2QSBA

Crystal structure of a protein from uncharacterized family upf0147 from thermoplasma acidophilum
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
85
structure length
85
Chain Sequence
b'VRVDQNLFNEVMYLLDELSQDITVPKNVRKVAQDSKAKLSQENESLDLRCATVLSMLDEMANDPNVPAHGRTDLYTIISKLEALS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0147 protein Ta0600
publication title Structure of a protein from uncharacterized family UPF0147 from Thermoplasma acidophilum.
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Structural genomics, unknown function
total genus 33
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03685 UPF0147 Uncharacterised protein family (UPF0147)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.50 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) Ta0600-like 2qsbA00
2BL8A 2BL7A 2FU2A 2QSBA 2QZGA 1TDPA
chains in the Genus database with same CATH superfamily
4HFVA 4U6RA 2ZRRA 4PL5A 4O1PA 3F4MA 3P23A 1YO7A 3B55A 2YFAA 3FBVA 3LJ2A 2L1LB 4GXTA 3LJ1A 2QGMA 4PL3A 2JB1A 4G76A 4Q9VA 5LNK1 2E8GA 4I1TA 2KKMA 2QSBA 1JQOA 2ZW3A 2JB2A 2GSCA 3LJ0A 4AS3A 2JAEA 4G75A 3IAS1 2A2CA 4YZCA 3Q8DA 3IAM1 1TDPA 4YZ9A 3FNBA 5HGIA 2RLDA 1SJ8A 2MJFB 2RADA 4HEA1 2YFBA 3DO9A 2FEFA 3I9V1 1W3SA 2ETDA 2BL7A 2XTQA 2CAZB 2V6EA 2F66B 2HGKA 2XMXA 3FVVA 1U5KA 4JCVE 2QZGA 3UITA 4Z7HA 2JB3A 4O1OA 2K19A 2V1CC 2JBWA 2IP6A 4DWLA 4YZDA 3DA4A 3JSBA 4AS2A 3AJFA 3DA3A 2RIOA 4Z7GA 4OAVB 2FU2A 3SDJA 4PL4A 2F6MB 2FUG1 3L0IA 2XTRA 4NV5A 4NV2A 3VA9A 3KP9A 2P22B 2BL8A 2A2DA 4OAUC
chains in the Genus database with same CATH topology
2BL8A 2BL7A 2FU2A 2QSBA 2QZGA 1TDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BL8 A;  2BL7 A;  2FU2 A;  2QSB A;  2QZG A;  1TDP A; 
#chains in the Genus database with same CATH topology
 4HFV A;  4U6R A;  2ZRR A;  4PL5 A;  4O1P A;  3F4M A;  3P23 A;  1YO7 A;  3B55 A;  2YFA A;  3FBV A;  3LJ2 A;  2L1L B;  4GXT A;  3LJ1 A;  2QGM A;  4PL3 A;  2JB1 A;  4G76 A;  4Q9V A;  5LNK 1;  2E8G A;  4I1T A;  2KKM A;  2QSB A;  1JQO A;  2ZW3 A;  2JB2 A;  2GSC A;  3LJ0 A;  4AS3 A;  2JAE A;  4G75 A;  3IAS 1;  2A2C A;  4YZC A;  3Q8D A;  3IAM 1;  1TDP A;  4YZ9 A;  3FNB A;  5HGI A;  2RLD A;  1SJ8 A;  2MJF B;  2RAD A;  4HEA 1;  2YFB A;  3DO9 A;  2FEF A;  3I9V 1;  1W3S A;  2ETD A;  2BL7 A;  2XTQ A;  2CAZ B;  2V6E A;  2F66 B;  2HGK A;  2XMX A;  3FVV A;  1U5K A;  4JCV E;  2QZG A;  3UIT A;  4Z7H A;  2JB3 A;  4O1O A;  2K19 A;  2V1C C;  2JBW A;  2IP6 A;  4DWL A;  4YZD A;  3DA4 A;  3JSB A;  4AS2 A;  3AJF A;  3DA3 A;  2RIO A;  4Z7G A;  4OAV B;  2FU2 A;  3SDJ A;  4PL4 A;  2F6M B;  2FUG 1;  3L0I A;  2XTR A;  4NV5 A;  4NV2 A;  3VA9 A;  3KP9 A;  2P22 B;  2BL8 A;  2A2D A;  4OAU C; 
#chains in the Genus database with same CATH homology
 2BL8 A;  2BL7 A;  2FU2 A;  2QSB A;  2QZG A;  1TDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...