2QSBA

Crystal structure of a protein from uncharacterized family upf0147 from thermoplasma acidophilum
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
85
structure length
85
Chain Sequence
VRVDQNLFNEVMYLLDELSQDITVPKNVRKVAQDSKAKLSQENESLDLRCATVLSMLDEMANDPNVPAHGRTDLYTIISKLEALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a protein from uncharacterized family UPF0147 from Thermoplasma acidophilum.
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Structural genomics, unknown function
molecule keywords UPF0147 protein Ta0600
total genus 33
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03685 UPF0147 Uncharacterised protein family (UPF0147)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.50 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) Ta0600-like 2qsbA00
2FU2A 2BL8A 2QSBA 1TDPA 2QZGA 2BL7A
chains in the Genus database with same CATH superfamily
2JBWA 3P23A 4AS3A 3FNBA 4G75A 3KP9A 5LNK1 1W3SA 2FUG1 3AJFA 3DO9A 2E8GA 3JSBA 2JB2A 2XTRA 2A2DA 4Z7HA 2QZGA 2JB1A 3FVVA 4YZCA 1TDPA 4PL4A 4NV2A 2KKMA 3IAM1 2XMXA 4U6RA 4O1OA 3B55A 3FBVA 2CAZB 2L1LB 4NV5A 3SDJA 2HGKA 1JQOA 4AS2A 4DWLA 2P22B 2XTQA 4HFVA 2ZW3A 2K19A 2YFAA 3LJ0A 1U5KA 3UITA 2RADA 4JCVE 2A2CA 4GXTA 2GSCA 2JB3A 3VA9A 4OAVB 2BL8A 4G76A 4OAUC 3F4MA 2F6MB 2QGMA 4Z7GA 3IAS1 1YO7A 2V6EA 4HEA1 4YZ9A 4PL5A 2ETDA 2FU2A 3Q8DA 2RLDA 3LJ2A 2FEFA 2QSBA 2V1CC 3I9V1 2F66B 4YZDA 4I1TA 4Q9VA 4O1PA 2YFBA 1SJ8A 2IP6A 5HGIA 2RIOA 2MJFB 3DA3A 3DA4A 2ZRRA 2JAEA 3L0IA 3LJ1A 2BL7A 4PL3A
chains in the Genus database with same CATH topology
2FU2A 2BL8A 2QSBA 1TDPA 2QZGA 2BL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FU2 A;  2BL8 A;  2QSB A;  1TDP A;  2QZG A;  2BL7 A; 
#chains in the Genus database with same CATH topology
 2JBW A;  3P23 A;  4AS3 A;  3FNB A;  4G75 A;  3KP9 A;  5LNK 1;  1W3S A;  2FUG 1;  3AJF A;  3DO9 A;  2E8G A;  3JSB A;  2JB2 A;  2XTR A;  2A2D A;  4Z7H A;  2QZG A;  2JB1 A;  3FVV A;  4YZC A;  1TDP A;  4PL4 A;  4NV2 A;  2KKM A;  3IAM 1;  2XMX A;  4U6R A;  4O1O A;  3B55 A;  3FBV A;  2CAZ B;  2L1L B;  4NV5 A;  3SDJ A;  2HGK A;  1JQO A;  4AS2 A;  4DWL A;  2P22 B;  2XTQ A;  4HFV A;  2ZW3 A;  2K19 A;  2YFA A;  3LJ0 A;  1U5K A;  3UIT A;  2RAD A;  4JCV E;  2A2C A;  4GXT A;  2GSC A;  2JB3 A;  3VA9 A;  4OAV B;  2BL8 A;  4G76 A;  4OAU C;  3F4M A;  2F6M B;  2QGM A;  4Z7G A;  3IAS 1;  1YO7 A;  2V6E A;  4HEA 1;  4YZ9 A;  4PL5 A;  2ETD A;  2FU2 A;  3Q8D A;  2RLD A;  3LJ2 A;  2FEF A;  2QSB A;  2V1C C;  3I9V 1;  2F66 B;  4YZD A;  4I1T A;  4Q9V A;  4O1P A;  2YFB A;  1SJ8 A;  2IP6 A;  5HGI A;  2RIO A;  2MJF B;  3DA3 A;  3DA4 A;  2ZRR A;  2JAE A;  3L0I A;  3LJ1 A;  2BL7 A;  4PL3 A; 
#chains in the Genus database with same CATH homology
 2FU2 A;  2BL8 A;  2QSB A;  1TDP A;  2QZG A;  2BL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...