2QSFX

Crystal structure of the rad4-rad23 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
104
Chain Sequence
IGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAVGSFQVDYTPEDDQAISRLCELGFERDLVIQVYFACDKNEEAAANILFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of DNA damage by the Rad4 nucleotide excision repair protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD4
total genus 33
structure length 104
sequence length 141
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00627 UBA UBA/TS-N domain
X PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2qsfX02
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2qsfX01
1OQYA 1DO2A 1OAIA 1WJ7A 1X3WB 4F1IA 2DHYA 2KHHA 1UFZA 3GLHE 1WGNA 2RRUA 4WP2A 1P3QQ 2DAKA 1ZMUA 2JNHA 2DAGA 1G4AE 3K9PA 3GLFE 4UN2B 2QNJA 3MMPA 1T6OA 1WGLA 1HJPA 1WR1B 1VG5A 5DFLA 3IHPA 3B89A 4Q7JA 2EKFA 3FRHA 3E21A 4G3OA 1HQYE 3H4JA 2DAMA 1OKSA 2MGWA 1OTRA 2QSHX 2JZ0A 2DAEA 1XXHE 2L4FA 1MN3A 1WHCA 1TTEA 2K9DA 1IM2A 1Q02A 1C7YA 1GO5A 2KNAA 1QZEA 2O25A 1R4GA 2MROB 1IXSA 1ZV1A 1PGYA 3K9OA 1TP4A 2LVNC 2JZ1A 1DV0A 1V92A 5JI2E 1CUKA 3LCUA 2DNAA 4F2LA 3GLGE 2QHOB 2LVQD 2DENA 3E46A 1TR8A 1VQ1A 1VDLA 4DBGB 1ZMWA 2OO9A 3IECA 4R71A 4YIRX 3T6PA 3ESWB 1VEJA 1VEGA 2JY6B 2B3TA 2QSGX 2LVOC 1T43A 2KNVA 2ZTDA 2BWEA 1ZMVA 1HT1E 2OOBA 2L4EA 1JR3E 1YLAA 2DI0A 2R0IA 3FRIA 2QSFX 2OOAA 4HEOA 2CP8A 1PVEA 2F4OB 1G41A 2H5XA 1G3IA 2BWBA 2F4MB 2EJSA 2L2DA 1VEKA 2JUJA 1Y8GA 1F4IA 2MR9A 3BBZA 3LCVB 1DO0A 2CWBA 2DAIA 2ZTCA 2G3QA 2K0BX 2HWJA 1IFYA 3F92A 1NV8A 2JY5A 1KYIA 2HAKA 2JY8A 1E94E 2LVPC 4GEWA 2JP7A 3GLIE 2DZLA 2KNZA 2JY7A 2LBCA 2LTUA 2EKKA 3FE3A 2WZJA 1SG9A 1A5TA 1BVSA 1WIVA 1EFUB 1XB2B 2LVAA 2DKLA 1AIPC 1NV9A 1HT2E 1X3ZB 2MJ5B
chains in the Genus database with same CATH superfamily
5IP7J 3SAVA 2VXZA 2KEBA 1ZR2A 4IHWA 2GA2A 2P6SA 3TO9A 2OF7A 2CG4A 2YUSA 1T39A 4WP2A 3HOXJ 1JTXA 1P9QC 1AKHA 1U9OA 3JSOA 3CCMI 1L2BA 1ZGWA 3LSTA 2BY3A 3QODA 4I98B 3VSKA 2RGVA 1YIJI 3DA1A 3LA7A 3JREA 3NBIA 3VSLA 1KFVA 2DWLA 2VQHA 3U61A 2RNJA 4JX4A 4GITA 1HSJA 2DQLA 3IC7A 2EZKA 3G3ZA 4RM3A 5HS8A 4XGIA 2M4GA 3CCRI 3O8GA 3V4GA 4XRMA 3U9GA 3H3UA 4LZJA 4M9ZA 3RFWA 2R62A 3I64A 4OOIA 1PJJA 2STWA 1R1VA 3U1KA 3H92A 2BHZA 3OYFA 1SD4A 2JZ0A 4XRSG 3I4VA 4GHAA 4CISA 3UNGC 1GV5A 5DYIA 1MN3A 1BOAA 3JRDA 4X1EA 5DM6F 3AG4H 3MWMA 1FSHA 2XPUA 5EP1A 4HW0A 3DLLF 1FOKA 1HA8A 5KCMA 1IY2A 2MROB 1OAOC 1TLHB 2FD5A 1Y0NA 4OMZA 1ZV1A 4RAYA 2M0MA 4RF0A 5BPIA 1B6AA 3TWKA 2CUJA 3BG6A 3CCEI 4F3QA 1B8IB 2JA2A 1F36A 4BDZA 3HHXA 1V92A 1R5LA 2D45A 3FWEA 3DBHB 4IOCF 3GLGE 3DFGA 4LJ4A 1TWFJ 3U1DA 2LVQD 2Y9ZA 4X6AJ 3FTEA 2QP9X 2DZOB 3M7GA 3CCJI 3AOEC 3CCYA 4YIRX 1DGGA 3COAC 5AIQA 2CV0A 2M7BA 1U9NA 1QQWA 3PO3J 1IXRC 1XDUA 4GCVA 1FOYA 4A93J 5GKNA 1QQIA 5HNFA 1FJLA 2X0LA 2Y0MA 5HLHA 3B73A 1K79A 2JVGA 3FXLA 2EV6A 1FLIA 1PVEA 4DR2M 4A6DA 3HYIA 4QWQA 2EZLA 1OLTA 9ANTA 2V4JC 5ICFA 4B08A 4W97A 5JLXA 1HW2A 3U6PA 3GLIA 3BP8A 2FU4A 1O57A 3CTAA 5EXSA 5D8LB 4AWXB 1Z67A 2X4AA 2JUCA 4DIQA 3SMPA 2K0BX 3HRTA 1Y1WJ 2O8KA 2HDCA 1KONA 3BJAA 1YG2A 1TDZA 1LKXA 1QUTA 3GO8A 2RVCA 3ABLH 4AKIA 4JI4M 2G0EA 2NVYJ 4BQAA 4QNRA 2XKPA 1TL8A 5E3MA 2LVPC 2HOAA 2JP7A 4PJNA 3JRGA 4I09A 4AKHA 4YFXF 1FIPA 3HJSA 2DPUA 3K1MA 4GFBA 1MMAA 3BTLA 3MKYB 4DV5M 1BR4A 2EZHA 4JYKA 2QYOA 5LGNA 1MMGA 2VASA 1XDSA 3LMMA 3JAMS 3BOQA 3SARA 4BL0B 4Y4RA 4RGRA 1MDMB 1BI3A 1HT2E 2JMWA 5LGTA 1SFOJ 5FKOA 1K61A 3M9AA 1Z9CA 4OIOF 3S1QJ 1ACIA 1WVRA 2DLLA 2VQCA 4MFDA 5E3OA 2GBYA 4RGSA 3ZOBA 5J6XA 2H1LA 3A2KA 2EA2A 1A36A 4UUSA 2HQ5A 2R7UA 1KZHA 2DAKA 3K0LA 3IG5A 2BGCA 3RI4A 2O6GE 3GUDA 4BJ6C 2JT1A 3GQ3A 3Q8GA 3FXMA 3DKWA 3QOEA 2DZNB 1WI3A 4ON0A 1WHUA 1WR1B 3J80Z 2KKOA 2KDOA 3BROA 2VJIA 2HQAA 3CDLA 2LF8A 1Q3BA 1QA6A 3FTFA 4NUBA 4RGUA 1XMQM 2GQQA 3S1NJ 5E17F 2MGWA 3FMRA 3L2WA 4ZJZA 4NC7A 2GAUA 1XCBA 3KYDB 1BIAA 5CYVA 4RMNA 2FNAA 2M8EA 3K4MA 4MFEA 4LJ9A 2KDZA 3CDHA 1J5YA 4NDLA 4JI7M 2XGNA 1IM2A 1MMSA 5HS9A 2KNAA 3VFDA 3GWZA 4C2UA 2EA4A 8CATA 1BW5A 1GLNA 4XLNF 2G8LA 2K7LA 1TP4A 3KVWA 2X6OA 2W1OA 4DUYM 2R7DA 4F91B 5J4YA 2ISZA 1FYKA 2CW8A 1SVLA 5BNGA 1I1SA 4TUWA 2EZIA 3GTLJ 3CO6C 1BR2A 2ZANA 4P9FA 3K2ZA 2XF3A 3V8KA 5M5XJ 3PQJA 5K5OA 1U0JA 4XRFA 4L9VA 3H9GA 1GJTA 1S72I 2JWSA 3ABKH 1ERDA 1VEJA 4EIWA 1WRJA 4LK0F 3KYCB 1T43A 3NBXX 3N4MA 1BL0A 3S8PA 1IN4A 2KQRA 2ZCWA 1N78A 5CQGA 4UUTA 2VPRA 2FS1A 3HPHA 1A5JA 2UV1A 2Z7JA 2PI0A 6PAXA 1L3LA 1HQCA 1P7JA 3G2BA 1YSYA 3GRRA 5FTJA 1O7LA 1R1TA 1K3XA 2ADUA 3IP4B 4AIKA 2K9MA 1PJRA 4MGKE 3D5SC 4EVIA 1V4RA 3K1JA 2FXAA 2M3AA 3FXOA 2R5ZB 2EK5A 1VQ9I 4A3LJ 2LD5A 3EDPA 4EJVA 1QAMA 3U6LA 2R18A 2FNPA 1QPIA 4HX8A 3F92A 1ETKA 4HA8A 4EGYA 2ZXJA 3QYFA 1LFBA 1D3YA 2ZMEB 1ONVA 1GXPA 3PL8A 3GQ5A 4PGGA 3GCMA 2ESNA 4LG3A 4HDVA 3BJ6A 4IJEA 4CZCA 3M07A 5EF6A 4XK4A 2CHGA 1TH3A 2JQ7A 2EFOA 3OY9A 2W7NA 1GV2A 4L0ZB 3MKZA 3K2LA 3DU5A 1OIPA 1Z5AA 2JRMA 3SYTA 2EFWA 4LG2A 2LVAA 2I8DA 3NWLA 1PJTA 5LLQA 3F8BA 2DU9A 4BAYA 2R7XA 1LEBA 2XAFA 1YS7A 1DGRM 1YHQI 4YRVA 1HW5A 2KFDA 4DR4M 2WB1N 1W1WE 4CYCA 3DCFA 2H27A 1ETQA 3EYYA 5EQTA 2LH9A 3LSHA 5LMUM 1MGTA 4H0EA 4KDPA 1E2XA 3AAFA 4LF9M 1QO0D 2KJBA 1XNQM 5L3FA 5KNLA 2W85A 5HLTA 3J81S 2HPIA 4IBFA 4N4NB 3ZMDA 2ZXIA 2LC2A 3MMPA 4AYBA 3G1LA 4BE0A 4REZA 1D8KA 2XAGA 3ZCBB 4E7HA 3G1MA 3AG3H 3B89A 5EXPA 4LF6M 2DT7B 4Q48A 2GNOA 3OL3A 4C9YA 3JRIA 1U8BA 4R79A 3CGWA 4Q7JA 1BI2A 4N0BA 3KCCA 1T2KA 1CF7A 2BW3B 2Y0SN 3I04M 2TRTA 4RS8A 3C3WA 3R0JA 1OKSA 3BR5A 3V7RA 4G6ZA 2VKVA 2E1NA 1FBUA 3H36A 1A31A 2NYXA 5J8FA 4BQNA 3MK6A 1X2MA 2LBFA 1MNMC 4BB9A 2QKLB 3HRMA 5E8GA 1Q02A 2QF7A 3LSMA 3ZQQA 4BS9A 2AHMA 5ITTA 2KISA 3ASNH 5CKTA 3JSPA 2R7VA 1IXSA 2VJJA 4NHJA 4WW0A 3EUAA 3JRBA 2DA1A 4EEFG 2JA5J 2JSPA 2BW3A 2UXDM 4MGZE 1R5HA 5TRDA 2P7CB 1Z5CA 3OYAA 4CCNA 1TDHA 1OCRH 3CO7C 2F2EA 2XZUA 2YX4A 4XLEA 2CH0A 1XC5A 2KA6B 2WSFF 3TDUC 3KXEC 3I56I 1OPCA 2Y30A 1HT1E 1KQ0A 4G6DA 4BEHA 1RUOA 3LVWA 3UMMA 2YNMD 1QZYA 2VE8A 2XASA 3ZP5A 3ABTA 1DPUA 3K7AJ 4L5EA 1X1BA 2APLA 2UXBM 3ROUA 2QPAA 1D5VA 1HDPA 3TDZC 4RF1A 2WA0A 2F5FA 1LV7A 2ECCA 4BUPA 1Y6IA 1NJGA 2FOWA 2K4BA 1K4TA 2A6TA 1UZCA 5DYGA 2IVMA 2L54A 4DV6M 3GTGJ 2LTPA 2CWBA 1SXJD 2XAUA 2BXZA 4PGHA 4JXJA 2HWJA 1LJ9A 2R7FA 2ESHA 4PT5A 1IFYA 5BOXA 2DMTA 2MC4A 5GTIC 2BE5F 3L29A 2L7KA 3M6AA 2XLJA 3I0TA 4HSRA 3ZMZA 4MNUA 1V54H 3ZQLA 4XRSA 2XHKA 1JKQC 3JR9A 2DPDA 5FGMA 5IREB 4YFKF 4P16A 1XGSA 2Q8KA 2W84A 4CCMA 2K9LA 5JI3E 1J0RA 3ECHA 3QYEA 1MJBA 3FTDA 3TOBA 4KA4A 3HOTA 4IX7A 5HNHA 3GLGB 1SEUA 4X66M 3HU1A 5FFXA 3GLFA 5DDGA 5J1RA 4IHSA 4IVNA 3J7AO 3OYBA 3IWZA 3VOEA 4JI5M 1FTTA 4IBJA 3GTMJ 4GHLA 2CW0F 4RGXA 4CUGA 1R00A 5HODA 3E6MA 1TQMA 2IS4A 4GDFA 1PYVA 3SZTA 4HPQA 3U6OA 5DTDA 1SMTA 1E9RA 1BBYA 2O3FA 1G4AE 4OVZB 2P7VB 2PJRA 2KL4A 4J00A 1W7PA 2HYGD 3VLFB 2P8TA 3GLXA 3TPZA 5ERIA 4EM2A 2A3SA 1IBLM 4A0YA 1U5TC 3OSGA 1T98A 3PIPF 1XSVA 3HHYA 4ITQA 2DDBA 2HDDA 2V9VA 3C1DA 2LF7A 1ZRDA 2K02A 1YTYA 4X62M 2OV7A 2R5YA 4GO1A 1HQYE 3F72A 3HZJA 4UB6C 4LGMA 2X85A 3WHLA 2LKPA 1HF0A 2AQEA 4GMQA 5BR8M 1BJZA 5H6RA 4B43A 2HKOA 1WHCA 1B4AA 3KP6A 1TW3A 4OU7A 1MH4A 4RA2A 5FKKA 2OTJI 2HKXA 1KGSA 1I94M 2GM4A 2Y0TA 4E7LA 4EJOA 1VNDA 3CMYA 1I39A 4RB1A 1Y56A 2H09A 1U8RA 1PGYA 4BHBA 1LFUP 2ZSIB 2HXIA 2EFPA 1X1CA 3ZN1A 2CHVA 3FD9A 5FLXS 4I01A 3LSJA 3LCUA 3VYTB 3K70C 2UWMA 2GA1A 2NNNA 4XORA 4G7ZF 3IHUA 3BTJA 1IRXA 3GXOA 1Z3YA 3BLYA 1IC8A 2EB7A 3P9IA 5EEHA 4WK8F 4A3VB 2AXTC 4R8HA 3A02A 1O4XA 1I3QJ 2H1RA 2FMLA 4LJAA 4O3MA 4CIZA 2M1BA 4CO8A 1MBEA 4BJTA 2JTVA 4B44A 1NK2P 2JA6J 2HNHA 4RB2C 3ZMTA 1Q1HA 1B9MA 2R0IA 2OPTA 2XAHA 4B1RA 2WAQN 3WGIA 2A07F 1POGA 2DJNA 1ZK8A 4HSTA 1P6RA 4KT5C 5K7FA 1Q3CA 3DPLC 2PMZN 1PDNC 2L2DA 1DP7P 4DUZM 3W2VA 1V55H 3PSFA 4D9JA 2LFBA 2ZTCA 1QRYA 2E71A 2V26A 1LFPA 3TWLA 3FKIJ 2W82A 3QPHA 5KAIC 4A3JJ 5HLGA 4KHPM 5TGTA 1HKSA 1YE9A 2FQ3A 2BEOA 3SEZA 3BDDA 3TEDA 3HU2A 4IBCA 2X8AA 2FA5A 4HEA2 4KODA 2EKKA 2KHMA 4JQFA 1TBXA 2ICWG 3OYIA 2WAEA 3CUQA 1FTZA 2E5ZA 4ZC3A 1VDDA 1QZZA 2HR3A 2BHYA 3JW4A 1VQ4I 4N9HA 3K69A 2BV6A 2DHYA 2HYJA 3K4CA 1CGPA 4HAMA 4I8OA 1CQTA 1AA7A 4YIFA 3UK6A 2XB5A 1S9HA 3PSIA 2L02A 2XGXA 1MH3A 2DHRA 4HX7A 1ZMUA 1JHHA 2MA3A 3PFYA 2L0KA 1IDZA 1WI9A 3PXGA 2QNJA 1WCMJ 3SHGB 3GFLA 4Q47A 1SFUA 3TW7A 3LOCA 4W5WA 3KP5A 5BQTA 4GRIA 2L7FP 1T8IA 2STTA 4CCOA 2YU9J 1OFIA 4ZDOA 4XR6A 1LDDA 3W2AA 4DR5M 2DQRA 1MJ9A 2EA0A 2BJVA 5AONA 3TKYA 3MZYA 2AXLA 1LE8B 4NSRA 4I0BA 3JTGA 1G6NA 1OYWA 2O5RA 4WURA 1KA8A 3DBLB 5EP4A 1IW7F 5GP9A 2GOMA 5HOOA 4FCVA 1HR0M 2R7RA 3L2AA 2XSZD 4KT6A 1OTRA 3FXUA 3RPUA 5DV5A 3KP7A 2QA4I 2QSHX 3T15A 3D8LA 1W5TA 3JAMZ 5LHHA 2QCUA 3F8MA 1FYMA 1G3WA 1G59A 2A6HF 2L4FA 2DOFA 3K6GA 2KMUA 1TW2A 2IRFG 1W0UA 5ITRA 2VPLA 3S3NA 3BR2A 3ZQGA 2RKOA 4QNMA 3C2HA 3JR5A 2XPVA 4G4NA 1KU3A 3P9KA 2CYYA 3TGNA 3TO7A 2XF7A 2XUBA 5IY5H 3KIOA 3B7QA 3FIWA 1TWAJ 3V76A 3ZQJA 5D5WB 2VQEM 2CV2A 7CATA 1I5ZA 2JZ1A 1RPWA 3BG9A 5E3LA 1R71A 4P17A 2V6EA 4AC0A 4DR7M 2ID3A 4JP0A 5LBQA 4OU0A 1GJSA 3DWLE 3FXQA 3BG7A 2R3SA 1FIAA 3B02A 3F8CA 3VYUB 3WGGA 1NY6A 1XC8A 3J7BA 1NTCA 3RDIA 1YW9A 2C96A 2B3TA 3F22A 2LVOC 2EFNA 1X4OA 3GLIB 2DN0A 3BZ6A 4FE4A 5EZHA 3GTJJ 1ZMVA 1JE8A 1R6BX 3BXWA 4MGYE 2E1OA 2L9NA 1K78B 2R46A 4MM3B 3OTOM 1KQ9A 3F3XA 1HNZM 1I3AA 5ILSA 1YLFA 4IHYA 2DFFA 3SEQA 4CXFA 3J80K 1Z5BA 4NOOB 3P9CA 3R6SA 2VE9A 1I1GA 2E36A 2L3DA 3GYHX 2Y9YA 3VKGA 5M5YJ 4B7HA 3K1PA 3HKZN 2VQLA 3B6CA 2Q0OA 4HF1A 2X1CA 3H5AA 2H1KA 2VJ5A 5F6FA 2DA3A 1FT9A 5LHIA 2L7HA 1NO1A 2COMA 2V9KA 5D5XB 2LXEA 1JUMA 2O03A 4A5NA 2MG4A 4ENJA 5GAHJ 4UHTA 3CJTB 1XB4A 4HV6A 3UGJA 1OR7A 2HL7A 4LK1F 5F27A 1FYLA 1IV8A 2MABA 2P5TA 2LSOA 1DU6A 1V3FA 3R4KA 4QPOA 2ZMEC 1HNWM 1EFUB 2G9WA 2HVRA 3I53A 4UVAA 4XLCA 1NV9A 3CJNA 2LNBA 1QNTA 2XIGA 3A03A 4C3HJ 2O01F 2CQKA 3FX3A 5LRRA 4U0YA 2RC4A 3M8FA 3DV8A 3FXJA 3HWSA 2V1UA 4I5SA 2COBA 5DCMB 4HLYA 2OZ6A 4ITVA 1N25A 3BG3A 3OV8A 4M72A 3CJRB 5BPDA 3S2DJ 3C3DA 2RREA 3ZMSA 3C2BA 3ZQFA 1YO5C 3VEPA 2DMPA 3U61B 1NNJA 2QKMB 3A1YA 1EF4A 4BY7J 3TP0A 1WPKA 4WXHA 1DUXC 5E1WA 3WGHA 3CZ6A 4BU2A 3DQVC 4S12A 2M87A 1TNSA 4Z8XA 5C44J 3BY6A 3SZGA 1WJFA 3T8TA 3SC3A 5C18A 1LVKA 2HZTA 2L6OA 2LVSA 1IUFA 3LSGA 1H88C 1RC9A 4XLHA 4DW6A 1XXHE 3TQSA 2PMZA 2QM3A 4Y33A 4CCKA 3ZC7B 3CLQA 2P6TA 4JK1X 4DR1M 1OCOH 3Q0VA 1YOVB 4DYRA 2XDVA 4BEHB 1FOXA 3K4KA 4B8XA 2NQ8C 3CDIA 3BG5A 4G4QA 3B7ZA 1MW7A 3FF5A 2HDWA 2P0WA 3E1SA 4KJZA 1J7KA 4H4KC 3D0SA 2F5OA 4RLFA 1CUKA 1MJGM 4XBOA 4F2LA 1A04A 1YW7A 2DFHA 2FMYA 3HJEA 4L9JA 2WY8Q 2KLOA 1W7PB 1XD7A 4IQ4A 4J19A 1L0OC 5M3FJ 4XSXF 2EH3A 2IGMA 2WBMA 1GDTA 3CCQI 5HVQC 2Z1DA 3FBIB 2VBYA 5FTLA 2VIXA 3FUUA 2XZFA 3KLNA 4LIUA 2K40A 4BYYA 4JI1M 3SZPA 1ETVA 1SVMA 1R36A 4LLLA 1B1BA 4AG6A 3DEUA 1YLAA 3B7NA 2M45A 2F4OB 3KP3A 2K9NA 5FROA 1G41A 4LFBM 5E18F 2LBFB 4PUSA 2XAQA 4E70A 4ZYHA 1QBJA 1X1DA 2X51A 3RPUD 2E34A 2V7FA 4NC8A 1Z0XA 2MR9A 2UXXA 1M1EB 1WJBA 1KU9A 3B74A 2K9QA 2OUMA 4DYQA 5D4RA 1AU7A 2UXCM 4G94A 2P5VA 3H3VK 2R7OA 4AI6A 4NXMM 2K27A 3BPXA 1SD6A 4BDYA 4B3XA 3KP4A 1R5GA 4LCBA 1USTA 2D1VA 2DA4A 2ZC2A 3CP8A 5JI6A 5EG0B 4GYGA 1HKTA 2QZ8A 3N05A 4C30A 2LYCA 4XKBA 3SASA 2WAFA 2K9SA 2ID6A 5IPAA 2I5UA 4EJTA 4V19K 1YI2I 2R92J 1TF0B 3HM5A 3KEOA 4IJAA 5L3CA 1X37A 3AG2H 2CW7A 3MAJA 4L18B 1JB0F 2XEPA 1AIPC 3DTKA 4BE1A 2F48A 2I10A 2PQ8A 3Q9VA 1DO2A 4JI8M 3AKZA 1XX5A 4B4CA 1D1AA 4EJUA 3E0JB 3GX4X 4ZTFA 2ZM6M 3S3OA 1P3QQ 3LFKA 4OIQF 1P4WA 4DR6M 2FBHA 3MEXA 5ITYA 1G3SA 3WG7H 2VOPA 4BH9A 1HOMA 2JNHA 1AKHB 2A6EF 3OYCA 1S7AA 2VI6A 3HHGA 2QLZA 1Y1VJ 1HW1A 2YX7A 5D6EA 4MIMA 4NB5A 3IKTA 2D7EA 1SXJA 3HTSB 2N35A 1FSEA 2R4GA 3OMYA 4AVPA 1H6UA 1PUFA 5E79C 2YQZA 2K5CA 3FDYA 2BBYA 3MFKA 5F0HA 3HUGB 2FFJA 1YJWI 1VQ8I 1XS9A 1JQJC 1U5TA 3RPQA 2GXBA 2OA4A 1LEAA 4PJ0C 3WHCA 5A2QZ 2HPMA 2CJJA 4U0WA 3CMMA 3RKQA 1TQPA 3GRVA 2XV4S 3CUQB 3QOPA 4G12A 4R1HA 3ZRGA 1L2DA 5EDNA 1FP2A 2WSCF 3JRCA 2MD0A 3R9XB 2FOIC 4JYAM 5FD6A 1YIOA 2FF4A 3S15J 3K9TA 1BR1A 2L9VA 2G5GX 3ULQB 1FPQA 3VFZA 4A3IJ 1E3PA 4FVMA 3M3YJ 1NY5A 3JTHA 1P92A 5HS7A 4Q4ZF 4II7A 5EJCA 2WV1A 1RI7A 1LDKB 4MHGA 1G71A 2CV1A 4A3MJ 2PG4A 3F6VA 4D80A 2LY9A 4E7SA 4PSXA 4B3RM 4IF4A 3QAUA 3E6DA 1PUEE 5H6QA 1RNLA 3S1RJ 4BHPA 1QAOA 2X1EA 2H6BA 3G1OA 3SDBA 1ZMWA 3LA3A 3IECA 2IEKA 4ETSA 3WHKA 3SXYA 4S0HB 4FW9A 4F93B 2CFXA 1S29A 2XF6A 2D2WA 2F5SA 2V1CA 3HEFA 1K6YA 5LD2C 3MZ8A 3L00A 1GVJA 4IRIA 3MVPA 3L1PA 1DGHA 4IOAF 1NNUC 1E0EA 3AOEA 1B72B 3WU1B 3J7AS 3NQOA 2BYVE 3KFWX 1B72A 3FKEA 1J9IA 5DCMA 1W5SA 4PFPA 4Z2YA 3SAUA 2HQNA 1ZQ3P 5DNYA 4JN6A 1Y8GA 3K4NA 3LSIA 3MCZA 4L9NA 5FKLA 3EYIA 4R7GA 1GL7A 4JX5A 3GF2A 3RYPA 3A01A 4N9IA 1YJ9I 2J5OA 4M3FA 4P55A 2E2HJ 3FXKA 5KQDA 5J1YA 3F6OA 4NRVA 1MIJA 4JX6A 2CS3A 3ISPA 2BY2A 3W0LB 4DOZA 4K2EA 5FKNA 4HNVA 2Y48A 4MEYF 3GLIE 1QVRA 3CCUI 5CLSA 3S1MJ 3T8RA 3RCOA 2R5ZA 5E26A 4PCZA 3KDSE 4LITA 1HXDA 2TCTA 2VKHA 3QQAA 4LB5A 2CFOA 3CCLI 2LHCA 2ERCA 1WSUA 1WIVA 3WODF 2VLAA 3HHWA 4LD5A 2ZAOA 3I58A 2E2IJ 1R5ID 4LFCM 1IF1A 3KZYA 2V79A 2R5YB 1Z21A 2DA2A 4B09A 5E3NA 4ESJA 2FOKA 4F1IA 3WTZA 1T08B 1HCRA 2KHHA 3CESA 3KFUG 2IA1A 4LIVA 2RRUA 3CF2A 2VONA 3WTSC 1W36C 3J80S 1NHWC 5H37D 3LQRA 4HF0A 4G7OF 2H94A 1T95A 3K4JA 1FY7A 3KSJA 4U7DA 5EP3A 2KW0A 1UMQA 4OVZA 4FHTA 3FXRA 1O3TA 3KW6A 2F5VA 1PM5A 5A2QS 3R60A 4KUMA 2YFQA 3E6BA 1VF9A 1TGUA 1SXJB 5GAEJ 3FKJA 1VG5A 2JPCA 1ZTRA 2KRUA 5DFLA 5EEGA 1NSFA 4LFAM 4LGWA 3JRHA 3B9PA 3I4NJ 2CEAA 3DTEA 1IRGA 2OQRA 1BN5A 2CQ7A 2HU9A 2FEZA 2MD5A 5IOZA 1IGNA 2HVQA 3AL0B 2M8GX 2DAMA 2ZB9A 1Z91A 3J81K 2HEOA 2VF8A 3TWMA 1MBHA 1ZGAA 2OJED 2HXOA 3CC4I 2DAEA 2HZDA 1GABA 3AL0C 3DBRB 2XGDA 3OIOA 3IV5A 1ZHFA 2MC3A 2K9DA 4AG5A 2I7NA 3GRUA 1YS6A 1MU5A 3HJ8A 4HL4A 1ZR4A 1OYIA 4IRGA 4RKUF 3AFHA 4ENKA 1CF7B 4IZZA 5LEKA 1ZH5A 5DD8A 3E5XA 1APLC 1BC8C 1ZAEA 4RB0A 1K78A 1HC8A 2MH8A 1H9GA 3WTUC 3J2PB 1UJ8A 2LRDA 2CQQA 2P4WA 2XGEA 4D7NA 3G73A 4UUVA 3GPPA 3BTCA 3W6VA 3N97A 2Y31A 1TR8A 1G3YA 3HU3A 5BS6A 3ABMH 2LNHC 3IKVA 4Y7NJ 3ABUA 1ITYA 3U60A 4OINF 2Y0SA 3GLLA 3ZCOA 4LJ8A 2IGNA 4IHXA 2FBIA 3ZMUA 2RKHA 2DOAA 2OOBA 3HY5A 1H9TA 5GAGJ 1JR3E 3KP1E 3PNVA 4AUXA 4M71A 3HHHA 4QLCU 2Q2EA 3LNQA 1IJWC 1W0TA 3A45A 2D1HA 1G3IA 3HSFA 5EZGA 2BVMA 3OYGA 2FSWA 1S3SA 2X9DA 3R61A 4HNUA 3QP6A 4UVBA 2HCBA 2MGQA 4C3IJ 3RKYA 3LCVB 3KSXA 3I51A 3VDPA 2QCOA 1I6XA 1XGOA 2B7EA 3T1BA 2LY2A 2Z16A 3JRAA 2G7HA 1GVNA 4DYCA 4I7HA 2E7WA 2L7IA 3JAMK 4I4LA 1OIZA 2QBYA 1T0FA 3BWGA 4NL4H 1C1KA 1B59A 2M0CA 2HTSA 3EPZA 1GKIA 4GEWA 2E1MC 2IXSA 3REOA 3HJQA 4KT0F 2VKDA 2XRLA 3TQNA 4XLFA 4U7BA 1IBMM 3HSRA 4IBIA 1IBKM 4DZPA 1W7PD 4EGZA 3U6QA 2ZSHB 1SC7A 4AU7A 4XIDA 1H0MA 1A35A 4OWRB 4BQQA 1R9TJ 4RAZA 1F4KA 1QVUA 2M4KA 3H1CA 5FLXZ 3S16J 4HLXA 4LJZF 1NVMA 1X2NA 4LFUA 3HPGA 2F5NA 1ETYA 3K1NA 4PK4A 5F1RA 2DCEA 2NS0A 5D6FA 1ULYA 4XMYA 3J7YJ 5DUKA 1D1CA 2ELHA 2V1NA 1LTMA 4B7FA 3W2WA 1L8QA 1OCPA 1R7JA 3ZQIA 3GFIA 1FMWA 3A0HC 2X4HA 4ZZLA 3DKXA 1JKPC 5HDNA 4I0AA 2DVWB 5F64A 3U6MA 3PM1A 4A2UA 2NVXJ 1ETWA 1X3UA 5K1YA 4D1QA 3L09A 4A3GJ 3V7SA 4CYDA 3EUHC 2D7GA 2Z4RA 3HOVJ 5DCFA 1ZELA 5ITXE 3CUQC 3OYDA 4Y28F 5CVVA 2J7OA 2KDLA 1D0ZA 2DOEA 1G8PA 2IAIA 1Y8RB 5EEAA 1SFKA 1E17A 5E20A 4QTRA 3WG9A 3GQ4A 3FK7A 4IXAA 1PUFB 2ACJA 3F23A 2C5RA 4K0KM 3FISA 4FASD 1KQ8A 4R3DA 1GHCA 3VK8A 1TT0A 2V1DA 3ILKA 5FLMJ 3M1CA 2FH0A 1IRFA 1K6OA 2PLYA 2LVNC 5FLVA 2CRGA 3ZQ7A 2Y2ZA 2LK2A 2M60A 2QVOA 4II2A 1LPQA 3O2PE 4CSWA 3ZQHA 2MLGA 3VK7A 2EV0A 1S6LA 5ITQA 1AUAA 2Z33A 4I2OA 3FYDA 3MHVC 1GUUA 2MYSA 4OAZA 3I4PA 3KOWE 5L3BA 1VQPI 3NWTA 4JI6M 5LFAA 2KPMA 4QIWN 4MTEA 1VQOI 3L27A 1KSFX 4IPAA 4M3BA 4I76A 3HTUA 2LDUA 3HG9A 3ZH9B 3L2CA 2AS5F 2WV0A 2R7TA 4DV7M 4L5IA 1IY1A 3FRIA 4JV5M 2FBKA 4RAFA 2VJ4A 3I71A 3FUVA 5JHUA 5EGOB 3SAWA 5JR3A 1LUJB 3L2RA 2E5LM 2QQBA 1EE8A 2NOGA 2KIMA 1LDJA 3T38A 5DEQA 1YFHA 3BBZA 4LLGF 3HKZA 3GLFB 2ZNYA 1XMOM 1R4NB 2G3QA 3L28A 2GIZA 3CTWB 1Z7UA 2L4AA 3BJOA 4LGYA 1I50J 3S3MA 1FBQA 1QVTA 1AWCA 4P9UA 1XPXA 3KOZE 5IZ7D 2DWNA 1MBGA 5IWAM 2QBYB 2L7MP 5EYRA 4A6EA 5M5WJ 3IRQA 2EIMH 2RGHA 1DP3A 3EIEA 1SMYF 4E7KA 2A5WA 4A69C 2GIVA 4YG2F 3AG1H 2Y20A 1UELB 1IN6A 2QUFA 1IN8A 1XB2B 4N4OB 1WZ2A 3MJ5A 3H5NA 2K3PA 4CZZA 4MH0E 1LVAA 2XAJA 1WJEA 1WQ2A 4CICA 1IG7A 1WJ7A 4II3A 4WXCA 2BVLA 2Y75A 1YJNI 1SVOA 4HX4A 4XICA 3KOXE 3GLHE 4MQ9F 1XGMA 3U5ZA 4MGIE 3CQZJ 3DEWA 4CCJA 2DK8A 4XL9A 3GP1A 2R7WA 1JR3D 3HGYA 3GLFE 5TJJA 1MMDA 3GTKJ 1JT0A 3GVAA 3GFMA 2JK3A 1T6OA 1HJPA 2UUCM 3KX2A 3QPLA 3G4SI 3H9QA 2MSYA 3K4LA 5KVRA 2ZJPF 4HLQA 4S04A 3CF5F 1HLVA 1H8AC 2IT0A 5HLIA 4CJ6A 3AJIB 3PUFA 1D0KA 2VC1A 3GRYA 1ETOA 3GPXA 2JUGA 4KN7X 3QRFF 4G3OA 4G4RA 3HGGA 2RQQA 1J75A 3H4JA 2FJ1A 4KYWA 1PJQA 3DU6A 5BPVA 1AHDP 2RV8A 3TBIA 4BBRJ 3EUKL 4RAGA 1UM8A 1EKEA 2BNKA 4D0PA 1HDDC 3S2WA 2M34A 2R7ZJ 4A3KJ 2GWRA 3A98B 1R22A 1R4MB 3RJPA 5IT3A 1GVDA 5D5UB 1X1AA 1TTEA 4B7GA 3MZHA 1MBJA 3SFIA 1D5YA 2X6YA 3PJRA 1GO5A 5JVTA 4WF2A 3BQYA 3C58A 1HKQA 1F43A 4V2GA 4WXDA 3K9OA 1SAUA 3ASOH 3HOUJ 2WADA 2LKXA 3OSFA 2VQGA 2GXGA 3WE2A 2VBZA 4IBBA 2XPWA 2Z5UA 4KLNA 1UFMA 4IQJA 2OZUA 2XKOA 3WTTC 3KP2A 3WU0A 1LQ1A 2ZBKB 5E6JA 1IO2A 4U87A 2HGCA 4OW0A 2KIQA 2OQ4A 1XMXA 5IP9J 3RGPA 1TWHJ 3SHFA 3HC7A 2GXAA 3BR0A 1G4DA 1RKWA 1FEXA 2K6BA 2KRFA 4CDGA 2DI0A 4DV1M 4NNJA 2QSFX 2OOAA 5KPZA 2IW5A 2PBIA 4NRWA 3LA2A 1TWGJ 3U6DA 1RZ4A 2BXYA 2ME0A 4A3FJ 3F8NA 2EJSA 2HHHM 1W36D 5ICEA 4BBAA 4IBEA 5CVIA 1IN5A 4Y13A 2CO5A 1KYZA 3DF8A 3L25A 3BR6A 3CCSI 4E7JA 2DAIA 2QQAA 2VBWA 2JZYA 5J3LA 1NJFA 3UZUA 5BMZA 3ZMVA 1QGPA 1FJGM 3PNTA 1WXQA 2O7OA 4LF4M 2LOOA 1RKTA 2KRCA 2WTEA 2XSDC 2MW8A 2ZXHA 2G7UA 1IDYA 4EATA 2NAZA 2LMDA 3FUXA 1QYRA 1MSEC 2LBCA 2LTUA 2XH9A 4LZZA 1IV6A 1TQIA 4KN4X 1JKOC 5J8CA 3KS8A 4XQFA 4F7ZA 1A5TA 1BVSA 3OL4A 1JKRC 2B63J 4D82A 3ONQA 1BC7C 1O7FA 4LJ5A 1X4PA 2WAQA 4PCQA 1X3ZB 3Q5FA 1WJCA 4BBSJ 2K86A 3IUOA 1EJ9A 4CYCB 4XONA 4UUSB 2LR8A 2J5YA 4DV2M 4GKJM 2Y21A 3BQZA 3VPRA 4XLPF 2LLKA 1WH5A 5FD5A 3K9PA 2ZJQF 1MDMA 2BY1A 2DA6A 2DK5A 3BCAA 4UNOA 1WJDA 4U0VA 4KMUX 1ZG5A 4HG2A 4LG0B 3I9V2 4ZDPA 2EIJH 4L8RC 3UJNA 1G2HA 3DEEA 2ZMEA 5B66C 4AD9A 3ZXSA 1HSTA 4M3DA 2CHQA 1XG1A 1QHGA 5L3EA 2VQFM 3U6CA 2E5NA 4PJLA 5GPAA 5L3DA 4F52A 4GH9A 3OWTA 4MQVA 3LAJA 2BOLA 2OC6A 3OOPA 2NVQJ 5L3GA 5IYBJ 3T1YM 2JA8J 2ECBA 3OIPA 1DU0A 1WJAA 4BQOA 1Z7LA 3A0BC 1P2FA 3GLGA 2VOOA 4M6VA 1A6IA 1T6SA 1QZEA 4IJFA 3OS1A 1SD5A 1KU7A 1OFHA 5B5EC 3RTRA 3SBJA 1EA3A 4A3EJ 3HUGA 2ZFWA 2F4IA 4AYBN 3DZDA 3FHNA 1ETXA 3CF0A 4ZYDA 2QGUA 3DP7A 1F5TA 4FWDA 4L5JA 2IJLA 2Z8YM 1ZG1A 2M5ZA 4C2MJ 4XK8F 1EH7A 3A01B 3OR2C 3FUWA 4R71A 1YITI 4GC9A 1JJ8C 3TMOA 3PUBA 1Z77A 3WTWC 3SJMA 1PJIA 3D1NI 3VKHA 1VEGA 2QSGX 1WKMA 3KP0E 3FHZA 1Z1DA 1JUSA 2DT5A 2JN6A 3THGA 2MFZA 4CHUA 2E35A 4X64M 1NG7A 1N77A 1U2WA 3KZIC 2ZO4A 1DGHB 3OYHA 3U6SA 5GPCA 1RESA 2XB0X 5FO5A 3JRFA 2CP8A 1PRBA 2VDBB 2IS1A 1XNRM 1IN7A 4QHTA 1S8NA 3PO2J 4HBLA 5FRNA 3H35A 3OR1C 1QUSA 1OKRA 3QWLA 2Z3XA 2XC7A 1MX0A 2F5PA 4GIPA 1REPC 4BNCA 2UUAM 4BLCA 3GZNB 1D0YA 5D4SA 3VYRB 2XSZA 1X19A 2QENA 2VBXA 1D0LA 3GPYA 3A42A 1R58A 4ESBA 1SAXA 2CRUA 1KYIA 1SFXA 3W6KB 5D8KB 3BT9A 1L1ZA 3S17J 2CSOA 3LSKA 2WSEF 2O8XA 3KEYA 5GTHC 5IOYA 2WZJA 2QZ4A 4QSHA 4G6QA 1N32M 2OD5A 1XN7A 4DBRA 3E97A 4DNCA 1A6QA 1PP7U 4C3JJ 2VT3A 2DODA 2EIKH 4M6YA 2IBDA 2CUFA 1OQYA 2WB1A 1F1ZA 3PIOF 2A68F 4HV5A 1WH7A 4BGDA 1D8JA 2K47A 4QOZC 1UHMA 3K10A 4D5CA 1XXHB 2VXDA 5EGOA 3GTPJ 4YHHM 2IA2A 1VQMI 1K82A 3DXJF 3HB9A 1YUBA 4KIBA 4I99C 1ON2A 3BCBA 3ERED 2CWEA 2XRNA 2E19A 2RQPA 2DYRH 2X6WA 4ENNA 1OISA 1K7AA 3SQNA 4NSOB 3WTVC 3W68A 2Z3YA 4LRSA 3VDXA 4BY1J 3LSRA 1T56A 2PFBA 4LF7M 2EKFA 1OCTC 3I4MJ 1MMNA 3TP3A 3VODA 3CMAI 2QQ8A 4LF8M 3DPTA 3QAHA 1FP1D 3TE6A 3M4OJ 2E1MB 3L2QA 3CJQB 3DOAA 2UUBM 2XGCA 2MH9A 1JR3A 4HYEA 2YSRA 3LAPA 1RIOH 2R45A 2ETHA 1RETA 1QDRA 4A3CJ 2DI3A 4OX9M 4PZJA 2CQNA 3S32A 2B0LA 5JVGF 3QYBA 2CU7A 4Y15A 5LGUA 4MO7A 3H0DA 1W4MA 3SYLA 2HQRA 3AV0A 4L15A 1XXHA 2ELKA 4G8XA 1DV0A 5B1AH 4HQMA 2YU3A 2NVUB 4MLOA 3CF6E 3TL4X 1RRJA 3LQQA 2ISYA 5DYMA 5FLXK 2J5PA 4DZJA 1XGNA 2EFQA 2HI3A 1WFXA 3MMYB 3T6PA 4RLQA 4UV8A 3ESWB 4G9YA 4HNTA 1IUYA 2LHGA 2JY6B 2HYFA 5B3SH 1FMVA 1USSA 2RNGA 4XKCA 1ZLKA 3TW6A 2KNVA 3DPUA 1NK3P 3HHZA 2X1DA 4WWCA 2NS8A 2BWEA 3C2GA 2JA7J 5FJ8J 2H8WA 1QZMA 4ENMA 3PNYA 2YPRA 1V5GA 3T5XA 1WWXA 5CQEA 4YIIA 2UU9M 1JGSA 1P4XA 3P7NA 3JCUC 2L09A 4UV9A 5C3EJ 2BJWA 1V34A 3FMSA 2JJ7A 2GLOA 2KJCA 2H5XA 2FE8A 3FBNB 2BWBA 5CJ9A 2NRAC 4PD2A 4PDKA 2O61A 4E6KG 5J1UA 1NG6A 4DV4M 2JVHA 3FUTA 4FCWA 1ZGJA 3KEQA 4HF2A 2IP2A 3E5UA 3VWBA 3GTQJ 4ZDLA 4FX0A 4PJJA 1T38A 2F4VM 5GADJ 1YQAA 5IT9S 1KU2A 1Q1VA 2KT0A 3FTCA 3Q3SA 3HOZJ 2UZKA 2FE3A 4FD2A 4BXFA 3BZKA 4BHCA 3ZPLA 2R0QC 5C4JJ 3FK6A 2DZLA 4ANRA 5E8IA 2A05A 2W57A 2O9LA 4IHVA 1FC3A 4M0WA 3JR4A 2EJRA 3CP2A 4OAYA 2IPQX 3GLHB 2M7AA 2RN7A 5F3WA 3K92A 2OPFA 3RKWA 4O5VA 1IXCA 1WJ5A 2MLKA 3PQKA 1Z6RA 2E2JJ 1DGFA 4IO9F 4LMYA 5FTKA 1SXJC 3CC7I 4M73A 1S5LC 1UHWA 2ZFUA 3V42A 4E4HA 5ILUA 1JUPA 1ODDA 1VQ5I 2HTJA 3CCVI 1BA5A 4FTHA 3RE8A 4CGZA 2R44A 1T33A 3NWSA 4JI0M 3BTIA 3VYSB 2NOJB 2RDPA 3E9SA 3HL2A 4FX4A 3ZN0A 1SANA 3KYLA 5K7HA 5E1ZB 2V1XA 2E60A 5KQ8A 1JGGA 4IKFA 1IRZA 2WWYA 1J09A 1NHAA 2XF5A 4KO8A 3M8JA 5IYCJ 5L8RF 2W00A 1XCVA 5A2QK 4YY3M 4EMSA 4JBAA 2KIFA 3S93A 4LOCA 3W3CA 3LL7A 3U5ZB 4FISA 2OQGA 1GL6A 3C18A 2LH0A 3NAUA 1SXJE 1IAWA 1XMKA 1PJSA 5EXXA 4E7IA 3GZ5A 1ORYB 3KZZA 1C0WA 4HRIA 3LW5F 1VQLI 1UG0A 3OS2A 2VODA 1EV7A 3W67A 2JPBA 3B6AA 1E32A 2ZAMA 5LMNM 2DFIA 3WTYC 2ZJRF 2O25A 2V6CA 4MGRA 1BJAA 4Y17A 5ILVA 1IXSB 3M0EA 4J01A 2R6FA 1OMIA 2R4EA 2A69F 4QPQA 1N75A 2K85A 5F04A 2LWXA 1JT6A 2EBIA 3I3LA 3MKWB 3HBLA 5KPRA 4LJ7A 1UB9A 4DQ2A 4M6XA 2CUZA 1VDLA 4DBGB 2F5EA 3M1EA 1RR7A 3OOUA 3WTXC 1DPRA 2O0YA 4I6ZA 1VQKI 4UY8I 4CGYB 4FCTA 2OBPA 5KAFC 1YRNA 4Y3OA 3V7CA 2PMUA 2W4SA 1OFCX 1IXZA 1D2NA 4P1WA 3SFZA 1BI0A 1K4SA 3L2VA 3AOGA 4D81A 2LKSA 3OYJA 1ZN2A 4MB7A 3BPVA 2M5WA 3FMQA 3TOAA 1YX5A 4AVZA 4UXNA 1V33A 3J27B 1N33M 2YR2A 3LSPA 4LRTA 2L9SA 4FE7A 3ZGKA 1Q39A 2NNYA 2R65A 1YW8A 3GTOJ 4S05A 1PP8F 1L2CA 1F4IA 2VC0A 5F1JA 2DDAA 1TWCJ 2K4JA 2PX9A 3X2QH 1O3SA 3O8HA 1QAQA 2DMUA 2X49A 2VF7A 1SD7A 2X6XA 3W0FA 3IL2A 1NH3A 3BC8A 1MSFC 3PVSA 3HOSA 2L5QA 4P5OA 5CPRB 5KHDA 4XN0A 4AZFA 4FETA 3T0YA 3CC2I 4DJAA 2NVTJ 2DA7A 2OTLI 2KZGA 2E7XA 2JY7A 4O6JA 4EV0A 3FE3A 1P4AA 4L0YB 2Y0QA 2JRTA 1QU3A 4M3GA 1LB2A 5M3MJ 4LG0A 1QPMA 4D5FA 2DKLA 5J4VA 1K83J 2M9HA 5JHFA 1JJ6C 4EM1A 4KNYA 3HOWJ 1Z05A 2I7PA 1GXQA 2P5KA 4P96A 5IT9K 3IH2A 3V8LA 1ZRFA 5ED4A 1Y39A 1R49A 3BR3A 3U6EA 2P81A 3ZQCA 2F6CA 4FQGA 4NC6A 4G4OA 3QP5A 2LY1A 2IGKA 2DAGA 1FWZA 3KETA 3PFIA 3OYMA 2QQ9A 2JWTA 2W25A 2UUZA 3S14J 2EO2A 5IP6A 4M9SA 2R7QA 4RBOA 2LG4A 1U78A 1WGLA 3SATA 1KYWA 4A3BJ 4AIHA 3I01M 5C1BA 2LP0A 2ME6A 1VZ0A 4NQWA 1HNXM 3C7JA 2XSJC 3U2RA 5HDKA 4FT8A 2KZSA 2IA0A 3FRHA 1UCRA 2KP6A 2ZXWH 3OYKA 2DJIA 3R0AA 4PJMA 3I4YA 1ZKGA 3IH4A 4A0ZA 4IIWA 2CGPA 3CMEI 3A46A 5JLWA 3IAM2 4OIRF 2MBFA 2K3FA 1BOBA 2Z9OA 2HOTA 2DW4A 3I59A 3E6CC 1FZPB 2C9OA 1U6GA 4LLNA 4JI2M 1R4GA 2DAOA 1E3HA 1XMAA 2DMQA 2GOXB 2RAEA 1OCCH 2IS6A 3G6EI 3GEZA 2L4MA 2NS7A 5DS9A 4LY6A 1JI8A 1OR7C 3IAS2 1OJLA 3C3EA 5KO3A 4Y52J 1VQ1A 1U3EM 4AQYM 1TTYA 2XROA 1L1TA 4ZH4F 3RZDJ 3EIHA 1GT0C 3I5UA 1RR8C 4YELA 2F5QA 4B3AA 2CUEA 2DTZA 4ESFA 5H2FC 2AHQA 1DGBA 3E3VA 3RIRA 2ZTDA 2HOEA 2WY7Q 2EQRA 4PSWA 3H4MA 4A0XA 4XOPA 1QHHD 4YEJA 2DT6A 5F08A 1R1UA 4EQQA 4B47A 4AKGA 5D5VB 1ZYRF 4HEOA 2Q2EB 2KXEA 4FWGA 4Z6YA 2L7ZA 3Q8XA 2VL8A 3F21A 1G3TA 3BOSA 3ECOA 3IH3A 5CVJA 2M2EA 4IL6C 1VEKA 3EUHA 4E7ZA 3M8EA 3HGIA 3O3KA 1X58A 3I59B 2DXIA 1X1PA 2XVCA 4I81A 2F5DA 3A4CA 2DWZB 2MH2A 3H5RA 4PFOA 1BM9A 4KICA 1IZ1A 4BJ5C 2OCCH 4WX9A 2L01A 2M30A 3UKGA 1TH4A 1Z6TA 2JY5A 1UHSA 2HFHA 1I27A 4L16A 1S3JA 1YX3A 3KS4A 2PMHA 1E94E 1O3RA 4KIFA 2NXNB 3L26A 4UB8C 3F9KA 3F0CA 5DUIA 4KISA 3RZOJ 4M0DA 2LREA 4RNAA 4KITB 4GC5A 4MEXF 4KIGA 1ENHA 3KPHA 1ZARA 3QPSA 2A5YB 2RGOA 3GBGA 5FSWA 4X0GA 3NRVA 1D0XA 4QOSA 1OAIA 1X3WB 4NXNM 2C99A 4MTDA 4MGHA 3K2AA 4EM0B 2R4JA 5EP2A 1WGNA 3HKPA 4B3MM 4DV3M 4XOTA 4GYIA 3EETA 4XM3A 4B3SM 2C6YA 3GMEA 4UVCA 4EJWA 2CMPA 4F55A 2OAZA 5LEJA 3RKXA 2VIIA 3IHPA 2QEXI 1TZLA 3H0GJ 1VQNI 1K3WA 3GFJA 1E9SA 2HOSA 1VQ6I 4ASNA 2GZWA 2W24A 5LRSA 2JXNA 1TT5B 4D7MA 3HIFA 1G8XA 4XKVA 2UXNA 1STZA 2DYSH 1Z59A 1S7OA 1E3OC 2OU2A 4HDUA 1IQPA 2DWMA 5TISC 1DDNA 4G7HF 4KMFA 1ZAOA 1ZG3A 1AOYA 1UG2A 1VI0A 5ITXA 3GW2A 3MD2A 3J81Z 4G6TB 3CLOA 4QHSA 2DFEA 4W1UA 4GKKM 2BZTA 3MN2A 3P5JA 4YFNF 4F92B 3S2HJ 2FUG2 1YYVA 1ZLJA 5K7ZA 1N36M 3I54A 5JI2E 5FTNA 2A61A 4HQEA 1W5CC 3WHBA 2PJRB 1R7RA 3DKYA 2QHOB 1XSXA 2H6CA 3RQIA 1FNNA 3IG8A 4M3EA 1UAAA 3GO5A 3G71I 4BACA 2Z4SA 3MKLA 4NQWB 3Q9SA 2EUCA 3K8ZA 4DR3M 4AIDA 1TH2A 1MKMA 3DFZA 1T0FC 3F8FA 3HOYJ 2ZKZA 4DGWB 4ABZA 1MD0A 5K5RA 2Z2SB 4CHTB 1XWIA 2L4EA 4L6V6 3EQLF 1R23A 3RGSA 3ELKA 3D5LA 4OMYA 4XLAA 4WCGA 2W48A 3R8FA 2FRHA 4XNFA 4FWHA 3DLAA 4TV7A 3L2UA 2JUJA 2JSCA 1RU3A 1TNTA 3OYLA 1HBXG 4ZTJA 1FX7A 2WC2A 2XFTA 1ZQ9A 3HX3A 3BZCA 3OIQA 2PEXA 2QWWA 3VDUA 2N8GA 5FRMA 2VT2A 5FTMA 5ICGA 4X65M 1V5FA 3O6BB 1JHFA 2EPFA 1NV8A 4CA0A 1EIJA 2DTRA 5FKMA 2V9PA 3L7WA 3FZVA 5EG0A 1TC3C 2JY8A 1MJAA 5IYDJ 1VFCA 1I4WA 1VTNC 1ORKA 4AM3A 3WE3A 2YR0A 1H89C 2TDXA 3UR3C 3IWFA 1SG9A 2KZUA 3T1HM 3DTIA 4LJ6A 3TO6A 4NBQA 4ZYEA 1R2YA 2XFSA 2L2OA 4AW4A 2V6ZM 5LHGA 1EH8A 2MJ5B 3QU3A 3MQ0A 5DM7F 4GXOA 1NHGC 4IBKA 3QPTA 4L78A 3U21A 1UFZA 3W6JB 4JI3M 1FBSA 4PDGA 4RDUA 4XKWA 2YS9A 1ZREA 5CVRA 4XBFA 3LFUA 1MNEA 2R7SA 3WU2C 5DD4A 2X48A 5C4XJ 5IT9Z 1VQ7I 4UN2B 4IBDA 2DA5A 2ZBKA 2KIUA 4A12A 4DV0M 1WGXA 5E1XA 1MBFA 3GPUA 2AO9A 4XSZF 3GLHA 4PDIA 4V2FA 4M9XA 5H20A 1YRNB 1Y0UA 4GGGA 4ZPXA 3H3ZA 3SMSA 1N34M 2DBBA 1EH6A 2ELJA 5KPTA 1Y8QB 1LNWA 3NEUA 4BE2A 3HDDA 1QDTA 3E21A 3RSNA 1QANA 3E4RA 4XN3A 3K4BA 2KZVA 4ANJA 1JXSA 3LWFA 4HOBA 3SDGA 3RYRA 2DMNA 3ML6A 3GZ6A 1O3QA 2VN2A 2VB6A 2KRHA 2Z99A 2ZJ2A 2VKEA 3IRRA 4B48A 2EWNA 2FX0A 1C7YA 1J5EM 1IY0A 3HRSA 1DGWY 3NARA 3KOYE 2VUMJ 1J2XA 2GQFA 2J7NA 3J7ZI 4ZYAA 3VB2A 5J47A 4BXXJ 3HXLA 2P5LC 3SYKA 2D7HA 2HS5A 3ZR8X 4C2TA 3HRUA 4BKXA 3K70D 1Z3XA 2IGOA 3BR1A 5ICCA 1J59A 4B3TM 2DNAA 2DO7A 1FOWA 4KFCA 3E46A 1XHBA 2DENA 4L9TA 3KE2A 3OS0A 3Q0WA 3I55I 2E1CA 3Q0UA 1T3TA 2OO9A 5AIPA 3OYEA 2F5CA 3E5QA 4RM2A 1RUNA 4L4UA 1B9NA 2BY0A 5CVUA 2C98A 3U60B 4DBQA 1B8IA 5J40A 4Q5SF 4IEJA 4IRHA 4CCLA 2FQ4A 1MNDA 4CH7A 5F0CA 5K5QA 3J7AY 2CE7A 1R6RA 2AQFA 4U88A 2IS2A 2ZNZA 5KK1A 2KRKA 4OIPF 4AIJA 3E7LA 1ZRCA 2HVSA 4ZYGA 1SFEA 2Y69H 3CUOA 1ON1A 5JFRA 4A3DJ 4IHTA 1D1BA 3L9FA 2F4MB 2L9RA 2OCEA 3D5RC 5B1BH 2PJPA 2EV5A 1S7EA 2HWVA 4LB6B 3CD6I 4M74A 5FFZA 2CQXA 1DO0A 4IBGA 5F0FA 4RB3C 1MBKA 1JTYA 4FCYA 3QU6A 5FB2A 2EINH 1BIBA 4I02A 3H9JA 1I6HJ 2HKJA 5ITUA 1BI1A 3FM3A 3C9PA 2PN6A 2Q1ZB 4HZFA 1LE8A 2HAKA 1DQUA 1MZBA 3FM5A 1V5EA 3D8BA 3OYNA 3FYCA 2D5VA 5HDGA 2KNZA 3HSEA 2B9SA 3LVVA 4LF5M 1F9NA 3ERMA 2R93J 1OCZH 3KLOA 1XSDA 2H8RA 1R2ZA 3RQ4A 2EILH 3V8JA 4BXUA 4ZZDA 4A5MA 4JOMA 2C9CA 1D0MA 1BW6A 1P7IA 1U5TB 1XTAA 1OYYA 5EXTA
chains in the Genus database with same CATH topology
1OQYA 1DO2A 1OAIA 1WJ7A 1X3WB 4F1IA 2DHYA 2KHHA 1UFZA 3GLHE 1WGNA 2RRUA 4WP2A 1P3QQ 2DAKA 1ZMUA 2JNHA 2DAGA 1G4AE 3K9PA 3GLFE 4UN2B 2QNJA 3MMPA 1T6OA 1WGLA 1HJPA 1WR1B 1VG5A 5DFLA 3IHPA 3B89A 4Q7JA 2EKFA 3FRHA 3E21A 4G3OA 1HQYE 3H4JA 2DAMA 1OKSA 2MGWA 1OTRA 2QSHX 2JZ0A 2DAEA 1XXHE 2L4FA 1MN3A 1WHCA 1TTEA 2K9DA 1IM2A 1Q02A 1C7YA 1GO5A 2KNAA 1QZEA 2O25A 1R4GA 2MROB 1IXSA 1ZV1A 1PGYA 3K9OA 1TP4A 2LVNC 2JZ1A 1DV0A 1V92A 5JI2E 1CUKA 3LCUA 2DNAA 4F2LA 3GLGE 2QHOB 2LVQD 2DENA 3E46A 1TR8A 1VQ1A 1VDLA 4DBGB 1ZMWA 2OO9A 3IECA 4R71A 4YIRX 3T6PA 3ESWB 1VEJA 1VEGA 2JY6B 2B3TA 2QSGX 2LVOC 1T43A 2KNVA 2ZTDA 2BWEA 1ZMVA 1HT1E 2OOBA 2L4EA 1JR3E 1YLAA 2DI0A 2R0IA 3FRIA 2QSFX 2OOAA 4HEOA 2CP8A 1PVEA 2F4OB 1G41A 2H5XA 1G3IA 2BWBA 2F4MB 2EJSA 2L2DA 1VEKA 2JUJA 1Y8GA 1F4IA 2MR9A 3BBZA 3LCVB 1DO0A 2CWBA 2DAIA 2ZTCA 2G3QA 2K0BX 2HWJA 1IFYA 3F92A 1NV8A 2JY5A 1KYIA 2HAKA 2JY8A 1E94E 2LVPC 4GEWA 2JP7A 3GLIE 2DZLA 2KNZA 2JY7A 2LBCA 2LTUA 2EKKA 3FE3A 2WZJA 1SG9A 1A5TA 1BVSA 1WIVA 1EFUB 1XB2B 2LVAA 2DKLA 1AIPC 1NV9A 1HT2E 1X3ZB 2MJ5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQY A;  1DO2 A;  1OAI A;  1WJ7 A;  1X3W B;  4F1I A;  2DHY A;  2KHH A;  1UFZ A;  3GLH E;  1WGN A;  2RRU A;  4WP2 A;  1P3Q Q;  2DAK A;  1ZMU A;  2JNH A;  2DAG A;  1G4A E;  3K9P A;  3GLF E;  4UN2 B;  2QNJ A;  3MMP A;  1T6O A;  1WGL A;  1HJP A;  1WR1 B;  1VG5 A;  5DFL A;  3IHP A;  3B89 A;  4Q7J A;  2EKF A;  3FRH A;  3E21 A;  4G3O A;  1HQY E;  3H4J A;  2DAM A;  1OKS A;  2MGW A;  1OTR A;  2QSH X;  2JZ0 A;  2DAE A;  1XXH E;  2L4F A;  1MN3 A;  1WHC A;  1TTE A;  2K9D A;  1IM2 A;  1Q02 A;  1C7Y A;  1GO5 A;  2KNA A;  1QZE A;  2O25 A;  1R4G A;  2MRO B;  1IXS A;  1ZV1 A;  1PGY A;  3K9O A;  1TP4 A;  2LVN C;  2JZ1 A;  1DV0 A;  1V92 A;  5JI2 E;  1CUK A;  3LCU A;  2DNA A;  4F2L A;  3GLG E;  2QHO B;  2LVQ D;  2DEN A;  3E46 A;  1TR8 A;  1VQ1 A;  1VDL A;  4DBG B;  1ZMW A;  2OO9 A;  3IEC A;  4R71 A;  4YIR X;  3T6P A;  3ESW B;  1VEJ A;  1VEG A;  2JY6 B;  2B3T A;  2QSG X;  2LVO C;  1T43 A;  2KNV A;  2ZTD A;  2BWE A;  1ZMV A;  1HT1 E;  2OOB A;  2L4E A;  1JR3 E;  1YLA A;  2DI0 A;  2R0I A;  3FRI A;  2QSF X;  2OOA A;  4HEO A;  2CP8 A;  1PVE A;  2F4O B;  1G41 A;  2H5X A;  1G3I A;  2BWB A;  2F4M B;  2EJS A;  2L2D A;  1VEK A;  2JUJ A;  1Y8G A;  1F4I A;  2MR9 A;  3BBZ A;  3LCV B;  1DO0 A;  2CWB A;  2DAI A;  2ZTC A;  2G3Q A;  2K0B X;  2HWJ A;  1IFY A;  3F92 A;  1NV8 A;  2JY5 A;  1KYI A;  2HAK A;  2JY8 A;  1E94 E;  2LVP C;  4GEW A;  2JP7 A;  3GLI E;  2DZL A;  2KNZ A;  2JY7 A;  2LBC A;  2LTU A;  2EKK A;  3FE3 A;  2WZJ A;  1SG9 A;  1A5T A;  1BVS A;  1WIV A;  1EFU B;  1XB2 B;  2LVA A;  2DKL A;  1AIP C;  1NV9 A;  1HT2 E;  1X3Z B;  2MJ5 B; 
#chains in the Genus database with same CATH topology
 5IP7 J;  3SAV A;  2VXZ A;  2KEB A;  1ZR2 A;  4IHW A;  2GA2 A;  2P6S A;  3TO9 A;  2OF7 A;  2CG4 A;  2YUS A;  1T39 A;  4WP2 A;  3HOX J;  1JTX A;  1P9Q C;  1AKH A;  1U9O A;  3JSO A;  3CCM I;  1L2B A;  1ZGW A;  3LST A;  2BY3 A;  3QOD A;  4I98 B;  3VSK A;  2RGV A;  1YIJ I;  3DA1 A;  3LA7 A;  3JRE A;  3NBI A;  3VSL A;  1KFV A;  2DWL A;  2VQH A;  3U61 A;  2RNJ A;  4JX4 A;  4GIT A;  1HSJ A;  2DQL A;  3IC7 A;  2EZK A;  3G3Z A;  4RM3 A;  5HS8 A;  4XGI A;  2M4G A;  3CCR I;  3O8G A;  3V4G A;  4XRM A;  3U9G A;  3H3U A;  4LZJ A;  4M9Z A;  3RFW A;  2R62 A;  3I64 A;  4OOI A;  1PJJ A;  2STW A;  1R1V A;  3U1K A;  3H92 A;  2BHZ A;  3OYF A;  1SD4 A;  2JZ0 A;  4XRS G;  3I4V A;  4GHA A;  4CIS A;  3UNG C;  1GV5 A;  5DYI A;  1MN3 A;  1BOA A;  3JRD A;  4X1E A;  5DM6 F;  3AG4 H;  3MWM A;  1FSH A;  2XPU A;  5EP1 A;  4HW0 A;  3DLL F;  1FOK A;  1HA8 A;  5KCM A;  1IY2 A;  2MRO B;  1OAO C;  1TLH B;  2FD5 A;  1Y0N A;  4OMZ A;  1ZV1 A;  4RAY A;  2M0M A;  4RF0 A;  5BPI A;  1B6A A;  3TWK A;  2CUJ A;  3BG6 A;  3CCE I;  4F3Q A;  1B8I B;  2JA2 A;  1F36 A;  4BDZ A;  3HHX A;  1V92 A;  1R5L A;  2D45 A;  3FWE A;  3DBH B;  4IOC F;  3GLG E;  3DFG A;  4LJ4 A;  1TWF J;  3U1D A;  2LVQ D;  2Y9Z A;  4X6A J;  3FTE A;  2QP9 X;  2DZO B;  3M7G A;  3CCJ I;  3AOE C;  3CCY A;  4YIR X;  1DGG A;  3COA C;  5AIQ A;  2CV0 A;  2M7B A;  1U9N A;  1QQW A;  3PO3 J;  1IXR C;  1XDU A;  4GCV A;  1FOY A;  4A93 J;  5GKN A;  1QQI A;  5HNF A;  1FJL A;  2X0L A;  2Y0M A;  5HLH A;  3B73 A;  1K79 A;  2JVG A;  3FXL A;  2EV6 A;  1FLI A;  1PVE A;  4DR2 M;  4A6D A;  3HYI A;  4QWQ A;  2EZL A;  1OLT A;  9ANT A;  2V4J C;  5ICF A;  4B08 A;  4W97 A;  5JLX A;  1HW2 A;  3U6P A;  3GLI A;  3BP8 A;  2FU4 A;  1O57 A;  3CTA A;  5EXS A;  5D8L B;  4AWX B;  1Z67 A;  2X4A A;  2JUC A;  4DIQ A;  3SMP A;  2K0B X;  3HRT A;  1Y1W J;  2O8K A;  2HDC A;  1KON A;  3BJA A;  1YG2 A;  1TDZ A;  1LKX A;  1QUT A;  3GO8 A;  2RVC A;  3ABL H;  4AKI A;  4JI4 M;  2G0E A;  2NVY J;  4BQA A;  4QNR A;  2XKP A;  1TL8 A;  5E3M A;  2LVP C;  2HOA A;  2JP7 A;  4PJN A;  3JRG A;  4I09 A;  4AKH A;  4YFX F;  1FIP A;  3HJS A;  2DPU A;  3K1M A;  4GFB A;  1MMA A;  3BTL A;  3MKY B;  4DV5 M;  1BR4 A;  2EZH A;  4JYK A;  2QYO A;  5LGN A;  1MMG A;  2VAS A;  1XDS A;  3LMM A;  3JAM S;  3BOQ A;  3SAR A;  4BL0 B;  4Y4R A;  4RGR A;  1MDM B;  1BI3 A;  1HT2 E;  2JMW A;  5LGT A;  1SFO J;  5FKO A;  1K61 A;  3M9A A;  1Z9C A;  4OIO F;  3S1Q J;  1ACI A;  1WVR A;  2DLL A;  2VQC A;  4MFD A;  5E3O A;  2GBY A;  4RGS A;  3ZOB A;  5J6X A;  2H1L A;  3A2K A;  2EA2 A;  1A36 A;  4UUS A;  2HQ5 A;  2R7U A;  1KZH A;  2DAK A;  3K0L A;  3IG5 A;  2BGC A;  3RI4 A;  2O6G E;  3GUD A;  4BJ6 C;  2JT1 A;  3GQ3 A;  3Q8G A;  3FXM A;  3DKW A;  3QOE A;  2DZN B;  1WI3 A;  4ON0 A;  1WHU A;  1WR1 B;  3J80 Z;  2KKO A;  2KDO A;  3BRO A;  2VJI A;  2HQA A;  3CDL A;  2LF8 A;  1Q3B A;  1QA6 A;  3FTF A;  4NUB A;  4RGU A;  1XMQ M;  2GQQ A;  3S1N J;  5E17 F;  2MGW A;  3FMR A;  3L2W A;  4ZJZ A;  4NC7 A;  2GAU A;  1XCB A;  3KYD B;  1BIA A;  5CYV A;  4RMN A;  2FNA A;  2M8E A;  3K4M A;  4MFE A;  4LJ9 A;  2KDZ A;  3CDH A;  1J5Y A;  4NDL A;  4JI7 M;  2XGN A;  1IM2 A;  1MMS A;  5HS9 A;  2KNA A;  3VFD A;  3GWZ A;  4C2U A;  2EA4 A;  8CAT A;  1BW5 A;  1GLN A;  4XLN F;  2G8L A;  2K7L A;  1TP4 A;  3KVW A;  2X6O A;  2W1O A;  4DUY M;  2R7D A;  4F91 B;  5J4Y A;  2ISZ A;  1FYK A;  2CW8 A;  1SVL A;  5BNG A;  1I1S A;  4TUW A;  2EZI A;  3GTL J;  3CO6 C;  1BR2 A;  2ZAN A;  4P9F A;  3K2Z A;  2XF3 A;  3V8K A;  5M5X J;  3PQJ A;  5K5O A;  1U0J A;  4XRF A;  4L9V A;  3H9G A;  1GJT A;  1S72 I;  2JWS A;  3ABK H;  1ERD A;  1VEJ A;  4EIW A;  1WRJ A;  4LK0 F;  3KYC B;  1T43 A;  3NBX X;  3N4M A;  1BL0 A;  3S8P A;  1IN4 A;  2KQR A;  2ZCW A;  1N78 A;  5CQG A;  4UUT A;  2VPR A;  2FS1 A;  3HPH A;  1A5J A;  2UV1 A;  2Z7J A;  2PI0 A;  6PAX A;  1L3L A;  1HQC A;  1P7J A;  3G2B A;  1YSY A;  3GRR A;  5FTJ A;  1O7L A;  1R1T A;  1K3X A;  2ADU A;  3IP4 B;  4AIK A;  2K9M A;  1PJR A;  4MGK E;  3D5S C;  4EVI A;  1V4R A;  3K1J A;  2FXA A;  2M3A A;  3FXO A;  2R5Z B;  2EK5 A;  1VQ9 I;  4A3L J;  2LD5 A;  3EDP A;  4EJV A;  1QAM A;  3U6L A;  2R18 A;  2FNP A;  1QPI A;  4HX8 A;  3F92 A;  1ETK A;  4HA8 A;  4EGY A;  2ZXJ A;  3QYF A;  1LFB A;  1D3Y A;  2ZME B;  1ONV A;  1GXP A;  3PL8 A;  3GQ5 A;  4PGG A;  3GCM A;  2ESN A;  4LG3 A;  4HDV A;  3BJ6 A;  4IJE A;  4CZC A;  3M07 A;  5EF6 A;  4XK4 A;  2CHG A;  1TH3 A;  2JQ7 A;  2EFO A;  3OY9 A;  2W7N A;  1GV2 A;  4L0Z B;  3MKZ A;  3K2L A;  3DU5 A;  1OIP A;  1Z5A A;  2JRM A;  3SYT A;  2EFW A;  4LG2 A;  2LVA A;  2I8D A;  3NWL A;  1PJT A;  5LLQ A;  3F8B A;  2DU9 A;  4BAY A;  2R7X A;  1LEB A;  2XAF A;  1YS7 A;  1DGR M;  1YHQ I;  4YRV A;  1HW5 A;  2KFD A;  4DR4 M;  2WB1 N;  1W1W E;  4CYC A;  3DCF A;  2H27 A;  1ETQ A;  3EYY A;  5EQT A;  2LH9 A;  3LSH A;  5LMU M;  1MGT A;  4H0E A;  4KDP A;  1E2X A;  3AAF A;  4LF9 M;  1QO0 D;  2KJB A;  1XNQ M;  5L3F A;  5KNL A;  2W85 A;  5HLT A;  3J81 S;  2HPI A;  4IBF A;  4N4N B;  3ZMD A;  2ZXI A;  2LC2 A;  3MMP A;  4AYB A;  3G1L A;  4BE0 A;  4REZ A;  1D8K A;  2XAG A;  3ZCB B;  4E7H A;  3G1M A;  3AG3 H;  3B89 A;  5EXP A;  4LF6 M;  2DT7 B;  4Q48 A;  2GNO A;  3OL3 A;  4C9Y A;  3JRI A;  1U8B A;  4R79 A;  3CGW A;  4Q7J A;  1BI2 A;  4N0B A;  3KCC A;  1T2K A;  1CF7 A;  2BW3 B;  2Y0S N;  3I04 M;  2TRT A;  4RS8 A;  3C3W A;  3R0J A;  1OKS A;  3BR5 A;  3V7R A;  4G6Z A;  2VKV A;  2E1N A;  1FBU A;  3H36 A;  1A31 A;  2NYX A;  5J8F A;  4BQN A;  3MK6 A;  1X2M A;  2LBF A;  1MNM C;  4BB9 A;  2QKL B;  3HRM A;  5E8G A;  1Q02 A;  2QF7 A;  3LSM A;  3ZQQ A;  4BS9 A;  2AHM A;  5ITT A;  2KIS A;  3ASN H;  5CKT A;  3JSP A;  2R7V A;  1IXS A;  2VJJ A;  4NHJ A;  4WW0 A;  3EUA A;  3JRB A;  2DA1 A;  4EEF G;  2JA5 J;  2JSP A;  2BW3 A;  2UXD M;  4MGZ E;  1R5H A;  5TRD A;  2P7C B;  1Z5C A;  3OYA A;  4CCN A;  1TDH A;  1OCR H;  3CO7 C;  2F2E A;  2XZU A;  2YX4 A;  4XLE A;  2CH0 A;  1XC5 A;  2KA6 B;  2WSF F;  3TDU C;  3KXE C;  3I56 I;  1OPC A;  2Y30 A;  1HT1 E;  1KQ0 A;  4G6D A;  4BEH A;  1RUO A;  3LVW A;  3UMM A;  2YNM D;  1QZY A;  2VE8 A;  2XAS A;  3ZP5 A;  3ABT A;  1DPU A;  3K7A J;  4L5E A;  1X1B A;  2APL A;  2UXB M;  3ROU A;  2QPA A;  1D5V A;  1HDP A;  3TDZ C;  4RF1 A;  2WA0 A;  2F5F A;  1LV7 A;  2ECC A;  4BUP A;  1Y6I A;  1NJG A;  2FOW A;  2K4B A;  1K4T A;  2A6T A;  1UZC A;  5DYG A;  2IVM A;  2L54 A;  4DV6 M;  3GTG J;  2LTP A;  2CWB A;  1SXJ D;  2XAU A;  2BXZ A;  4PGH A;  4JXJ A;  2HWJ A;  1LJ9 A;  2R7F A;  2ESH A;  4PT5 A;  1IFY A;  5BOX A;  2DMT A;  2MC4 A;  5GTI C;  2BE5 F;  3L29 A;  2L7K A;  3M6A A;  2XLJ A;  3I0T A;  4HSR A;  3ZMZ A;  4MNU A;  1V54 H;  3ZQL A;  4XRS A;  2XHK A;  1JKQ C;  3JR9 A;  2DPD A;  5FGM A;  5IRE B;  4YFK F;  4P16 A;  1XGS A;  2Q8K A;  2W84 A;  4CCM A;  2K9L A;  5JI3 E;  1J0R A;  3ECH A;  3QYE A;  1MJB A;  3FTD A;  3TOB A;  4KA4 A;  3HOT A;  4IX7 A;  5HNH A;  3GLG B;  1SEU A;  4X66 M;  3HU1 A;  5FFX A;  3GLF A;  5DDG A;  5J1R A;  4IHS A;  4IVN A;  3J7A O;  3OYB A;  3IWZ A;  3VOE A;  4JI5 M;  1FTT A;  4IBJ A;  3GTM J;  4GHL A;  2CW0 F;  4RGX A;  4CUG A;  1R00 A;  5HOD A;  3E6M A;  1TQM A;  2IS4 A;  4GDF A;  1PYV A;  3SZT A;  4HPQ A;  3U6O A;  5DTD A;  1SMT A;  1E9R A;  1BBY A;  2O3F A;  1G4A E;  4OVZ B;  2P7V B;  2PJR A;  2KL4 A;  4J00 A;  1W7P A;  2HYG D;  3VLF B;  2P8T A;  3GLX A;  3TPZ A;  5ERI A;  4EM2 A;  2A3S A;  1IBL M;  4A0Y A;  1U5T C;  3OSG A;  1T98 A;  3PIP F;  1XSV A;  3HHY A;  4ITQ A;  2DDB A;  2HDD A;  2V9V A;  3C1D A;  2LF7 A;  1ZRD A;  2K02 A;  1YTY A;  4X62 M;  2OV7 A;  2R5Y A;  4GO1 A;  1HQY E;  3F72 A;  3HZJ A;  4UB6 C;  4LGM A;  2X85 A;  3WHL A;  2LKP A;  1HF0 A;  2AQE A;  4GMQ A;  5BR8 M;  1BJZ A;  5H6R A;  4B43 A;  2HKO A;  1WHC A;  1B4A A;  3KP6 A;  1TW3 A;  4OU7 A;  1MH4 A;  4RA2 A;  5FKK A;  2OTJ I;  2HKX A;  1KGS A;  1I94 M;  2GM4 A;  2Y0T A;  4E7L A;  4EJO A;  1VND A;  3CMY A;  1I39 A;  4RB1 A;  1Y56 A;  2H09 A;  1U8R A;  1PGY A;  4BHB A;  1LFU P;  2ZSI B;  2HXI A;  2EFP A;  1X1C A;  3ZN1 A;  2CHV A;  3FD9 A;  5FLX S;  4I01 A;  3LSJ A;  3LCU A;  3VYT B;  3K70 C;  2UWM A;  2GA1 A;  2NNN A;  4XOR A;  4G7Z F;  3IHU A;  3BTJ A;  1IRX A;  3GXO A;  1Z3Y A;  3BLY A;  1IC8 A;  2EB7 A;  3P9I A;  5EEH A;  4WK8 F;  4A3V B;  2AXT C;  4R8H A;  3A02 A;  1O4X A;  1I3Q J;  2H1R A;  2FML A;  4LJA A;  4O3M A;  4CIZ A;  2M1B A;  4CO8 A;  1MBE A;  4BJT A;  2JTV A;  4B44 A;  1NK2 P;  2JA6 J;  2HNH A;  4RB2 C;  3ZMT A;  1Q1H A;  1B9M A;  2R0I A;  2OPT A;  2XAH A;  4B1R A;  2WAQ N;  3WGI A;  2A07 F;  1POG A;  2DJN A;  1ZK8 A;  4HST A;  1P6R A;  4KT5 C;  5K7F A;  1Q3C A;  3DPL C;  2PMZ N;  1PDN C;  2L2D A;  1DP7 P;  4DUZ M;  3W2V A;  1V55 H;  3PSF A;  4D9J A;  2LFB A;  2ZTC A;  1QRY A;  2E71 A;  2V26 A;  1LFP A;  3TWL A;  3FKI J;  2W82 A;  3QPH A;  5KAI C;  4A3J J;  5HLG A;  4KHP M;  5TGT A;  1HKS A;  1YE9 A;  2FQ3 A;  2BEO A;  3SEZ A;  3BDD A;  3TED A;  3HU2 A;  4IBC A;  2X8A A;  2FA5 A;  4HEA 2;  4KOD A;  2EKK A;  2KHM A;  4JQF A;  1TBX A;  2ICW G;  3OYI A;  2WAE A;  3CUQ A;  1FTZ A;  2E5Z A;  4ZC3 A;  1VDD A;  1QZZ A;  2HR3 A;  2BHY A;  3JW4 A;  1VQ4 I;  4N9H A;  3K69 A;  2BV6 A;  2DHY A;  2HYJ A;  3K4C A;  1CGP A;  4HAM A;  4I8O A;  1CQT A;  1AA7 A;  4YIF A;  3UK6 A;  2XB5 A;  1S9H A;  3PSI A;  2L02 A;  2XGX A;  1MH3 A;  2DHR A;  4HX7 A;  1ZMU A;  1JHH A;  2MA3 A;  3PFY A;  2L0K A;  1IDZ A;  1WI9 A;  3PXG A;  2QNJ A;  1WCM J;  3SHG B;  3GFL A;  4Q47 A;  1SFU A;  3TW7 A;  3LOC A;  4W5W A;  3KP5 A;  5BQT A;  4GRI A;  2L7F P;  1T8I A;  2STT A;  4CCO A;  2YU9 J;  1OFI A;  4ZDO A;  4XR6 A;  1LDD A;  3W2A A;  4DR5 M;  2DQR A;  1MJ9 A;  2EA0 A;  2BJV A;  5AON A;  3TKY A;  3MZY A;  2AXL A;  1LE8 B;  4NSR A;  4I0B A;  3JTG A;  1G6N A;  1OYW A;  2O5R A;  4WUR A;  1KA8 A;  3DBL B;  5EP4 A;  1IW7 F;  5GP9 A;  2GOM A;  5HOO A;  4FCV A;  1HR0 M;  2R7R A;  3L2A A;  2XSZ D;  4KT6 A;  1OTR A;  3FXU A;  3RPU A;  5DV5 A;  3KP7 A;  2QA4 I;  2QSH X;  3T15 A;  3D8L A;  1W5T A;  3JAM Z;  5LHH A;  2QCU A;  3F8M A;  1FYM A;  1G3W A;  1G59 A;  2A6H F;  2L4F A;  2DOF A;  3K6G A;  2KMU A;  1TW2 A;  2IRF G;  1W0U A;  5ITR A;  2VPL A;  3S3N A;  3BR2 A;  3ZQG A;  2RKO A;  4QNM A;  3C2H A;  3JR5 A;  2XPV A;  4G4N A;  1KU3 A;  3P9K A;  2CYY A;  3TGN A;  3TO7 A;  2XF7 A;  2XUB A;  5IY5 H;  3KIO A;  3B7Q A;  3FIW A;  1TWA J;  3V76 A;  3ZQJ A;  5D5W B;  2VQE M;  2CV2 A;  7CAT A;  1I5Z A;  2JZ1 A;  1RPW A;  3BG9 A;  5E3L A;  1R71 A;  4P17 A;  2V6E A;  4AC0 A;  4DR7 M;  2ID3 A;  4JP0 A;  5LBQ A;  4OU0 A;  1GJS A;  3DWL E;  3FXQ A;  3BG7 A;  2R3S A;  1FIA A;  3B02 A;  3F8C A;  3VYU B;  3WGG A;  1NY6 A;  1XC8 A;  3J7B A;  1NTC A;  3RDI A;  1YW9 A;  2C96 A;  2B3T A;  3F22 A;  2LVO C;  2EFN A;  1X4O A;  3GLI B;  2DN0 A;  3BZ6 A;  4FE4 A;  5EZH A;  3GTJ J;  1ZMV A;  1JE8 A;  1R6B X;  3BXW A;  4MGY E;  2E1O A;  2L9N A;  1K78 B;  2R46 A;  4MM3 B;  3OTO M;  1KQ9 A;  3F3X A;  1HNZ M;  1I3A A;  5ILS A;  1YLF A;  4IHY A;  2DFF A;  3SEQ A;  4CXF A;  3J80 K;  1Z5B A;  4NOO B;  3P9C A;  3R6S A;  2VE9 A;  1I1G A;  2E36 A;  2L3D A;  3GYH X;  2Y9Y A;  3VKG A;  5M5Y J;  4B7H A;  3K1P A;  3HKZ N;  2VQL A;  3B6C A;  2Q0O A;  4HF1 A;  2X1C A;  3H5A A;  2H1K A;  2VJ5 A;  5F6F A;  2DA3 A;  1FT9 A;  5LHI A;  2L7H A;  1NO1 A;  2COM A;  2V9K A;  5D5X B;  2LXE A;  1JUM A;  2O03 A;  4A5N A;  2MG4 A;  4ENJ A;  5GAH J;  4UHT A;  3CJT B;  1XB4 A;  4HV6 A;  3UGJ A;  1OR7 A;  2HL7 A;  4LK1 F;  5F27 A;  1FYL A;  1IV8 A;  2MAB A;  2P5T A;  2LSO A;  1DU6 A;  1V3F A;  3R4K A;  4QPO A;  2ZME C;  1HNW M;  1EFU B;  2G9W A;  2HVR A;  3I53 A;  4UVA A;  4XLC A;  1NV9 A;  3CJN A;  2LNB A;  1QNT A;  2XIG A;  3A03 A;  4C3H J;  2O01 F;  2CQK A;  3FX3 A;  5LRR A;  4U0Y A;  2RC4 A;  3M8F A;  3DV8 A;  3FXJ A;  3HWS A;  2V1U A;  4I5S A;  2COB A;  5DCM B;  4HLY A;  2OZ6 A;  4ITV A;  1N25 A;  3BG3 A;  3OV8 A;  4M72 A;  3CJR B;  5BPD A;  3S2D J;  3C3D A;  2RRE A;  3ZMS A;  3C2B A;  3ZQF A;  1YO5 C;  3VEP A;  2DMP A;  3U61 B;  1NNJ A;  2QKM B;  3A1Y A;  1EF4 A;  4BY7 J;  3TP0 A;  1WPK A;  4WXH A;  1DUX C;  5E1W A;  3WGH A;  3CZ6 A;  4BU2 A;  3DQV C;  4S12 A;  2M87 A;  1TNS A;  4Z8X A;  5C44 J;  3BY6 A;  3SZG A;  1WJF A;  3T8T A;  3SC3 A;  5C18 A;  1LVK A;  2HZT A;  2L6O A;  2LVS A;  1IUF A;  3LSG A;  1H88 C;  1RC9 A;  4XLH A;  4DW6 A;  1XXH E;  3TQS A;  2PMZ A;  2QM3 A;  4Y33 A;  4CCK A;  3ZC7 B;  3CLQ A;  2P6T A;  4JK1 X;  4DR1 M;  1OCO H;  3Q0V A;  1YOV B;  4DYR A;  2XDV A;  4BEH B;  1FOX A;  3K4K A;  4B8X A;  2NQ8 C;  3CDI A;  3BG5 A;  4G4Q A;  3B7Z A;  1MW7 A;  3FF5 A;  2HDW A;  2P0W A;  3E1S A;  4KJZ A;  1J7K A;  4H4K C;  3D0S A;  2F5O A;  4RLF A;  1CUK A;  1MJG M;  4XBO A;  4F2L A;  1A04 A;  1YW7 A;  2DFH A;  2FMY A;  3HJE A;  4L9J A;  2WY8 Q;  2KLO A;  1W7P B;  1XD7 A;  4IQ4 A;  4J19 A;  1L0O C;  5M3F J;  4XSX F;  2EH3 A;  2IGM A;  2WBM A;  1GDT A;  3CCQ I;  5HVQ C;  2Z1D A;  3FBI B;  2VBY A;  5FTL A;  2VIX A;  3FUU A;  2XZF A;  3KLN A;  4LIU A;  2K40 A;  4BYY A;  4JI1 M;  3SZP A;  1ETV A;  1SVM A;  1R36 A;  4LLL A;  1B1B A;  4AG6 A;  3DEU A;  1YLA A;  3B7N A;  2M45 A;  2F4O B;  3KP3 A;  2K9N A;  5FRO A;  1G41 A;  4LFB M;  5E18 F;  2LBF B;  4PUS A;  2XAQ A;  4E70 A;  4ZYH A;  1QBJ A;  1X1D A;  2X51 A;  3RPU D;  2E34 A;  2V7F A;  4NC8 A;  1Z0X A;  2MR9 A;  2UXX A;  1M1E B;  1WJB A;  1KU9 A;  3B74 A;  2K9Q A;  2OUM A;  4DYQ A;  5D4R A;  1AU7 A;  2UXC M;  4G94 A;  2P5V A;  3H3V K;  2R7O A;  4AI6 A;  4NXM M;  2K27 A;  3BPX A;  1SD6 A;  4BDY A;  4B3X A;  3KP4 A;  1R5G A;  4LCB A;  1UST A;  2D1V A;  2DA4 A;  2ZC2 A;  3CP8 A;  5JI6 A;  5EG0 B;  4GYG A;  1HKT A;  2QZ8 A;  3N05 A;  4C30 A;  2LYC A;  4XKB A;  3SAS A;  2WAF A;  2K9S A;  2ID6 A;  5IPA A;  2I5U A;  4EJT A;  4V19 K;  1YI2 I;  2R92 J;  1TF0 B;  3HM5 A;  3KEO A;  4IJA A;  5L3C A;  1X37 A;  3AG2 H;  2CW7 A;  3MAJ A;  4L18 B;  1JB0 F;  2XEP A;  1AIP C;  3DTK A;  4BE1 A;  2F48 A;  2I10 A;  2PQ8 A;  3Q9V A;  1DO2 A;  4JI8 M;  3AKZ A;  1XX5 A;  4B4C A;  1D1A A;  4EJU A;  3E0J B;  3GX4 X;  4ZTF A;  2ZM6 M;  3S3O A;  1P3Q Q;  3LFK A;  4OIQ F;  1P4W A;  4DR6 M;  2FBH A;  3MEX A;  5ITY A;  1G3S A;  3WG7 H;  2VOP A;  4BH9 A;  1HOM A;  2JNH A;  1AKH B;  2A6E F;  3OYC A;  1S7A A;  2VI6 A;  3HHG A;  2QLZ A;  1Y1V J;  1HW1 A;  2YX7 A;  5D6E A;  4MIM A;  4NB5 A;  3IKT A;  2D7E A;  1SXJ A;  3HTS B;  2N35 A;  1FSE A;  2R4G A;  3OMY A;  4AVP A;  1H6U A;  1PUF A;  5E79 C;  2YQZ A;  2K5C A;  3FDY A;  2BBY A;  3MFK A;  5F0H A;  3HUG B;  2FFJ A;  1YJW I;  1VQ8 I;  1XS9 A;  1JQJ C;  1U5T A;  3RPQ A;  2GXB A;  2OA4 A;  1LEA A;  4PJ0 C;  3WHC A;  5A2Q Z;  2HPM A;  2CJJ A;  4U0W A;  3CMM A;  3RKQ A;  1TQP A;  3GRV A;  2XV4 S;  3CUQ B;  3QOP A;  4G12 A;  4R1H A;  3ZRG A;  1L2D A;  5EDN A;  1FP2 A;  2WSC F;  3JRC A;  2MD0 A;  3R9X B;  2FOI C;  4JYA M;  5FD6 A;  1YIO A;  2FF4 A;  3S15 J;  3K9T A;  1BR1 A;  2L9V A;  2G5G X;  3ULQ B;  1FPQ A;  3VFZ A;  4A3I J;  1E3P A;  4FVM A;  3M3Y J;  1NY5 A;  3JTH A;  1P92 A;  5HS7 A;  4Q4Z F;  4II7 A;  5EJC A;  2WV1 A;  1RI7 A;  1LDK B;  4MHG A;  1G71 A;  2CV1 A;  4A3M J;  2PG4 A;  3F6V A;  4D80 A;  2LY9 A;  4E7S A;  4PSX A;  4B3R M;  4IF4 A;  3QAU A;  3E6D A;  1PUE E;  5H6Q A;  1RNL A;  3S1R J;  4BHP A;  1QAO A;  2X1E A;  2H6B A;  3G1O A;  3SDB A;  1ZMW A;  3LA3 A;  3IEC A;  2IEK A;  4ETS A;  3WHK A;  3SXY A;  4S0H B;  4FW9 A;  4F93 B;  2CFX A;  1S29 A;  2XF6 A;  2D2W A;  2F5S A;  2V1C A;  3HEF A;  1K6Y A;  5LD2 C;  3MZ8 A;  3L00 A;  1GVJ A;  4IRI A;  3MVP A;  3L1P A;  1DGH A;  4IOA F;  1NNU C;  1E0E A;  3AOE A;  1B72 B;  3WU1 B;  3J7A S;  3NQO A;  2BYV E;  3KFW X;  1B72 A;  3FKE A;  1J9I A;  5DCM A;  1W5S A;  4PFP A;  4Z2Y A;  3SAU A;  2HQN A;  1ZQ3 P;  5DNY A;  4JN6 A;  1Y8G A;  3K4N A;  3LSI A;  3MCZ A;  4L9N A;  5FKL A;  3EYI A;  4R7G A;  1GL7 A;  4JX5 A;  3GF2 A;  3RYP A;  3A01 A;  4N9I A;  1YJ9 I;  2J5O A;  4M3F A;  4P55 A;  2E2H J;  3FXK A;  5KQD A;  5J1Y A;  3F6O A;  4NRV A;  1MIJ A;  4JX6 A;  2CS3 A;  3ISP A;  2BY2 A;  3W0L B;  4DOZ A;  4K2E A;  5FKN A;  4HNV A;  2Y48 A;  4MEY F;  3GLI E;  1QVR A;  3CCU I;  5CLS A;  3S1M J;  3T8R A;  3RCO A;  2R5Z A;  5E26 A;  4PCZ A;  3KDS E;  4LIT A;  1HXD A;  2TCT A;  2VKH A;  3QQA A;  4LB5 A;  2CFO A;  3CCL I;  2LHC A;  2ERC A;  1WSU A;  1WIV A;  3WOD F;  2VLA A;  3HHW A;  4LD5 A;  2ZAO A;  3I58 A;  2E2I J;  1R5I D;  4LFC M;  1IF1 A;  3KZY A;  2V79 A;  2R5Y B;  1Z21 A;  2DA2 A;  4B09 A;  5E3N A;  4ESJ A;  2FOK A;  4F1I A;  3WTZ A;  1T08 B;  1HCR A;  2KHH A;  3CES A;  3KFU G;  2IA1 A;  4LIV A;  2RRU A;  3CF2 A;  2VON A;  3WTS C;  1W36 C;  3J80 S;  1NHW C;  5H37 D;  3LQR A;  4HF0 A;  4G7O F;  2H94 A;  1T95 A;  3K4J A;  1FY7 A;  3KSJ A;  4U7D A;  5EP3 A;  2KW0 A;  1UMQ A;  4OVZ A;  4FHT A;  3FXR A;  1O3T A;  3KW6 A;  2F5V A;  1PM5 A;  5A2Q S;  3R60 A;  4KUM A;  2YFQ A;  3E6B A;  1VF9 A;  1TGU A;  1SXJ B;  5GAE J;  3FKJ A;  1VG5 A;  2JPC A;  1ZTR A;  2KRU A;  5DFL A;  5EEG A;  1NSF A;  4LFA M;  4LGW A;  3JRH A;  3B9P A;  3I4N J;  2CEA A;  3DTE A;  1IRG A;  2OQR A;  1BN5 A;  2CQ7 A;  2HU9 A;  2FEZ A;  2MD5 A;  5IOZ A;  1IGN A;  2HVQ A;  3AL0 B;  2M8G X;  2DAM A;  2ZB9 A;  1Z91 A;  3J81 K;  2HEO A;  2VF8 A;  3TWM A;  1MBH A;  1ZGA A;  2OJE D;  2HXO A;  3CC4 I;  2DAE A;  2HZD A;  1GAB A;  3AL0 C;  3DBR B;  2XGD A;  3OIO A;  3IV5 A;  1ZHF A;  2MC3 A;  2K9D A;  4AG5 A;  2I7N A;  3GRU A;  1YS6 A;  1MU5 A;  3HJ8 A;  4HL4 A;  1ZR4 A;  1OYI A;  4IRG A;  4RKU F;  3AFH A;  4ENK A;  1CF7 B;  4IZZ A;  5LEK A;  1ZH5 A;  5DD8 A;  3E5X A;  1APL C;  1BC8 C;  1ZAE A;  4RB0 A;  1K78 A;  1HC8 A;  2MH8 A;  1H9G A;  3WTU C;  3J2P B;  1UJ8 A;  2LRD A;  2CQQ A;  2P4W A;  2XGE A;  4D7N A;  3G73 A;  4UUV A;  3GPP A;  3BTC A;  3W6V A;  3N97 A;  2Y31 A;  1TR8 A;  1G3Y A;  3HU3 A;  5BS6 A;  3ABM H;  2LNH C;  3IKV A;  4Y7N J;  3ABU A;  1ITY A;  3U60 A;  4OIN F;  2Y0S A;  3GLL A;  3ZCO A;  4LJ8 A;  2IGN A;  4IHX A;  2FBI A;  3ZMU A;  2RKH A;  2DOA A;  2OOB A;  3HY5 A;  1H9T A;  5GAG J;  1JR3 E;  3KP1 E;  3PNV A;  4AUX A;  4M71 A;  3HHH A;  4QLC U;  2Q2E A;  3LNQ A;  1IJW C;  1W0T A;  3A45 A;  2D1H A;  1G3I A;  3HSF A;  5EZG A;  2BVM A;  3OYG A;  2FSW A;  1S3S A;  2X9D A;  3R61 A;  4HNU A;  3QP6 A;  4UVB A;  2HCB A;  2MGQ A;  4C3I J;  3RKY A;  3LCV B;  3KSX A;  3I51 A;  3VDP A;  2QCO A;  1I6X A;  1XGO A;  2B7E A;  3T1B A;  2LY2 A;  2Z16 A;  3JRA A;  2G7H A;  1GVN A;  4DYC A;  4I7H A;  2E7W A;  2L7I A;  3JAM K;  4I4L A;  1OIZ A;  2QBY A;  1T0F A;  3BWG A;  4NL4 H;  1C1K A;  1B59 A;  2M0C A;  2HTS A;  3EPZ A;  1GKI A;  4GEW A;  2E1M C;  2IXS A;  3REO A;  3HJQ A;  4KT0 F;  2VKD A;  2XRL A;  3TQN A;  4XLF A;  4U7B A;  1IBM M;  3HSR A;  4IBI A;  1IBK M;  4DZP A;  1W7P D;  4EGZ A;  3U6Q A;  2ZSH B;  1SC7 A;  4AU7 A;  4XID A;  1H0M A;  1A35 A;  4OWR B;  4BQQ A;  1R9T J;  4RAZ A;  1F4K A;  1QVU A;  2M4K A;  3H1C A;  5FLX Z;  3S16 J;  4HLX A;  4LJZ F;  1NVM A;  1X2N A;  4LFU A;  3HPG A;  2F5N A;  1ETY A;  3K1N A;  4PK4 A;  5F1R A;  2DCE A;  2NS0 A;  5D6F A;  1ULY A;  4XMY A;  3J7Y J;  5DUK A;  1D1C A;  2ELH A;  2V1N A;  1LTM A;  4B7F A;  3W2W A;  1L8Q A;  1OCP A;  1R7J A;  3ZQI A;  3GFI A;  1FMW A;  3A0H C;  2X4H A;  4ZZL A;  3DKX A;  1JKP C;  5HDN A;  4I0A A;  2DVW B;  5F64 A;  3U6M A;  3PM1 A;  4A2U A;  2NVX J;  1ETW A;  1X3U A;  5K1Y A;  4D1Q A;  3L09 A;  4A3G J;  3V7S A;  4CYD A;  3EUH C;  2D7G A;  2Z4R A;  3HOV J;  5DCF A;  1ZEL A;  5ITX E;  3CUQ C;  3OYD A;  4Y28 F;  5CVV A;  2J7O A;  2KDL A;  1D0Z A;  2DOE A;  1G8P A;  2IAI A;  1Y8R B;  5EEA A;  1SFK A;  1E17 A;  5E20 A;  4QTR A;  3WG9 A;  3GQ4 A;  3FK7 A;  4IXA A;  1PUF B;  2ACJ A;  3F23 A;  2C5R A;  4K0K M;  3FIS A;  4FAS D;  1KQ8 A;  4R3D A;  1GHC A;  3VK8 A;  1TT0 A;  2V1D A;  3ILK A;  5FLM J;  3M1C A;  2FH0 A;  1IRF A;  1K6O A;  2PLY A;  2LVN C;  5FLV A;  2CRG A;  3ZQ7 A;  2Y2Z A;  2LK2 A;  2M60 A;  2QVO A;  4II2 A;  1LPQ A;  3O2P E;  4CSW A;  3ZQH A;  2MLG A;  3VK7 A;  2EV0 A;  1S6L A;  5ITQ A;  1AUA A;  2Z33 A;  4I2O A;  3FYD A;  3MHV C;  1GUU A;  2MYS A;  4OAZ A;  3I4P A;  3KOW E;  5L3B A;  1VQP I;  3NWT A;  4JI6 M;  5LFA A;  2KPM A;  4QIW N;  4MTE A;  1VQO I;  3L27 A;  1KSF X;  4IPA A;  4M3B A;  4I76 A;  3HTU A;  2LDU A;  3HG9 A;  3ZH9 B;  3L2C A;  2AS5 F;  2WV0 A;  2R7T A;  4DV7 M;  4L5I A;  1IY1 A;  3FRI A;  4JV5 M;  2FBK A;  4RAF A;  2VJ4 A;  3I71 A;  3FUV A;  5JHU A;  5EGO B;  3SAW A;  5JR3 A;  1LUJ B;  3L2R A;  2E5L M;  2QQB A;  1EE8 A;  2NOG A;  2KIM A;  1LDJ A;  3T38 A;  5DEQ A;  1YFH A;  3BBZ A;  4LLG F;  3HKZ A;  3GLF B;  2ZNY A;  1XMO M;  1R4N B;  2G3Q A;  3L28 A;  2GIZ A;  3CTW B;  1Z7U A;  2L4A A;  3BJO A;  4LGY A;  1I50 J;  3S3M A;  1FBQ A;  1QVT A;  1AWC A;  4P9U A;  1XPX A;  3KOZ E;  5IZ7 D;  2DWN A;  1MBG A;  5IWA M;  2QBY B;  2L7M P;  5EYR A;  4A6E A;  5M5W J;  3IRQ A;  2EIM H;  2RGH A;  1DP3 A;  3EIE A;  1SMY F;  4E7K A;  2A5W A;  4A69 C;  2GIV A;  4YG2 F;  3AG1 H;  2Y20 A;  1UEL B;  1IN6 A;  2QUF A;  1IN8 A;  1XB2 B;  4N4O B;  1WZ2 A;  3MJ5 A;  3H5N A;  2K3P A;  4CZZ A;  4MH0 E;  1LVA A;  2XAJ A;  1WJE A;  1WQ2 A;  4CIC A;  1IG7 A;  1WJ7 A;  4II3 A;  4WXC A;  2BVL A;  2Y75 A;  1YJN I;  1SVO A;  4HX4 A;  4XIC A;  3KOX E;  3GLH E;  4MQ9 F;  1XGM A;  3U5Z A;  4MGI E;  3CQZ J;  3DEW A;  4CCJ A;  2DK8 A;  4XL9 A;  3GP1 A;  2R7W A;  1JR3 D;  3HGY A;  3GLF E;  5TJJ A;  1MMD A;  3GTK J;  1JT0 A;  3GVA A;  3GFM A;  2JK3 A;  1T6O A;  1HJP A;  2UUC M;  3KX2 A;  3QPL A;  3G4S I;  3H9Q A;  2MSY A;  3K4L A;  5KVR A;  2ZJP F;  4HLQ A;  4S04 A;  3CF5 F;  1HLV A;  1H8A C;  2IT0 A;  5HLI A;  4CJ6 A;  3AJI B;  3PUF A;  1D0K A;  2VC1 A;  3GRY A;  1ETO A;  3GPX A;  2JUG A;  4KN7 X;  3QRF F;  4G3O A;  4G4R A;  3HGG A;  2RQQ A;  1J75 A;  3H4J A;  2FJ1 A;  4KYW A;  1PJQ A;  3DU6 A;  5BPV A;  1AHD P;  2RV8 A;  3TBI A;  4BBR J;  3EUK L;  4RAG A;  1UM8 A;  1EKE A;  2BNK A;  4D0P A;  1HDD C;  3S2W A;  2M34 A;  2R7Z J;  4A3K J;  2GWR A;  3A98 B;  1R22 A;  1R4M B;  3RJP A;  5IT3 A;  1GVD A;  5D5U B;  1X1A A;  1TTE A;  4B7G A;  3MZH A;  1MBJ A;  3SFI A;  1D5Y A;  2X6Y A;  3PJR A;  1GO5 A;  5JVT A;  4WF2 A;  3BQY A;  3C58 A;  1HKQ A;  1F43 A;  4V2G A;  4WXD A;  3K9O A;  1SAU A;  3ASO H;  3HOU J;  2WAD A;  2LKX A;  3OSF A;  2VQG A;  2GXG A;  3WE2 A;  2VBZ A;  4IBB A;  2XPW A;  2Z5U A;  4KLN A;  1UFM A;  4IQJ A;  2OZU A;  2XKO A;  3WTT C;  3KP2 A;  3WU0 A;  1LQ1 A;  2ZBK B;  5E6J A;  1IO2 A;  4U87 A;  2HGC A;  4OW0 A;  2KIQ A;  2OQ4 A;  1XMX A;  5IP9 J;  3RGP A;  1TWH J;  3SHF A;  3HC7 A;  2GXA A;  3BR0 A;  1G4D A;  1RKW A;  1FEX A;  2K6B A;  2KRF A;  4CDG A;  2DI0 A;  4DV1 M;  4NNJ A;  2QSF X;  2OOA A;  5KPZ A;  2IW5 A;  2PBI A;  4NRW A;  3LA2 A;  1TWG J;  3U6D A;  1RZ4 A;  2BXY A;  2ME0 A;  4A3F J;  3F8N A;  2EJS A;  2HHH M;  1W36 D;  5ICE A;  4BBA A;  4IBE A;  5CVI A;  1IN5 A;  4Y13 A;  2CO5 A;  1KYZ A;  3DF8 A;  3L25 A;  3BR6 A;  3CCS I;  4E7J A;  2DAI A;  2QQA A;  2VBW A;  2JZY A;  5J3L A;  1NJF A;  3UZU A;  5BMZ A;  3ZMV A;  1QGP A;  1FJG M;  3PNT A;  1WXQ A;  2O7O A;  4LF4 M;  2LOO A;  1RKT A;  2KRC A;  2WTE A;  2XSD C;  2MW8 A;  2ZXH A;  2G7U A;  1IDY A;  4EAT A;  2NAZ A;  2LMD A;  3FUX A;  1QYR A;  1MSE C;  2LBC A;  2LTU A;  2XH9 A;  4LZZ A;  1IV6 A;  1TQI A;  4KN4 X;  1JKO C;  5J8C A;  3KS8 A;  4XQF A;  4F7Z A;  1A5T A;  1BVS A;  3OL4 A;  1JKR C;  2B63 J;  4D82 A;  3ONQ A;  1BC7 C;  1O7F A;  4LJ5 A;  1X4P A;  2WAQ A;  4PCQ A;  1X3Z B;  3Q5F A;  1WJC A;  4BBS J;  2K86 A;  3IUO A;  1EJ9 A;  4CYC B;  4XON A;  4UUS B;  2LR8 A;  2J5Y A;  4DV2 M;  4GKJ M;  2Y21 A;  3BQZ A;  3VPR A;  4XLP F;  2LLK A;  1WH5 A;  5FD5 A;  3K9P A;  2ZJQ F;  1MDM A;  2BY1 A;  2DA6 A;  2DK5 A;  3BCA A;  4UNO A;  1WJD A;  4U0V A;  4KMU X;  1ZG5 A;  4HG2 A;  4LG0 B;  3I9V 2;  4ZDP A;  2EIJ H;  4L8R C;  3UJN A;  1G2H A;  3DEE A;  2ZME A;  5B66 C;  4AD9 A;  3ZXS A;  1HST A;  4M3D A;  2CHQ A;  1XG1 A;  1QHG A;  5L3E A;  2VQF M;  3U6C A;  2E5N A;  4PJL A;  5GPA A;  5L3D A;  4F52 A;  4GH9 A;  3OWT A;  4MQV A;  3LAJ A;  2BOL A;  2OC6 A;  3OOP A;  2NVQ J;  5L3G A;  5IYB J;  3T1Y M;  2JA8 J;  2ECB A;  3OIP A;  1DU0 A;  1WJA A;  4BQO A;  1Z7L A;  3A0B C;  1P2F A;  3GLG A;  2VOO A;  4M6V A;  1A6I A;  1T6S A;  1QZE A;  4IJF A;  3OS1 A;  1SD5 A;  1KU7 A;  1OFH A;  5B5E C;  3RTR A;  3SBJ A;  1EA3 A;  4A3E J;  3HUG A;  2ZFW A;  2F4I A;  4AYB N;  3DZD A;  3FHN A;  1ETX A;  3CF0 A;  4ZYD A;  2QGU A;  3DP7 A;  1F5T A;  4FWD A;  4L5J A;  2IJL A;  2Z8Y M;  1ZG1 A;  2M5Z A;  4C2M J;  4XK8 F;  1EH7 A;  3A01 B;  3OR2 C;  3FUW A;  4R71 A;  1YIT I;  4GC9 A;  1JJ8 C;  3TMO A;  3PUB A;  1Z77 A;  3WTW C;  3SJM A;  1PJI A;  3D1N I;  3VKH A;  1VEG A;  2QSG X;  1WKM A;  3KP0 E;  3FHZ A;  1Z1D A;  1JUS A;  2DT5 A;  2JN6 A;  3THG A;  2MFZ A;  4CHU A;  2E35 A;  4X64 M;  1NG7 A;  1N77 A;  1U2W A;  3KZI C;  2ZO4 A;  1DGH B;  3OYH A;  3U6S A;  5GPC A;  1RES A;  2XB0 X;  5FO5 A;  3JRF A;  2CP8 A;  1PRB A;  2VDB B;  2IS1 A;  1XNR M;  1IN7 A;  4QHT A;  1S8N A;  3PO2 J;  4HBL A;  5FRN A;  3H35 A;  3OR1 C;  1QUS A;  1OKR A;  3QWL A;  2Z3X A;  2XC7 A;  1MX0 A;  2F5P A;  4GIP A;  1REP C;  4BNC A;  2UUA M;  4BLC A;  3GZN B;  1D0Y A;  5D4S A;  3VYR B;  2XSZ A;  1X19 A;  2QEN A;  2VBX A;  1D0L A;  3GPY A;  3A42 A;  1R58 A;  4ESB A;  1SAX A;  2CRU A;  1KYI A;  1SFX A;  3W6K B;  5D8K B;  3BT9 A;  1L1Z A;  3S17 J;  2CSO A;  3LSK A;  2WSE F;  2O8X A;  3KEY A;  5GTH C;  5IOY A;  2WZJ A;  2QZ4 A;  4QSH A;  4G6Q A;  1N32 M;  2OD5 A;  1XN7 A;  4DBR A;  3E97 A;  4DNC A;  1A6Q A;  1PP7 U;  4C3J J;  2VT3 A;  2DOD A;  2EIK H;  4M6Y A;  2IBD A;  2CUF A;  1OQY A;  2WB1 A;  1F1Z A;  3PIO F;  2A68 F;  4HV5 A;  1WH7 A;  4BGD A;  1D8J A;  2K47 A;  4QOZ C;  1UHM A;  3K10 A;  4D5C A;  1XXH B;  2VXD A;  5EGO A;  3GTP J;  4YHH M;  2IA2 A;  1VQM I;  1K82 A;  3DXJ F;  3HB9 A;  1YUB A;  4KIB A;  4I99 C;  1ON2 A;  3BCB A;  3ERE D;  2CWE A;  2XRN A;  2E19 A;  2RQP A;  2DYR H;  2X6W A;  4ENN A;  1OIS A;  1K7A A;  3SQN A;  4NSO B;  3WTV C;  3W68 A;  2Z3Y A;  4LRS A;  3VDX A;  4BY1 J;  3LSR A;  1T56 A;  2PFB A;  4LF7 M;  2EKF A;  1OCT C;  3I4M J;  1MMN A;  3TP3 A;  3VOD A;  3CMA I;  2QQ8 A;  4LF8 M;  3DPT A;  3QAH A;  1FP1 D;  3TE6 A;  3M4O J;  2E1M B;  3L2Q A;  3CJQ B;  3DOA A;  2UUB M;  2XGC A;  2MH9 A;  1JR3 A;  4HYE A;  2YSR A;  3LAP A;  1RIO H;  2R45 A;  2ETH A;  1RET A;  1QDR A;  4A3C J;  2DI3 A;  4OX9 M;  4PZJ A;  2CQN A;  3S32 A;  2B0L A;  5JVG F;  3QYB A;  2CU7 A;  4Y15 A;  5LGU A;  4MO7 A;  3H0D A;  1W4M A;  3SYL A;  2HQR A;  3AV0 A;  4L15 A;  1XXH A;  2ELK A;  4G8X A;  1DV0 A;  5B1A H;  4HQM A;  2YU3 A;  2NVU B;  4MLO A;  3CF6 E;  3TL4 X;  1RRJ A;  3LQQ A;  2ISY A;  5DYM A;  5FLX K;  2J5P A;  4DZJ A;  1XGN A;  2EFQ A;  2HI3 A;  1WFX A;  3MMY B;  3T6P A;  4RLQ A;  4UV8 A;  3ESW B;  4G9Y A;  4HNT A;  1IUY A;  2LHG A;  2JY6 B;  2HYF A;  5B3S H;  1FMV A;  1USS A;  2RNG A;  4XKC A;  1ZLK A;  3TW6 A;  2KNV A;  3DPU A;  1NK3 P;  3HHZ A;  2X1D A;  4WWC A;  2NS8 A;  2BWE A;  3C2G A;  2JA7 J;  5FJ8 J;  2H8W A;  1QZM A;  4ENM A;  3PNY A;  2YPR A;  1V5G A;  3T5X A;  1WWX A;  5CQE A;  4YII A;  2UU9 M;  1JGS A;  1P4X A;  3P7N A;  3JCU C;  2L09 A;  4UV9 A;  5C3E J;  2BJW A;  1V34 A;  3FMS A;  2JJ7 A;  2GLO A;  2KJC A;  2H5X A;  2FE8 A;  3FBN B;  2BWB A;  5CJ9 A;  2NRA C;  4PD2 A;  4PDK A;  2O61 A;  4E6K G;  5J1U A;  1NG6 A;  4DV4 M;  2JVH A;  3FUT A;  4FCW A;  1ZGJ A;  3KEQ A;  4HF2 A;  2IP2 A;  3E5U A;  3VWB A;  3GTQ J;  4ZDL A;  4FX0 A;  4PJJ A;  1T38 A;  2F4V M;  5GAD J;  1YQA A;  5IT9 S;  1KU2 A;  1Q1V A;  2KT0 A;  3FTC A;  3Q3S A;  3HOZ J;  2UZK A;  2FE3 A;  4FD2 A;  4BXF A;  3BZK A;  4BHC A;  3ZPL A;  2R0Q C;  5C4J J;  3FK6 A;  2DZL A;  4ANR A;  5E8I A;  2A05 A;  2W57 A;  2O9L A;  4IHV A;  1FC3 A;  4M0W A;  3JR4 A;  2EJR A;  3CP2 A;  4OAY A;  2IPQ X;  3GLH B;  2M7A A;  2RN7 A;  5F3W A;  3K92 A;  2OPF A;  3RKW A;  4O5V A;  1IXC A;  1WJ5 A;  2MLK A;  3PQK A;  1Z6R A;  2E2J J;  1DGF A;  4IO9 F;  4LMY A;  5FTK A;  1SXJ C;  3CC7 I;  4M73 A;  1S5L C;  1UHW A;  2ZFU A;  3V42 A;  4E4H A;  5ILU A;  1JUP A;  1ODD A;  1VQ5 I;  2HTJ A;  3CCV I;  1BA5 A;  4FTH A;  3RE8 A;  4CGZ A;  2R44 A;  1T33 A;  3NWS A;  4JI0 M;  3BTI A;  3VYS B;  2NOJ B;  2RDP A;  3E9S A;  3HL2 A;  4FX4 A;  3ZN0 A;  1SAN A;  3KYL A;  5K7H A;  5E1Z B;  2V1X A;  2E60 A;  5KQ8 A;  1JGG A;  4IKF A;  1IRZ A;  2WWY A;  1J09 A;  1NHA A;  2XF5 A;  4KO8 A;  3M8J A;  5IYC J;  5L8R F;  2W00 A;  1XCV A;  5A2Q K;  4YY3 M;  4EMS A;  4JBA A;  2KIF A;  3S93 A;  4LOC A;  3W3C A;  3LL7 A;  3U5Z B;  4FIS A;  2OQG A;  1GL6 A;  3C18 A;  2LH0 A;  3NAU A;  1SXJ E;  1IAW A;  1XMK A;  1PJS A;  5EXX A;  4E7I A;  3GZ5 A;  1ORY B;  3KZZ A;  1C0W A;  4HRI A;  3LW5 F;  1VQL I;  1UG0 A;  3OS2 A;  2VOD A;  1EV7 A;  3W67 A;  2JPB A;  3B6A A;  1E32 A;  2ZAM A;  5LMN M;  2DFI A;  3WTY C;  2ZJR F;  2O25 A;  2V6C A;  4MGR A;  1BJA A;  4Y17 A;  5ILV A;  1IXS B;  3M0E A;  4J01 A;  2R6F A;  1OMI A;  2R4E A;  2A69 F;  4QPQ A;  1N75 A;  2K85 A;  5F04 A;  2LWX A;  1JT6 A;  2EBI A;  3I3L A;  3MKW B;  3HBL A;  5KPR A;  4LJ7 A;  1UB9 A;  4DQ2 A;  4M6X A;  2CUZ A;  1VDL A;  4DBG B;  2F5E A;  3M1E A;  1RR7 A;  3OOU A;  3WTX C;  1DPR A;  2O0Y A;  4I6Z A;  1VQK I;  4UY8 I;  4CGY B;  4FCT A;  2OBP A;  5KAF C;  1YRN A;  4Y3O A;  3V7C A;  2PMU A;  2W4S A;  1OFC X;  1IXZ A;  1D2N A;  4P1W A;  3SFZ A;  1BI0 A;  1K4S A;  3L2V A;  3AOG A;  4D81 A;  2LKS A;  3OYJ A;  1ZN2 A;  4MB7 A;  3BPV A;  2M5W A;  3FMQ A;  3TOA A;  1YX5 A;  4AVZ A;  4UXN A;  1V33 A;  3J27 B;  1N33 M;  2YR2 A;  3LSP A;  4LRT A;  2L9S A;  4FE7 A;  3ZGK A;  1Q39 A;  2NNY A;  2R65 A;  1YW8 A;  3GTO J;  4S05 A;  1PP8 F;  1L2C A;  1F4I A;  2VC0 A;  5F1J A;  2DDA A;  1TWC J;  2K4J A;  2PX9 A;  3X2Q H;  1O3S A;  3O8H A;  1QAQ A;  2DMU A;  2X49 A;  2VF7 A;  1SD7 A;  2X6X A;  3W0F A;  3IL2 A;  1NH3 A;  3BC8 A;  1MSF C;  3PVS A;  3HOS A;  2L5Q A;  4P5O A;  5CPR B;  5KHD A;  4XN0 A;  4AZF A;  4FET A;  3T0Y A;  3CC2 I;  4DJA A;  2NVT J;  2DA7 A;  2OTL I;  2KZG A;  2E7X A;  2JY7 A;  4O6J A;  4EV0 A;  3FE3 A;  1P4A A;  4L0Y B;  2Y0Q A;  2JRT A;  1QU3 A;  4M3G A;  1LB2 A;  5M3M J;  4LG0 A;  1QPM A;  4D5F A;  2DKL A;  5J4V A;  1K83 J;  2M9H A;  5JHF A;  1JJ6 C;  4EM1 A;  4KNY A;  3HOW J;  1Z05 A;  2I7P A;  1GXQ A;  2P5K A;  4P96 A;  5IT9 K;  3IH2 A;  3V8L A;  1ZRF A;  5ED4 A;  1Y39 A;  1R49 A;  3BR3 A;  3U6E A;  2P81 A;  3ZQC A;  2F6C A;  4FQG A;  4NC6 A;  4G4O A;  3QP5 A;  2LY1 A;  2IGK A;  2DAG A;  1FWZ A;  3KET A;  3PFI A;  3OYM A;  2QQ9 A;  2JWT A;  2W25 A;  2UUZ A;  3S14 J;  2EO2 A;  5IP6 A;  4M9S A;  2R7Q A;  4RBO A;  2LG4 A;  1U78 A;  1WGL A;  3SAT A;  1KYW A;  4A3B J;  4AIH A;  3I01 M;  5C1B A;  2LP0 A;  2ME6 A;  1VZ0 A;  4NQW A;  1HNX M;  3C7J A;  2XSJ C;  3U2R A;  5HDK A;  4FT8 A;  2KZS A;  2IA0 A;  3FRH A;  1UCR A;  2KP6 A;  2ZXW H;  3OYK A;  2DJI A;  3R0A A;  4PJM A;  3I4Y A;  1ZKG A;  3IH4 A;  4A0Z A;  4IIW A;  2CGP A;  3CME I;  3A46 A;  5JLW A;  3IAM 2;  4OIR F;  2MBF A;  2K3F A;  1BOB A;  2Z9O A;  2HOT A;  2DW4 A;  3I59 A;  3E6C C;  1FZP B;  2C9O A;  1U6G A;  4LLN A;  4JI2 M;  1R4G A;  2DAO A;  1E3H A;  1XMA A;  2DMQ A;  2GOX B;  2RAE A;  1OCC H;  2IS6 A;  3G6E I;  3GEZ A;  2L4M A;  2NS7 A;  5DS9 A;  4LY6 A;  1JI8 A;  1OR7 C;  3IAS 2;  1OJL A;  3C3E A;  5KO3 A;  4Y52 J;  1VQ1 A;  1U3E M;  4AQY M;  1TTY A;  2XRO A;  1L1T A;  4ZH4 F;  3RZD J;  3EIH A;  1GT0 C;  3I5U A;  1RR8 C;  4YEL A;  2F5Q A;  4B3A A;  2CUE A;  2DTZ A;  4ESF A;  5H2F C;  2AHQ A;  1DGB A;  3E3V A;  3RIR A;  2ZTD A;  2HOE A;  2WY7 Q;  2EQR A;  4PSW A;  3H4M A;  4A0X A;  4XOP A;  1QHH D;  4YEJ A;  2DT6 A;  5F08 A;  1R1U A;  4EQQ A;  4B47 A;  4AKG A;  5D5V B;  1ZYR F;  4HEO A;  2Q2E B;  2KXE A;  4FWG A;  4Z6Y A;  2L7Z A;  3Q8X A;  2VL8 A;  3F21 A;  1G3T A;  3BOS A;  3ECO A;  3IH3 A;  5CVJ A;  2M2E A;  4IL6 C;  1VEK A;  3EUH A;  4E7Z A;  3M8E A;  3HGI A;  3O3K A;  1X58 A;  3I59 B;  2DXI A;  1X1P A;  2XVC A;  4I81 A;  2F5D A;  3A4C A;  2DWZ B;  2MH2 A;  3H5R A;  4PFO A;  1BM9 A;  4KIC A;  1IZ1 A;  4BJ5 C;  2OCC H;  4WX9 A;  2L01 A;  2M30 A;  3UKG A;  1TH4 A;  1Z6T A;  2JY5 A;  1UHS A;  2HFH A;  1I27 A;  4L16 A;  1S3J A;  1YX3 A;  3KS4 A;  2PMH A;  1E94 E;  1O3R A;  4KIF A;  2NXN B;  3L26 A;  4UB8 C;  3F9K A;  3F0C A;  5DUI A;  4KIS A;  3RZO J;  4M0D A;  2LRE A;  4RNA A;  4KIT B;  4GC5 A;  4MEX F;  4KIG A;  1ENH A;  3KPH A;  1ZAR A;  3QPS A;  2A5Y B;  2RGO A;  3GBG A;  5FSW A;  4X0G A;  3NRV A;  1D0X A;  4QOS A;  1OAI A;  1X3W B;  4NXN M;  2C99 A;  4MTD A;  4MGH A;  3K2A A;  4EM0 B;  2R4J A;  5EP2 A;  1WGN A;  3HKP A;  4B3M M;  4DV3 M;  4XOT A;  4GYI A;  3EET A;  4XM3 A;  4B3S M;  2C6Y A;  3GME A;  4UVC A;  4EJW A;  2CMP A;  4F55 A;  2OAZ A;  5LEJ A;  3RKX A;  2VII A;  3IHP A;  2QEX I;  1TZL A;  3H0G J;  1VQN I;  1K3W A;  3GFJ A;  1E9S A;  2HOS A;  1VQ6 I;  4ASN A;  2GZW A;  2W24 A;  5LRS A;  2JXN A;  1TT5 B;  4D7M A;  3HIF A;  1G8X A;  4XKV A;  2UXN A;  1STZ A;  2DYS H;  1Z59 A;  1S7O A;  1E3O C;  2OU2 A;  4HDU A;  1IQP A;  2DWM A;  5TIS C;  1DDN A;  4G7H F;  4KMF A;  1ZAO A;  1ZG3 A;  1AOY A;  1UG2 A;  1VI0 A;  5ITX A;  3GW2 A;  3MD2 A;  3J81 Z;  4G6T B;  3CLO A;  4QHS A;  2DFE A;  4W1U A;  4GKK M;  2BZT A;  3MN2 A;  3P5J A;  4YFN F;  4F92 B;  3S2H J;  2FUG 2;  1YYV A;  1ZLJ A;  5K7Z A;  1N36 M;  3I54 A;  5JI2 E;  5FTN A;  2A61 A;  4HQE A;  1W5C C;  3WHB A;  2PJR B;  1R7R A;  3DKY A;  2QHO B;  1XSX A;  2H6C A;  3RQI A;  1FNN A;  3IG8 A;  4M3E A;  1UAA A;  3GO5 A;  3G71 I;  4BAC A;  2Z4S A;  3MKL A;  4NQW B;  3Q9S A;  2EUC A;  3K8Z A;  4DR3 M;  4AID A;  1TH2 A;  1MKM A;  3DFZ A;  1T0F C;  3F8F A;  3HOY J;  2ZKZ A;  4DGW B;  4ABZ A;  1MD0 A;  5K5R A;  2Z2S B;  4CHT B;  1XWI A;  2L4E A;  4L6V 6;  3EQL F;  1R23 A;  3RGS A;  3ELK A;  3D5L A;  4OMY A;  4XLA A;  4WCG A;  2W48 A;  3R8F A;  2FRH A;  4XNF A;  4FWH A;  3DLA A;  4TV7 A;  3L2U A;  2JUJ A;  2JSC A;  1RU3 A;  1TNT A;  3OYL A;  1HBX G;  4ZTJ A;  1FX7 A;  2WC2 A;  2XFT A;  1ZQ9 A;  3HX3 A;  3BZC A;  3OIQ A;  2PEX A;  2QWW A;  3VDU A;  2N8G A;  5FRM A;  2VT2 A;  5FTM A;  5ICG A;  4X65 M;  1V5F A;  3O6B B;  1JHF A;  2EPF A;  1NV8 A;  4CA0 A;  1EIJ A;  2DTR A;  5FKM A;  2V9P A;  3L7W A;  3FZV A;  5EG0 A;  1TC3 C;  2JY8 A;  1MJA A;  5IYD J;  1VFC A;  1I4W A;  1VTN C;  1ORK A;  4AM3 A;  3WE3 A;  2YR0 A;  1H89 C;  2TDX A;  3UR3 C;  3IWF A;  1SG9 A;  2KZU A;  3T1H M;  3DTI A;  4LJ6 A;  3TO6 A;  4NBQ A;  4ZYE A;  1R2Y A;  2XFS A;  2L2O A;  4AW4 A;  2V6Z M;  5LHG A;  1EH8 A;  2MJ5 B;  3QU3 A;  3MQ0 A;  5DM7 F;  4GXO A;  1NHG C;  4IBK A;  3QPT A;  4L78 A;  3U21 A;  1UFZ A;  3W6J B;  4JI3 M;  1FBS A;  4PDG A;  4RDU A;  4XKW A;  2YS9 A;  1ZRE A;  5CVR A;  4XBF A;  3LFU A;  1MNE A;  2R7S A;  3WU2 C;  5DD4 A;  2X48 A;  5C4X J;  5IT9 Z;  1VQ7 I;  4UN2 B;  4IBD A;  2DA5 A;  2ZBK A;  2KIU A;  4A12 A;  4DV0 M;  1WGX A;  5E1X A;  1MBF A;  3GPU A;  2AO9 A;  4XSZ F;  3GLH A;  4PDI A;  4V2F A;  4M9X A;  5H20 A;  1YRN B;  1Y0U A;  4GGG A;  4ZPX A;  3H3Z A;  3SMS A;  1N34 M;  2DBB A;  1EH6 A;  2ELJ A;  5KPT A;  1Y8Q B;  1LNW A;  3NEU A;  4BE2 A;  3HDD A;  1QDT A;  3E21 A;  3RSN A;  1QAN A;  3E4R A;  4XN3 A;  3K4B A;  2KZV A;  4ANJ A;  1JXS A;  3LWF A;  4HOB A;  3SDG A;  3RYR A;  2DMN A;  3ML6 A;  3GZ6 A;  1O3Q A;  2VN2 A;  2VB6 A;  2KRH A;  2Z99 A;  2ZJ2 A;  2VKE A;  3IRR A;  4B48 A;  2EWN A;  2FX0 A;  1C7Y A;  1J5E M;  1IY0 A;  3HRS A;  1DGW Y;  3NAR A;  3KOY E;  2VUM J;  1J2X A;  2GQF A;  2J7N A;  3J7Z I;  4ZYA A;  3VB2 A;  5J47 A;  4BXX J;  3HXL A;  2P5L C;  3SYK A;  2D7H A;  2HS5 A;  3ZR8 X;  4C2T A;  3HRU A;  4BKX A;  3K70 D;  1Z3X A;  2IGO A;  3BR1 A;  5ICC A;  1J59 A;  4B3T M;  2DNA A;  2DO7 A;  1FOW A;  4KFC A;  3E46 A;  1XHB A;  2DEN A;  4L9T A;  3KE2 A;  3OS0 A;  3Q0W A;  3I55 I;  2E1C A;  3Q0U A;  1T3T A;  2OO9 A;  5AIP A;  3OYE A;  2F5C A;  3E5Q A;  4RM2 A;  1RUN A;  4L4U A;  1B9N A;  2BY0 A;  5CVU A;  2C98 A;  3U60 B;  4DBQ A;  1B8I A;  5J40 A;  4Q5S F;  4IEJ A;  4IRH A;  4CCL A;  2FQ4 A;  1MND A;  4CH7 A;  5F0C A;  5K5Q A;  3J7A Y;  2CE7 A;  1R6R A;  2AQF A;  4U88 A;  2IS2 A;  2ZNZ A;  5KK1 A;  2KRK A;  4OIP F;  4AIJ A;  3E7L A;  1ZRC A;  2HVS A;  4ZYG A;  1SFE A;  2Y69 H;  3CUO A;  1ON1 A;  5JFR A;  4A3D J;  4IHT A;  1D1B A;  3L9F A;  2F4M B;  2L9R A;  2OCE A;  3D5R C;  5B1B H;  2PJP A;  2EV5 A;  1S7E A;  2HWV A;  4LB6 B;  3CD6 I;  4M74 A;  5FFZ A;  2CQX A;  1DO0 A;  4IBG A;  5F0F A;  4RB3 C;  1MBK A;  1JTY A;  4FCY A;  3QU6 A;  5FB2 A;  2EIN H;  1BIB A;  4I02 A;  3H9J A;  1I6H J;  2HKJ A;  5ITU A;  1BI1 A;  3FM3 A;  3C9P A;  2PN6 A;  2Q1Z B;  4HZF A;  1LE8 A;  2HAK A;  1DQU A;  1MZB A;  3FM5 A;  1V5E A;  3D8B A;  3OYN A;  3FYC A;  2D5V A;  5HDG A;  2KNZ A;  3HSE A;  2B9S A;  3LVV A;  4LF5 M;  1F9N A;  3ERM A;  2R93 J;  1OCZ H;  3KLO A;  1XSD A;  2H8R A;  1R2Z A;  3RQ4 A;  2EIL H;  3V8J A;  4BXU A;  4ZZD A;  4A5M A;  4JOM A;  2C9C A;  1D0M A;  1BW6 A;  1P7I A;  1U5T B;  1XTA A;  1OYY A;  5EXT A; 
#chains in the Genus database with same CATH homology
 1OQY A;  1DO2 A;  1OAI A;  1WJ7 A;  1X3W B;  4F1I A;  2DHY A;  2KHH A;  1UFZ A;  3GLH E;  1WGN A;  2RRU A;  4WP2 A;  1P3Q Q;  2DAK A;  1ZMU A;  2JNH A;  2DAG A;  1G4A E;  3K9P A;  3GLF E;  4UN2 B;  2QNJ A;  3MMP A;  1T6O A;  1WGL A;  1HJP A;  1WR1 B;  1VG5 A;  5DFL A;  3IHP A;  3B89 A;  4Q7J A;  2EKF A;  3FRH A;  3E21 A;  4G3O A;  1HQY E;  3H4J A;  2DAM A;  1OKS A;  2MGW A;  1OTR A;  2QSH X;  2JZ0 A;  2DAE A;  1XXH E;  2L4F A;  1MN3 A;  1WHC A;  1TTE A;  2K9D A;  1IM2 A;  1Q02 A;  1C7Y A;  1GO5 A;  2KNA A;  1QZE A;  2O25 A;  1R4G A;  2MRO B;  1IXS A;  1ZV1 A;  1PGY A;  3K9O A;  1TP4 A;  2LVN C;  2JZ1 A;  1DV0 A;  1V92 A;  5JI2 E;  1CUK A;  3LCU A;  2DNA A;  4F2L A;  3GLG E;  2QHO B;  2LVQ D;  2DEN A;  3E46 A;  1TR8 A;  1VQ1 A;  1VDL A;  4DBG B;  1ZMW A;  2OO9 A;  3IEC A;  4R71 A;  4YIR X;  3T6P A;  3ESW B;  1VEJ A;  1VEG A;  2JY6 B;  2B3T A;  2QSG X;  2LVO C;  1T43 A;  2KNV A;  2ZTD A;  2BWE A;  1ZMV A;  1HT1 E;  2OOB A;  2L4E A;  1JR3 E;  1YLA A;  2DI0 A;  2R0I A;  3FRI A;  2QSF X;  2OOA A;  4HEO A;  2CP8 A;  1PVE A;  2F4O B;  1G41 A;  2H5X A;  1G3I A;  2BWB A;  2F4M B;  2EJS A;  2L2D A;  1VEK A;  2JUJ A;  1Y8G A;  1F4I A;  2MR9 A;  3BBZ A;  3LCV B;  1DO0 A;  2CWB A;  2DAI A;  2ZTC A;  2G3Q A;  2K0B X;  2HWJ A;  1IFY A;  3F92 A;  1NV8 A;  2JY5 A;  1KYI A;  2HAK A;  2JY8 A;  1E94 E;  2LVP C;  4GEW A;  2JP7 A;  3GLI E;  2DZL A;  2KNZ A;  2JY7 A;  2LBC A;  2LTU A;  2EKK A;  3FE3 A;  2WZJ A;  1SG9 A;  1A5T A;  1BVS A;  1WIV A;  1EFU B;  1XB2 B;  2LVA A;  2DKL A;  1AIP C;  1NV9 A;  1HT2 E;  1X3Z B;  2MJ5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...