ5 e;  1K8A C;  1M3C A;  3H8Z A;  3EG9 A;  1GCQ C;  1YBY A;  2LCC A;  5IHK A;  1RLP C;  2Y90 A;  5CCA A;  2AKK A;  1WIE A;  3M53 A;  2V8J A;  4UC4 A;  2DZ9 A;  4JRP A;  4RTV A;  4QQD A;  1TU0 B;  4R56 A;  3VS3 A;  2KK4 A;  1X75 C;  2KXD A;  3HHT B;  4M77 F;  5LJ3 h;  4C8Q D;  3S3O A;  4FCY A;  3EGD A;  2ZPF B;  4LD9 K;  1VQ6 Q;  4ORZ A;  4LDU A;  2O2O A;  2V26 A;  4RTZ A;  2OTL T;  1U3O A;  2D0Q B;  4B9X A;  1B3Q A;  2RJE A;  4F14 A;  1ZBJ A;  1M2V A;  4QQG A;  1IRE B;  2EBP A;  1K73 R;  2HSP A;  2L3P A;  3M54 A;  5LJ3 f;  1N9S A;  1OU8 A;  4WF2 A;  5FRM A;  1I5O B;  4HT9 A;  3WXM B;  4PFO A;  1VUB A;  1AEY A;  4JRK A;  3CCE T;  2RK1 A;  3CC7 T;  2SEM A;  3LH0 A;  2VC8 A;  4C5G A;  1U06 A;  1E7O A;  1VYV A;  3GIB A;  2DF6 A;  1QVG A;  1YNZ A;  1ZSG A;  1SEM A;  1OZ3 A;  2JTE A;  4IUV A;  2JMC A;  2MM2 A;  1K9M C;  2VGN A;  3CCJ Q;  2BUD A;  4FT2 A;  1IO6 A;  2F2V A;  3C94 A;  4BD3 A;  2CZ1 B;  2EAY A;  2NUT A;  3A8M B;  4C0D B;  1KC8 U;  2KYB A;  4PJN A;  3CXC P;  4IUP A;  2MWP A;  1Y96 A;  2ZPG B;  3MJX A;  4D6W A;  4JS4 A;  3EG3 A;  1YFN A;  2LRQ A;  2M0Y A;  3PIP A;  4J9I A;  3PE0 A;  3HPW A;  4CI0 C;  1OV3 A;  1NYF A;  1VQN Q;  4MZT A;  1XQH A;  4N4I A;  2Y4X A;  3OW2 S;  5FRO A;  3G6E Q;  3DKM A;  4OB2 B;  2AZS A;  2QTV A;  4M7D C;  3VUZ A;  3J80 E;  3CCS A;  2KVQ G;  3VS2 A;  4C0Z A;  3A5Z B;  5GAO q;  3PFS A;  3OS5 A;  1Q86 R;  1QCN A;  2KSS A;  2MK5 A;  1B07 A;  1YCY A;  1BI1 A;  3GBQ A;  1Y0M A;  2FYK A;  3PVQ A;  1W70 A;  3CQT A;  1ZHI A;  2GFA A;  4X1V A;  2DTI A;  4GY5 A;  3M55 A;  3BQB A;  3CME Q;  2DL5 A;  1PC0 A;  4XQ3 A;  4FT4 A;  4A4F A;  2QGG A;  5GAO l;  2X9H A;  4ZN3 A;  2JXB A;  4AFU C;  3SD4 A;  2DIQ A;  1ZSZ A;  3RIR A;  1JBM A;  2D9T A;  3CC2 T;  4M7D A;  2LVM A;  2A28 A;  2K57 A;  5EQJ B;  2PZ1 A;  5CO7 A;  4IKF A;  2QQR A;  2JTM A;  3QHS A;  2YXY A;  3EG9 B;  2K5F A;  1CKB A;  4FIB A;  5LJ3 j;  2KDS A;  3I56 Q;  1N9R A;  1KQ1 A;  4BI3 A;  3OYJ A;  2MYS A;  1QWF A;  4QW2 A;  2ZPB B;  4AMC A;  2DD4 A;  1M90 C;  3O8V A;  3R6N A;  1Y07 A;  2B25 A;  1M1K C;  2LT1 A;  4MMK A;  2GBQ A;  2O9V A;  1Y7X A;  2KE9 A;  1Z9Q A;  5I21 A;  1UTI A;  5FTK A;  1VYU A;  2DFU A;  2FRY A;  3ME9 A;  4MDW A;  4A4G A;  4BY6 C;  4ELZ C;  1ZUU A;  3HU1 A;  2LMJ A;  3SEM A;  3PMI A;  1XNI A;  2XIC A;  2DNU A;  4KT0 E;  4R0K A;  4A4E A;  5GMK h;  2JVV A;  3CCQ A;  2E4H A;  3HU3 A;  2DKG A;  2DAQ A;  1VQM Q;  4PJO D;  3NGP A;  1C0M A;  2CUD A;  1U8R A;  2RJD A;  4E6R A;  4F7U B;  1VQP A;  5HK0 A;  5A2Q E;  5KYY B;  4PK4 A;  2LX9 A;  4KDL A;  1BI0 A;  2QYZ A;  2V8I A;  5LJ3 g;  1YP5 A;  3JB9 D;  1V76 A;  3CCQ T;  4AFZ C;  2MF2 A;  1U1T A;  1UGR B;  1UHF A;  4C92 D;  3CC7 Q;  2E3I A;  1Q82 R;  1VQK A;  1DJ7 B;  2FPD A;  4NOY A;  2NUZ A;  3QXE B;  3UAT A;  1PWT A;  3QKJ A;  2DXU A;  2EQI A;  4QVC A;  1BI3 A;  1IRX A;  4IUT A;  3HRS A;  4C92 E;  1WFW A;  2PVD B;  1M8M A;  2HL3 A;  1VQ4 A;  2EGC A;  1IZ6 A;  4M7A G;  2RQW A;  3I55 Q;  1VQK T;  1M5Q 1;  3HL8 A;  4XU0 A;  1QQJ A;  4BE2 A;  3SFM A;  1IGQ A;  1I5L A;  1RI9 A;  3MPU B;  1VA7 A;  5FU6 C;  3CPF A;  3L2U A;  4JJD A;  4JDS A;  2R58 A;  2QEX Q;  5FTL A;  2CRE A;  1M1F A;  2HBW A;  2OTL Q;  2QK0 A;  1N27 A;  3G6E T;  1TUD A;  4KH0 B;  2ATC B;  2RHI A;  5KYN A;  3JCM d;  4FL6 A;  5DYI A;  1KC8 R;  1R8O B;  1GCP A;  3INZ A;  1GL5 A;  3JB9 H;  1VIE A;  2D0N A;  1AHJ B;  4ZGD B;  5FWC A;  4X9D A;  4XTZ A;  5CCX A;  5GMK j;  4FU6 A;  3OYG A;  3P8D A;  3M0S A;  5IAY A;  2J7I A;  3L42 A;  4D8D A;  3EGD B;  3SWN A;  2AHJ B;  3MB5 A;  2F2X A;  1NZ9 A;  4J9E A;  3RER A;  1S1N A;  3QYH B;  1CZ5 A;  1MGQ A;  2YVL A;  2CH4 W;  2F5K A;  2MOX A;  2DL8 A;  4RUG A;  2HKN A;  2CT4 A;  4J8O A;  2A08 A;  3CPW P;  5KYY A;  3CC2 Q;  3G4S A;  2BIV A;  3AT1 B;  2JUF A;  1YCS B;  4PJL A;  3E2U A;  1N5Z A;  3JV3 A;  1WHH A;  1NJI C;  5GLF A;  4KUI A;  3A1P A;  3QWX X;  3N5B B;  1BIB A;  4OB0 B;  3JAM E;  1G2B A;  1B7T A;  4HCB A;  4O6J A;  4PJM A;  3RR6 A;  2JMA A;  4JZ3 A;  1RLQ C;  2XMF A;  4CC2 A;  3OQ5 A;  3CD6 Q;  5M9O A;  1X6O A;  5GAM j;  4M7D F;  1M2V B;  5EC7 A;  4PJO B;  3CCU Q;  1KSW A;  5GAN 6;  2BZ8 A;  1VQ8 Q;  2YUQ A;  1VQ6 A;  3ER0 A;  3OY9 A;  2VYT A;  1VQ5 A;  2A37 A;  1SHF A;  4C5I A;  5CIU A;  1UJY A;  1M9S A;  2HDA A;  3OYI A;  2P0P A;  1LPL A;  3H0I A;  2CSQ A;  3EHQ A;  4A54 A;  2QA4 T;  3OYK A;  2LQK A;  2RHY A;  1WX6 A;  4MDX A;  3CCE A;  1SSF A;  2GF7 A;  3LWI A;  3V8K A;  1ARK A;  1S72 Q;  4FYX B;  1BK2 A;  2DMO A;  5GAO m;  1K76 A;  2CUB A;  5FWB A;  5ERG B;  1WHM A;  2NUP A;  4DEX A;  2QA4 A;  3L2V A;  5D6Y A;  1GFD A;  4IUR A;  3FJP A;  4ANJ A;  1GBR A;  2CDT A;  2Q1C X;  1QCS A;  2NUT B;  2LJ1 A;  2E1H A;  4NL2 A;  3G4S T;  2DLP A;  4D8K A;  4M7D G;  5IN1 A;  2LCS A;  2GTJ A;  2BZX A;  1LOJ A;  3ZJV A;  2JS2 A;  2XI9 A;  4FYY B;  1QWE A;  1RI0 A;  1IHW A;  3M0R A;  1QLY A;  3M0P A;  2EQK A;  4KBM B;  1O9S A;  2X3X D;  4OMF B;  1T3S A;  1GXI E;  5C6S A;  4Y92 A;  4RTY A;  4Z89 A;  3EHR A;  3MEU A;  1Q86 C;  4PFZ A;  5FLX E;  2KY9 A;  2KEA A;  5GAN 5;  2LQN A;  3CCR Q;  2ROL A;  4JS5 A;  3NTI A;  4DOW A;  3CC4 A;  3A8H B;  4J9B A;  5GAM f;  1I9G A;  1C1A A;  2ZAE A;  4C92 A;  1XTD A;  4M78 B;  2E6Z A;  1UJ0 A;  4XK8 E;  3OS1 A;  4M7D E;  4KDI A;  1HK9 A;  2V1Q A;  1TH7 A;  4GLM A;  3CCV Q;  3M59 A;  1UG1 A;  5I2S A;  2EYY A;  2E10 A;  1A0N B;  3CCL Q;  1M27 C;  1AOJ A;  1SSH A;  2BKD N;  2FB7 A;  3H41 A;  2OTJ Q;  4EMH A;  4WTO B;  1BYM A;  2NWM A;  2FL7 A;  1CR5 A;  5FTM A;  1UGS B;  3SWN C;  2PTK A;  3EFS A;  4DOV A;  2KI7 A;  2XHC A;  2FZG B;  4GLK A;  2KRN A;  2RI2 A;  1YI2 T;  2FZK B;  1M2O A;  5D6W A;  2E64 A;  3I9Q A;  4KH1 B;  1WXU A;  2HD0 A;  4M4Z A;  2KQW A;  4ZGJ B;  2R57 A;  3KFV A;  1WA7 A;  1Q95 G;  1ZUY A;  2M16 A;  4XU3 A;  5LJ5 d;  5KYW B;  1VQL T;  2FPF A;  2QQS A;  1WLF A;  2KT8 A;  1VQ9 Q;  1PD1 A;  1OZ2 A;  4IUU A;  1YI2 A;  3FPU A;  4F7U E;  2MM0 A;  3UF4 A;  3HSB A;  3GP8 A;  4OMN A;  2FZC B;  4BI4 A;  8ATC B;  2CGH A;  3S3M A;  1D0Y A;  2DIG A;  2SRC A;  4J83 A;  2J6K A;  1K0S A;  4JLG A;  3LLR A;  3O5Z A;  1I0C A;  3FRN A;  3H0H A;  2QXF A;  3CCR T;  2E5K A;  2EJG A;  1SRL A;  2FVU A;  2RQT A;  2IG0 A;  3PTA A;  4E7L A;  2AZV A;  3CME T;  1JB0 E;  4MZM A;  3OYC A;  5FU7 C;  1H3Z A;  2HKQ B;  4E7S A;  3QDF A;  4BI8 B;  1JQQ A;  5FTJ A;  1FXX A;  2RHX A;  1QCO A;  2K3B A;  3QPH A;  2EYZ A;  2L0A A;  3VS6 A;  2JOY A;  3VYG A;  3MO8 A;  3A98 A;  4A63 B;  1TG0 A;  4R55 A;  2VB6 A;  2DYB A;  2Y4Y A;  1YJN T;  1FMW A;  4C92 C;  3QWY A;  4EMG A;  2YSQ A;  4J5Y A;  3LGF A;  3OB9 A;  3CPW A;  3CBM A;  2QEX T;  2LQ8 A;  1VQ4 Q;  4M75 G;  2L3Q A;  4AG1 C;  5GAN 8;  5KYX B;  3BFM A;  1H8K A;  2CZ6 B;  3R6O A;  5CKF A;  1TXQ A;  2CP0 A;  2L2P A;  1QP3 A;  2O01 E;  1M1K R;  1YJN A;  5GAM g;  2V8K A;  3C12 A;  2DTH A;  4ARI A;  4ARC A;  3I5R A;  1CSK A;  2EIF A;  2QQ9 A;  1YIJ Q;  1PG5 B;  1M8V A;  2K5L A;  3RES A;  3MP1 A;  4E47 A;  1TSF A;  1VQM T;  2PU9 B;  3E9G A;  1ZA1 B;  2I0N A;  4M77 A;  4EMK C;  1PKT A;  2EQM A;  4HCK A;  1VQO Q;  3LX7 A;  2E6N A;  2YRV A;  3ZBD A;  2HQH A;  3CEY A;  3X26 B;  4IUQ A;  5GAN d;  3LW5 E;  2CP5 A;  1H92 A;  2EPD A;  4FM4 B;  1Q7Y C;  1Q81 C;  3JRZ A;  4IIM A;  2LP5 A;  1O75 A;  5I2M A;  3VS5 A;  4RTW A;  3NFC A;  2RHZ A;  2CH4 A;  3I35 A;  2LJ0 A;  2CP6 A;  4II1 A;  1V29 B;  1IB8 A;  2O88 A;  2B8A A;  4RG8 A;  3OBY A;  1PRM C;  2XDB A;  1HD3 A;  5HKC A;  3OS2 A;  1M3A A;  3M56 A;  2K3X A; 
#chains in the Genus database with same CATH homology
 5GAM e;  3SDZ A;  1Y71 A;  1G5V A;  4PJO F;  2HQX A;  4BUG A;  2DXT A;  1N6A A;  4O5V A;  2K5I A;  3E9F A;  4M75 E;  4M75 F;  3RUX A;  5C0M A;  4M78 D;  5FU6 C;  3CPW S;  4HA8 A;  5FU7 B;  2YLB A;  5J26 A;  3RKX A;  4BY6 B;  1YIJ A;  4OGE A;  3CPF A;  2DXB A;  3L2U A;  5CVI A;  2X4Y A;  2DVE A;  4QVZ A;  3JCM g;  3JCM P;  4ZTJ A;  1OI1 A;  3OYN A;  5CKD A;  1VQL A;  1KHI A;  1VQP T;  3OYA A;  4JDS A;  4N0A A;  2A3L A;  1Q86 U;  2Q1A X;  1FWZ A;  2C06 A;  2R58 A;  3SWN B;  4M77 E;  2E70 A;  4C5H A;  3QJY A;  5FTL A;  4KUL A;  3HRT A;  1M1F A;  1N27 A;  5KCO A;  1QDN A;  3G6E T;  1S3S A;  4C8Q F;  4ZTF A;  2RHI A;  5GAN e;  3JCM d;  4FL6 A;  5GMK l;  1VQ8 A;  5DYI A;  1MHN A;  5GMK e;  1R8O B;  2CKK A;  2XU8 A;  3CC4 T;  2EQU A;  3INZ A;  3J7A F;  2PJH B;  1XOV A;  5KH6 A;  4J7I A;  3JB9 H;  1VIE A;  1YJW A;  1WJS A;  1AHJ B;  3JCM h;  4ZGD B;  5A0L A;  3QWZ A;  1QW1 A;  1UGQ B;  4X9D A;  4XTZ A;  2ZPI B;  3ZEH A;  5GMK j;  2OTJ T;  5CCX A;  3Q1J A;  3ZJU A;  2RHU A;  2JN0 A;  2RI3 A;  2LNV A;  2XG8 D;  4FU6 A;  2GFU A;  5CR2 A;  3OYG A;  4PLL A;  3P8D A;  3C95 A;  1EIF A;  5L8R E;  2XID A;  4HCZ A;  3KBG A;  5GAN 4;  2XKO C;  5IAY A;  3OYD A;  3V8L A;  4E7H A;  1VQ4 T;  3CCL T;  2B25 A;  3L42 A;  3CMA T;  4DQ2 A;  3SWN A;  2DXC A;  2AHJ B;  3MB5 A;  1NZ9 A;  3QJ6 A;  5CAI A;  4OB3 B;  1KC8 C;  3TIW A;  1B34 A;  2EWN A;  5CKB A;  2DEQ A;  4Q5W A;  4KOD A;  5LJ5 f;  2EFI A;  4XU1 A;  5GAO r;  4TVR A;  4ZGE B;  4M78 F;  3RER A;  1QVF A;  1YJ9 A;  2GQV A;  1X01 A;  2KMT A;  2H3J A;  3QYH B;  1CZ5 A;  2JZ2 A;  2DJZ A;  3V7S A;  3OW2 A;  4KUD K;  1MGQ A;  2YVL A;  3DB3 A;  5GAN g;  2LTO A;  3VUB A;  1VQ9 T;  2F5K A;  1BKB A;  4M7D D;  2NLU A;  2DPP B;  2MAM A;  5GAN 7;  1D3B B;  3QG1 A;  5GAN 2;  3CC7 A;  4J8O A;  1JJ2 A;  2JNG A;  4M75 B;  4C8Q E;  5GMK m;  1K73 C;  3NTK A;  2L5Q A;  3MEA A;  3ASK A;  2BIV A;  5EG2 A;  4YTL A;  3G4S A;  4HT8 A;  2PUK B;  3CD6 T;  3FPT A;  3TRE A;  2JUF A;  4V2S A;  4OF1 A;  2L8D A;  2E41 A;  2PUO B;  2WSE E;  1YJ9 T;  2DZC A;  1BIA A;  1Q82 C;  2Q18 X;  4BE1 A;  4RKU E;  5LJ5 h;  4OVA A;  4N4H A;  4XTV A;  3OYL A;  4M78 G;  2CS7 A;  2VGM A;  1M1K C;  1NJI C;  3I56 T;  2MI6 A;  2RB6 A;  4JRI A;  5GLF A;  3M5A A;  4KUI A;  1UGP B;  3JB9 I;  4BE0 A;  3QQ8 A;  2FHD A;  3MP6 A;  4M7A A;  4X34 A;  3OSS C;  3FDR A;  1S72 A;  5GAN j;  4PJO E;  3FB9 A;  4C5E A;  3X24 B;  3N5B B;  1BIB A;  4BAC A;  4OB0 B;  3MEW A;  3JAM E;  2LT4 A;  3BDU A;  2RJC A;  3BW1 A;  4EPC A;  3OYM A;  4HCB A;  3G71 A;  4O6J A;  5GAN 3;  2HNI A;  3EFR A;  2RO0 A;  2WSF E;  4VUB A;  4AS1 A;  1WPY A;  5C1B A;  1HXD A;  2O4X B;  4EMK B;  4N0A C;  5DM7 R;  4KO8 A;  3M4Y A;  3A8L B;  5DYG A;  3M4G A;  3A8G B;  4BDZ A;  3OQ5 A;  5LJ3 e;  1E32 A;  4PJO A;  3QZ5 B;  3GNF B;  3JCM b;  1R7R A;  2VXE A;  1WGS A;  2QEX A;  1P92 A;  3CCM T;  5M9O A;  5GAN f;  2E12 A;  1X6O A;  5CK9 A;  5GAM j;  3CMA A;  1M1K U;  3JB9 F;  4M7D F;  3HU2 A;  4XTW A;  3V8J A;  4PJO B;  2P0Q A;  5J3B A;  5GAN 6;  3C4S A;  5KE3 A;  4Y28 E;  1VQ6 A;  4M77 D;  3ER0 A;  4C92 F;  3OY9 A;  3PGG A;  3PMT A;  2VYT A;  4OGC A;  2P4T A;  2RH2 A;  1VQ5 A;  3UWN A;  3HP9 A;  4M78 A;  3CC2 A;  3CCS T;  3KUF A;  4C5I A;  3ZJT A;  5CIU A;  2RM4 A;  2QTX A;  2CZ7 B;  4F7U G;  1M9S A;  3OMG A;  5GAO n;  3OYI A;  2P0P A;  3M9Q A;  5D6X A;  5LL6 S;  3QSU A;  2JTF A;  2F5T X;  3L2W A;  2L3R A;  4A54 A;  3QC8 A;  1KG1 A;  4E7J A;  2QA4 T;  3OYK A;  2LQK A;  4XAX B;  3LWH A;  3E19 A;  3CCV A;  3AHU A;  1RL2 A;  2RHY A;  3URG A;  4C8Q B;  1W4S A;  4QVD A;  4JUV A;  1YIJ T;  4MDX A;  3G7Z A;  4J6W A;  1WQW A;  3CCL A;  4X9C A;  5LJ5 e;  1SSF A;  2GF7 A;  2VV5 A;  3H8Z A;  3LWI A;  3CCE A;  3QDR B;  3JCM J;  1K8A C;  2Q19 X;  2RI5 A;  3V8K A;  3M57 A;  3A8O B;  1YBY A;  1M4Z A;  2I2L A;  2LCC A;  5CQX A;  3M58 A;  4C0D C;  2Y90 A;  4MZP A;  4M77 C;  4EMK A;  5CCA A;  1JJ2 S;  3CCR A;  5GAM d;  2Q1D X;  5GAO m;  2M1H A;  1I81 A;  2ZZD A;  5ERG B;  4M75 D;  4A4H A;  3M53 A;  2V8J A;  4HCC A;  3BDL A;  4UC4 A;  1PSE A;  2DZ9 A;  4XTU A;  3L2V A;  3G71 T;  2QA4 A;  4JRQ A;  4Y91 A;  5D6Y A;  4JRP A;  5FRN A;  4QQD A;  4MML A;  2HQE A;  4IUR A;  3FJP A;  4A53 A;  2DD5 A;  5CCB A;  5GAM h;  2K4Y A;  1B34 B;  3JCM W;  4R56 A;  2Q1C X;  1QCS A;  4N4G A;  4ME7 A;  3RKY A;  2E1H A;  3G6E A;  3CBO A;  4PLI A;  2KK4 A;  4NL2 A;  1X75 C;  3G4S T;  3CD6 A;  3OYE A;  3GF5 A;  3L1A A;  3CXC A;  1O54 A;  3HHT B;  4M77 F;  4M7D G;  5LJ3 h;  2CYZ B;  3RMQ A;  5IN1 A;  4C8Q D;  3S3O A;  1YJW T;  2ZPF B;  3FLG A;  1VQO T;  1W2B S;  4LD9 K;  5DLQ E;  1LOJ A;  3ZJV A;  4LDU A;  5AYF A;  2P0K A;  1I8F A;  2XI9 A;  3HRU A;  1RI0 A;  2X35 A;  1WJQ A;  2MMP A;  5FU6 B;  3HKS A;  2OTL T;  1KHC A;  1CZ4 A;  4RMO A;  2D0Q B;  4B9X A;  3VU3 C;  2RJE A;  2EQK A;  4C92 B;  2OTJ A;  2QDY B;  1S72 T;  2XDD A;  5KE2 A;  4KBM B;  4QQG A;  3VV0 A;  1O9S A;  2RD1 A;  4OMF B;  2DTO A;  1IRE B;  4M77 B;  3WVD B;  1QVP A;  4BB7 A;  5C6S A;  1GXI E;  2QQB A;  3T9N A;  3M54 A;  5LJ3 f;  1N9S A;  2RK2 A;  4WF2 A;  3X25 B;  3MEU A;  3CME A;  4M7A F;  2OTL A;  5FRM A;  1VQN A;  1Q86 C;  3WXM B;  5FLX E;  2KY9 A;  1KD1 C;  4HT9 A;  1G3Y A;  3CXC S;  5GAN 5;  3OSV A;  5A0G A;  3V7C A;  1VUB A;  5FTN A;  3OBW A;  4JS5 A;  4JRK A;  1WJR A;  5DLO A;  3CCE T;  3E1S A;  3NTI A;  4DOW A;  2RK1 A;  3CC4 A;  3CC7 T;  3A8H B;  3LH0 A;  3LGL A;  2VC8 A;  5GAM f;  3JCM X;  3CCU A;  4C5G A;  1I9G A;  5CQY A;  2RJF A;  1KQ2 A;  2PVO B;  4C92 A;  1BI2 A;  1XTD A;  4M78 B;  4M7A B;  3GIB A;  2E6Z A;  1QVG A;  3S3N A;  3QII A;  2F69 A;  1NE8 A;  2WSC E;  4EDU A;  4XK8 E;  1OZ3 A;  3HFN A;  3OS1 A;  4M7D E;  4IUV A;  3MCA B;  1QVF S;  3I56 A;  5LJ5 g;  2MM2 A;  3VYH B;  2K2V A;  1K9M C;  2VGN A;  3DLM A;  1VQ5 T;  4KDI A;  2BUD A;  4FT2 A;  1HK9 A;  1TH7 A;  3QQ7 A;  2YUJ A;  1OYX A;  3M59 A;  1U1S A;  4J6Y A;  3C94 A;  4BD3 A;  2KAF A;  3JB9 G;  4FSX A;  1KQS S;  5I2S A;  2CZ1 B;  4C0F A;  2E10 A;  2EAY A;  3L2Q A;  3A8M B;  4C0D B;  4AQ7 A;  1KC8 U;  1QP2 A;  2BKD N;  4J7F A;  3JCM f;  4E7I A;  4P5N A;  4E7K A;  4IUP A;  2MWP A;  1Y96 A;  2ZPG B;  4LDW A;  2FB7 A;  4M7A E;  4EMH A;  4D6W A;  4JS4 A;  1LNX A;  2LCL A;  3L2Z A;  1BYM A;  3CCM A;  2FL7 A;  2LRQ A;  3CBP A;  2XK0 A;  3HFO A;  3TCJ A;  3WVE B;  1UGS B;  3SWN C;  3SB2 A;  1YHQ T;  1CR5 A;  1VQ7 A;  5FTM A;  5CKH A;  3EFS A;  2ZPH B;  4PKC C;  3PIP A;  2OAU A;  4DOV A;  5B6C A;  5CD1 A;  2XHC A;  3HPW A;  4CI0 C;  4L59 A;  2EKO A;  3GLX A;  4XTY A;  2CZ0 B;  4GLK A;  2RI2 A;  4M78 E;  3FPR A;  2YLC A;  2E65 A;  3OMC A;  4MZT A;  1XQH A;  4N4I A;  1YI2 T;  2Y4X A;  3OW2 S;  1WQ7 A;  5D6W A;  5FRO A;  1W2B A;  4OP0 A;  2E64 A;  1WNL A;  1M90 U;  1G3W A;  3DKM A;  1N8R C;  1VQ6 T;  4OB2 B;  2HD0 A;  2EYQ A;  3UDC A;  1Q82 U;  2KQW A;  4ZGJ B;  2R57 A;  1G3S A;  3TEE A;  3VKI A;  3H6Z A;  3CCJ T;  2DO3 A;  2ZGW A;  2M16 A;  2LC4 A;  4XU3 A;  1VQ8 T;  4M7D C;  1NJI U;  3VUZ A;  5LJ5 d;  2R5A A;  2E5Q A;  3J80 E;  3CCS A;  1VQL T;  2QQS A;  3EAE A;  1M1G A;  4ATO A;  2KVQ G;  1WLF A;  4QQ6 A;  3OA6 A;  1H64 1;  3CCV T;  4C0Z A;  4B9W A;  1OZ2 A;  3A5Z B;  5GAO q;  3OYF A;  3PFS A;  4LDX A;  1VIF A;  4C8Q G;  4IUU A;  1YI2 A;  3GNG A;  2ZCF B;  4F7U E;  1ZQ1 A;  2MM0 A;  3OS5 A;  3FPU A;  2MWO A;  2ZPE B;  4C8Q C;  4RCC A;  3HSB A;  3GP8 A;  2KSS A;  1YCY A;  1BI1 A;  4RV0 A;  2X4X A;  1K73 U;  3DLL A;  2FYK A;  4BI4 A;  3PT9 A;  3X28 B;  1ZHI A;  3GOX A;  2GFA A;  3MHX A;  1PSF A;  2CGH A;  2DTI A;  3FEO A;  4LDV A;  4GY5 A;  4ZN1 A;  3S3M A;  3NTH A;  2DIG A;  2K3Y A;  3M55 A;  4J83 A;  3DB4 A;  4JLG A;  1JRI A;  2QQA A;  4LD6 A;  3LLR A;  3ZFJ A;  3BQB A;  2X4J A;  3FRN A;  3RMS A;  1K9M U;  2WAC A;  2QXF A;  4L6V 5;  4XQ3 A;  2LDM A;  4FT4 A;  4A4F A;  3CCR T;  5GMK i;  5GAO l;  2EJG A;  1VQM A;  1ZC1 A;  2FVU A;  4ZN3 A;  3LHD A;  2IG0 A;  2DK3 A;  3PTA A;  2HAX A;  1VQN T;  3I55 A;  2VUB A;  4E7L A;  3SD4 A;  1JB0 E;  3CME T;  4Z02 A;  2DIQ A;  3RIR A;  4MZM A;  3OYC A;  4JJN K;  5FU7 C;  4HKE A;  1JBM A;  2D9T A;  1UB4 A;  5CKE A;  3JCM Q;  3CC2 T;  4M7A D;  3J81 E;  3QZ9 B;  5DY9 A;  4M7D A;  1NPR A;  2LVM A;  4NL3 A;  3CCU T;  2K57 A;  3OS0 A;  4BI8 B;  5EQJ B;  3TU4 K;  5FTJ A;  1FXX A;  3ZGZ A;  2RHX A;  5CO7 A;  4IKF A;  2QQR A;  2JTM A;  3QHS A;  1VQO A;  2XDP A;  3QO3 A;  4L5G A;  2EQJ A;  3QPH A;  1Q7Y U;  1Q81 U;  1Y96 B;  2JOY A;  3MET A;  3JCM c;  1VQ7 T;  2K5F A;  3QYG B;  2IVW A;  2D6F A;  3VYG A;  4FIB A;  3P8B B;  5LJ3 j;  4RCB A;  2KDS A;  1LJO A;  3FIF A;  4PNO A;  1N9R A;  3MO8 A;  1KQ1 A;  4BI3 A;  3OYJ A;  5HY6 A;  2YHT A;  3CCJ A;  4R55 A;  3F70 A;  2RA2 A;  4QW2 A;  2ZPB B;  4XU2 A;  4F7U A;  1KQS A;  2Y4Y A;  1YJN T;  2DD4 A;  2L89 A;  5J39 A;  4C92 C;  1M90 C;  3O8V A;  4EMG A;  4M7A C;  3UPU A;  1N8R U;  3CF2 A;  4J5Y A;  1Y07 A;  3LGF A;  3BY7 A;  4JLI A;  4M78 C;  3S6W A;  2X4W A;  3KXT A;  3OB9 A;  1YIT A;  2LT1 A;  4MMK A;  4J6X A;  5KCH A;  3CPW A;  3CBM A;  1K8A U;  4RG2 A;  1Y7X A;  4C8Q A;  2QEX T;  2LQ8 A;  5I21 A;  5LJ5 j;  4M75 G;  3JCM V;  5FTK A;  3ME9 A;  4MDW A;  4A4G A;  3PIO A;  5GAN 8;  4ELY C;  3BFM A;  4BY6 C;  4ELZ C;  2CZ6 B;  2G3R A;  3R6O A;  2LW6 A;  5CKF A;  2R5M A;  3HU1 A;  1QP3 A;  2O01 E;  2EJ9 A;  3PMI A;  1XNI A;  3OYB A;  4PJO G;  1YJN A;  2XIC A;  5GAM g;  2V8K A;  4KT0 E;  4A4E A;  5GMK h;  1YHQ A;  3C12 A;  2JVV A;  2DTH A;  3CCQ A;  3QBY A;  4PJO C;  4ARI A;  4ARC A;  3HU3 A;  2QQ9 A;  2DKG A;  2EIF A;  4BDY A;  1NPP A;  2DAQ A;  4PJO D;  1M8V A;  2K5L A;  4F7U F;  3RES A;  1U8R A;  2RJD A;  3MP1 A;  3I55 T;  4F7U B;  1VQP A;  2XD0 A;  5HK0 A;  1FX7 A;  4E47 A;  5A0D A;  5A2Q E;  4M7D B;  1VQM T;  2PU9 B;  4C92 G;  3E9G A;  2LX9 A;  3L2R A;  4OB1 B;  4KDL A;  2PQW A;  5C18 A;  1BI0 A;  2V8I A;  5LJ3 g;  4M77 A;  4EMK C;  3PNW C;  4KLN A;  2EQM A;  4LDY A;  4M77 G;  3RKW A;  3JB9 D;  1VQ9 A;  3CCQ T;  3LGA A;  3GPL A;  1I4K 1;  3LX7 A;  2A7Y A;  2E6N A;  1G3T A;  2MF2 A;  2O4X A;  2YRV A;  1U1T A;  3ZBD A;  1UGR B;  4DA4 A;  3CEY A;  3X26 B;  4C92 D;  4IUQ A;  5IT9 E;  3UT1 A;  3JCM e;  5GAN d;  1VQK A;  4XTX A;  1DJ7 B;  3LW5 E;  4NOY A;  4FM4 B;  3QUI A;  3MEV A;  5HK3 A;  1Q7Y C;  3JRZ A;  3MP8 A;  1Q81 C;  3QXE B;  1QVG S;  2M0O A;  1H3Z A;  1O75 A;  5I2M A;  3OYH A;  3LYI A;  3NFC A;  3P8H A;  2RHZ A;  3X20 B;  3QKJ A;  5LJ3 d;  2DXU A;  2GCX A;  3VJP A;  4QVC A;  1BI3 A;  4IUT A;  5GAN h;  3FC3 A;  3JSC A;  4II1 A;  1V29 B;  4A4K A;  3HRS A;  4C92 E;  1UEB A;  2B8A A;  4PL6 A;  3OBY A;  4RG8 A;  2PVD B;  2VXF A;  5GAO p;  1KD1 U;  2M9U A;  2HBP A;  1VQ4 A;  2XDB A;  1IZ6 A;  2JV2 A;  4CQN A;  3JB9 J;  4C0G A;  4M7A G;  4NS5 A;  2QI2 A;  2PVG B;  3OYY A;  5HKC A;  3OS2 A;  3M56 A;  1VQK T;  1D3B A;  1YIT T;  1M5Q 1;  3HL8 A;  2EJF A;  4XU0 A;  5EPP A;  4BE2 A;  3SFM A;  4M75 A;  3V7R A;  1I5L A;  2PWY A;  4M75 C;  2K3X A;  1ZBX A;  4CRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...