2QRYA

Periplasmic thiamin binding protein
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
308
structure length
308
Chain Sequence
KPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAWISEWQRAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Similarities between Thiamin-Binding Protein and Thiaminase-I Suggest a Common Ancestor
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Thiamine-binding periplasmic protein
total genus 88
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qryA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qryA01
2A5SA 2Y7PA 4GL0A 4IO2A 3RTWB 3V5AA 5CC2A 3R6UA 4IO3A 5I56B 1Y1ZA 2F35A 4ELRA 4NEDA 5CMCA 1HSJA 3M3LA 2PT1A 1US4A 3PUVE 3FZVA 1FW0A 1A8FA 1DTZA 3ZKLA 2YJPA 4AB6A 3K01A 5K2YA 4OHNA 1ZU0A 3KFMA 5I2NB 2XD2A 4GOTA 4GQOA 3SEXA 5TPAA 1FTLA 4JWXA 4XKQA 2O69A 1HSLA 4LATA 5CMBA 1OLAA 2QSXA 1MQDA 3QYTA 2UYFA 4F3PA 1JW4A 4DIGA 4F2QA 1TT1A 4MBPA 2Q2AA 3FV2A 3RTFB 3VLWA 5LOMA 4R75A 1SW2A 2O7UA 5ICTA 1B32A 2D21A 4XTCQ 3PD8A 5H8FA 3MZ1A 2XXHA 1MXWA 1SD3A 3IOWA 4U2RA 3V89B 1ZKBA 3H06B 1URDA 2Z22A 3HHFA 4ZECA 1NKXA 2F34A 4IO6A 4TLMB 3O9PA 4G8HA 3RT6B 1XC1A 1USYE 4ZEFA 1ZJLA 2X7PA 1MM6A 3IO4A 1DMBA 3SETA 1NMUA 5EHSA 3MAMA 3G3HA 5AA2B 5ITPA 4X1BA 1VSOA 3H6VA 3FD3A 3FXUA 3LSWA 1LFGA 1SW4A 1ZMGA 1ZTYA 3FVGA 3N6TA 1SYHA 3TPAA 1R1NA 3FIRA 4YICA 3I6VA 3M3KA 5KDTA 2DYXA 3EHSA 3H4ZA 2QPQA 1OQGA 3L6HA 4NF6A 5DEXB 4DXCA 4RY1A 2DQVA 1MPCA 3QUFA 2F6GA 1I6AA 2F97A 2H99A 3RUMA 2H98A 1S7YA 3TQLA 3K6UA 3QUJA 4LONB 3ZSFA 3TKDA 2Q9TA 3TDJA 3KG2A 2P0SA 3DP8A 2O51A 2DXRA 4OEUA 3S9LC 4E0XA 3M8UA 1LCFA 1EZ9A 3CSBA 1AIVA 2XHDA 4H0WA 1FQFA 2H9BA 4ISUA 5AA1A 4I1DA 2DP8A 4R9GA 4ZEIA 3G3JA 2E1SA 2E0SA 4POWA 1UIVA 3QIMA 4F39A 2QS2A 4OETA 4QSEA 3FVNA 4NF4B 2O7IA 1LLSA 5AA4B 3C32A 4GXAA 3FJ7A 3UP9A 2XD3A 3N94A 4RK9A 1DOTA 4LQ5A 4OWDA 2I4BA 4GFRA 3GXAA 4R6HA 3TTKA 4BDNA 5B70A 1QUJA 2Y7WA 3V83A 3AXFA 1BP5A 1MY3A 5H8HB 2THIA 2Z8FA 3PUWE 1PBQA 3FUZA 5F7VA 4RA1A 1WODA 2OZZA 4O3AA 1D9YA 2DE4A 5KCJA 3GBBA 3LBSA 3TCFA 3G3GA 1PBPA 1B52A 1FQAA 1M5BA 3A3UA 1B1XA 3KGCA 4GWOA 4R74A 1B3HA 1GV8A 5AE4A 4YMBA 3B7DA 1B3LA 1P1OA 1QKAA 4C0RA 4GVOA 3FXQA 1POY1 3JYRA 3LC8A 4G68C 4GXSB 3MP6A 1MXXA 4NF5A 4DE8A 3KN7A 3CVGA 2HZLA 2V3UA 3EHUA 1Q1KA 4FE8A 4HCYA 3IJXB 4IB2A 4ONYA 1PC3A 4UA8A 3PPQA 4YKJA 3VFJA 1P1WA 3B6QA 4LP2B 3OSQA 1S50A 4RK2A 1BTJA 1YCJA 1PEBA 2ZYOA 5M2VA 3T22A 1WDNA 2Z8DA 3IB2A 3K02A 4KYDA 1MDQA 3FASA 4IGRA 2UVJA 2X7QA 5H8SA 5DT6A 3VV5A 4YU0A 2XX7A 4ESXA 2Y7KA 1JEUA 4IGTA 3O6GA 4G2ZA 1MS7A 4NF6B 5DEXA 3TODA 2WKYA 1H76A 3ZS6A 2D5WA 3N6UA 2R6GE 4EDPA 4F19A 4ND9A 3S2VA 1NNKA 3KOSA 2ABHA 2DS9A 4PETA 1FQCA 1MXUA 3CFLA 3MVZA 4PFWA 4PFYA 4E0WA 4NF8B 2QMWA 3VXBA 3CFZA 2P1SA 3V8XB 4YKKA 1M5DA 2ALUA 2D3IA 3S9EA 2F36A 4MLQA 1B5JA 3IR1A 3MPLA 1LGBC 2M8CA 4FAJA 1B40A 2OCUA 4N6PA 5EYFA 3IX1A 5FTHA 3FV1A 1D9VA 4OMBA 4QFKA 5ITOA 3OMBA 3OO8A 4TOZA 3MJNA 1GTKA 2KLFA 3C36A 2HCAA 3T9VA 3VE1B 1Z7ME 3QXMA 2REGA 1FCKA 3CG3A 4NTLA 1Z7NE 4QHQA 3UORA 3HPIA 4C1TA 2Q8JA 1MY0A 2G93A 4F3GA 1MQHA 5H8NB 2V93A 1RYXA 1VFDA 1ATGA 4Q5TA 2CZLA 3OEKA 4YZZA 2YLNA 1A7LA 3Q29A 2HQ0A 2RKMA 1UTHB 4F3SA 4KFQA 4DXBA 1AL3A 3CFXA 5H8QA 4LZ8A 4MLVA 3THIA 3TYHA 3CI8A 4R2FA 2ZYKA 3MZ9A 1B3EA 1IXCA 2HZKA 3FXRA 3MC2A 4LVQA 3EHTA 4OTEA 1IUDA 4YAHX 4OESA 2B65A 4JWOA 1QUIA 3MW0A 1TWYA 1YAEA 3HO7A 3IORA 3QK6A 3H03A 4YB6A 3LSXA 4G77A 4QF9A 4QFNA 3GZGA 5FHNA 2VD3A 3OO7A 3TTLA 4R6YA 4KR5A 4YB7A 4F29A 1MG1A 1N0TA 2B3BA 4OVJA 4KD5A 4BDLA 2RCBA 4KI0E 3KEIA 3QSLA 2F6PA 1A55A 4IO7A 2H5YA 2OWSA 1BKAA 4U21A 3UK4A 4G8NA 2V84A 3HV1A 3I5OA 3OENA 2UXAA 3VVDA 1SW1A 1NH7A 4DLDA 4H8IA 2DOJA 3ILUB 4OFOA 4K3FA 4G4PA 1N7XA 2I3VA 2AL4A 1I6QA 4R6KA 3EN3A 2G29A 3IK6B 1IZ1A 3JZJA 4BLAA 1MDP1 1LAHE 2ZNUA 1L5TA 4XKRA 4KYEA 1OLCA 1Y3PA 1RYOA 2RC9A 1R9QA 1B5HA 3KBRA 4RPOA 4H6DA 4X48A 3FVKA 4QFLA 4F18A 3LSFB 2FA7A 1ZIUA 2RC7A 4MF3A 2F7BA 1F9BA 1FQDA 2LAOA 1FTKA 3IJOB 4L17A 1LBCA 4FECA 4YKPA 1B5IA 1S9TA 2Y7IA 4RPNA 2NOOA 5B7DA 3MQ9A 2O68A 3PGFA 1NNFA 3U94A 4BDRA 4ZS9A 4H65A 1LFHA 1B7UA 1I6BA 4P0GA 1JVYA 2QMXA 1UIUA 2V3TA 3W15C 2NVUB 4QFPA 4LUBA 1PDAA 1USYH 3O6IA 4ZE8A 5CMKA 5CMMA 1JQFA 4R2BA 3L6GA 3O66A 3PMWA 2XXYA 5H8NA 3U8QA 4U4SA 1I69A 4ZEBA 4DXUA 1B0HA 1TFAA 1UTBB 1OVBA 1B2HA 4PFUA 4XKPA 3RGYA 3TAJA 4LZ5A 3U92A 3QAXA 5CBSA 1B4ZA 1JW5A 3MVYA 2H4IA 2ESNA 3OO9A 4U23A 4NWDA 2XXUA 2NXOA 3KN8A 4KQPA 4WEDA 5F1QA 5H8QB 2PYYA 4IY5A 3TTRA 2VOZA 1IEJA 1N04A 4U4XA 1EU8A 2Z8EA 4KCCA 5FTIA 4ZEKA 5AA4A 2FYIA 4H67A 4OYVA 1EZPA 1Y20A 4OFJA 2HAVA 5TP9A 5DVJA 1DPEA 3TEPA 3LR1A 5H8FB 3ILTB 1GGGA 1B6HA 1Y9UA 2IA4A 2Q2CA 3G3KA 3K0VA 3N26A 4PE5B 3T9HB 1DTGA 1MM7A 5HM4B 5A5XA 5JK4A 2F7CA 3HN0A 5JTYA 1FQEA 1QVSA 1NFTA 4R72A 2I0CA 1O7TA 4WEPA 2I48A 3OD7A 5I84A 4OFLA 3MP1A 2ANJA 4N07A 1EH3A 4GD5A 2YPNA 4N13A 3FATA 2AIXA 2HAUA 1O64A 1FTOA 4R73A 3TTNA 2X26A 3C9HA 3PPNA 5L9MA 2QL3A 5EHMA 3SEUA 1MRPA 4HW8A 5BWJA 3O6HA 3KZGA 1LAGE 3CSGA 4BDQA 1M5EA 2XXTA 3IOUA 3E3KA 1WVJA 1VFEA 3BKIB 3RY3A 1FTJA 4PQJA 4YKIA 4I8CA 4AB5A 3PPOA 4RNSA 3S9MC 3K00A 3FVOA 4DCXA 3C35A 4NE4A 4GLIA 3FGSA 3D4GA 3PMXA 3KSJA 4EXLA 3TQWA 4F2OA 2OBGA 5I58A 4BDMA 4Z7EA 3C33A 2Z23A 1VR5A 2ZNTA 1POTA 2DXYA 1N84A 4ZZEA 3MVXA 5I2NA 3IB1A 1MH3A 2O6AA 2Q88A 4F1VA 2ZNSA 1URSA 3C31A 3K4UA 4OXVA 3T9UA 4AQ4A 3KSXA 5I2KA 4NF8A 3PMVA 2XXQA 1RKMA 1UTBA 2HFBA 4P0IA 1LAFE 2I4CA 2GHBA 2UVIA 3G3IA 1IXIA 1LB8A 1PB8A 2AL5A 2DE2A 2ZYNA 3Q25A 3VVFA 4FATA 1IIWA 2GFEA 3FJGA 2DWIA 3O2AA 4P11A 1VE4A 2REJA 3N5LA 1T0KA 1H43A 4OQOA 5DYHA 2ONRA 2RCAA 1SW5A 3K6VA 4BDOA 1PB7A 4TQUQ 5DVFA 4Z0IA 1SI0A 2AYSA 2F8DA 2RF1A 3O28A 4EUOA 3RQTA 1BLFA 3HHGA 3MZBA 2DVCA 3ONMA 5ISUA 2I6EA 2XX9A 5CI5A 1FTMA 3OEMA 4Q30B 5AA2D 2ONKE 2QRYA 2UVHA 3GLBA 4MFIA 1H3DA 3TMGA 4JWYA 3CR9A 1B3GA 3UN6A 3G7WA 1SI1A 1B9JA 1NH8A 3PUZE 3Q28A 4JXIA 3OSRA 4JBZA 1SYIA 4NMYA 2RINA 5DTBA 4H5GA 1A54A 1LBBA 1P1QA 1TXFA 2DSFA 3OO6A 4NF5B 4U1ZA 1J1NA 1AMFA 1TFDA 3CIJA 3IOTA 5KDTB 5A5XB 5TPAB 3MWBA 4F1YA 3T93B 1II5A 3T66A 1P99A 1US5A 1MXVA 3MUQA 1SVXB 5I56A 1XHYA 1BIYA 1MQJA 4KHZE 3FJMA 1Y3NA 3E13X 3VVEA 1B7ZA 2VHAA 1Y4TA 3PU5A 2V3QA 2XXIA 1IXGA 2UYEA 2XXWA 3B6WA 3IO6A 4HS7A 3S4UA 5CBRA 1QKBA 3DP4A 4R9FA 1QULA 5JTYB 4ESWA 1MPBA 2O1LA 3SERA 4WKMA 4LA9A 3UIFA 2VGQA 5I58B 1Q35A 2OWTA 5FHOA 2DWJA 4F1UA 2DVZA 4ZZAA 5AA3A 1JETA 1NNTA 2GHAA 1B1HA 1YPNA 4OEVA 4FEBA 1CE2A 1EZOA 1B7HA 3BBRA 3IL1B 3PPRA 3BFUA 1QUKA 2UVGA 4RXLA 1ZLQA 1P1UA 2PVUA 3H7MA 3LSLA 5I59A 5I2KB 2Q89A 4QFOA 3MVWA 1JEVA 1XVXA 3H6WA 4M4GA 1JW1A 2HXWA 1MPDA 5CRYA 1LAXA 3PV0E 4OZ9A 1H44A 4OENA 2H25A 1LCTA 3GBAA 1B3FA 3KJ7A 3K6XA 3MPKA 1ELJA 4IY6A 4Q0CA 1B58A 3T9XB 3UGWA 2DWAA 3MP8A 2F78A 4DZ1A 1OVTA 5I57B 5L9SA 2XXRA 1NNPA 1A99A 1M5FA 1MXYA 1SQYA 2DWHA 3HSTA 4PP0A 3TTMA 3DELB 4YMAA 3H6TA 1XVYA 2OJTA 3IAZA 1XS5A 3SKPA 1N3XA 3K1NA 1DPPA 1SDXA 3KOTA 3LUYA 4U22A 4F22A 4EF1A 1Y1MA 2QS1A 3U72A 3SESA 4X9TA 4ELOA 3RT8A 3TCHA 1XOCA 3DLNA 2I58A 2VP1A 2XXXA 3O29A 2OLBA 1R9LA 1SBPA 4RYAA 5L9OA 3IOVA 2BJJX 4FORA 3K1PA 2R9JA 4KCDA 4LZ7A 4XKNA 2PT2A 5H8HA 1D4NA 4IO5A 1AOVA 2XXPA 5HPQA 1R6ZA 3BFTA 2Y84A 2QS4A 4KPTA 1A40A 1OIBA 3WAFA 5IKBA 1JVXA 3OOAA 4DDDA 3EPEA 1MQIA 2XX8A 3VXCA 1Y3QA 4NF4A 1ANFA 4QSCA 4O3CA 1LB9A 5TP9B 1NL5A 3OXNA 4GIZA 4I9DA 4EQBA 3U1OA 4HTGA 3B6TA 4H1XA 5ELVA 2A5TB 1B51A 4RJZA 2DE3A 3O97A 4U1OA 2ZYMA 2RC8A 4POXA 2FNCA 4UACA 3S9NC 5L8DA 3ECRA 3SEVA 3K6WA 3H3GA 3P7IA 4G68B 4WXJA 4EF2A 1AH5A 4YB5A 5CM6A 2PX1A 5I59B 1OMPA 5KCJB 3A3CA 1B0LA 5ICQA 4EQ9A 5J1DA 2VD2A 3C34A 3K1MA 4G8MA 3USDA 2QJEA 1N76A 4JB7A 4F3BA 4QSDA 1YTVA 3W9VA 3H6UA 4X1DA 1O63A 3DP6A 5DVIA 1QW0A 3OELA 2V25A 4PFTA 3ZKKA 2OK2A 4ELPA 4JSOA 3SEYA 5JEIA 3G3FA 3PUXE 4LQ2A 3PPPA 4XIGQ 3RLFE 4F31B 4ZE9A 2ONSA 4GF8A 1N7WA 3R7XA 4O3BA 2B3FA 1UQWA 2F5XA 3Q27A 2NUVA 4IO4A 1MH4A 2R71A 4NWCA 3D4CA 3VDFA 4EXKA 3CG1A 5I57A 5IAIA 3KN3A 4ECFA 4ELQA 2CMOA 1IQ7A 1P1NA 3PUYE 1URGA 2F7AA 4C1UA 4DCYA 1Y4CA 1HSEA 3E9XA 4ZDMA 1QJMA 3IB0A 1ZBMA 4H8JA 1IITA 3R26A 4M1VA 1B05A 1B46A 4XXUA 4TLLB 4FIMA 2Y7RA 3EQ1A 3PD9A 1FQBA 1MY4A 3RN8A 3WAEA 4KYSA 3E4RA 3JV9A 4THIA 3DM0A 1GR2A 1LSTA 3Q26A 1D3KA 3RPWA 3U93A 4I62A 2GH9A 2ZMBA 5FHMA 4FJPA 1MXZA 3EF7A 3HCQA 5HBCA 3TUSA 1JNFA 1H45A 3VLUA 2P2AA 3K2DA 1MY2A 4GRKA 3TFLA 5KZTA 1A8EA 2O1MA 2I0BA 3T96B 4GL8A 3TCGA 1N3WA 2W7YA 1OQHA 1IXHA 3RNNA 2O84X 2IEEA 3F11A 1UTHA 3A09A 3MBPA 2NWJA 1PB9A 3CRBA 3TELA 2PMSA 3UA8A 1MY1A 2GRVA 3VLVA 4ZEDA 3M3FA 2XXVA 2ZXTA 1GVCA 4JSDA 1LFIA 2I49A 3I3VA 2A5TA 4HCWA 4MH5A 3KJTA 2QS3A 4OERA 1KWHA 3TZAA 4Q8RA 3SEWA 4FEDA 3ODBA 5K2XA 3SDFA 5AA2A 4H5FA 1XT8A 1M5CA 2I3WA 1DSNA 5TU0A 3W9WA 1B4HA 2PBWA 4G68A 2HEUA 4QRZA 5BUUA 3C4MA 4EQ7A 4JDFA 1CB6A 1MQGA
chains in the Genus database with same CATH superfamily
4GL0A 2Y7PA 5CC2A 4I40A 3R6UA 2PT1A 3FZVA 1A8FA 4AB6A 2YJPA 3K01A 5I2NB 2XD2A 4GOTA 3SEXA 4XKQA 4LATA 2MKZA 1FPJA 4DIGA 1TT1A 3RTFB 4H45A 1SW2A 3PD8A 2XXHA 2Q8MA 4U2RA 4ZECA 2F34A 3FD3A 3FXUA 3TPAA 4EF2A 2DQVA 3TQLA 3KG2A 2O51A 4OEUA 1AIVA 4I1DA 2DP8A 4R9GA 3G3JA 4POWA 1UIVA 4OETA 3C32A 4GXAA 1RDXA 2XD3A 4RK9A 4HXVA 1WODA 4O3AA 2DE4A 4DI3D 3LBSA 3G3GA 1M5BA 3A3UA 4GWOA 3KGCA 4X04A 4P1EA 1POY1 4G68C 4NF5A 3KN7A 4HCYA 1Q1KA 4IB2A 4ONYA 4YKJA 3PPQA 3B6QA 4LP2B 3OSQA 1S50A 4RK2A 1YCJA 5M2VA 2ZYOA 3T22A 4IGRA 2UVJA 3VV5A 2FHYA 4N91A 1IMCA 4NF6B 5DEXA 1H76A 2D5WA 4F19A 1KA1A 4ND9A 3KOSA 2ABHA 2DS9A 2QMWA 3CFZA 4YKKA 4N17A 3S9EA 1B40A 2OCUA 4N6PA 5FTHA 3FV1A 3OMBA 4TOZA 1GTKA 4PAIA 3CG3A 2Q8JA 1UTHB 1AL3A 3THIA 3MZ9A 1IXCA 4PFIA 4OESA 4JWOA 1K9YA 1FPEA 3IORA 4YB6A 3LSXA 4G77A 5FHNA 4R6YA 4YB7A 3FXBA 4F29A 1MG1A 4OVJA 4KD5A 4MJOA 4BDLA 5ESYA 3QSLA 2H5YA 4XEQA 2V84A 2UXAA 1SW1A 4OFOA 1N7XA 2I3VA 1I6QA 3EN3A 2QVRA 3IK6B 1FJ9A 1LAHE 2RC9A 1R9QA 4H6DA 2FA7A 4PBQA 1F9BA 1FQDA 4BDOA 4L17A 4YKPA 4PDDA 2O68A 2XWKA 1NNFA 4BDRA 1JVYA 4QFPA 4R2BA 3O66A 1B0HA 1B2HA 5CBSA 1B4ZA 4XF5A 4H67A 4OYVA 4OFJA 5TP9A 5DVJA 1DPEA 3LR1A 1Y9UA 2Q2CA 4PE5B 5JK4A 1MM7A 4GBWA 4R72A 2I0CA 4PGPA 1O7TA 3E79A 4WEPA 3OD7A 4OFLA 2ANJA 4R73A 3TTNA 3FATA 4UABA 3PPNA 3C9HA 2QL3A 1MRPA 3KZGA 1LAGE 4OVRA 1M5EA 1VFEA 1K9ZA 4I8CA 3TQWA 4P9KA 2DXYA 4ZZEA 3MVXA 1YYZA 3IB1A 1MH3A 2Q88A 5EQ9A 1URSA 3C31A 4NF8A 2XXQA 4HE0A 1RKMA 3MYUA 1IXIA 1LB8A 3VVFA 4PE3A 3FJGA 5IZZA 3N5LA 1G0HA 5DYHA 5ET7A 1SW5A 2RF1A 3RQTA 1NV3A 3MZBA 5AA2D 2UVHA 1NV0A 3TMGA 1H3DA 3UN6A 4LN5A 4JXIA 1NH8A 3PUZE 4X8RA 4H5GA 5TPAB 3T93B 5I56A 3LV0A 1B7ZA 2XXIA 1IXGA 5CBRA 4R9FA 1MPBA 2O1LA 4WKMA 4LA9A 5FHOA 1NNTA 1B1HA 1YPNA 4FEBA 1EZOA 1B7HA 3BFUA 1NV6A 4RXLA 3LSLA 2PVUA 3H7MA 3MVWA 1JW1A 1LAXA 4GWWA 3GBAA 1LCTA 1B3FA 3K6XA 4MX6A 5I57B 5L9SA 2XXRA 1NNPA 1A99A 2DWHA 4P1LA 4PP0A 3NOHA 3K1NA 4F22A 4X9TA 3RT8A 1XOCA 1SBPA 4RYAA 2BJJX 4FBPA 2R9JA 4GX6A 1R6ZA 3BFTA 4AS4A 3OOAA 3EPEA 5TP9B 1ANFA 4QSCA 1NL5A 3OXNA 4I9DA 4P8BA 4HTGA 3B6TA 4H1XA 4HE1A 4RJZA 2DE3A 5L8DA 2P3VA 3K6WA 4G68B 1AH5A 1NUZA 5KCJB 3T0JA 3K1MA 1NV7A 1N76A 5A5XB 1O63A 2V25A 2OK2A 4JSOA 3G3FA 4F31B 2HHMA 2B3FA 4IO4A 2R71A 1FBGA 4NWCA 1IQ7A 3PUYE 1URGA 4XXUA 1ZBMA 4H8JA 4MNPA 1B05A 1FQBA 1MY4A 4KYSA 1GR2A 1LSTA 3Q26A 1FPGA 3HCQA 3TUSA 1JNFA 3TFLA 4GL8A 1NUYA 1N3WA 1OQHA 1KA0A 1PB9A 3CRBA 3VLVA 3M3FA 1GVCA 4JSDA 1LFIA 2I49A 4Q8RA 4FEDA 5K2XA 2ZZVA 5AA2A 4H5FA 2I3WA 1M5CA 4PAFA 2HEUA 4XIGQ 4EQ7A 4XKRA 1MQGA 4IO2A 2XWOA 1DTZA 4OHNA 4GQOA 2FVZA 5CMBA 2QSXA 3QYTA 4F3PA 1INPA 1JW4A 4F2QA 5LOMA 2O7UA 1B32A 1FBEA 3MZ1A 1MXWA 4PCDA 3H06B 1URDA 3HHFA 2GQ1A 1NKXA 5ITPA 1VSOA 3N6TA 1ZMGA 1ZTYA 3FVGA 1SYHA 1IMFA 3D1RA 3M3KA 4YICA 2QPQA 3L6HA 4MNCA 4RY1A 2WEFA 2F97A 3RUMA 2H98A 4LONB 3TKDA 3TDJA 3DP8A 4E0XA 3M8UA 1LCFA 3CSBA 4H0WA 4I3YA 1KZ8A 2E0SA 4QSEA 2O7IA 1LLSA 3UP9A 3N94A 4N8YA 1DOTA 1D9QA 4LQ5A 4GFRA 1FBDA 4R6HA 2XA5A 3V83A 3AXFA 5H8HB 2THIA 5EYHA 1B1XA 1B3HA 4DI4B 1QKAA 4C0RA 3FXQA 4AS5A 2V3UA 5EQAA 4FE8A 1WDNA 3IB2A 1MDQA 5DT6A 1JEUA 3O6GA 4G2ZA 5F24A 2WKYA 3N6UA 2R6GE 3S2VA 1NNKA 1MXUA 3CFLA 4PFWA 5EYGA 2QVUA 4PFYA 3VXBA 3LUZA 2ALUA 2VT5A 2F36A 3IR1A 1LGBC 2M8CA 4FAJA 3IX1A 5ITOA 3T9VA 3C36A 1Z7ME 3QXMA 4I3EA 5AA2B 4NTLA 4F3GA 1MQHA 1RYXA 1ATGA 2CZLA 4NHBA 2YLNA 1A7LA 3Q29A 2HQ0A 2RKMA 4F3SA 4LZ8A 3TYHA 5IZ1A 5H8SA 1B3EA 4N15A 1IUDA 4YAHX 2B65A 3B8BA 3MW0A 1TWYA 1YAEA 4N8GA 2VD3A 3TTLA 5ET5A 2B3BA 2RCBA 4F1YA 4G8NA 3HV1A 3OENA 2DOJA 2AL4A 3JZJA 1IZ1A 4P3LA 1FSAA 1L5TA 1RYOA 4NN3A 4RPOA 2B4MA 4QFLA 3LSFB 4PBHA 1FTKA 3IJOB 1LBCA 4FECA 4GX4A 3MQ9A 2L5VA 4ZS9A 4P0GA 2QMXA 2V3TA 2NVUB 4ZE8A 5CMMA 5H8NA 4PFUA 4LZ5A 3QAXA 1JW5A 2H4IA 3OO9A 4NWDA 2XXUA 4WEDA 3TTRA 2VOZA 5FTIA 1N04A 3EKIA 4U4XA 5AA4A 2CZIA 2XWIA 2HAVA 4GX3A 5IGAA 2PFYA 1B6HA 3K0VA 1DTGA 2F7CA 3HN0A 2I48A 4QBAA 3GYYA 2YPNA 1DCUA 5EHMA 3O6HA 4GWXA 3QMFA 3CSGA 3RY3A 4PQJA 4YKIA 4RNSA 3K00A 3FVOA 4GLIA 3FGSA 5I58A 2OBGA 3C33A 1G0IA 1N84A 1FBPA 2O6AA 1FBHA 2ZNSA 4OXVA 3KSXA 1LAFE 1EYIA 2I4CA 2UVIA 3Q25A 2DE2A 2AL5A 2ZYNA 4FATA 3O2AA 1H43A 4OQOA 2ONRA 1PB7A 1SI0A 3O28A 4EUOA 3HHGA 2ONKE 2QRYA 4MFIA 4JWYA 4NMYA 3Q28A 1SYIA 5JTYB 4U1ZA 1P1QA 1J1NA 1TFDA 1VDWA 1NUXA 2QVVA 3MUQA 1XHYA 4KHZE 5EQ7A 2V3QA 2XXWA 3IO6A 3S4UA 1QKBA 3DP4A 1QULA 2PCRA 3SERA 4O8MA 1EYKA 5I58B 2DWJA 4OEVA 3IL1B 4M4GA 5CRYA 3PV0E 1H44A 3KJ7A 4Q0CA 2F78A 3TTMA 3DELB 4YMAA 3H6TA 2QS1A 2HPGA 3TCHA 2OLBA 1R9LA 4JVCA 5LTCA 5L9OA 3IOVA 4FORA 3K1PA 4LZ7A 4XKNA 5H8HA 1A40A 1OIBA 1Y3QA 4NF4A 4OVTA 4O3CA 4EQBA 3U1OA 2A5TB 4N4UA 4OVSA 2ZYMA 2RC8A 4G61A 3SEVA 3H3GA 4YB5A 5CM6A 2PX1A 5I59B 5ICQA 4EQ9A 5J1DA 1DK4A 4JB7A 1FJ6A 3H6UA 3ZKKA 4ELPA 2VPOA 1NV5A 3PUXE 3PPPA 2ONSA 1UQWA 3Q27A 2NUVA 4NAPA 3KN3A 2FIXA 4ECFA 1FRPA 2CMOA 1HSEA 3IB0A 1IITA 1B46A 4TLLB 4FIMA 3EQ1A 3PD9A 3RN8A 2B4LA 3JV9A 3U93A 4I62A 2ZMBA 5FHMA 4KXPA 5IZ3A 3EF7A 5HBCA 4GRKA 1MY2A 5KZTA 1A8EA 2I0BA 3T96B 3TCGA 2KR0A 2PMSA 3E78A 2XXVA 4MH5A 3I3VA 4HCWA 3KJTA 4OERA 3ODBA 3SDFA 3MSTA 1XT8A 3SZPA 5TU0A 1FPKA 1B4HA 5BUUA 1CB6A 2A5SA 3V5AA 1Y1ZA 4ELRA 4GWUA 5CMCA 3M3LA 1RDZA 2OX3A 1FW0A 3ZKLA 4GWZA 5TPAA 1FTLA 4JWXA 1HSLA 1MQDA 5EQ8A 3FV2A 4R75A 4XTCQ 4HE2A 3IOWA 3V89B 1ZKBA 1XC1A 4ZEFA 1ZJLA 2X7PA 1MM6A 1DMBA 3SETA 1NMUA 5EHSA 3MAMA 3G3HA 4X1BA 3H6VA 3RPLA 1R1NA 3I6VA 5KDTA 4NF6A 5DEXB 4DXCA 3QUFA 2F6GA 3ZSFA 2H99A 4MEVA 1S7YA 3K6UA 2Q9TA 3S9LC 4XFEA 1FQFA 2H9BA 4ZEIA 2E1SA 3CHGA 3QIMA 4F39A 4NF4B 4PF6A 2CZHA 1QUJA 1BP5A 3PUWE 5F7VA 4RA1A 3HFUA 3GBBA 5AE4A 4GBVA 4R74A 4YMBA 3B7DA 1B3LA 1P1OA 5LDZA 3JYRA 3LC8A 3MP6A 1MXXA 2HZLA 3EHUA 4NG7A 3VFJA 1P1WA 4PC9A 1PEBA 4KYDA 2Z8DA 3K02A 3FASA 3T1BA 4YU0A 2XX7A 4ESXA 2Y7KA 4PETA 2F3BA 3MVZA 4NF8B 2P1SA 3V8XB 4GWSA 2D3IA 4MLQA 1LBWA 3MPLA 1LBVA 5EYFA 3FBPA 3MJNA 2KLFA 2HCAA 2REGA 1FCKA 3PTYA 1Z7NE 4C1TA 3HPIA 2G93A 2CEXA 2V93A 3OEKA 4JVIA 4YZZA 3IFCA 3CFXA 5H8QA 5J16A 3CI8A 4R2FA 3MC2A 4OTEA 3EHTA 2WYKA 1QUIA 3HO7A 3H03A 4QFNA 4QF9A 3GZGA 4KR5A 1N0TA 4KI0E 3KEIA 4IO7A 2OWSA 3I5OA 1NH7A 4H8IA 3ILUB 4G4PA 2G29A 2CEYA 3ISPA 1MDP1 1OLCA 1Y3PA 1FBFA 4X48A 3FVKA 4F18A 4PGNA 4MF3A 1NV4A 2F7BA 2LAOA 3RPWA 3RPLB 1S9TA 2Y7IA 2NOOA 1LFHA 1I6BA 3W15C 1PDAA 1USYH 5CMKA 2BJIA 2XXYA 1TFAA 1UTBB 1OVBA 3U92A 4U23A 3KN8A 5H8QB 5A5LA 5F1QA 2PYYA 4IY5A 1LBXA 3N26A 1FQEA 5I84A 4OA4A 1RDYA 4N13A 2AIXA 2HAUA 1O64A 4HW8A 5BWJA 3SEUA 4BDQA 2VPNA 2XXTA 3IOUA 4NQ8A 3E3KA 1WVJA 3BKIB 1FTJA 2WYPA 3S9MC 4DCXA 4NE4A 5B70A 4F2OA 4BDMA 1VR5A 2ZNTA 1POTA 3U65A 4F1VA 3K4UA 5I2KA 1UTBA 2HFBA 5I3SA 3G3IA 1PB8A 1IIWA 2GFEA 2REJA 2RCAA 3K6VA 4TQUQ 4Z0IA 2F8DA 2DVCA 3ONMA 5ISUA 5CI5A 3GLBA 3CR9A 5DTBA 3OSRA 4JBZA 4PAKA 2DSFA 3OO6A 4NF5B 1AMFA 3IOTA 5IM2A 1II5A 1US5A 1MXVA 1BIYA 1MQJA 3FJMA 1Y3NA 3E13X 2VHAA 1Y4TA 1DBZA 4ESWA 3UIFA 2VGQA 2OWTA 4OVPA 2DVZA 4F1UA 1JETA 2GHAA 4MNIA 1QUKA 1ZLQA 5I2KB 1JEVA 1XVXA 3H6WA 2HXWA 4NGUA 4OVQA 4OZ9A 4OENA 1B58A 3UGWA 2DWAA 3MP8A 4DZ1A 3KBZA 1MXYA 1NUWA 1XVYA 2OJTA 3SKPA 1XS5A 4U22A 1DPPA 3KOTA 3LUYA 1Y1MA 3U72A 2OWZA 2I58A 3O29A 2XWVA 4KCDA 4IO5A 1AOVA 2XXPA 2Y84A 2QS4A 4KPTA 3WAFA 5IKBA 1JVXA 1MQIA 2XX8A 1LB9A 4GIZA 1B51A 2FNCA 3S9NC 2Q74A 3ECRA 1FPLA 5T3JA 2VD2A 3USDA 4QSDA 1YTVA 4X1DA 3DP6A 1QW0A 4PFTA 1EZPA 3SEYA 4ZE9A 2Y5KA 1IMAA 3R7XA 4O3BA 2F5XA 4EXKA 3CG1A 5I57A 4ELQA 4NX1A 4ZDMA 1QJMA 2Y7RA 3WAEA 3E4RA 3DM0A 1D3KA 4N81A 1MXZA 1H45A 3K2DA 4N6DA 2O1MA 2W7YA 1JP4A 3RNNA 1LBYA 1UTHA 3MBPA 2NWJA 3UA8A 3TELA 1MY1A 2ZXTA 4ZEDA 1KWHA 1DSNA 2PBWA 4G68A 4QRZA 2FBPA 1IMBA 3C4MA 4JDFA 3RTWB 1YXIA 4IO3A 5I56B 2F35A 4NEDA 1HSJA 1US4A 3PUVE 5K2YA 1ZU0A 3KFMA 1FPDA 2O69A 1OLAA 2UYFA 4MBPA 2Q2AA 3VLWA 2D21A 5H8FA 1SD3A 1IMDA 2Z22A 4IO6A 3ROJA 4TLMB 3O9PA 4G8HA 3RT6B 1USYE 3IO4A 3LSWA 1LFGA 1SW4A 3FIRA 4O7IA 2DYXA 3EHSA 3H4ZA 1OQGA 1MPCA 1I6AA 3QUJA 2JJKA 2P0SA 2DXRA 4MMPA 1EZ9A 2XHDA 4MAGA 4P56A 4ISUA 5AA1A 2QS2A 3FVNA 5AA4B 2R8TA 3FJ7A 2DDKA 4OWDA 2I4BA 3TTKA 1FPFA 3GXAA 4P47A 4BDNA 2Y7WA 1LEVA 1MY3A 1SPIA 2Z8FA 1PBQA 3FUZA 2OZZA 1D9YA 5KCJA 3TCFA 1PBPA 1B52A 1FQAA 5DW8A 5ET6A 1GV8A 4GVOA 4GXSB 4DE8A 3B50A 3CVGA 3IJXB 4UA8A 1PC3A 1BTJA 2X7QA 1CNQA 3KC0A 4IGTA 2WBBA 1MS7A 1FPBA 3TODA 3ZS6A 4EDPA 1FQCA 4E0WA 2F3DA 3IFAA 1M5DA 1B5JA 1FTAA 1D9VA 4OMBA 4QFKA 3OO8A 1FBCA 3VE1B 4NF0A 3UORA 4QHQA 5H8NB 1MY0A 1VFDA 3KC1A 4Q5TA 4KFQA 4DXBA 4MLVA 2ZYKA 2HZKA 3FXRA 4LVQA 4GWYA 4O94A 3QK6A 1Q9DA 3OO7A 2F6PA 1A55A 3UK4A 4U21A 1BKAA 4DLDA 1XI6A 4K3FA 1NI9A 4R6KA 4BLAA 2V4CA 2ZNUA 4KYEA 3RYDA 1B5HA 1NV2A 3KBRA 1ZIUA 2RC7A 3TAJA 1NV1A 5B7DA 1B5IA 4RPNA 3PGFA 1YZ0A 3U94A 4H65A 1B7UA 1UIUA 4LUBA 3O6IA 1JQFA 3L6GA 2QFLA 3PMWA 3U8QA 2ZZXA 4U4SA 1I69A 4ZEBA 4XKPA 3RGYA 3MVYA 2ESNA 2NXOA 4KQPA 1IEJA 4ZEKA 1EU8A 2Z8EA 4KCCA 1EYJA 2FYIA 3A29A 1Y20A 5IZ3B 3TEPA 5H8FB 3ILTB 1GGGA 2IA4A 3G3KA 3T9HB 5A5XA 5JTYA 1QVSA 4MIJA 1NFTA 3MP1A 4N07A 2HXRA 2PFZA 1EH3A 4GD5A 3VVDA 1FTOA 2X26A 5L9MA 4N6KA 4AB5A 2ZZWA 3PPOA 3C35A 4EXLA 3D4GA 3PMXA 3KSJA 4Z7EA 2Z23A 5I2NA 3T9UA 4AQ4A 3PMVA 5ET8A 4P0IA 2GHBA 2XXKA 2DWIA 4P11A 1VE4A 4PDHA 1T0KA 5DVFA 2AYSA 1BLFA 2I6EA 2XX9A 1FTMA 3OEMA 4Q30B 1B3GA 3G7WA 1SI1A 1B9JA 2RINA 1A54A 1LBBA 1TXFA 5KDTB 3CIJA 3MWBA 4PFBA 3T66A 1P99A 1SVXB 3PU5A 2UYEA 3B6WA 4HS7A 4PTKA 1Q35A 4ZZAA 5AA3A 2KQZA 1CE2A 3BBRA 3PPRA 2UVGA 1QGXA 5I7IA 1P1UA 2Q89A 2CZKA 4QFOA 1MPDA 2H25A 4IY6A 3VVEA 1ELJA 3T9XB 1OVTA 3HSTA 1SQYA 5ICTA 1M5FA 3IAZA 1FPIA 1N3XA 1SDXA 4EF1A 5I5PA 3SESA 2WX9A 4ELOA 3DLNA 2XXXA 2VP1A 2PT2A 1D4NA 5HPQA 4DDDA 3VXCA 5ELVA 4QXDA 3O97A 4U1OA 4UACA 4POXA 2P3NA 4OANA 3P7IA 2Y5LA 4WXJA 3BIGA 4JVDA 1OMPA 3A3CA 1B0LA 3C34A 4G8MA 2QJEA 4F3BA 3W9VA 5DVIA 5HM4B 3OELA 5JEIA 4LQ2A 4PFRA 3RLFE 4GF8A 1N7WA 4O7MA 3VDFA 1BK4A 1MH4A 3D4CA 3BIHA 5IAIA 2WBDA 4PF8A 1LBZA 1P1NA 2F7AA 4C1UA 4DCYA 1Y4CA 3E9XA 4DXUA 4M1VA 3R26A 4H46A 2FIEA 4THIA 2GH9A 4FJPA 4MHFA 3VLUA 2P2AA 1AWBA 4MCOA 1IXHA 2O84X 2IEEA 3F11A 3A09A 2GRVA 5FBPA 2A5TA 1IMEA 2QS3A 3TZAA 3SEWA 3W9WA 4IR8A 5I59A 3MPKA
chains in the Genus database with same CATH topology
2A5SA 2Y7PA 4GL0A 4IO2A 3RTWB 3V5AA 5CC2A 3R6UA 4IO3A 5I56B 1Y1ZA 2F35A 4ELRA 4NEDA 5CMCA 1HSJA 3M3LA 2PT1A 1US4A 3PUVE 3FZVA 1FW0A 1A8FA 1DTZA 3ZKLA 2YJPA 4AB6A 3K01A 5K2YA 4OHNA 1ZU0A 3KFMA 5I2NB 2XD2A 4GOTA 4GQOA 3SEXA 5TPAA 1FTLA 4JWXA 4XKQA 2O69A 1HSLA 4LATA 5CMBA 1OLAA 2QSXA 1MQDA 3QYTA 2UYFA 4F3PA 1JW4A 4DIGA 4F2QA 1TT1A 4MBPA 2Q2AA 3FV2A 3RTFB 3VLWA 5LOMA 4R75A 1SW2A 2O7UA 5ICTA 1B32A 2D21A 4XTCQ 3PD8A 5H8FA 3MZ1A 2XXHA 1MXWA 1SD3A 3IOWA 4U2RA 3V89B 1ZKBA 3H06B 1URDA 2Z22A 3HHFA 4ZECA 1NKXA 2F34A 4IO6A 4TLMB 3O9PA 4G8HA 3RT6B 1XC1A 1USYE 4ZEFA 1ZJLA 2X7PA 1MM6A 3IO4A 1DMBA 3SETA 1NMUA 5EHSA 3MAMA 3G3HA 5AA2B 5ITPA 4X1BA 1VSOA 3H6VA 3FD3A 3FXUA 3LSWA 1LFGA 1SW4A 1ZMGA 1ZTYA 3FVGA 3N6TA 1SYHA 3TPAA 1R1NA 3FIRA 4YICA 3I6VA 3M3KA 5KDTA 2DYXA 3EHSA 3H4ZA 2QPQA 1OQGA 3L6HA 4NF6A 5DEXB 4DXCA 4RY1A 2DQVA 1MPCA 3QUFA 2F6GA 1I6AA 2F97A 2H99A 3RUMA 2H98A 1S7YA 3TQLA 3K6UA 3QUJA 4LONB 3ZSFA 3TKDA 2Q9TA 3TDJA 3KG2A 2P0SA 3DP8A 2O51A 2DXRA 4OEUA 3S9LC 4E0XA 3M8UA 1LCFA 1EZ9A 3CSBA 1AIVA 2XHDA 4H0WA 1FQFA 2H9BA 4ISUA 5AA1A 4I1DA 2DP8A 4R9GA 4ZEIA 3G3JA 2E1SA 2E0SA 4POWA 1UIVA 3QIMA 4F39A 2QS2A 4OETA 4QSEA 3FVNA 4NF4B 2O7IA 1LLSA 5AA4B 3C32A 4GXAA 3FJ7A 3UP9A 2XD3A 3N94A 4RK9A 1DOTA 4LQ5A 4OWDA 2I4BA 4GFRA 3GXAA 4R6HA 3TTKA 4BDNA 5B70A 1QUJA 2Y7WA 3V83A 3AXFA 1BP5A 1MY3A 5H8HB 2THIA 2Z8FA 3PUWE 1PBQA 3FUZA 5F7VA 4RA1A 1WODA 2OZZA 4O3AA 1D9YA 2DE4A 5KCJA 3GBBA 3LBSA 3TCFA 3G3GA 1PBPA 1B52A 1FQAA 1M5BA 3A3UA 1B1XA 3KGCA 4GWOA 4R74A 1B3HA 1GV8A 5AE4A 4YMBA 3B7DA 1B3LA 1P1OA 1QKAA 4C0RA 4GVOA 3FXQA 1POY1 3JYRA 3LC8A 4G68C 4GXSB 3MP6A 1MXXA 4NF5A 4DE8A 3KN7A 3CVGA 2HZLA 2V3UA 3EHUA 1Q1KA 4FE8A 4HCYA 3IJXB 4IB2A 4ONYA 1PC3A 4UA8A 3PPQA 4YKJA 3VFJA 1P1WA 3B6QA 4LP2B 3OSQA 1S50A 4RK2A 1BTJA 1YCJA 1PEBA 2ZYOA 5M2VA 3T22A 1WDNA 2Z8DA 3IB2A 3K02A 4KYDA 1MDQA 3FASA 4IGRA 2UVJA 2X7QA 5H8SA 5DT6A 3VV5A 4YU0A 2XX7A 4ESXA 2Y7KA 1JEUA 4IGTA 3O6GA 4G2ZA 1MS7A 4NF6B 5DEXA 3TODA 2WKYA 1H76A 3ZS6A 2D5WA 3N6UA 2R6GE 4EDPA 4F19A 4ND9A 3S2VA 1NNKA 3KOSA 2ABHA 2DS9A 4PETA 1FQCA 1MXUA 3CFLA 3MVZA 4PFWA 4PFYA 4E0WA 4NF8B 2QMWA 3VXBA 3CFZA 2P1SA 3V8XB 4YKKA 1M5DA 2ALUA 2D3IA 3S9EA 2F36A 4MLQA 1B5JA 3IR1A 3MPLA 1LGBC 2M8CA 4FAJA 1B40A 2OCUA 4N6PA 5EYFA 3IX1A 5FTHA 3FV1A 1D9VA 4OMBA 4QFKA 5ITOA 3OMBA 3OO8A 4TOZA 3MJNA 1GTKA 2KLFA 3C36A 2HCAA 3T9VA 3VE1B 1Z7ME 3QXMA 2REGA 1FCKA 3CG3A 4NTLA 1Z7NE 4QHQA 3UORA 3HPIA 4C1TA 2Q8JA 1MY0A 2G93A 4F3GA 1MQHA 5H8NB 2V93A 1RYXA 1VFDA 1ATGA 4Q5TA 2CZLA 3OEKA 4YZZA 2YLNA 1A7LA 3Q29A 2HQ0A 2RKMA 1UTHB 4F3SA 4KFQA 4DXBA 1AL3A 3CFXA 5H8QA 4LZ8A 4MLVA 3THIA 3TYHA 3CI8A 4R2FA 2ZYKA 3MZ9A 1B3EA 1IXCA 2HZKA 3FXRA 3MC2A 4LVQA 3EHTA 4OTEA 1IUDA 4YAHX 4OESA 2B65A 4JWOA 1QUIA 3MW0A 1TWYA 1YAEA 3HO7A 3IORA 3QK6A 3H03A 4YB6A 3LSXA 4G77A 4QF9A 4QFNA 3GZGA 5FHNA 2VD3A 3OO7A 3TTLA 4R6YA 4KR5A 4YB7A 4F29A 1MG1A 1N0TA 2B3BA 4OVJA 4KD5A 4BDLA 2RCBA 4KI0E 3KEIA 3QSLA 2F6PA 1A55A 4IO7A 2H5YA 2OWSA 1BKAA 4U21A 3UK4A 4G8NA 2V84A 3HV1A 3I5OA 3OENA 2UXAA 3VVDA 1SW1A 1NH7A 4DLDA 4H8IA 2DOJA 3ILUB 4OFOA 4K3FA 4G4PA 1N7XA 2I3VA 2AL4A 1I6QA 4R6KA 3EN3A 2G29A 3IK6B 1IZ1A 3JZJA 4BLAA 1MDP1 1LAHE 2ZNUA 1L5TA 4XKRA 4KYEA 1OLCA 1Y3PA 1RYOA 2RC9A 1R9QA 1B5HA 3KBRA 4RPOA 4H6DA 4X48A 3FVKA 4QFLA 4F18A 3LSFB 2FA7A 1ZIUA 2RC7A 4MF3A 2F7BA 1F9BA 1FQDA 2LAOA 1FTKA 3IJOB 4L17A 1LBCA 4FECA 4YKPA 1B5IA 1S9TA 2Y7IA 4RPNA 2NOOA 5B7DA 3MQ9A 2O68A 3PGFA 1NNFA 3U94A 4BDRA 4ZS9A 4H65A 1LFHA 1B7UA 1I6BA 4P0GA 1JVYA 2QMXA 1UIUA 2V3TA 3W15C 2NVUB 4QFPA 4LUBA 1PDAA 1USYH 3O6IA 4ZE8A 5CMKA 5CMMA 1JQFA 4R2BA 3L6GA 3O66A 3PMWA 2XXYA 5H8NA 3U8QA 4U4SA 1I69A 4ZEBA 4DXUA 1B0HA 1TFAA 1UTBB 1OVBA 1B2HA 4PFUA 4XKPA 3RGYA 3TAJA 4LZ5A 3U92A 3QAXA 5CBSA 1B4ZA 1JW5A 3MVYA 2H4IA 2ESNA 3OO9A 4U23A 4NWDA 2XXUA 2NXOA 3KN8A 4KQPA 4WEDA 5F1QA 5H8QB 2PYYA 4IY5A 3TTRA 2VOZA 1IEJA 1N04A 4U4XA 1EU8A 2Z8EA 4KCCA 5FTIA 4ZEKA 5AA4A 2FYIA 4H67A 4OYVA 1EZPA 1Y20A 4OFJA 2HAVA 5TP9A 5DVJA 1DPEA 3TEPA 3LR1A 5H8FB 3ILTB 1GGGA 1B6HA 1Y9UA 2IA4A 2Q2CA 3G3KA 3K0VA 3N26A 4PE5B 3T9HB 1DTGA 1MM7A 5HM4B 5A5XA 5JK4A 2F7CA 3HN0A 5JTYA 1FQEA 1QVSA 1NFTA 4R72A 2I0CA 1O7TA 4WEPA 2I48A 3OD7A 5I84A 4OFLA 3MP1A 2ANJA 4N07A 1EH3A 4GD5A 2YPNA 4N13A 3FATA 2AIXA 2HAUA 1O64A 1FTOA 4R73A 3TTNA 2X26A 3C9HA 3PPNA 5L9MA 2QL3A 5EHMA 3SEUA 1MRPA 4HW8A 5BWJA 3O6HA 3KZGA 1LAGE 3CSGA 4BDQA 1M5EA 2XXTA 3IOUA 3E3KA 1WVJA 1VFEA 3BKIB 3RY3A 1FTJA 4PQJA 4YKIA 4I8CA 4AB5A 3PPOA 4RNSA 3S9MC 3K00A 3FVOA 4DCXA 3C35A 4NE4A 4GLIA 3FGSA 3D4GA 3PMXA 3KSJA 4EXLA 3TQWA 4F2OA 2OBGA 5I58A 4BDMA 4Z7EA 3C33A 2Z23A 1VR5A 2ZNTA 1POTA 2DXYA 1N84A 4ZZEA 3MVXA 5I2NA 3IB1A 1MH3A 2O6AA 2Q88A 4F1VA 2ZNSA 1URSA 3C31A 3K4UA 4OXVA 3T9UA 4AQ4A 3KSXA 5I2KA 4NF8A 3PMVA 2XXQA 1RKMA 1UTBA 2HFBA 4P0IA 1LAFE 2I4CA 2GHBA 2UVIA 3G3IA 1IXIA 1LB8A 1PB8A 2AL5A 2DE2A 2ZYNA 3Q25A 3VVFA 4FATA 1IIWA 2GFEA 3FJGA 2DWIA 3O2AA 4P11A 1VE4A 2REJA 3N5LA 1T0KA 1H43A 4OQOA 5DYHA 2ONRA 2RCAA 1SW5A 3K6VA 4BDOA 1PB7A 4TQUQ 5DVFA 4Z0IA 1SI0A 2AYSA 2F8DA 2RF1A 3O28A 4EUOA 3RQTA 1BLFA 3HHGA 3MZBA 2DVCA 3ONMA 5ISUA 2I6EA 2XX9A 5CI5A 1FTMA 3OEMA 4Q30B 5AA2D 2ONKE 2QRYA 2UVHA 3GLBA 4MFIA 1H3DA 3TMGA 4JWYA 3CR9A 1B3GA 3UN6A 3G7WA 1SI1A 1B9JA 1NH8A 3PUZE 3Q28A 4JXIA 3OSRA 4JBZA 1SYIA 4NMYA 2RINA 5DTBA 4H5GA 1A54A 1LBBA 1P1QA 1TXFA 2DSFA 3OO6A 4NF5B 4U1ZA 1J1NA 1AMFA 1TFDA 3CIJA 3IOTA 5KDTB 5A5XB 5TPAB 3MWBA 4F1YA 3T93B 1II5A 3T66A 1P99A 1US5A 1MXVA 3MUQA 1SVXB 5I56A 1XHYA 1BIYA 1MQJA 4KHZE 3FJMA 1Y3NA 3E13X 3VVEA 1B7ZA 2VHAA 1Y4TA 3PU5A 2V3QA 2XXIA 1IXGA 2UYEA 2XXWA 3B6WA 3IO6A 4HS7A 3S4UA 5CBRA 1QKBA 3DP4A 4R9FA 1QULA 5JTYB 4ESWA 1MPBA 2O1LA 3SERA 4WKMA 4LA9A 3UIFA 2VGQA 5I58B 1Q35A 2OWTA 5FHOA 2DWJA 4F1UA 2DVZA 4ZZAA 5AA3A 1JETA 1NNTA 2GHAA 1B1HA 1YPNA 4OEVA 4FEBA 1CE2A 1EZOA 1B7HA 3BBRA 3IL1B 3PPRA 3BFUA 1QUKA 2UVGA 4RXLA 1ZLQA 1P1UA 2PVUA 3H7MA 3LSLA 5I59A 5I2KB 2Q89A 4QFOA 3MVWA 1JEVA 1XVXA 3H6WA 4M4GA 1JW1A 2HXWA 1MPDA 5CRYA 1LAXA 3PV0E 4OZ9A 1H44A 4OENA 2H25A 1LCTA 3GBAA 1B3FA 3KJ7A 3K6XA 3MPKA 1ELJA 4IY6A 4Q0CA 1B58A 3T9XB 3UGWA 2DWAA 3MP8A 2F78A 4DZ1A 1OVTA 5I57B 5L9SA 2XXRA 1NNPA 1A99A 1M5FA 1MXYA 1SQYA 2DWHA 3HSTA 4PP0A 3TTMA 3DELB 4YMAA 3H6TA 1XVYA 2OJTA 3IAZA 1XS5A 3SKPA 1N3XA 3K1NA 1DPPA 1SDXA 3KOTA 3LUYA 4U22A 4F22A 4EF1A 1Y1MA 2QS1A 3U72A 3SESA 4X9TA 4ELOA 3RT8A 3TCHA 1XOCA 3DLNA 2I58A 2VP1A 2XXXA 3O29A 2OLBA 1R9LA 1SBPA 4RYAA 5L9OA 3IOVA 2BJJX 4FORA 3K1PA 2R9JA 4KCDA 4LZ7A 4XKNA 2PT2A 5H8HA 1D4NA 4IO5A 1AOVA 2XXPA 5HPQA 1R6ZA 3BFTA 2Y84A 2QS4A 4KPTA 1A40A 1OIBA 3WAFA 5IKBA 1JVXA 3OOAA 4DDDA 3EPEA 1MQIA 2XX8A 3VXCA 1Y3QA 4NF4A 1ANFA 4QSCA 4O3CA 1LB9A 5TP9B 1NL5A 3OXNA 4GIZA 4I9DA 4EQBA 3U1OA 4HTGA 3B6TA 4H1XA 5ELVA 2A5TB 1B51A 4RJZA 2DE3A 3O97A 4U1OA 2ZYMA 2RC8A 4POXA 2FNCA 4UACA 3S9NC 5L8DA 3ECRA 3SEVA 3K6WA 3H3GA 3P7IA 4G68B 4WXJA 4EF2A 1AH5A 4YB5A 5CM6A 2PX1A 5I59B 1OMPA 5KCJB 3A3CA 1B0LA 5ICQA 4EQ9A 5J1DA 2VD2A 3C34A 3K1MA 4G8MA 3USDA 2QJEA 1N76A 4JB7A 4F3BA 4QSDA 1YTVA 3W9VA 3H6UA 4X1DA 1O63A 3DP6A 5DVIA 1QW0A 3OELA 2V25A 4PFTA 3ZKKA 2OK2A 4ELPA 4JSOA 3SEYA 5JEIA 3G3FA 3PUXE 4LQ2A 3PPPA 4XIGQ 3RLFE 4F31B 4ZE9A 2ONSA 4GF8A 1N7WA 3R7XA 4O3BA 2B3FA 1UQWA 2F5XA 3Q27A 2NUVA 4IO4A 1MH4A 2R71A 4NWCA 3D4CA 3VDFA 4EXKA 3CG1A 5I57A 5IAIA 3KN3A 4ECFA 4ELQA 2CMOA 1IQ7A 1P1NA 3PUYE 1URGA 2F7AA 4C1UA 4DCYA 1Y4CA 1HSEA 3E9XA 4ZDMA 1QJMA 3IB0A 1ZBMA 4H8JA 1IITA 3R26A 4M1VA 1B05A 1B46A 4XXUA 4TLLB 4FIMA 2Y7RA 3EQ1A 3PD9A 1FQBA 1MY4A 3RN8A 3WAEA 4KYSA 3E4RA 3JV9A 4THIA 3DM0A 1GR2A 1LSTA 3Q26A 1D3KA 3RPWA 3U93A 4I62A 2GH9A 2ZMBA 5FHMA 4FJPA 1MXZA 3EF7A 3HCQA 5HBCA 3TUSA 1JNFA 1H45A 3VLUA 2P2AA 3K2DA 1MY2A 4GRKA 3TFLA 5KZTA 1A8EA 2O1MA 2I0BA 3T96B 4GL8A 3TCGA 1N3WA 2W7YA 1OQHA 1IXHA 3RNNA 2O84X 2IEEA 3F11A 1UTHA 3A09A 3MBPA 2NWJA 1PB9A 3CRBA 3TELA 2PMSA 3UA8A 1MY1A 2GRVA 3VLVA 4ZEDA 3M3FA 2XXVA 2ZXTA 1GVCA 4JSDA 1LFIA 2I49A 3I3VA 2A5TA 4HCWA 4MH5A 3KJTA 2QS3A 4OERA 1KWHA 3TZAA 4Q8RA 3SEWA 4FEDA 3ODBA 5K2XA 3SDFA 5AA2A 4H5FA 1XT8A 1M5CA 2I3WA 1DSNA 5TU0A 3W9WA 1B4HA 2PBWA 4G68A 2HEUA 4QRZA 5BUUA 3C4MA 4EQ7A 4JDFA 1CB6A 1MQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5S A;  2Y7P A;  4GL0 A;  4IO2 A;  3RTW B;  3V5A A;  5CC2 A;  3R6U A;  4IO3 A;  5I56 B;  1Y1Z A;  2F35 A;  4ELR A;  4NED A;  5CMC A;  1HSJ A;  3M3L A;  2PT1 A;  1US4 A;  3PUV E;  3FZV A;  1FW0 A;  1A8F A;  1DTZ A;  3ZKL A;  2YJP A;  4AB6 A;  3K01 A;  5K2Y A;  4OHN A;  1ZU0 A;  3KFM A;  5I2N B;  2XD2 A;  4GOT A;  4GQO A;  3SEX A;  5TPA A;  1FTL A;  4JWX A;  4XKQ A;  2O69 A;  1HSL A;  4LAT A;  5CMB A;  1OLA A;  2QSX A;  1MQD A;  3QYT A;  2UYF A;  4F3P A;  1JW4 A;  4DIG A;  4F2Q A;  1TT1 A;  4MBP A;  2Q2A A;  3FV2 A;  3RTF B;  3VLW A;  5LOM A;  4R75 A;  1SW2 A;  2O7U A;  5ICT A;  1B32 A;  2D21 A;  4XTC Q;  3PD8 A;  5H8F A;  3MZ1 A;  2XXH A;  1MXW A;  1SD3 A;  3IOW A;  4U2R A;  3V89 B;  1ZKB A;  3H06 B;  1URD A;  2Z22 A;  3HHF A;  4ZEC A;  1NKX A;  2F34 A;  4IO6 A;  4TLM B;  3O9P A;  4G8H A;  3RT6 B;  1XC1 A;  1USY E;  4ZEF A;  1ZJL A;  2X7P A;  1MM6 A;  3IO4 A;  1DMB A;  3SET A;  1NMU A;  5EHS A;  3MAM A;  3G3H A;  5AA2 B;  5ITP A;  4X1B A;  1VSO A;  3H6V A;  3FD3 A;  3FXU A;  3LSW A;  1LFG A;  1SW4 A;  1ZMG A;  1ZTY A;  3FVG A;  3N6T A;  1SYH A;  3TPA A;  1R1N A;  3FIR A;  4YIC A;  3I6V A;  3M3K A;  5KDT A;  2DYX A;  3EHS A;  3H4Z A;  2QPQ A;  1OQG A;  3L6H A;  4NF6 A;  5DEX B;  4DXC A;  4RY1 A;  2DQV A;  1MPC A;  3QUF A;  2F6G A;  1I6A A;  2F97 A;  2H99 A;  3RUM A;  2H98 A;  1S7Y A;  3TQL A;  3K6U A;  3QUJ A;  4LON B;  3ZSF A;  3TKD A;  2Q9T A;  3TDJ A;  3KG2 A;  2P0S A;  3DP8 A;  2O51 A;  2DXR A;  4OEU A;  3S9L C;  4E0X A;  3M8U A;  1LCF A;  1EZ9 A;  3CSB A;  1AIV A;  2XHD A;  4H0W A;  1FQF A;  2H9B A;  4ISU A;  5AA1 A;  4I1D A;  2DP8 A;  4R9G A;  4ZEI A;  3G3J A;  2E1S A;  2E0S A;  4POW A;  1UIV A;  3QIM A;  4F39 A;  2QS2 A;  4OET A;  4QSE A;  3FVN A;  4NF4 B;  2O7I A;  1LLS A;  5AA4 B;  3C32 A;  4GXA A;  3FJ7 A;  3UP9 A;  2XD3 A;  3N94 A;  4RK9 A;  1DOT A;  4LQ5 A;  4OWD A;  2I4B A;  4GFR A;  3GXA A;  4R6H A;  3TTK A;  4BDN A;  5B70 A;  1QUJ A;  2Y7W A;  3V83 A;  3AXF A;  1BP5 A;  1MY3 A;  5H8H B;  2THI A;  2Z8F A;  3PUW E;  1PBQ A;  3FUZ A;  5F7V A;  4RA1 A;  1WOD A;  2OZZ A;  4O3A A;  1D9Y A;  2DE4 A;  5KCJ A;  3GBB A;  3LBS A;  3TCF A;  3G3G A;  1PBP A;  1B52 A;  1FQA A;  1M5B A;  3A3U A;  1B1X A;  3KGC A;  4GWO A;  4R74 A;  1B3H A;  1GV8 A;  5AE4 A;  4YMB A;  3B7D A;  1B3L A;  1P1O A;  1QKA A;  4C0R A;  4GVO A;  3FXQ A;  1POY 1;  3JYR A;  3LC8 A;  4G68 C;  4GXS B;  3MP6 A;  1MXX A;  4NF5 A;  4DE8 A;  3KN7 A;  3CVG A;  2HZL A;  2V3U A;  3EHU A;  1Q1K A;  4FE8 A;  4HCY A;  3IJX B;  4IB2 A;  4ONY A;  1PC3 A;  4UA8 A;  3PPQ A;  4YKJ A;  3VFJ A;  1P1W A;  3B6Q A;  4LP2 B;  3OSQ A;  1S50 A;  4RK2 A;  1BTJ A;  1YCJ A;  1PEB A;  2ZYO A;  5M2V A;  3T22 A;  1WDN A;  2Z8D A;  3IB2 A;  3K02 A;  4KYD A;  1MDQ A;  3FAS A;  4IGR A;  2UVJ A;  2X7Q A;  5H8S A;  5DT6 A;  3VV5 A;  4YU0 A;  2XX7 A;  4ESX A;  2Y7K A;  1JEU A;  4IGT A;  3O6G A;  4G2Z A;  1MS7 A;  4NF6 B;  5DEX A;  3TOD A;  2WKY A;  1H76 A;  3ZS6 A;  2D5W A;  3N6U A;  2R6G E;  4EDP A;  4F19 A;  4ND9 A;  3S2V A;  1NNK A;  3KOS A;  2ABH A;  2DS9 A;  4PET A;  1FQC A;  1MXU A;  3CFL A;  3MVZ A;  4PFW A;  4PFY A;  4E0W A;  4NF8 B;  2QMW A;  3VXB A;  3CFZ A;  2P1S A;  3V8X B;  4YKK A;  1M5D A;  2ALU A;  2D3I A;  3S9E A;  2F36 A;  4MLQ A;  1B5J A;  3IR1 A;  3MPL A;  1LGB C;  2M8C A;  4FAJ A;  1B40 A;  2OCU A;  4N6P A;  5EYF A;  3IX1 A;  5FTH A;  3FV1 A;  1D9V A;  4OMB A;  4QFK A;  5ITO A;  3OMB A;  3OO8 A;  4TOZ A;  3MJN A;  1GTK A;  2KLF A;  3C36 A;  2HCA A;  3T9V A;  3VE1 B;  1Z7M E;  3QXM A;  2REG A;  1FCK A;  3CG3 A;  4NTL A;  1Z7N E;  4QHQ A;  3UOR A;  3HPI A;  4C1T A;  2Q8J A;  1MY0 A;  2G93 A;  4F3G A;  1MQH A;  5H8N B;  2V93 A;  1RYX A;  1VFD A;  1ATG A;  4Q5T A;  2CZL A;  3OEK A;  4YZZ A;  2YLN A;  1A7L A;  3Q29 A;  2HQ0 A;  2RKM A;  1UTH B;  4F3S A;  4KFQ A;  4DXB A;  1AL3 A;  3CFX A;  5H8Q A;  4LZ8 A;  4MLV A;  3THI A;  3TYH A;  3CI8 A;  4R2F A;  2ZYK A;  3MZ9 A;  1B3E A;  1IXC A;  2HZK A;  3FXR A;  3MC2 A;  4LVQ A;  3EHT A;  4OTE A;  1IUD A;  4YAH X;  4OES A;  2B65 A;  4JWO A;  1QUI A;  3MW0 A;  1TWY A;  1YAE A;  3HO7 A;  3IOR A;  3QK6 A;  3H03 A;  4YB6 A;  3LSX A;  4G77 A;  4QF9 A;  4QFN A;  3GZG A;  5FHN A;  2VD3 A;  3OO7 A;  3TTL A;  4R6Y A;  4KR5 A;  4YB7 A;  4F29 A;  1MG1 A;  1N0T A;  2B3B A;  4OVJ A;  4KD5 A;  4BDL A;  2RCB A;  4KI0 E;  3KEI A;  3QSL A;  2F6P A;  1A55 A;  4IO7 A;  2H5Y A;  2OWS A;  1BKA A;  4U21 A;  3UK4 A;  4G8N A;  2V84 A;  3HV1 A;  3I5O A;  3OEN A;  2UXA A;  3VVD A;  1SW1 A;  1NH7 A;  4DLD A;  4H8I A;  2DOJ A;  3ILU B;  4OFO A;  4K3F A;  4G4P A;  1N7X A;  2I3V A;  2AL4 A;  1I6Q A;  4R6K A;  3EN3 A;  2G29 A;  3IK6 B;  1IZ1 A;  3JZJ A;  4BLA A;  1MDP 1;  1LAH E;  2ZNU A;  1L5T A;  4XKR A;  4KYE A;  1OLC A;  1Y3P A;  1RYO A;  2RC9 A;  1R9Q A;  1B5H A;  3KBR A;  4RPO A;  4H6D A;  4X48 A;  3FVK A;  4QFL A;  4F18 A;  3LSF B;  2FA7 A;  1ZIU A;  2RC7 A;  4MF3 A;  2F7B A;  1F9B A;  1FQD A;  2LAO A;  1FTK A;  3IJO B;  4L17 A;  1LBC A;  4FEC A;  4YKP A;  1B5I A;  1S9T A;  2Y7I A;  4RPN A;  2NOO A;  5B7D A;  3MQ9 A;  2O68 A;  3PGF A;  1NNF A;  3U94 A;  4BDR A;  4ZS9 A;  4H65 A;  1LFH A;  1B7U A;  1I6B A;  4P0G A;  1JVY A;  2QMX A;  1UIU A;  2V3T A;  3W15 C;  2NVU B;  4QFP A;  4LUB A;  1PDA A;  1USY H;  3O6I A;  4ZE8 A;  5CMK A;  5CMM A;  1JQF A;  4R2B A;  3L6G A;  3O66 A;  3PMW A;  2XXY A;  5H8N A;  3U8Q A;  4U4S A;  1I69 A;  4ZEB A;  4DXU A;  1B0H A;  1TFA A;  1UTB B;  1OVB A;  1B2H A;  4PFU A;  4XKP A;  3RGY A;  3TAJ A;  4LZ5 A;  3U92 A;  3QAX A;  5CBS A;  1B4Z A;  1JW5 A;  3MVY A;  2H4I A;  2ESN A;  3OO9 A;  4U23 A;  4NWD A;  2XXU A;  2NXO A;  3KN8 A;  4KQP A;  4WED A;  5F1Q A;  5H8Q B;  2PYY A;  4IY5 A;  3TTR A;  2VOZ A;  1IEJ A;  1N04 A;  4U4X A;  1EU8 A;  2Z8E A;  4KCC A;  5FTI A;  4ZEK A;  5AA4 A;  2FYI A;  4H67 A;  4OYV A;  1EZP A;  1Y20 A;  4OFJ A;  2HAV A;  5TP9 A;  5DVJ A;  1DPE A;  3TEP A;  3LR1 A;  5H8F B;  3ILT B;  1GGG A;  1B6H A;  1Y9U A;  2IA4 A;  2Q2C A;  3G3K A;  3K0V A;  3N26 A;  4PE5 B;  3T9H B;  1DTG A;  1MM7 A;  5HM4 B;  5A5X A;  5JK4 A;  2F7C A;  3HN0 A;  5JTY A;  1FQE A;  1QVS A;  1NFT A;  4R72 A;  2I0C A;  1O7T A;  4WEP A;  2I48 A;  3OD7 A;  5I84 A;  4OFL A;  3MP1 A;  2ANJ A;  4N07 A;  1EH3 A;  4GD5 A;  2YPN A;  4N13 A;  3FAT A;  2AIX A;  2HAU A;  1O64 A;  1FTO A;  4R73 A;  3TTN A;  2X26 A;  3C9H A;  3PPN A;  5L9M A;  2QL3 A;  5EHM A;  3SEU A;  1MRP A;  4HW8 A;  5BWJ A;  3O6H A;  3KZG A;  1LAG E;  3CSG A;  4BDQ A;  1M5E A;  2XXT A;  3IOU A;  3E3K A;  1WVJ A;  1VFE A;  3BKI B;  3RY3 A;  1FTJ A;  4PQJ A;  4YKI A;  4I8C A;  4AB5 A;  3PPO A;  4RNS A;  3S9M C;  3K00 A;  3FVO A;  4DCX A;  3C35 A;  4NE4 A;  4GLI A;  3FGS A;  3D4G A;  3PMX A;  3KSJ A;  4EXL A;  3TQW A;  4F2O A;  2OBG A;  5I58 A;  4BDM A;  4Z7E A;  3C33 A;  2Z23 A;  1VR5 A;  2ZNT A;  1POT A;  2DXY A;  1N84 A;  4ZZE A;  3MVX A;  5I2N A;  3IB1 A;  1MH3 A;  2O6A A;  2Q88 A;  4F1V A;  2ZNS A;  1URS A;  3C31 A;  3K4U A;  4OXV A;  3T9U A;  4AQ4 A;  3KSX A;  5I2K A;  4NF8 A;  3PMV A;  2XXQ A;  1RKM A;  1UTB A;  2HFB A;  4P0I A;  1LAF E;  2I4C A;  2GHB A;  2UVI A;  3G3I A;  1IXI A;  1LB8 A;  1PB8 A;  2AL5 A;  2DE2 A;  2ZYN A;  3Q25 A;  3VVF A;  4FAT A;  1IIW A;  2GFE A;  3FJG A;  2DWI A;  3O2A A;  4P11 A;  1VE4 A;  2REJ A;  3N5L A;  1T0K A;  1H43 A;  4OQO A;  5DYH A;  2ONR A;  2RCA A;  1SW5 A;  3K6V A;  4BDO A;  1PB7 A;  4TQU Q;  5DVF A;  4Z0I A;  1SI0 A;  2AYS A;  2F8D A;  2RF1 A;  3O28 A;  4EUO A;  3RQT A;  1BLF A;  3HHG A;  3MZB A;  2DVC A;  3ONM A;  5ISU A;  2I6E A;  2XX9 A;  5CI5 A;  1FTM A;  3OEM A;  4Q30 B;  5AA2 D;  2ONK E;  2QRY A;  2UVH A;  3GLB A;  4MFI A;  1H3D A;  3TMG A;  4JWY A;  3CR9 A;  1B3G A;  3UN6 A;  3G7W A;  1SI1 A;  1B9J A;  1NH8 A;  3PUZ E;  3Q28 A;  4JXI A;  3OSR A;  4JBZ A;  1SYI A;  4NMY A;  2RIN A;  5DTB A;  4H5G A;  1A54 A;  1LBB A;  1P1Q A;  1TXF A;  2DSF A;  3OO6 A;  4NF5 B;  4U1Z A;  1J1N A;  1AMF A;  1TFD A;  3CIJ A;  3IOT A;  5KDT B;  5A5X B;  5TPA B;  3MWB A;  4F1Y A;  3T93 B;  1II5 A;  3T66 A;  1P99 A;  1US5 A;  1MXV A;  3MUQ A;  1SVX B;  5I56 A;  1XHY A;  1BIY A;  1MQJ A;  4KHZ E;  3FJM A;  1Y3N A;  3E13 X;  3VVE A;  1B7Z A;  2VHA A;  1Y4T A;  3PU5 A;  2V3Q A;  2XXI A;  1IXG A;  2UYE A;  2XXW A;  3B6W A;  3IO6 A;  4HS7 A;  3S4U A;  5CBR A;  1QKB A;  3DP4 A;  4R9F A;  1QUL A;  5JTY B;  4ESW A;  1MPB A;  2O1L A;  3SER A;  4WKM A;  4LA9 A;  3UIF A;  2VGQ A;  5I58 B;  1Q35 A;  2OWT A;  5FHO A;  2DWJ A;  4F1U A;  2DVZ A;  4ZZA A;  5AA3 A;  1JET A;  1NNT A;  2GHA A;  1B1H A;  1YPN A;  4OEV A;  4FEB A;  1CE2 A;  1EZO A;  1B7H A;  3BBR A;  3IL1 B;  3PPR A;  3BFU A;  1QUK A;  2UVG A;  4RXL A;  1ZLQ A;  1P1U A;  2PVU A;  3H7M A;  3LSL A;  5I59 A;  5I2K B;  2Q89 A;  4QFO A;  3MVW A;  1JEV A;  1XVX A;  3H6W A;  4M4G A;  1JW1 A;  2HXW A;  1MPD A;  5CRY A;  1LAX A;  3PV0 E;  4OZ9 A;  1H44 A;  4OEN A;  2H25 A;  1LCT A;  3GBA A;  1B3F A;  3KJ7 A;  3K6X A;  3MPK A;  1ELJ A;  4IY6 A;  4Q0C A;  1B58 A;  3T9X B;  3UGW A;  2DWA A;  3MP8 A;  2F78 A;  4DZ1 A;  1OVT A;  5I57 B;  5L9S A;  2XXR A;  1NNP A;  1A99 A;  1M5F A;  1MXY A;  1SQY A;  2DWH A;  3HST A;  4PP0 A;  3TTM A;  3DEL B;  4YMA A;  3H6T A;  1XVY A;  2OJT A;  3IAZ A;  1XS5 A;  3SKP A;  1N3X A;  3K1N A;  1DPP A;  1SDX A;  3KOT A;  3LUY A;  4U22 A;  4F22 A;  4EF1 A;  1Y1M A;  2QS1 A;  3U72 A;  3SES A;  4X9T A;  4ELO A;  3RT8 A;  3TCH A;  1XOC A;  3DLN A;  2I58 A;  2VP1 A;  2XXX A;  3O29 A;  2OLB A;  1R9L A;  1SBP A;  4RYA A;  5L9O A;  3IOV A;  2BJJ X;  4FOR A;  3K1P A;  2R9J A;  4KCD A;  4LZ7 A;  4XKN A;  2PT2 A;  5H8H A;  1D4N A;  4IO5 A;  1AOV A;  2XXP A;  5HPQ A;  1R6Z A;  3BFT A;  2Y84 A;  2QS4 A;  4KPT A;  1A40 A;  1OIB A;  3WAF A;  5IKB A;  1JVX A;  3OOA A;  4DDD A;  3EPE A;  1MQI A;  2XX8 A;  3VXC A;  1Y3Q A;  4NF4 A;  1ANF A;  4QSC A;  4O3C A;  1LB9 A;  5TP9 B;  1NL5 A;  3OXN A;  4GIZ A;  4I9D A;  4EQB A;  3U1O A;  4HTG A;  3B6T A;  4H1X A;  5ELV A;  2A5T B;  1B51 A;  4RJZ A;  2DE3 A;  3O97 A;  4U1O A;  2ZYM A;  2RC8 A;  4POX A;  2FNC A;  4UAC A;  3S9N C;  5L8D A;  3ECR A;  3SEV A;  3K6W A;  3H3G A;  3P7I A;  4G68 B;  4WXJ A;  4EF2 A;  1AH5 A;  4YB5 A;  5CM6 A;  2PX1 A;  5I59 B;  1OMP A;  5KCJ B;  3A3C A;  1B0L A;  5ICQ A;  4EQ9 A;  5J1D A;  2VD2 A;  3C34 A;  3K1M A;  4G8M A;  3USD A;  2QJE A;  1N76 A;  4JB7 A;  4F3B A;  4QSD A;  1YTV A;  3W9V A;  3H6U A;  4X1D A;  1O63 A;  3DP6 A;  5DVI A;  1QW0 A;  3OEL A;  2V25 A;  4PFT A;  3ZKK A;  2OK2 A;  4ELP A;  4JSO A;  3SEY A;  5JEI A;  3G3F A;  3PUX E;  4LQ2 A;  3PPP A;  4XIG Q;  3RLF E;  4F31 B;  4ZE9 A;  2ONS A;  4GF8 A;  1N7W A;  3R7X A;  4O3B A;  2B3F A;  1UQW A;  2F5X A;  3Q27 A;  2NUV A;  4IO4 A;  1MH4 A;  2R71 A;  4NWC A;  3D4C A;  3VDF A;  4EXK A;  3CG1 A;  5I57 A;  5IAI A;  3KN3 A;  4ECF A;  4ELQ A;  2CMO A;  1IQ7 A;  1P1N A;  3PUY E;  1URG A;  2F7A A;  4C1U A;  4DCY A;  1Y4C A;  1HSE A;  3E9X A;  4ZDM A;  1QJM A;  3IB0 A;  1ZBM A;  4H8J A;  1IIT A;  3R26 A;  4M1V A;  1B05 A;  1B46 A;  4XXU A;  4TLL B;  4FIM A;  2Y7R A;  3EQ1 A;  3PD9 A;  1FQB A;  1MY4 A;  3RN8 A;  3WAE A;  4KYS A;  3E4R A;  3JV9 A;  4THI A;  3DM0 A;  1GR2 A;  1LST A;  3Q26 A;  1D3K A;  3RPW A;  3U93 A;  4I62 A;  2GH9 A;  2ZMB A;  5FHM A;  4FJP A;  1MXZ A;  3EF7 A;  3HCQ A;  5HBC A;  3TUS A;  1JNF A;  1H45 A;  3VLU A;  2P2A A;  3K2D A;  1MY2 A;  4GRK A;  3TFL A;  5KZT A;  1A8E A;  2O1M A;  2I0B A;  3T96 B;  4GL8 A;  3TCG A;  1N3W A;  2W7Y A;  1OQH A;  1IXH A;  3RNN A;  2O84 X;  2IEE A;  3F11 A;  1UTH A;  3A09 A;  3MBP A;  2NWJ A;  1PB9 A;  3CRB A;  3TEL A;  2PMS A;  3UA8 A;  1MY1 A;  2GRV A;  3VLV A;  4ZED A;  3M3F A;  2XXV A;  2ZXT A;  1GVC A;  4JSD A;  1LFI A;  2I49 A;  3I3V A;  2A5T A;  4HCW A;  4MH5 A;  3KJT A;  2QS3 A;  4OER A;  1KWH A;  3TZA A;  4Q8R A;  3SEW A;  4FED A;  3ODB A;  5K2X A;  3SDF A;  5AA2 A;  4H5F A;  1XT8 A;  1M5C A;  2I3W A;  1DSN A;  5TU0 A;  3W9W A;  1B4H A;  2PBW A;  4G68 A;  2HEU A;  4QRZ A;  5BUU A;  3C4M A;  4EQ7 A;  4JDF A;  1CB6 A;  1MQG A; 
#chains in the Genus database with same CATH topology
 4GL0 A;  2Y7P A;  5CC2 A;  4I40 A;  3R6U A;  2PT1 A;  3FZV A;  1A8F A;  4AB6 A;  2YJP A;  3K01 A;  5I2N B;  2XD2 A;  4GOT A;  3SEX A;  4XKQ A;  4LAT A;  2MKZ A;  1FPJ A;  4DIG A;  1TT1 A;  3RTF B;  4H45 A;  1SW2 A;  3PD8 A;  2XXH A;  2Q8M A;  4U2R A;  4ZEC A;  2F34 A;  3FD3 A;  3FXU A;  3TPA A;  4EF2 A;  2DQV A;  3TQL A;  3KG2 A;  2O51 A;  4OEU A;  1AIV A;  4I1D A;  2DP8 A;  4R9G A;  3G3J A;  4POW A;  1UIV A;  4OET A;  3C32 A;  4GXA A;  1RDX A;  2XD3 A;  4RK9 A;  4HXV A;  1WOD A;  4O3A A;  2DE4 A;  4DI3 D;  3LBS A;  3G3G A;  1M5B A;  3A3U A;  4GWO A;  3KGC A;  4X04 A;  4P1E A;  1POY 1;  4G68 C;  4NF5 A;  3KN7 A;  4HCY A;  1Q1K A;  4IB2 A;  4ONY A;  4YKJ A;  3PPQ A;  3B6Q A;  4LP2 B;  3OSQ A;  1S50 A;  4RK2 A;  1YCJ A;  5M2V A;  2ZYO A;  3T22 A;  4IGR A;  2UVJ A;  3VV5 A;  2FHY A;  4N91 A;  1IMC A;  4NF6 B;  5DEX A;  1H76 A;  2D5W A;  4F19 A;  1KA1 A;  4ND9 A;  3KOS A;  2ABH A;  2DS9 A;  2QMW A;  3CFZ A;  4YKK A;  4N17 A;  3S9E A;  1B40 A;  2OCU A;  4N6P A;  5FTH A;  3FV1 A;  3OMB A;  4TOZ A;  1GTK A;  4PAI A;  3CG3 A;  2Q8J A;  1UTH B;  1AL3 A;  3THI A;  3MZ9 A;  1IXC A;  4PFI A;  4OES A;  4JWO A;  1K9Y A;  1FPE A;  3IOR A;  4YB6 A;  3LSX A;  4G77 A;  5FHN A;  4R6Y A;  4YB7 A;  3FXB A;  4F29 A;  1MG1 A;  4OVJ A;  4KD5 A;  4MJO A;  4BDL A;  5ESY A;  3QSL A;  2H5Y A;  4XEQ A;  2V84 A;  2UXA A;  1SW1 A;  4OFO A;  1N7X A;  2I3V A;  1I6Q A;  3EN3 A;  2QVR A;  3IK6 B;  1FJ9 A;  1LAH E;  2RC9 A;  1R9Q A;  4H6D A;  2FA7 A;  4PBQ A;  1F9B A;  1FQD A;  4BDO A;  4L17 A;  4YKP A;  4PDD A;  2O68 A;  2XWK A;  1NNF A;  4BDR A;  1JVY A;  4QFP A;  4R2B A;  3O66 A;  1B0H A;  1B2H A;  5CBS A;  1B4Z A;  4XF5 A;  4H67 A;  4OYV A;  4OFJ A;  5TP9 A;  5DVJ A;  1DPE A;  3LR1 A;  1Y9U A;  2Q2C A;  4PE5 B;  5JK4 A;  1MM7 A;  4GBW A;  4R72 A;  2I0C A;  4PGP A;  1O7T A;  3E79 A;  4WEP A;  3OD7 A;  4OFL A;  2ANJ A;  4R73 A;  3TTN A;  3FAT A;  4UAB A;  3PPN A;  3C9H A;  2QL3 A;  1MRP A;  3KZG A;  1LAG E;  4OVR A;  1M5E A;  1VFE A;  1K9Z A;  4I8C A;  3TQW A;  4P9K A;  2DXY A;  4ZZE A;  3MVX A;  1YYZ A;  3IB1 A;  1MH3 A;  2Q88 A;  5EQ9 A;  1URS A;  3C31 A;  4NF8 A;  2XXQ A;  4HE0 A;  1RKM A;  3MYU A;  1IXI A;  1LB8 A;  3VVF A;  4PE3 A;  3FJG A;  5IZZ A;  3N5L A;  1G0H A;  5DYH A;  5ET7 A;  1SW5 A;  2RF1 A;  3RQT A;  1NV3 A;  3MZB A;  5AA2 D;  2UVH A;  1NV0 A;  3TMG A;  1H3D A;  3UN6 A;  4LN5 A;  4JXI A;  1NH8 A;  3PUZ E;  4X8R A;  4H5G A;  5TPA B;  3T93 B;  5I56 A;  3LV0 A;  1B7Z A;  2XXI A;  1IXG A;  5CBR A;  4R9F A;  1MPB A;  2O1L A;  4WKM A;  4LA9 A;  5FHO A;  1NNT A;  1B1H A;  1YPN A;  4FEB A;  1EZO A;  1B7H A;  3BFU A;  1NV6 A;  4RXL A;  3LSL A;  2PVU A;  3H7M A;  3MVW A;  1JW1 A;  1LAX A;  4GWW A;  3GBA A;  1LCT A;  1B3F A;  3K6X A;  4MX6 A;  5I57 B;  5L9S A;  2XXR A;  1NNP A;  1A99 A;  2DWH A;  4P1L A;  4PP0 A;  3NOH A;  3K1N A;  4F22 A;  4X9T A;  3RT8 A;  1XOC A;  1SBP A;  4RYA A;  2BJJ X;  4FBP A;  2R9J A;  4GX6 A;  1R6Z A;  3BFT A;  4AS4 A;  3OOA A;  3EPE A;  5TP9 B;  1ANF A;  4QSC A;  1NL5 A;  3OXN A;  4I9D A;  4P8B A;  4HTG A;  3B6T A;  4H1X A;  4HE1 A;  4RJZ A;  2DE3 A;  5L8D A;  2P3V A;  3K6W A;  4G68 B;  1AH5 A;  1NUZ A;  5KCJ B;  3T0J A;  3K1M A;  1NV7 A;  1N76 A;  5A5X B;  1O63 A;  2V25 A;  2OK2 A;  4JSO A;  3G3F A;  4F31 B;  2HHM A;  2B3F A;  4IO4 A;  2R71 A;  1FBG A;  4NWC A;  1IQ7 A;  3PUY E;  1URG A;  4XXU A;  1ZBM A;  4H8J A;  4MNP A;  1B05 A;  1FQB A;  1MY4 A;  4KYS A;  1GR2 A;  1LST A;  3Q26 A;  1FPG A;  3HCQ A;  3TUS A;  1JNF A;  3TFL A;  4GL8 A;  1NUY A;  1N3W A;  1OQH A;  1KA0 A;  1PB9 A;  3CRB A;  3VLV A;  3M3F A;  1GVC A;  4JSD A;  1LFI A;  2I49 A;  4Q8R A;  4FED A;  5K2X A;  2ZZV A;  5AA2 A;  4H5F A;  2I3W A;  1M5C A;  4PAF A;  2HEU A;  4XIG Q;  4EQ7 A;  4XKR A;  1MQG A;  4IO2 A;  2XWO A;  1DTZ A;  4OHN A;  4GQO A;  2FVZ A;  5CMB A;  2QSX A;  3QYT A;  4F3P A;  1INP A;  1JW4 A;  4F2Q A;  5LOM A;  2O7U A;  1B32 A;  1FBE A;  3MZ1 A;  1MXW A;  4PCD A;  3H06 B;  1URD A;  3HHF A;  2GQ1 A;  1NKX A;  5ITP A;  1VSO A;  3N6T A;  1ZMG A;  1ZTY A;  3FVG A;  1SYH A;  1IMF A;  3D1R A;  3M3K A;  4YIC A;  2QPQ A;  3L6H A;  4MNC A;  4RY1 A;  2WEF A;  2F97 A;  3RUM A;  2H98 A;  4LON B;  3TKD A;  3TDJ A;  3DP8 A;  4E0X A;  3M8U A;  1LCF A;  3CSB A;  4H0W A;  4I3Y A;  1KZ8 A;  2E0S A;  4QSE A;  2O7I A;  1LLS A;  3UP9 A;  3N94 A;  4N8Y A;  1DOT A;  1D9Q A;  4LQ5 A;  4GFR A;  1FBD A;  4R6H A;  2XA5 A;  3V83 A;  3AXF A;  5H8H B;  2THI A;  5EYH A;  1B1X A;  1B3H A;  4DI4 B;  1QKA A;  4C0R A;  3FXQ A;  4AS5 A;  2V3U A;  5EQA A;  4FE8 A;  1WDN A;  3IB2 A;  1MDQ A;  5DT6 A;  1JEU A;  3O6G A;  4G2Z A;  5F24 A;  2WKY A;  3N6U A;  2R6G E;  3S2V A;  1NNK A;  1MXU A;  3CFL A;  4PFW A;  5EYG A;  2QVU A;  4PFY A;  3VXB A;  3LUZ A;  2ALU A;  2VT5 A;  2F36 A;  3IR1 A;  1LGB C;  2M8C A;  4FAJ A;  3IX1 A;  5ITO A;  3T9V A;  3C36 A;  1Z7M E;  3QXM A;  4I3E A;  5AA2 B;  4NTL A;  4F3G A;  1MQH A;  1RYX A;  1ATG A;  2CZL A;  4NHB A;  2YLN A;  1A7L A;  3Q29 A;  2HQ0 A;  2RKM A;  4F3S A;  4LZ8 A;  3TYH A;  5IZ1 A;  5H8S A;  1B3E A;  4N15 A;  1IUD A;  4YAH X;  2B65 A;  3B8B A;  3MW0 A;  1TWY A;  1YAE A;  4N8G A;  2VD3 A;  3TTL A;  5ET5 A;  2B3B A;  2RCB A;  4F1Y A;  4G8N A;  3HV1 A;  3OEN A;  2DOJ A;  2AL4 A;  3JZJ A;  1IZ1 A;  4P3L A;  1FSA A;  1L5T A;  1RYO A;  4NN3 A;  4RPO A;  2B4M A;  4QFL A;  3LSF B;  4PBH A;  1FTK A;  3IJO B;  1LBC A;  4FEC A;  4GX4 A;  3MQ9 A;  2L5V A;  4ZS9 A;  4P0G A;  2QMX A;  2V3T A;  2NVU B;  4ZE8 A;  5CMM A;  5H8N A;  4PFU A;  4LZ5 A;  3QAX A;  1JW5 A;  2H4I A;  3OO9 A;  4NWD A;  2XXU A;  4WED A;  3TTR A;  2VOZ A;  5FTI A;  1N04 A;  3EKI A;  4U4X A;  5AA4 A;  2CZI A;  2XWI A;  2HAV A;  4GX3 A;  5IGA A;  2PFY A;  1B6H A;  3K0V A;  1DTG A;  2F7C A;  3HN0 A;  2I48 A;  4QBA A;  3GYY A;  2YPN A;  1DCU A;  5EHM A;  3O6H A;  4GWX A;  3QMF A;  3CSG A;  3RY3 A;  4PQJ A;  4YKI A;  4RNS A;  3K00 A;  3FVO A;  4GLI A;  3FGS A;  5I58 A;  2OBG A;  3C33 A;  1G0I A;  1N84 A;  1FBP A;  2O6A A;  1FBH A;  2ZNS A;  4OXV A;  3KSX A;  1LAF E;  1EYI A;  2I4C A;  2UVI A;  3Q25 A;  2DE2 A;  2AL5 A;  2ZYN A;  4FAT A;  3O2A A;  1H43 A;  4OQO A;  2ONR A;  1PB7 A;  1SI0 A;  3O28 A;  4EUO A;  3HHG A;  2ONK E;  2QRY A;  4MFI A;  4JWY A;  4NMY A;  3Q28 A;  1SYI A;  5JTY B;  4U1Z A;  1P1Q A;  1J1N A;  1TFD A;  1VDW A;  1NUX A;  2QVV A;  3MUQ A;  1XHY A;  4KHZ E;  5EQ7 A;  2V3Q A;  2XXW A;  3IO6 A;  3S4U A;  1QKB A;  3DP4 A;  1QUL A;  2PCR A;  3SER A;  4O8M A;  1EYK A;  5I58 B;  2DWJ A;  4OEV A;  3IL1 B;  4M4G A;  5CRY A;  3PV0 E;  1H44 A;  3KJ7 A;  4Q0C A;  2F78 A;  3TTM A;  3DEL B;  4YMA A;  3H6T A;  2QS1 A;  2HPG A;  3TCH A;  2OLB A;  1R9L A;  4JVC A;  5LTC A;  5L9O A;  3IOV A;  4FOR A;  3K1P A;  4LZ7 A;  4XKN A;  5H8H A;  1A40 A;  1OIB A;  1Y3Q A;  4NF4 A;  4OVT A;  4O3C A;  4EQB A;  3U1O A;  2A5T B;  4N4U A;  4OVS A;  2ZYM A;  2RC8 A;  4G61 A;  3SEV A;  3H3G A;  4YB5 A;  5CM6 A;  2PX1 A;  5I59 B;  5ICQ A;  4EQ9 A;  5J1D A;  1DK4 A;  4JB7 A;  1FJ6 A;  3H6U A;  3ZKK A;  4ELP A;  2VPO A;  1NV5 A;  3PUX E;  3PPP A;  2ONS A;  1UQW A;  3Q27 A;  2NUV A;  4NAP A;  3KN3 A;  2FIX A;  4ECF A;  1FRP A;  2CMO A;  1HSE A;  3IB0 A;  1IIT A;  1B46 A;  4TLL B;  4FIM A;  3EQ1 A;  3PD9 A;  3RN8 A;  2B4L A;  3JV9 A;  3U93 A;  4I62 A;  2ZMB A;  5FHM A;  4KXP A;  5IZ3 A;  3EF7 A;  5HBC A;  4GRK A;  1MY2 A;  5KZT A;  1A8E A;  2I0B A;  3T96 B;  3TCG A;  2KR0 A;  2PMS A;  3E78 A;  2XXV A;  4MH5 A;  3I3V A;  4HCW A;  3KJT A;  4OER A;  3ODB A;  3SDF A;  3MST A;  1XT8 A;  3SZP A;  5TU0 A;  1FPK A;  1B4H A;  5BUU A;  1CB6 A;  2A5S A;  3V5A A;  1Y1Z A;  4ELR A;  4GWU A;  5CMC A;  3M3L A;  1RDZ A;  2OX3 A;  1FW0 A;  3ZKL A;  4GWZ A;  5TPA A;  1FTL A;  4JWX A;  1HSL A;  1MQD A;  5EQ8 A;  3FV2 A;  4R75 A;  4XTC Q;  4HE2 A;  3IOW A;  3V89 B;  1ZKB A;  1XC1 A;  4ZEF A;  1ZJL A;  2X7P A;  1MM6 A;  1DMB A;  3SET A;  1NMU A;  5EHS A;  3MAM A;  3G3H A;  4X1B A;  3H6V A;  3RPL A;  1R1N A;  3I6V A;  5KDT A;  4NF6 A;  5DEX B;  4DXC A;  3QUF A;  2F6G A;  3ZSF A;  2H99 A;  4MEV A;  1S7Y A;  3K6U A;  2Q9T A;  3S9L C;  4XFE A;  1FQF A;  2H9B A;  4ZEI A;  2E1S A;  3CHG A;  3QIM A;  4F39 A;  4NF4 B;  4PF6 A;  2CZH A;  1QUJ A;  1BP5 A;  3PUW E;  5F7V A;  4RA1 A;  3HFU A;  3GBB A;  5AE4 A;  4GBV A;  4R74 A;  4YMB A;  3B7D A;  1B3L A;  1P1O A;  5LDZ A;  3JYR A;  3LC8 A;  3MP6 A;  1MXX A;  2HZL A;  3EHU A;  4NG7 A;  3VFJ A;  1P1W A;  4PC9 A;  1PEB A;  4KYD A;  2Z8D A;  3K02 A;  3FAS A;  3T1B A;  4YU0 A;  2XX7 A;  4ESX A;  2Y7K A;  4PET A;  2F3B A;  3MVZ A;  4NF8 B;  2P1S A;  3V8X B;  4GWS A;  2D3I A;  4MLQ A;  1LBW A;  3MPL A;  1LBV A;  5EYF A;  3FBP A;  3MJN A;  2KLF A;  2HCA A;  2REG A;  1FCK A;  3PTY A;  1Z7N E;  4C1T A;  3HPI A;  2G93 A;  2CEX A;  2V93 A;  3OEK A;  4JVI A;  4YZZ A;  3IFC A;  3CFX A;  5H8Q A;  5J16 A;  3CI8 A;  4R2F A;  3MC2 A;  4OTE A;  3EHT A;  2WYK A;  1QUI A;  3HO7 A;  3H03 A;  4QFN A;  4QF9 A;  3GZG A;  4KR5 A;  1N0T A;  4KI0 E;  3KEI A;  4IO7 A;  2OWS A;  3I5O A;  1NH7 A;  4H8I A;  3ILU B;  4G4P A;  2G29 A;  2CEY A;  3ISP A;  1MDP 1;  1OLC A;  1Y3P A;  1FBF A;  4X48 A;  3FVK A;  4F18 A;  4PGN A;  4MF3 A;  1NV4 A;  2F7B A;  2LAO A;  3RPW A;  3RPL B;  1S9T A;  2Y7I A;  2NOO A;  1LFH A;  1I6B A;  3W15 C;  1PDA A;  1USY H;  5CMK A;  2BJI A;  2XXY A;  1TFA A;  1UTB B;  1OVB A;  3U92 A;  4U23 A;  3KN8 A;  5H8Q B;  5A5L A;  5F1Q A;  2PYY A;  4IY5 A;  1LBX A;  3N26 A;  1FQE A;  5I84 A;  4OA4 A;  1RDY A;  4N13 A;  2AIX A;  2HAU A;  1O64 A;  4HW8 A;  5BWJ A;  3SEU A;  4BDQ A;  2VPN A;  2XXT A;  3IOU A;  4NQ8 A;  3E3K A;  1WVJ A;  3BKI B;  1FTJ A;  2WYP A;  3S9M C;  4DCX A;  4NE4 A;  5B70 A;  4F2O A;  4BDM A;  1VR5 A;  2ZNT A;  1POT A;  3U65 A;  4F1V A;  3K4U A;  5I2K A;  1UTB A;  2HFB A;  5I3S A;  3G3I A;  1PB8 A;  1IIW A;  2GFE A;  2REJ A;  2RCA A;  3K6V A;  4TQU Q;  4Z0I A;  2F8D A;  2DVC A;  3ONM A;  5ISU A;  5CI5 A;  3GLB A;  3CR9 A;  5DTB A;  3OSR A;  4JBZ A;  4PAK A;  2DSF A;  3OO6 A;  4NF5 B;  1AMF A;  3IOT A;  5IM2 A;  1II5 A;  1US5 A;  1MXV A;  1BIY A;  1MQJ A;  3FJM A;  1Y3N A;  3E13 X;  2VHA A;  1Y4T A;  1DBZ A;  4ESW A;  3UIF A;  2VGQ A;  2OWT A;  4OVP A;  2DVZ A;  4F1U A;  1JET A;  2GHA A;  4MNI A;  1QUK A;  1ZLQ A;  5I2K B;  1JEV A;  1XVX A;  3H6W A;  2HXW A;  4NGU A;  4OVQ A;  4OZ9 A;  4OEN A;  1B58 A;  3UGW A;  2DWA A;  3MP8 A;  4DZ1 A;  3KBZ A;  1MXY A;  1NUW A;  1XVY A;  2OJT A;  3SKP A;  1XS5 A;  4U22 A;  1DPP A;  3KOT A;  3LUY A;  1Y1M A;  3U72 A;  2OWZ A;  2I58 A;  3O29 A;  2XWV A;  4KCD A;  4IO5 A;  1AOV A;  2XXP A;  2Y84 A;  2QS4 A;  4KPT A;  3WAF A;  5IKB A;  1JVX A;  1MQI A;  2XX8 A;  1LB9 A;  4GIZ A;  1B51 A;  2FNC A;  3S9N C;  2Q74 A;  3ECR A;  1FPL A;  5T3J A;  2VD2 A;  3USD A;  4QSD A;  1YTV A;  4X1D A;  3DP6 A;  1QW0 A;  4PFT A;  1EZP A;  3SEY A;  4ZE9 A;  2Y5K A;  1IMA A;  3R7X A;  4O3B A;  2F5X A;  4EXK A;  3CG1 A;  5I57 A;  4ELQ A;  4NX1 A;  4ZDM A;  1QJM A;  2Y7R A;  3WAE A;  3E4R A;  3DM0 A;  1D3K A;  4N81 A;  1MXZ A;  1H45 A;  3K2D A;  4N6D A;  2O1M A;  2W7Y A;  1JP4 A;  3RNN A;  1LBY A;  1UTH A;  3MBP A;  2NWJ A;  3UA8 A;  3TEL A;  1MY1 A;  2ZXT A;  4ZED A;  1KWH A;  1DSN A;  2PBW A;  4G68 A;  4QRZ A;  2FBP A;  1IMB A;  3C4M A;  4JDF A;  3RTW B;  1YXI A;  4IO3 A;  5I56 B;  2F35 A;  4NED A;  1HSJ A;  1US4 A;  3PUV E;  5K2Y A;  1ZU0 A;  3KFM A;  1FPD A;  2O69 A;  1OLA A;  2UYF A;  4MBP A;  2Q2A A;  3VLW A;  2D21 A;  5H8F A;  1SD3 A;  1IMD A;  2Z22 A;  4IO6 A;  3ROJ A;  4TLM B;  3O9P A;  4G8H A;  3RT6 B;  1USY E;  3IO4 A;  3LSW A;  1LFG A;  1SW4 A;  3FIR A;  4O7I A;  2DYX A;  3EHS A;  3H4Z A;  1OQG A;  1MPC A;  1I6A A;  3QUJ A;  2JJK A;  2P0S A;  2DXR A;  4MMP A;  1EZ9 A;  2XHD A;  4MAG A;  4P56 A;  4ISU A;  5AA1 A;  2QS2 A;  3FVN A;  5AA4 B;  2R8T A;  3FJ7 A;  2DDK A;  4OWD A;  2I4B A;  3TTK A;  1FPF A;  3GXA A;  4P47 A;  4BDN A;  2Y7W A;  1LEV A;  1MY3 A;  1SPI A;  2Z8F A;  1PBQ A;  3FUZ A;  2OZZ A;  1D9Y A;  5KCJ A;  3TCF A;  1PBP A;  1B52 A;  1FQA A;  5DW8 A;  5ET6 A;  1GV8 A;  4GVO A;  4GXS B;  4DE8 A;  3B50 A;  3CVG A;  3IJX B;  4UA8 A;  1PC3 A;  1BTJ A;  2X7Q A;  1CNQ A;  3KC0 A;  4IGT A;  2WBB A;  1MS7 A;  1FPB A;  3TOD A;  3ZS6 A;  4EDP A;  1FQC A;  4E0W A;  2F3D A;  3IFA A;  1M5D A;  1B5J A;  1FTA A;  1D9V A;  4OMB A;  4QFK A;  3OO8 A;  1FBC A;  3VE1 B;  4NF0 A;  3UOR A;  4QHQ A;  5H8N B;  1MY0 A;  1VFD A;  3KC1 A;  4Q5T A;  4KFQ A;  4DXB A;  4MLV A;  2ZYK A;  2HZK A;  3FXR A;  4LVQ A;  4GWY A;  4O94 A;  3QK6 A;  1Q9D A;  3OO7 A;  2F6P A;  1A55 A;  3UK4 A;  4U21 A;  1BKA A;  4DLD A;  1XI6 A;  4K3F A;  1NI9 A;  4R6K A;  4BLA A;  2V4C A;  2ZNU A;  4KYE A;  3RYD A;  1B5H A;  1NV2 A;  3KBR A;  1ZIU A;  2RC7 A;  3TAJ A;  1NV1 A;  5B7D A;  1B5I A;  4RPN A;  3PGF A;  1YZ0 A;  3U94 A;  4H65 A;  1B7U A;  1UIU A;  4LUB A;  3O6I A;  1JQF A;  3L6G A;  2QFL A;  3PMW A;  3U8Q A;  2ZZX A;  4U4S A;  1I69 A;  4ZEB A;  4XKP A;  3RGY A;  3MVY A;  2ESN A;  2NXO A;  4KQP A;  1IEJ A;  4ZEK A;  1EU8 A;  2Z8E A;  4KCC A;  1EYJ A;  2FYI A;  3A29 A;  1Y20 A;  5IZ3 B;  3TEP A;  5H8F B;  3ILT B;  1GGG A;  2IA4 A;  3G3K A;  3T9H B;  5A5X A;  5JTY A;  1QVS A;  4MIJ A;  1NFT A;  3MP1 A;  4N07 A;  2HXR A;  2PFZ A;  1EH3 A;  4GD5 A;  3VVD A;  1FTO A;  2X26 A;  5L9M A;  4N6K A;  4AB5 A;  2ZZW A;  3PPO A;  3C35 A;  4EXL A;  3D4G A;  3PMX A;  3KSJ A;  4Z7E A;  2Z23 A;  5I2N A;  3T9U A;  4AQ4 A;  3PMV A;  5ET8 A;  4P0I A;  2GHB A;  2XXK A;  2DWI A;  4P11 A;  1VE4 A;  4PDH A;  1T0K A;  5DVF A;  2AYS A;  1BLF A;  2I6E A;  2XX9 A;  1FTM A;  3OEM A;  4Q30 B;  1B3G A;  3G7W A;  1SI1 A;  1B9J A;  2RIN A;  1A54 A;  1LBB A;  1TXF A;  5KDT B;  3CIJ A;  3MWB A;  4PFB A;  3T66 A;  1P99 A;  1SVX B;  3PU5 A;  2UYE A;  3B6W A;  4HS7 A;  4PTK A;  1Q35 A;  4ZZA A;  5AA3 A;  2KQZ A;  1CE2 A;  3BBR A;  3PPR A;  2UVG A;  1QGX A;  5I7I A;  1P1U A;  2Q89 A;  2CZK A;  4QFO A;  1MPD A;  2H25 A;  4IY6 A;  3VVE A;  1ELJ A;  3T9X B;  1OVT A;  3HST A;  1SQY A;  5ICT A;  1M5F A;  3IAZ A;  1FPI A;  1N3X A;  1SDX A;  4EF1 A;  5I5P A;  3SES A;  2WX9 A;  4ELO A;  3DLN A;  2XXX A;  2VP1 A;  2PT2 A;  1D4N A;  5HPQ A;  4DDD A;  3VXC A;  5ELV A;  4QXD A;  3O97 A;  4U1O A;  4UAC A;  4POX A;  2P3N A;  4OAN A;  3P7I A;  2Y5L A;  4WXJ A;  3BIG A;  4JVD A;  1OMP A;  3A3C A;  1B0L A;  3C34 A;  4G8M A;  2QJE A;  4F3B A;  3W9V A;  5DVI A;  5HM4 B;  3OEL A;  5JEI A;  4LQ2 A;  4PFR A;  3RLF E;  4GF8 A;  1N7W A;  4O7M A;  3VDF A;  1BK4 A;  1MH4 A;  3D4C A;  3BIH A;  5IAI A;  2WBD A;  4PF8 A;  1LBZ A;  1P1N A;  2F7A A;  4C1U A;  4DCY A;  1Y4C A;  3E9X A;  4DXU A;  4M1V A;  3R26 A;  4H46 A;  2FIE A;  4THI A;  2GH9 A;  4FJP A;  4MHF A;  3VLU A;  2P2A A;  1AWB A;  4MCO A;  1IXH A;  2O84 X;  2IEE A;  3F11 A;  3A09 A;  2GRV A;  5FBP A;  2A5T A;  1IME A;  2QS3 A;  3TZA A;  3SEW A;  3W9W A;  4IR8 A;  5I59 A;  3MPK A; 
#chains in the Genus database with same CATH homology
 2A5S A;  2Y7P A;  4GL0 A;  4IO2 A;  3RTW B;  3V5A A;  5CC2 A;  3R6U A;  4IO3 A;  5I56 B;  1Y1Z A;  2F35 A;  4ELR A;  4NED A;  5CMC A;  1HSJ A;  3M3L A;  2PT1 A;  1US4 A;  3PUV E;  3FZV A;  1FW0 A;  1A8F A;  1DTZ A;  3ZKL A;  2YJP A;  4AB6 A;  3K01 A;  5K2Y A;  4OHN A;  1ZU0 A;  3KFM A;  5I2N B;  2XD2 A;  4GOT A;  4GQO A;  3SEX A;  5TPA A;  1FTL A;  4JWX A;  4XKQ A;  2O69 A;  1HSL A;  4LAT A;  5CMB A;  1OLA A;  2QSX A;  1MQD A;  3QYT A;  2UYF A;  4F3P A;  1JW4 A;  4DIG A;  4F2Q A;  1TT1 A;  4MBP A;  2Q2A A;  3FV2 A;  3RTF B;  3VLW A;  5LOM A;  4R75 A;  1SW2 A;  2O7U A;  5ICT A;  1B32 A;  2D21 A;  4XTC Q;  3PD8 A;  5H8F A;  3MZ1 A;  2XXH A;  1MXW A;  1SD3 A;  3IOW A;  4U2R A;  3V89 B;  1ZKB A;  3H06 B;  1URD A;  2Z22 A;  3HHF A;  4ZEC A;  1NKX A;  2F34 A;  4IO6 A;  4TLM B;  3O9P A;  4G8H A;  3RT6 B;  1XC1 A;  1USY E;  4ZEF A;  1ZJL A;  2X7P A;  1MM6 A;  3IO4 A;  1DMB A;  3SET A;  1NMU A;  5EHS A;  3MAM A;  3G3H A;  5AA2 B;  5ITP A;  4X1B A;  1VSO A;  3H6V A;  3FD3 A;  3FXU A;  3LSW A;  1LFG A;  1SW4 A;  1ZMG A;  1ZTY A;  3FVG A;  3N6T A;  1SYH A;  3TPA A;  1R1N A;  3FIR A;  4YIC A;  3I6V A;  3M3K A;  5KDT A;  2DYX A;  3EHS A;  3H4Z A;  2QPQ A;  1OQG A;  3L6H A;  4NF6 A;  5DEX B;  4DXC A;  4RY1 A;  2DQV A;  1MPC A;  3QUF A;  2F6G A;  1I6A A;  2F97 A;  2H99 A;  3RUM A;  2H98 A;  1S7Y A;  3TQL A;  3K6U A;  3QUJ A;  4LON B;  3ZSF A;  3TKD A;  2Q9T A;  3TDJ A;  3KG2 A;  2P0S A;  3DP8 A;  2O51 A;  2DXR A;  4OEU A;  3S9L C;  4E0X A;  3M8U A;  1LCF A;  1EZ9 A;  3CSB A;  1AIV A;  2XHD A;  4H0W A;  1FQF A;  2H9B A;  4ISU A;  5AA1 A;  4I1D A;  2DP8 A;  4R9G A;  4ZEI A;  3G3J A;  2E1S A;  2E0S A;  4POW A;  1UIV A;  3QIM A;  4F39 A;  2QS2 A;  4OET A;  4QSE A;  3FVN A;  4NF4 B;  2O7I A;  1LLS A;  5AA4 B;  3C32 A;  4GXA A;  3FJ7 A;  3UP9 A;  2XD3 A;  3N94 A;  4RK9 A;  1DOT A;  4LQ5 A;  4OWD A;  2I4B A;  4GFR A;  3GXA A;  4R6H A;  3TTK A;  4BDN A;  5B70 A;  1QUJ A;  2Y7W A;  3V83 A;  3AXF A;  1BP5 A;  1MY3 A;  5H8H B;  2THI A;  2Z8F A;  3PUW E;  1PBQ A;  3FUZ A;  5F7V A;  4RA1 A;  1WOD A;  2OZZ A;  4O3A A;  1D9Y A;  2DE4 A;  5KCJ A;  3GBB A;  3LBS A;  3TCF A;  3G3G A;  1PBP A;  1B52 A;  1FQA A;  1M5B A;  3A3U A;  1B1X A;  3KGC A;  4GWO A;  4R74 A;  1B3H A;  1GV8 A;  5AE4 A;  4YMB A;  3B7D A;  1B3L A;  1P1O A;  1QKA A;  4C0R A;  4GVO A;  3FXQ A;  1POY 1;  3JYR A;  3LC8 A;  4G68 C;  4GXS B;  3MP6 A;  1MXX A;  4NF5 A;  4DE8 A;  3KN7 A;  3CVG A;  2HZL A;  2V3U A;  3EHU A;  1Q1K A;  4FE8 A;  4HCY A;  3IJX B;  4IB2 A;  4ONY A;  1PC3 A;  4UA8 A;  3PPQ A;  4YKJ A;  3VFJ A;  1P1W A;  3B6Q A;  4LP2 B;  3OSQ A;  1S50 A;  4RK2 A;  1BTJ A;  1YCJ A;  1PEB A;  2ZYO A;  5M2V A;  3T22 A;  1WDN A;  2Z8D A;  3IB2 A;  3K02 A;  4KYD A;  1MDQ A;  3FAS A;  4IGR A;  2UVJ A;  2X7Q A;  5H8S A;  5DT6 A;  3VV5 A;  4YU0 A;  2XX7 A;  4ESX A;  2Y7K A;  1JEU A;  4IGT A;  3O6G A;  4G2Z A;  1MS7 A;  4NF6 B;  5DEX A;  3TOD A;  2WKY A;  1H76 A;  3ZS6 A;  2D5W A;  3N6U A;  2R6G E;  4EDP A;  4F19 A;  4ND9 A;  3S2V A;  1NNK A;  3KOS A;  2ABH A;  2DS9 A;  4PET A;  1FQC A;  1MXU A;  3CFL A;  3MVZ A;  4PFW A;  4PFY A;  4E0W A;  4NF8 B;  2QMW A;  3VXB A;  3CFZ A;  2P1S A;  3V8X B;  4YKK A;  1M5D A;  2ALU A;  2D3I A;  3S9E A;  2F36 A;  4MLQ A;  1B5J A;  3IR1 A;  3MPL A;  1LGB C;  2M8C A;  4FAJ A;  1B40 A;  2OCU A;  4N6P A;  5EYF A;  3IX1 A;  5FTH A;  3FV1 A;  1D9V A;  4OMB A;  4QFK A;  5ITO A;  3OMB A;  3OO8 A;  4TOZ A;  3MJN A;  1GTK A;  2KLF A;  3C36 A;  2HCA A;  3T9V A;  3VE1 B;  1Z7M E;  3QXM A;  2REG A;  1FCK A;  3CG3 A;  4NTL A;  1Z7N E;  4QHQ A;  3UOR A;  3HPI A;  4C1T A;  2Q8J A;  1MY0 A;  2G93 A;  4F3G A;  1MQH A;  5H8N B;  2V93 A;  1RYX A;  1VFD A;  1ATG A;  4Q5T A;  2CZL A;  3OEK A;  4YZZ A;  2YLN A;  1A7L A;  3Q29 A;  2HQ0 A;  2RKM A;  1UTH B;  4F3S A;  4KFQ A;  4DXB A;  1AL3 A;  3CFX A;  5H8Q A;  4LZ8 A;  4MLV A;  3THI A;  3TYH A;  3CI8 A;  4R2F A;  2ZYK A;  3MZ9 A;  1B3E A;  1IXC A;  2HZK A;  3FXR A;  3MC2 A;  4LVQ A;  3EHT A;  4OTE A;  1IUD A;  4YAH X;  4OES A;  2B65 A;  4JWO A;  1QUI A;  3MW0 A;  1TWY A;  1YAE A;  3HO7 A;  3IOR A;  3QK6 A;  3H03 A;  4YB6 A;  3LSX A;  4G77 A;  4QF9 A;  4QFN A;  3GZG A;  5FHN A;  2VD3 A;  3OO7 A;  3TTL A;  4R6Y A;  4KR5 A;  4YB7 A;  4F29 A;  1MG1 A;  1N0T A;  2B3B A;  4OVJ A;  4KD5 A;  4BDL A;  2RCB A;  4KI0 E;  3KEI A;  3QSL A;  2F6P A;  1A55 A;  4IO7 A;  2H5Y A;  2OWS A;  1BKA A;  4U21 A;  3UK4 A;  4G8N A;  2V84 A;  3HV1 A;  3I5O A;  3OEN A;  2UXA A;  3VVD A;  1SW1 A;  1NH7 A;  4DLD A;  4H8I A;  2DOJ A;  3ILU B;  4OFO A;  4K3F A;  4G4P A;  1N7X A;  2I3V A;  2AL4 A;  1I6Q A;  4R6K A;  3EN3 A;  2G29 A;  3IK6 B;  1IZ1 A;  3JZJ A;  4BLA A;  1MDP 1;  1LAH E;  2ZNU A;  1L5T A;  4XKR A;  4KYE A;  1OLC A;  1Y3P A;  1RYO A;  2RC9 A;  1R9Q A;  1B5H A;  3KBR A;  4RPO A;  4H6D A;  4X48 A;  3FVK A;  4QFL A;  4F18 A;  3LSF B;  2FA7 A;  1ZIU A;  2RC7 A;  4MF3 A;  2F7B A;  1F9B A;  1FQD A;  2LAO A;  1FTK A;  3IJO B;  4L17 A;  1LBC A;  4FEC A;  4YKP A;  1B5I A;  1S9T A;  2Y7I A;  4RPN A;  2NOO A;  5B7D A;  3MQ9 A;  2O68 A;  3PGF A;  1NNF A;  3U94 A;  4BDR A;  4ZS9 A;  4H65 A;  1LFH A;  1B7U A;  1I6B A;  4P0G A;  1JVY A;  2QMX A;  1UIU A;  2V3T A;  3W15 C;  2NVU B;  4QFP A;  4LUB A;  1PDA A;  1USY H;  3O6I A;  4ZE8 A;  5CMK A;  5CMM A;  1JQF A;  4R2B A;  3L6G A;  3O66 A;  3PMW A;  2XXY A;  5H8N A;  3U8Q A;  4U4S A;  1I69 A;  4ZEB A;  4DXU A;  1B0H A;  1TFA A;  1UTB B;  1OVB A;  1B2H A;  4PFU A;  4XKP A;  3RGY A;  3TAJ A;  4LZ5 A;  3U92 A;  3QAX A;  5CBS A;  1B4Z A;  1JW5 A;  3MVY A;  2H4I A;  2ESN A;  3OO9 A;  4U23 A;  4NWD A;  2XXU A;  2NXO A;  3KN8 A;  4KQP A;  4WED A;  5F1Q A;  5H8Q B;  2PYY A;  4IY5 A;  3TTR A;  2VOZ A;  1IEJ A;  1N04 A;  4U4X A;  1EU8 A;  2Z8E A;  4KCC A;  5FTI A;  4ZEK A;  5AA4 A;  2FYI A;  4H67 A;  4OYV A;  1EZP A;  1Y20 A;  4OFJ A;  2HAV A;  5TP9 A;  5DVJ A;  1DPE A;  3TEP A;  3LR1 A;  5H8F B;  3ILT B;  1GGG A;  1B6H A;  1Y9U A;  2IA4 A;  2Q2C A;  3G3K A;  3K0V A;  3N26 A;  4PE5 B;  3T9H B;  1DTG A;  1MM7 A;  5HM4 B;  5A5X A;  5JK4 A;  2F7C A;  3HN0 A;  5JTY A;  1FQE A;  1QVS A;  1NFT A;  4R72 A;  2I0C A;  1O7T A;  4WEP A;  2I48 A;  3OD7 A;  5I84 A;  4OFL A;  3MP1 A;  2ANJ A;  4N07 A;  1EH3 A;  4GD5 A;  2YPN A;  4N13 A;  3FAT A;  2AIX A;  2HAU A;  1O64 A;  1FTO A;  4R73 A;  3TTN A;  2X26 A;  3C9H A;  3PPN A;  5L9M A;  2QL3 A;  5EHM A;  3SEU A;  1MRP A;  4HW8 A;  5BWJ A;  3O6H A;  3KZG A;  1LAG E;  3CSG A;  4BDQ A;  1M5E A;  2XXT A;  3IOU A;  3E3K A;  1WVJ A;  1VFE A;  3BKI B;  3RY3 A;  1FTJ A;  4PQJ A;  4YKI A;  4I8C A;  4AB5 A;  3PPO A;  4RNS A;  3S9M C;  3K00 A;  3FVO A;  4DCX A;  3C35 A;  4NE4 A;  4GLI A;  3FGS A;  3D4G A;  3PMX A;  3KSJ A;  4EXL A;  3TQW A;  4F2O A;  2OBG A;  5I58 A;  4BDM A;  4Z7E A;  3C33 A;  2Z23 A;  1VR5 A;  2ZNT A;  1POT A;  2DXY A;  1N84 A;  4ZZE A;  3MVX A;  5I2N A;  3IB1 A;  1MH3 A;  2O6A A;  2Q88 A;  4F1V A;  2ZNS A;  1URS A;  3C31 A;  3K4U A;  4OXV A;  3T9U A;  4AQ4 A;  3KSX A;  5I2K A;  4NF8 A;  3PMV A;  2XXQ A;  1RKM A;  1UTB A;  2HFB A;  4P0I A;  1LAF E;  2I4C A;  2GHB A;  2UVI A;  3G3I A;  1IXI A;  1LB8 A;  1PB8 A;  2AL5 A;  2DE2 A;  2ZYN A;  3Q25 A;  3VVF A;  4FAT A;  1IIW A;  2GFE A;  3FJG A;  2DWI A;  3O2A A;  4P11 A;  1VE4 A;  2REJ A;  3N5L A;  1T0K A;  1H43 A;  4OQO A;  5DYH A;  2ONR A;  2RCA A;  1SW5 A;  3K6V A;  4BDO A;  1PB7 A;  4TQU Q;  5DVF A;  4Z0I A;  1SI0 A;  2AYS A;  2F8D A;  2RF1 A;  3O28 A;  4EUO A;  3RQT A;  1BLF A;  3HHG A;  3MZB A;  2DVC A;  3ONM A;  5ISU A;  2I6E A;  2XX9 A;  5CI5 A;  1FTM A;  3OEM A;  4Q30 B;  5AA2 D;  2ONK E;  2QRY A;  2UVH A;  3GLB A;  4MFI A;  1H3D A;  3TMG A;  4JWY A;  3CR9 A;  1B3G A;  3UN6 A;  3G7W A;  1SI1 A;  1B9J A;  1NH8 A;  3PUZ E;  3Q28 A;  4JXI A;  3OSR A;  4JBZ A;  1SYI A;  4NMY A;  2RIN A;  5DTB A;  4H5G A;  1A54 A;  1LBB A;  1P1Q A;  1TXF A;  2DSF A;  3OO6 A;  4NF5 B;  4U1Z A;  1J1N A;  1AMF A;  1TFD A;  3CIJ A;  3IOT A;  5KDT B;  5A5X B;  5TPA B;  3MWB A;  4F1Y A;  3T93 B;  1II5 A;  3T66 A;  1P99 A;  1US5 A;  1MXV A;  3MUQ A;  1SVX B;  5I56 A;  1XHY A;  1BIY A;  1MQJ A;  4KHZ E;  3FJM A;  1Y3N A;  3E13 X;  3VVE A;  1B7Z A;  2VHA A;  1Y4T A;  3PU5 A;  2V3Q A;  2XXI A;  1IXG A;  2UYE A;  2XXW A;  3B6W A;  3IO6 A;  4HS7 A;  3S4U A;  5CBR A;  1QKB A;  3DP4 A;  4R9F A;  1QUL A;  5JTY B;  4ESW A;  1MPB A;  2O1L A;  3SER A;  4WKM A;  4LA9 A;  3UIF A;  2VGQ A;  5I58 B;  1Q35 A;  2OWT A;  5FHO A;  2DWJ A;  4F1U A;  2DVZ A;  4ZZA A;  5AA3 A;  1JET A;  1NNT A;  2GHA A;  1B1H A;  1YPN A;  4OEV A;  4FEB A;  1CE2 A;  1EZO A;  1B7H A;  3BBR A;  3IL1 B;  3PPR A;  3BFU A;  1QUK A;  2UVG A;  4RXL A;  1ZLQ A;  1P1U A;  2PVU A;  3H7M A;  3LSL A;  5I59 A;  5I2K B;  2Q89 A;  4QFO A;  3MVW A;  1JEV A;  1XVX A;  3H6W A;  4M4G A;  1JW1 A;  2HXW A;  1MPD A;  5CRY A;  1LAX A;  3PV0 E;  4OZ9 A;  1H44 A;  4OEN A;  2H25 A;  1LCT A;  3GBA A;  1B3F A;  3KJ7 A;  3K6X A;  3MPK A;  1ELJ A;  4IY6 A;  4Q0C A;  1B58 A;  3T9X B;  3UGW A;  2DWA A;  3MP8 A;  2F78 A;  4DZ1 A;  1OVT A;  5I57 B;  5L9S A;  2XXR A;  1NNP A;  1A99 A;  1M5F A;  1MXY A;  1SQY A;  2DWH A;  3HST A;  4PP0 A;  3TTM A;  3DEL B;  4YMA A;  3H6T A;  1XVY A;  2OJT A;  3IAZ A;  1XS5 A;  3SKP A;  1N3X A;  3K1N A;  1DPP A;  1SDX A;  3KOT A;  3LUY A;  4U22 A;  4F22 A;  4EF1 A;  1Y1M A;  2QS1 A;  3U72 A;  3SES A;  4X9T A;  4ELO A;  3RT8 A;  3TCH A;  1XOC A;  3DLN A;  2I58 A;  2VP1 A;  2XXX A;  3O29 A;  2OLB A;  1R9L A;  1SBP A;  4RYA A;  5L9O A;  3IOV A;  2BJJ X;  4FOR A;  3K1P A;  2R9J A;  4KCD A;  4LZ7 A;  4XKN A;  2PT2 A;  5H8H A;  1D4N A;  4IO5 A;  1AOV A;  2XXP A;  5HPQ A;  1R6Z A;  3BFT A;  2Y84 A;  2QS4 A;  4KPT A;  1A40 A;  1OIB A;  3WAF A;  5IKB A;  1JVX A;  3OOA A;  4DDD A;  3EPE A;  1MQI A;  2XX8 A;  3VXC A;  1Y3Q A;  4NF4 A;  1ANF A;  4QSC A;  4O3C A;  1LB9 A;  5TP9 B;  1NL5 A;  3OXN A;  4GIZ A;  4I9D A;  4EQB A;  3U1O A;  4HTG A;  3B6T A;  4H1X A;  5ELV A;  2A5T B;  1B51 A;  4RJZ A;  2DE3 A;  3O97 A;  4U1O A;  2ZYM A;  2RC8 A;  4POX A;  2FNC A;  4UAC A;  3S9N C;  5L8D A;  3ECR A;  3SEV A;  3K6W A;  3H3G A;  3P7I A;  4G68 B;  4WXJ A;  4EF2 A;  1AH5 A;  4YB5 A;  5CM6 A;  2PX1 A;  5I59 B;  1OMP A;  5KCJ B;  3A3C A;  1B0L A;  5ICQ A;  4EQ9 A;  5J1D A;  2VD2 A;  3C34 A;  3K1M A;  4G8M A;  3USD A;  2QJE A;  1N76 A;  4JB7 A;  4F3B A;  4QSD A;  1YTV A;  3W9V A;  3H6U A;  4X1D A;  1O63 A;  3DP6 A;  5DVI A;  1QW0 A;  3OEL A;  2V25 A;  4PFT A;  3ZKK A;  2OK2 A;  4ELP A;  4JSO A;  3SEY A;  5JEI A;  3G3F A;  3PUX E;  4LQ2 A;  3PPP A;  4XIG Q;  3RLF E;  4F31 B;  4ZE9 A;  2ONS A;  4GF8 A;  1N7W A;  3R7X A;  4O3B A;  2B3F A;  1UQW A;  2F5X A;  3Q27 A;  2NUV A;  4IO4 A;  1MH4 A;  2R71 A;  4NWC A;  3D4C A;  3VDF A;  4EXK A;  3CG1 A;  5I57 A;  5IAI A;  3KN3 A;  4ECF A;  4ELQ A;  2CMO A;  1IQ7 A;  1P1N A;  3PUY E;  1URG A;  2F7A A;  4C1U A;  4DCY A;  1Y4C A;  1HSE A;  3E9X A;  4ZDM A;  1QJM A;  3IB0 A;  1ZBM A;  4H8J A;  1IIT A;  3R26 A;  4M1V A;  1B05 A;  1B46 A;  4XXU A;  4TLL B;  4FIM A;  2Y7R A;  3EQ1 A;  3PD9 A;  1FQB A;  1MY4 A;  3RN8 A;  3WAE A;  4KYS A;  3E4R A;  3JV9 A;  4THI A;  3DM0 A;  1GR2 A;  1LST A;  3Q26 A;  1D3K A;  3RPW A;  3U93 A;  4I62 A;  2GH9 A;  2ZMB A;  5FHM A;  4FJP A;  1MXZ A;  3EF7 A;  3HCQ A;  5HBC A;  3TUS A;  1JNF A;  1H45 A;  3VLU A;  2P2A A;  3K2D A;  1MY2 A;  4GRK A;  3TFL A;  5KZT A;  1A8E A;  2O1M A;  2I0B A;  3T96 B;  4GL8 A;  3TCG A;  1N3W A;  2W7Y A;  1OQH A;  1IXH A;  3RNN A;  2O84 X;  2IEE A;  3F11 A;  1UTH A;  3A09 A;  3MBP A;  2NWJ A;  1PB9 A;  3CRB A;  3TEL A;  2PMS A;  3UA8 A;  1MY1 A;  2GRV A;  3VLV A;  4ZED A;  3M3F A;  2XXV A;  2ZXT A;  1GVC A;  4JSD A;  1LFI A;  2I49 A;  3I3V A;  2A5T A;  4HCW A;  4MH5 A;  3KJT A;  2QS3 A;  4OER A;  1KWH A;  3TZA A;  4Q8R A;  3SEW A;  4FED A;  3ODB A;  5K2X A;  3SDF A;  5AA2 A;  4H5F A;  1XT8 A;  1M5C A;  2I3W A;  1DSN A;  5TU0 A;  3W9W A;  1B4H A;  2PBW A;  4G68 A;  2HEU A;  4QRZ A;  5BUU A;  3C4M A;  4EQ7 A;  4JDF A;  1CB6 A;  1MQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...