2QSFX

Crystal structure of the rad4-rad23 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
104
Chain Sequence
IGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAVGSFQVDYTPEDDQAISRLCELGFERDLVIQVYFACDKNEEAAANILFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of DNA damage by the Rad4 nucleotide excision repair protein
pubmed doi rcsb
molecule keywords DNA repair protein RAD4
molecule tags Dna binding protein
source organism Saccharomyces cerevisiae
total genus 33
structure length 104
sequence length 141
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00627 UBA UBA/TS-N domain
X PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2qsfX02
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2qsfX01
1XB2B 2MROB 3ESWB 1AIPC 1ZV1A 1DO2A 1T43A 1TR8A 1HJPA 2HWJA 3E46A 1OQYA 2MGWA 1VEKA 2ZTDA 2K9DA 2LVOC 2L4EA 1DV0A 3F92A 2QNJA 1VQ1A 1R4GA 1E94E 4Q7JA 2DI0A 1V92A 2LVNC 1Y8GA 3BBZA 3LCVB 1X3ZB 4F2LA 1EFUB 1PGYA 1WJ7A 2JY8A 1HQYE 2JNHA 3FRHA 4DBGB 2LTUA 3FE3A 1VEGA 1MN3A 2DNAA 2KHHA 5DFLA 1GO5A 1TP4A 1QZEA 1ZMUA 4R71A 2DAGA 2MR9A 1VDLA 1KYIA 3GLGE 3K9OA 1XXHE 1UFZA 3MMPA 1A5TA 1C7YA 1IM2A 2DENA 2KNVA 2KNAA 4G3OA 1X3WB 1OKSA 2R0IA 1VG5A 2K0BX 2OOBA 1OAIA 1ZMWA 3T6PA 2DKLA 2WZJA 2LVQD 2QHOB 2DAKA 3FRIA 2QSFX 3GLFE 2QSGX 2KNZA 4F1IA 1G41A 1IFYA 2BWBA 1CUKA 1ZMVA 4YIRX 2DAMA 2L4FA 1VEJA 2EJSA 3E21A 1Q02A 1WIVA 2LBCA 2LVPC 3IECA 2OOAA 1T6OA 2DHYA 2G3QA 2H5XA 2JY6B 2RRUA 2JY5A 3GLHE 3K9PA 1SG9A 1PVEA 2JZ0A 1WGLA 2EKKA 2DAIA 2DAEA 2JY7A 2LVAA 2BWEA 1OTRA 2B3TA 2JZ1A 1F4IA 2ZTCA 3GLIE 3B89A 1DO0A 1JR3E 3IHPA 1WGNA 2OO9A 2MJ5B 2DZLA 1P3QQ 2F4OB 4GEWA 1HT2E 1NV9A 1NV8A 2CWBA 1WHCA 2QSHX 2F4MB 3H4JA 5JI2E 1G3IA 1HT1E 1BVSA 1IXSA 2L2DA 1TTEA 1YLAA 2JP7A 4UN2B 4HEOA 1G4AE 2CP8A 2JUJA 3LCUA 4WP2A 2HAKA 2EKFA 1WR1B 2O25A
chains in the Genus database with same CATH superfamily
2J5PA 2FU4A 2M5WA 1AIPC 2VBXA 4JI5M 3ESWB 2YNMD 3CP8A 3I53A 2XROA 3HHWA 1QHHD 4O6JA 1G3TA 4JI2M 3F22A 1XXHA 5H37D 5LD2C 3I0TA 2V1XA 3AKZA 5M3MJ 2L7ZA 1EIJA 3BR2A 4DBRA 3N4MA 1FYKA 2J5YA 1K82A 2LFBA 2EZKA 1M1EB 3CMMA 3U61A 3TQSA 1ENHA 4S12A 3ABMH 4L5EA 2C99A 1QANA 2OBPA 2VE8A 2KT0A 2JZYA 3U9GA 2VI6A 4Q48A 5HS9A 3AOGA 3QWLA 3SAUA 2HDWA 4ZC3A 4D5CA 3V7CA 3K2ZA 5KNLA 3SDBA 1H9TA 4JI0M 3SHGB 3KS8A 2XGNA 4MLOA 2Y9ZA 2YQZA 4BEHA 1XWIA 3ZQGA 4HBLA 3VB2A 1PM5A 3QU3A 4YIFA 4DR3M 2KHHA 2KDOA 4I76A 2EFQA 1QZEA 3GLXA 1TH3A 3LW5F 1FJLA 2LYCA 4A3CJ 4RNAA 1YJ9I 3ZR8X 3TGNA 1SVOA 3GLLA 5GPAA 4M6XA 3FUWA 4PT5A 1A35A 3SAVA 4DR1M 3RPUD 3L27A 1HNWM 3TKYA 1FEXA 5FTMA 3ZRGA 2Y0SA 2VJIA 3GLFB 1G6NA 4FQGA 1BOAA 5FD5A 2BY0A 4B47A 4G12A 3BPXA 3BJ6A 3K7AJ 4IJFA 4M0DA 1BI3A 1EH7A 1Y6IA 3I3LA 4GC5A 3T5XA 3SJMA 4A3IJ 2M7AA 3KZZA 2RNGA 1VQ6I 2B0LA 5TJJA 1BC7C 3M8EA 2HTJA 1XGOA 4Y33A 3TEDA 2QHOB 2EZIA 3E6CC 2QSFX 2L9RA 2R5ZB 4LJ9A 3KP0E 4UB8C 4ON0A 5IP9J 4QLCU 4RAGA 2EA0A 4GFBA 2R0QC 3RYPA 4OWRB 1T08B 1K78A 2K86A 3A0HC 2CG4A 3OIOA 2L7IA 5J8FA 3CCVI 1HBXG 5LRSA 2DOAA 5DTDA 4TUWA 5ILVA 3BR1A 2JY6B 3LSMA 2X1EA 4OAZA 4BQNA 1BW5A 1TLHB 1E9RA 1N34M 2NOGA 3KPHA 1YE9A 5A2QS 1OCPA 4IHSA 4E4HA 4QOSA 2LVAA 3GXOA 2A3SA 4QWQA 2E1CA 1MBHA 4K2EA 1S7EA 3E4RA 4DUYM 2RC4A 3LAPA 4A0YA 2L9SA 3DFZA 5GTHC 4Z8XA 2L9VA 1ZELA 2QCOA 3PQKA 1QDTA 4LB6B 4ENNA 2ZXIA 4WXCA 4LF5M 2FH0A 3FM3A 4D7NA 1S3JA 2DZLA 5B5EC 2ZMEB 1YYVA 2ICWG 4CYCB 1ZGAA 2LMDA 4G8XA 3F8BA 2R46A 4I81A 2ECCA 2KW0A 2GLOA 1R36A 2D5VA 4XL9A 3OSFA 5HOOA 2DZNB 1HQCA 3SMPA 3CF0A 3U6QA 1Z0XA 2EZHA 2WA0A 1R49A 4ZPXA 4M72A 2L7MP 3LCUA 5F3WA 1S5LC 2FOWA 2X4AA 3OOPA 4G4QA 3FWEA 1YFHA 2WAQN 2Z9OA 1UFMA 1L0OC 1T43A 4I98B 2CV0A 3C3WA 1CF7A 4O5VA 2ZJQF 3MCZA 3A98B 1G8PA 1QZYA 2DA3A 2QENA 3Q9VA 3KP5A 4EJOA 4WX9A 4M9SA 4X66M 1R4GA 4MM3B 4ANRA 4YHHM 3NBIA 1LDKB 2BVMA 3J2PB 1NSFA 1L2CA 4HLXA 1U5TC 1R2ZA 1IDYA 5CQEA 2XB5A 4CA0A 3CUOA 2KMUA 4PK4A 2PG4A 1DPRA 5C1BA 2JSCA 3OS0A 1LB2A 2CQ7A 1RI7A 2JMWA 2QGUA 3CDLA 3JREA 1SFKA 5GP9A 4E7SA 3HSEA 4UXNA 2K9MA 2FEZA 1OFCX 1SAUA 2FBHA 3S1MJ 3MKZA 4ZYAA 3LWFA 1HSTA 2CQQA 3IG8A 2E60A 2LKPA 3W68A 4RGUA 1ZLJA 5CLSA 2MBFA 3OYFA 2UXBM 2LHCA 3G6EI 4V2FA 1PUEE 1VDDA 5ILSA 3DTEA 1U3EM 3OL4A 3OR1C 3BZCA 1Y56A 1JKPC 3S1NJ 4PCZA 5DYMA 1TW3A 3T1BA 4OU7A 4XONA 1P7IA 2LK2A 4KUMA 1Z5BA 5E18F 2VC0A 3KIOA 4D0PA 2DAOA 5M5WJ 3A01B 2E71A 2OPFA 4LJZF 3F8CA 1RUNA 1WI3A 2BGCA 2XKPA 1G41A 2JJ7A 3MKLA 4WW0A 3GPXA 1D0LA 2HTSA 4CIZA 1X2NA 4LJ8A 4M74A 2RV8A 5M3FJ 3GTKJ 1NK2P 4G94A 4E7ZA 3GFJA 3OYKA 2L6OA 2Z4RA 1V3FA 3PVSA 3D5RC 1WIVA 4II3A 3WU2C 2XRLA 5F6FA 3O2PE 3GWZA 5KVRA 2LNHC 1ZN2A 2P81A 1HW5A 3AG1H 4X1EA 5E3OA 1S3SA 3H9GA 4NHJA 3JCUC 5FO5A 3R8FA 2PX9A 1L2BA 2X8AA 2E2HJ 1B8IA 3A03A 3GRUA 2XC7A 1MJ9A 1IRXA 1SG9A 3AG2H 2Y2ZA 1T98A 4MNUA 3TOAA 1PJIA 2DMUA 5ERIA 4BHCA 1QZZA 3HU2A 2LRDA 4AW4A 4C2MJ 3DKYA 4H0EA 2LF7A 1WXQA 1N77A 3IUOA 3AJIB 1HKTA 2XZFA 1TC3C 4NL4H 5IZ7D 5F0FA 2F4VM 2CHQA 2ISYA 5B3SH 3GUDA 1BR2A 3KZIC 3LSPA 2R7WA 1TWFJ 4HLQA 2JRMA 2F4OB 3K70D 2R45A 3GFLA 2DFIA 4RGXA 1SD5A 4EJVA 4IIWA 4DYCA 2BEOA 2K27A 3CQZJ 1G3IA 3R60A 1BVSA 2ZXJA 3SFIA 5HLHA 4M3GA 1L8QA 2WADA 1FY7A 1O4XA 1L1ZA 3MWMA 3PNTA 3Q0VA 2ZM6M 3ABKH 4LZZA 4KA4A 1IBMM 3HGGA 3F6VA 1XB2B 3FBNB 3TDZC 1S72I 3TO7A 2KDZA 4X64M 3JR4A 4MGHA 2LHGA 1ZTRA 4BU2A 5D8LB 1W36C 5E17F 3MK6A 3Q8XA 3B7NA 1SXJA 5ITYA 3TPZA 4AG6A 2ZTDA 1D1CA 2GA2A 3GO5A 3TOBA 5HNHA 5C4JJ 4RF1A 1MJGM 3W2WA 1LJ9A 3E7LA 1XMXA 1P2FA 4J01A 4C30A 2RN7A 3GTGJ 4LLLA 2EUCA 3ZCBB 1PDNC 4L18B 2YR2A 2Z3YA 3P9IA 3GQ5A 4PSWA 1J7KA 3RFWA 1BIBA 4XKCA 2MH8A 2OTJI 1AKHA 2DBBA 3T38A 2L7HA 2WSCF 3DPLC 1S9HA 2DN0A 1F5TA 1Z7UA 1JHHA 1HA8A 1B1BA 3HSFA 1A6QA 2FD5A 1Z21A 1BN5A 2RQPA 1X19A 4Y52J 2M45A 2MLKA 4IBFA 4Y4RA 1P9QC 4IO9F 4KNYA 1TT5B 2R44A 4BNCA 4UNOA 2CGPA 3FTDA 2O7OA 2DENA 1MZBA 3HKZA 4GHLA 2NNNA 2LXEA 4IBGA 3K1MA 2NQ8C 5ITUA 2JUCA 2XRNA 3F9KA 2R5YA 4RF0A 1I39A 2OOBA 4FWHA 2D2WA 2IP2A 5KK1A 1R9TJ 4NSOB 4S0HB 1TQIA 2M30A 4PGGA 1K6OA 1BA5A 2LVQD 1AA7A 1KYWA 4GKKM 4GKJM 2CUZA 1YW9A 2VONA 1G3SA 3FXKA 5LBQA 1GDTA 2UUCM 3K92A 1R1TA 5DNYA 4DNCA 4LLGF 3I4VA 1IFYA 3TW7A 3ZH9B 2FMLA 3OR2C 1Z67A 2MABA 1JKRC 1BBYA 2KISA 2DA1A 1WPKA 1ONVA 3KP7A 3KSJA 2AXLA 4M9ZA 3GTJJ 2LVPC 3M6AA 1XPXA 2V6EA 3HM5A 4FWGA 2WSFF 2CWEA 3ELKA 2QQBA 5DUKA 1KQ0A 1XD7A 3GLHE 3K9PA 5EEAA 3D8BA 4X0GA 4F7ZA 1IC8A 1OIZA 2O8XA 3TW6A 2KIQA 1J2XA 4ZTJA 1QDRA 1HF0A 2FQ3A 3T0YA 1JR3E 2RGVA 4BHPA 3P7NA 3FF5A 5K7FA 4GIPA 2K3PA 2UXNA 3KP2A 2MJ5B 4YG2F 1SD6A 2Y0QA 2QZ4A 3DFGA 3L28A 2CWBA 3K1JA 3K10A 1WHCA 1WRJA 1BC8C 4HNTA 4G6TB 1T2KA 3C2GA 2EA4A 4LFCM 3RE8A 3DV8A 4L5JA 2JA5J 2Z16A 3ABLH 3L25A 3EETA 3U6OA 1YS7A 3ZMVA 2JP7A 4B7GA 2R6FA 3BG5A 4PDGA 4ITQA 2YSRA 2IT0A 1MU5A 5E79C 2V1UA 4HV6A 3RPUA 2BY2A 3EIEA 2FMYA 5JI6A 2CRGA 3J81Z 5IT9K 2H94A 1QPIA 2Y20A 1LDDA 2VT2A 4DV0M 5K5OA 5F64A 2R4GA 4IHWA 3BOSA 3QOPA 5L3FA 5KAFC 1IN6A 4NNJA 3DKWA 3P9KA 3IKTA 1V92A 3UK6A 2O01F 3L09A 4KODA 4BE2A 2OQGA 3LFKA 3D8LA 3HU3A 5LHGA 1FOKA 1PGYA 2JNHA 4DBGB 2COBA 5ITTA 4DV2M 2F5SA 2BNKA 1R6RA 3ZQLA 1SXJC 3M07A 3FUTA 2A05A 4AM3A 2VIIA 1YS6A 4XORA 4RS8A 2V6ZM 3BR3A 3CCSI 4II2A 2FE3A 4ZTFA 4JN6A 2RAEA 3V7SA 4LFAM 1NG6A 3CMEI 1HDPA 5F1RA 3A02A 5E8IA 4XRSA 3HTUA 2DQRA 1LE8B 2F5QA 2AXTC 4I2OA 1UFZA 2EV0A 2K02A 3REOA 3VPRA 4IJEA 4XKBA 2BY1A 3FUVA 1MMAA 2CW7A 3TP0A 4XKVA 3SYLA 3FXRA 5FSWA 3FXUA 4N0BA 3L2RA 4IF4A 2IRFG 2R0IA 2JXNA 1YSYA 4Y7NJ 3W2AA 2X9DA 3H36A 3QU6A 3ECHA 3I4PA 1R71A 5EXSA 4EGZA 3HU1A 2H27A 3BG3A 3OYLA 1W7PD 1QAOA 4YIIA 1BR4A 2UXCM 2VUMJ 3GZ6A 2KNZA 4F1IA 2V6CA 4S05A 4FD2A 2EV6A 4XKWA 4GCVA 1LNWA 2L4FA 4LGMA 1XC8A 2XZUA 1XMOM 1DGGA 1FPQA 1RC9A 3VOEA 5J4VA 3M1EA 4MFEA 3HGIA 1ZK8A 4RGSA 4I02A 3D5LA 3FKJA 3ZMUA 3IRRA 1Y1WJ 4CDGA 4CCMA 1Z91A 3I58A 3RDIA 2ZSIB 3R9XB 1WGXA 3BG9A 5CPRB 2L7FP 3MAJA 1F9NA 4DV6M 3HZJA 3TMOA 2DVWB 4LIVA 1ZGJA 2DMQA 4HX8A 2HYFA 1ZG1A 3NBXX 5H2FC 5H6QA 3NWLA 2P4WA 4JXJA 4CCJA 3D1NI 3PM1A 3PQJA 4QPOA 4YFKF 3MKWB 3TWKA 1W1WE 3LSTA 1NHAA 4IQ4A 1I6HJ 2ECBA 3NWSA 3L1PA 2H1KA 3E5UA 5KO3A 3M7GA 4E7LA 2R3SA 4IKFA 4KN7X 3CCRI 2KRCA 1VFCA 1OCCH 4NC8A 4YRVA 1JR3D 1P92A 1P3QQ 4LG2A 4GYIA 1Q3BA 1NV9A 3DEWA 1GXPA 3E5XA 5B1AH 1O3RA 1QZMA 3FTCA 2OCCH 3QOEA 3L2VA 2Z4SA 3FYCA 2OJED 4PJJA 1EV7A 1YLAA 3E9SA 1HR0M 2E2JJ 1H0MA 1S8NA 5A2QK 1AU7A 2KKOA 4AYBA 1U78A 2I10A 2X6YA 4EGYA 4LOCA 3PL8A 5FKOA 2VL8A 1N78A 4L78A 2XGXA 4CHUA 3L2WA 3U2RA 1QVUA 3FTFA 4W1UA 4E6KG 4JI8M 4JV5M 1R2YA 2F5OA 5CVVA 1PP7U 3GCMA 1T39A 5FTKA 2HYJA 4LJ4A 2WB1N 4ZZDA 5HDKA 1HCRA 3GTLJ 1FTTA 1VF9A 2IXSA 4B3MM 2K9QA 3FXQA 3JTHA 5CVRA 4AUXA 4CH7A 3U6DA 3AL0B 4BKXA 3L29A 3SFZA 2EV5A 1JHFA 5F08A 2QP9X 1D0ZA 2VBYA 2G8LA 1SMYF 1TWCJ 3CP2A 5D5XB 3BR0A 4EJTA 2C98A 4LLNA 4RA2A 2K6BA 2MC3A 3FM5A 3WHCA 2QPAA 1OFHA 7CATA 1FBQA 2JVHA 3ASNH 3THGA 1B72A 2HQAA 4GH9A 2M1BA 1IV8A 3K2LA 1E2XA 2M0MA 4HV5A 2FOKA 4EMSA 1BW6A 2YPRA 2P8TA 4L8RC 1XDUA 2Z1DA 4OAYA 2KNVA 5JLXA 1YX5A 2HWVA 4G3OA 4I99C 4MGIE 1JUSA 1UCRA 2BW3B 4M0WA 1GVDA 2EIMH 3S8PA 3TO9A 1FT9A 2M7BA 2OUMA 3FMQA 3OYHA 4B09A 3W6VA 3KOWE 2DKLA 1OISA 3HRTA 4QOZC 1SMTA 1MBJA 2UUAM 3L00A 3FRIA 2LG4A 3MHVC 4ZJZA 2ZAMA 4H4KC 4OW0A 1ON2A 2IGKA 3RI4A 2IGMA 2X1DA 2L5QA 2OCEA 5B66C 3OYMA 1K61A 3H3UA 1EF4A 4E7JA 1UG0A 4U0WA 3WG9A 1DU0A 1FIPA 2Y0TA 2LBCA 1OYIA 3D5SC 3VK7A 2K5CA 2M0CA 4K0KM 2DYRH 4QNRA 1YQAA 3B7ZA 2KQRA 3O3KA 1YRNA 1DU6A 3M8FA 1WHUA 3VDPA 2L2OA 1XSXA 3U6CA 2UXDM 2OAZA 2HOEA 2NOJB 1ZAOA 1VQ7I 2JZ0A 4M73A 5CQGA 5L3GA 1JE8A 1ORYB 5IWAM 4BHBA 3J7YJ 2Y48A 2JWTA 1T38A 1NK3P 2MD5A 3FXJA 4DR6M 5E3MA 1U8RA 4B1RA 2LP0A 3H0GJ 4LD5A 1DO0A 2ZXWH 1R23A 4PSXA 1FBSA 2O0YA 3ASOH 4YY3M 3OL3A 3IG5A 2WAQA 3AG4H 2FXAA 4RBOA 2PJRA 2VOPA 2DA5A 2UU9M 4C3HJ 1TWAJ 3DPTA 3K9TA 3QP6A 4CZCA 3E6BA 5DYGA 2R7FA 3HRSA 3HJEA 5L8RF 3WTXC 2GNOA 3T15A 1Y0NA 4LF4M 1CGPA 2YS9A 4NQWA 1QBJA 2W57A 3W6JB 2X1CA 2LBFB 3ABUA 4IHVA 2ZFUA 1EH8A 4L9VA 2ME6A 2YFQA 1DGBA 2E35A 2ELJA 1OCOH 1VEKA 3R0JA 1DV0A 1MBFA 1QA6A 1N75A 2TRTA 2UUBM 3LAJA 1ITYA 2AQEA 2FE8A 1LKXA 2XAQA 6PAXA 1X1AA 5EZHA 4HYEA 2K40A 4QIWN 3DEEA 4MEYF 2OD5A 3F72A 3TL4X 2VXDA 1ZYRF 4FASD 2FFJA 4JI3M 2KZVA 1QAMA 3O8GA 5HS8A 5K7HA 1J9IA 2LDUA 2DFHA 2IBDA 2I7NA 2CW8A 1EE8A 1E3OC 3LVVA 2IS4A 2R7TA 4MGRA 4Z2YA 3DTKA 1NY6A 3I59A 1YTYA 2MR9A 2CUEA 2NVQJ 3SASA 2LY9A 2WAFA 2HL7A 1MMNA 3K9OA 3V4GA 5EGOB 3OYNA 4QNMA 1D8KA 3M1CA 2XPVA 2R93J 4BBAA 3CGWA 4RMNA 2UZKA 3Q5FA 3BTIA 5KHDA 1IM2A 3HUGB 1U5TB 2DMPA 2VC1A 1IRZA 3ZPLA 1WVRA 1AWCA 2PJPA 4NXMM 1X3WB 4U88A 4R1HA 3WTVC 3KP4A 2JA8J 4L15A 1XXHB 1RESA 2VKHA 4UV9A 4IBIA 1DP3A 1GV5A 5DUIA 3U61B 3U5ZA 3DBLB 1TDHA 5IP7J 2YU9J 2Z3XA 3KX2A 3T8RA 5J6XA 2QSGX 3BCBA 1O7LA 3ZQHA 1NHWC 3BTCA 2VKDA 4F92B 1Y8QB 1XGNA 3LQRA 1ZMVA 4GC9A 4R7GA 2MG4A 1SVMA 4BEHB 1Q02A 5HS7A 5IPAA 5LLQA 4FCTA 5AIPA 3I04M 4HF2A 3DF8A 4XQFA 1T6SA 2EBIA 2G3QA 4LCBA 4NRVA 5CVIA 1GXQA 4LF7M 1DDNA 2RDPA 3KEOA 2JY5A 3SXYA 1JI8A 3K70C 1RZ4A 1YIOA 4HQMA 1OTRA 5LEJA 2XGDA 4LZJA 2PMZN 1QU3A 4IJAA 2LLKA 2XF3A 1HNXM 1NHGC 2K7LA 4A93J 5TISC 2F48A 4I5SA 1XX5A 1JXSA 2K47A 3ZMTA 1ZHFA 2IW5A 2KLOA 4OIPF 2I7PA 4ZYHA 4P9UA 1DGFA 1FP2A 3I71A 1HT2E 2DO7A 5IYCJ 1KFVA 2CRUA 4Q47A 3ZQ7A 1LVKA 1OLTA 4CGYB 2QSHX 2A6HF 2WAEA 3CO7C 1EA3A 4Y13A 2WWYA 1BI1A 1Q1VA 2LH0A 3JRDA 2F5VA 3G4SI 4UN2B 1NJGA 4HEOA 2XASA 3J7AS 2VKEA 2E7WA 2DLLA 2W84A 5EP3A 4DV3M 4L9TA 1K78B 3T8TA 3C2BA 4M6YA 2WSEF 1HJPA 3SARA 2ME0A 2PN6A 3EUAA 2QA4I 4C3IJ 4P9FA 2R7XA 3LA2A 2BE5F 2N8GA 4NXNM 1SFUA 5DYIA 2D7EA 1VQ1A 2RREA 5FLXZ 1P7JA 2KRKA 3ZMSA 4LJ6A 1YOVB 2KA6B 2LVNC 5BS6A 4DR4M 1W7PA 3JRIA 3UKGA 1DP7P 1Y8GA 3LCVB 4A3MJ 2VASA 1Z1DA 3LQQA 5LRRA 4KMFA 2J7NA 3OWTA 5E1XA 2M8EA 5LGNA 3S17J 1MMGA 1HC8A 1HW1A 2JQ7A 4C9YA 2IA0A 3WTYC 2HQ5A 1OIPA 3OYAA 2UWMA 1ETOA 5J1UA 4AWXB 3WTTC 2HVQA 3NWTA 1TH2A 1TH4A 1MKMA 2A6EF 4GGGA 5FFZA 4X6AJ 1ACIA 3FIWA 2NS0A 5DM7F 1T95A 2AQFA 3QODA 1LEAA 4XN3A 1J75A 3QPTA 5E3NA 1ZG3A 5BQTA 5HDGA 2FOIC 2CHVA 1KYZA 3OYDA 4PDIA 4NDLA 1VQMI 2B7EA 1XMQM 5BMZA 1OKSA 3GLHA 8CATA 4HX4A 1ETKA 1WH5A 2IA1A 4LK0F 5ICFA 2XPWA 4MH0E 5J40A 3VDXA 2OTLI 2OZ6A 1U9NA 3CF5F 3MEXA 5EP2A 2WZJA 2O61A 4WCGA 2R92J 5H6RA 4D1QA 2VPLA 3JRAA 4KDPA 4CGZA 1JR3A 2X48A 2E1MC 1P4AA 2EQRA 3BQZA 4ENJA 3GLHB 2OC6A 4LJ5A 3BZKA 3W3CA 1MJAA 2BHYA 3S93A 2M4GA 3E97A 3QQAA 4YFXF 1JJ8C 4MIMA 5AONA 2CMPA 3BG6A 2GBYA 1WSUA 1B9NA 3T1YM 4CJ6A 1T6OA 3GW2A 2P6SA 2Y31A 2DYSH 2KEBA 2VJ5A 3ROUA 2LY2A 3LSKA 4P17A 1MD0A 2GXBA 2HGCA 2H6BA 1SAXA 3H4MA 3HKPA 2DXIA 1PVEA 5BPVA 2M5ZA 1FIAA 1OYYA 3DP7A 4HAMA 3SZGA 5CKTA 3GRYA 1HOMA 2LC2A 1Q39A 3AOEA 2NXNB 4UVCA 5FROA 4EM1A 2VIXA 2DDAA 3R0AA 4Q4ZF 3FDYA 5GAEJ 4KYWA 5D4RA 4DZJA 2ELHA 2O5RA 3LA3A 2FQ4A 1MSEC 3GPUA 2HZTA 4DJAA 4A3BJ 2FA5A 3GP1A 3K4KA 4RDUA 1JUPA 3H4JA 3JSPA 1FBUA 4KLNA 4GO1A 3BWGA 5ITXA 2QQ8A 2GOXB 1PJRA 4ZYDA 2A68F 4UUSA 3ZQCA 1RIOH 3VODA 3V8LA 4XLAA 3VSKA 3LNQA 4Y15A 1O7FA 1SVLA 3F6OA 2IGNA 2VBWA 1QHGA 3KP3A 3VYUB 5F27A 4DOZA 3DA1A 4MB7A 2CE7A 2WC2A 3UNGC 2DOEA 2MGWA 3HOTA 3U6MA 4UUSB 2HDDA 2K9DA 2XF6A 4REZA 4LITA 2CQXA 1B8IB 3HOSA 1A5JA 1IN5A 4KO8A 3NEUA 3KP6A 4HG2A 3RJPA 2EO2A 2ZAOA 4Q7JA 3DPUA 3AFHA 1QYRA 1ODDA 1XGSA 3H1CA 1VQ5I 2DWLA 4MGYE 4A3GJ 1ZR4A 4F2LA 3CTWB 2BJWA 2H1LA 3OV8A 3FRHA 1IN8A 2CJJA 2ZNYA 3I9V2 1JTXA 4BAYA 5IOYA 1VEGA 1XNRM 1KU3A 1MIJA 4B08A 4A3KJ 2A07F 3BP8A 5ICGA 1J09A 1GO5A 2UV1A 4HF1A 4WF2A 4LF8M 4OIQF 1UELB 2E36A 3LL7A 2NS7A 1N33M 2IS6A 4C2TA 2QCUA 5F0CA 3OY9A 4EATA 3U1DA 2KJBA 2OZUA 2HDCA 1D2NA 3F8MA 1K3WA 1LVAA 2EFWA 1XTAA 1A5TA 2ZSHB 1WFXA 3HPGA 3MKYB 4KIFA 5JHFA 4A5NA 2EA2A 2KNAA 1R22A 1ON1A 2VQGA 2ZBKA 2K4BA 4PCQA 4UVBA 1WQ2A 2QKLB 2R7RA 5FD6A 1SXJB 1LV7A 3FXMA 1D0XA 3HHGA 3LFUA 3OMYA 3JRHA 4PJLA 3RKYA 1X4OA 1YW7A 5LGTA 3CDHA 1EKEA 1X1CA 2V26A 1FOXA 2VOOA 1ZAEA 4B3RM 1N32M 3ERMA 1OCRH 1ZLKA 2QBYA 2BWBA 2F4IA 2XH9A 5J4YA 4YIRX 2RVCA 2F5FA 2K9NA 1VEJA 1R7RA 3L2AA 2QZ8A 3CO6C 4RM2A 2HFHA 1AKHB 4CHTB 1T3TA 4CO8A 2MSYA 2N35A 2LF8A 3FMRA 4IPAA 2EB7A 1LFUP 2M3AA 2KIUA 2ZJRF 3HOZJ 4JBAA 1XS9A 4BBRJ 2DTZA 1B4AA 2O3FA 5IP6A 1XCBA 2L01A 2LWXA 3MZYA 1FZPB 2D7HA 5H20A 2EKKA 3GEZA 4P1WA 5HLTA 3M4OJ 2KXEA 2X6WA 2FUG2 4HPQA 3ZQQA 4J19A 3GLGA 3GLIE 2BVLA 4RLQA 1FNNA 4BE1A 1IBKM 2H8WA 1FMWA 1V55H 3KS4A 3JRBA 2STTA 1AUAA 5TRDA 4D9JA 4HX7A 5ICEA 2R5YB 1XDSA 3MMYB 4WXDA 1DQUA 3RKWA 3SEZA 1TNSA 2FX0A 3HEFA 1YJNI 1NV8A 3JTGA 2HS5A 4DV5M 3E0JB 2QF7A 4CXFA 4JI1M 1HT1E 3SZTA 3K6GA 2R62A 3WHKA 2WB1A 4XIDA 1G4AE 1MBEA 3VFDA 1IXRC 3AOEC 2MW8A 4EV0A 1Y1VJ 3G1MA 1E17A 2DWNA 5C3EJ 3UR3C 2NVUB 2HCBA 5FGMA 3HL2A 4PGHA 3KW6A 4DV7M 1RKWA 2LSOA 3U6PA 1SANA 1QVTA 1YX3A 3E3VA 4UV8A 3M0EA 1D3YA 1SD7A 4ZZLA 2EZLA 2K9SA 3VSLA 3CCJI 4MGKE 3BBZA 3GX4X 5FLXS 3HYIA 3IP4B 1OYWA 4PFPA 3CC4I 3UGJA 1L1TA 1H88C 3WTWC 4F3QA 1R7JA 2YX7A 2ZCWA 3GVAA 1K4TA 1LTMA 3KFUG 1W5CC 4B3XA 3ZC7B 1FX7A 4KIBA 4BQAA 2MLGA 3C7JA 5LGUA 4M9XA 3QPHA 3HGYA 1QPMA 3B74A 1WH7A 1FC3A 2OQRA 4P16A 2L02A 5KPRA 1W0TA 2V7FA 4M71A 3K4NA 1X3UA 3J81K 3CUQA 1O3QA 2DT7B 4W5WA 2Z8YM 4UB6C 4GITA 3W67A 3VFZA 3EUKL 2R7ZJ 2DFEA 5EG0A 2OA4A 5ITXE 1FSEA 2WY7Q 1CQTA 1FLIA 2L9NA 4LGYA 5EXTA 1X1PA 4BY7J 1APLC 4N9IA 3WU1B 1YO5C 1SFEA 2EIJH 2FS1A 2BHZA 5J47A 4KT6A 3CJRB 3WGGA 2R7SA 2NRAC 1STZA 3FUXA 2Y75A 5KPTA 3FUUA 1MDMA 5E26A 2ZKZA 3RIRA 5EG0B 4N4NB 4L0ZB 1T8IA 1UB9A 3LSJA 3RSNA 3H3ZA 5FKLA 2NAZA 3OYIA 2LKSA 2JPCA 2O8KA 1BR1A 3B02A 3ZMZA 3S2WA 5K1YA 4BUPA 1S29A 2HKXA 3HY5A 3ZQFA 1XHBA 4W97A 4ANJA 1K6YA 3HG9A 3G3ZA 1HNZM 2W4SA 1Z3XA 2X0LA 2XGEA 2ZTCA 2GZWA 2KL4A 3KYDB 4G9YA 1GVJA 4CISA 2M2EA 3ZGKA 4FTHA 3HWSA 2QKMB 3E5QA 1ERDA 2ERCA 1X58A 5E8GA 2EJRA 2Z33A 2QVOA 4IHTA 4B7HA 1MJBA 3BROA 2OO9A 3K69A 5LMNM 4LY6A 3QAUA 3SBJA 2KJCA 3ONQA 3JAMZ 1B59A 4HQEA 3GTPJ 4XN0A 5EEHA 2V9VA 2XSZD 1G3WA 2CFXA 2R4EA 2NS8A 4ZH4F 1R5HA 3C3DA 3W0FA 1IXSA 3Q0UA 2JWSA 1S7AA 1YW8A 3IHUA 3IH2A 4LMYA 2FBIA 1TBXA 4DW6A 4BDZA 2E1NA 3CCQI 2PFBA 3L2CA 2CP8A 3IV5A 3N97A 2KPMA 1Y0UA 1JGSA 1TT0A 1WGLA 4IBKA 4DIQA 1VQLI 4S04A 5HDNA 4ENKA 1YJWI 2VQHA 3HOVJ 4PJNA 2BJVA 2E19A 3CTAA 3QYBA 2ZC2A 1I94M 2VXZA 3DCFA 4QPQA 1WI9A 2XPUA 3OIQA 3UMMA 5L3DA 3G71I 4G7OF 3E6MA 5LEKA 4A3EJ 4D7MA 3H0DA 5FKNA 5JVGF 1D5YA 1I1GA 5DCFA 3OYGA 4KIGA 3VEPA 4A12A 2RKOA 2EINH 1ETQA 2XKOA 3A0BC 1FJGM 3KYCB 5J1RA 1HKQA 5EYRA 2O9LA 1QNTA 1MN3A 1W0UA 3S3OA 4B8XA 1J5EM 2MD0A 4JQFA 2JA6J 3C9PA 4MEXF 2G7UA 2Y0MA 3CMYA 3GPYA 3VWBA 4FT8A 5EF6A 2P5KA 3NAUA 1LQ1A 2DAGA 1IDZA 3K4CA 1Q3CA 2VQEM 4I4LA 3C1DA 5FKKA 1XB4A 3GLGE 1A6IA 1D0MA 1RU3A 2A6TA 1T0FA 2V1NA 2X6XA 2QEXI 4HNVA 4BY1J 2XF5A 1D1AA 3DU6A 3OIPA 3DKXA 3LSGA 5AIQA 2F5CA 4DZPA 4KITB 4WXHA 1MGTA 5GKNA 4NUBA 3NARA 4XMYA 5BNGA 2DPUA 1I1SA 1R1VA 1OAIA 2V79A 2RQQA 2P7CB 1R58A 2RGOA 1SFOJ 3WHBA 4BL0B 1TWGJ 1NG7A 2DAKA 1YLFA 4FE4A 4BDYA 3K4LA 3H3VK 4MFDA 4E70A 5D5VB 1WJBA 3CUQC 2XEPA 4KT0F 4AVZA 4KFCA 2KDLA 2CUJA 3S3MA 3E21A 3BJOA 1XCVA 1IO2A 1ZH5A 4PZJA 2M60A 1XC5A 4HSTA 2PMZA 2ZANA 4I0AA 4XLEA 2YX4A 2WV1A 3RYRA 2R7DA 4R79A 1ZRFA 3S14J 3I4YA 2ZFWA 4HDVA 4BJ6C 4NC6A 1OR7A 4KT5C 2YR0A 5GAGJ 1B72B 2FNAA 4FWDA 4RB3C 2DQLA 3ZN1A 2DAIA 2C5RA 2D1HA 1Z9CA 2EPFA 2JZ1A 1ZR2A 4EM0B 2GWRA 3H5RA 2IEKA 3DEUA 3RQIA 2BY3A 2HI3A 2FNPA 1TL8A 5KPZA 3GF2A 3IHPA 2CQNA 2Z5UA 4N9HA 3I01M 5GADJ 4PJMA 5FRMA 4A3JJ 1W5TA 1ZREA 5B1BH 2VODA 2LD5A 3B7QA 3KVWA 1JT6A 3BCAA 4AKGA 1H89C 1MNMC 4QTRA 2Z99A 2C6YA 4AQYM 4AIKA 1IF1A 5EZGA 1S6LA 5JI2E 3JRGA 4UUTA 4JYAM 4RKUF 3VYRB 2JA7J 1Z59A 2G9WA 2DK8A 2NVYJ 2XLJA 4MTDA 4F52A 3H5NA 1UHMA 3H5AA 4Y17A 3J80Z 1BL0A 5JLWA 4PD2A 5IY5H 4XGIA 2EKFA 1WR1B 4OVZA 4DGWB 1DO2A 3IKVA 3CCYA 4ZDLA 2P5VA 1RR7A 3E46A 1IW7F 4AD9A 1YRNB 3A2KA 3SZPA 1Y8RB 3ISPA 2L4EA 4DYQA 4A0ZA 3FISA 1MBKA 4FHTA 4JX6A 1XMAA 1NH3A 4P55A 1KZHA 2QYOA 5TGTA 3M3YJ 1D5VA 4XBFA 2C96A 1KSFX 2MC4A 3S32A 1Z77A 1WJEA 4XRSG 2KRHA 3VKHA 4GRIA 5DD4A 2LTUA 3UZUA 4IBBA 1XN7A 3G2BA 4ITVA 3KETA 3A46A 3FXOA 2DODA 1D0KA 4L0YB 1TP4A 5C44J 2DA6A 3OYBA 3RKQA 2PJRB 2OQ4A 3RZDJ 1Q1HA 5EDNA 4IRHA 4AVPA 4D81A 2X4HA 5KQDA 5LMUM 3B6CA 5HODA 3ZN0A 1IBLM 4A2UA 1DUXC 1UAAA 3ZQJA 1P4WA 3QYFA 3TO6A 3S2HJ 2A5WA 5EXPA 2LOOA 2HPMA 2Q2EA 4NQWB 5J8CA 2R18A 4IXAA 3L26A 4HF0A 3BJAA 5DS9A 2FBKA 3HTSB 2DT6A 3TQNA 4LF9M 1WCMJ 5D5WB 3S3NA 2L0KA 4CYDA 3MD2A 3RQ4A 1USTA 2STWA 2EK5A 3TP3A 1N25A 5E1WA 1R4NB 2DOFA 2WBMA 3KZYA 5F04A 3BTJA 3BG7A 4XLNF 4AIJA 5IT9S 3CLOA 3Q0WA 5EEGA 4WWCA 1KQ9A 2CQKA 4ENMA 2HR3A 5EQTA 2CFOA 4BBSJ 5BPIA 2KFDA 1T0FC 3MZ8A 4RM3A 4KICA 3RGSA 2IGOA 2QQ9A 4B3AA 2NNYA 5CVJA 1VI0A 3P5JA 4RLFA 4FISA 1OCZH 2VF8A 1PUFA 3CZ6A 2F2EA 1I27A 4F91B 1PP8F 5CYVA 4RAFA 4AIHA 1E0EA 1QO0D 4EQQA 2OOAA 2K85A 1DGRM 4X65M 2JUGA 3I4NJ 2M8GX 5FTLA 3DLLF 3DXJF 1TDZA 3L2UA 5EP4A 3I59B 5K7ZA 4NBQA 3C3EA 1NNUC 5L3CA 1QGPA 1PJJA 3PIOF 4BGDA 3U6LA 4IBJA 3TWLA 1PUFB 2D1VA 3PFYA 2E1MB 4C2UA 3JRCA 3LVWA 3R61A 4ETSA 4IRIA 1QQWA 1OAOC 2BV6A 4I6ZA 3CLQA 4XR6A 1CF7B 1MMDA 4UY8I 4GXOA 4ZYGA 2JA2A 2Y30A 1U0JA 2MA3A 4BJ5C 1IV6A 1E3PA 4GEWA 1OR7C 1POGA 3K4BA 4L9JA 4AYBN 3JSOA 2UUZA 1VQ4I 3S2DJ 5K5RA 4HRIA 5FLVA 4GHAA 1U8BA 3U5ZB 3IC7A 4FCYA 4DBQA 3I55I 3EIHA 2WV0A 2HEOA 2I8DA 2NYXA 4BXUA 4KJZA 2KIFA 3S16J 3JAMS 1FTZA 1VQPI 4JK1X 3GLFA 4IOCF 3KXEC 4ESFA 2HAKA 4XLFA 2O25A 1L2DA 2BZTA 4A3LJ 1OPCA 2W82A 1ZV1A 3KOZE 1MNEA 3GFMA 1XGMA 2P6TA 4AKIA 1VQOI 2R7VA 2GIZA 2H1RA 3LSIA 1KU2A 3HOWJ 1BJAA 1V5EA 4Y28F 1B6AA 1UMQA 3GQ4A 1QQIA 1SC7A 2VKVA 2F5EA 4P5OA 4KHPM 4EVIA 4EIWA 4XRMA 2KRUA 1MH4A 2R5ZA 2QLZA 4DYRA 4HDUA 2KZGA 2Z7JA 4IX7A 1G4DA 3GTMJ 2CH0A 1JJ6C 3PO2J 4E7HA 1ZG5A 5C18A 4XRFA 1TQMA 4LB5A 1FP1D 2EILH 2A5YB 3HDDA 4BH9A 2OPTA 4U0YA 1K79A 4CICA 3S1RJ 3H92A 2MYSA 3DU5A 1FWZA 1G3YA 3BXWA 1ZMUA 1GV2A 4LK1F 4II7A 5EP1A 4IEJA 4PDKA 4DQ2A 3GYHX 1TWHJ 2H09A 1FOYA 2B9SA 1WWXA 1XSVA 1IQPA 2K4JA 4G6QA 3BLYA 2V4JC 3EDPA 5ICCA 2XB0X 4NC7A 4AC0A 4F55A 3FHZA 1NY5A 3B9PA 4IHXA 2B63J 2VJ4A 4ZDOA 1F36A 2EIKH 4BB9A 4B3SM 4Q5SF 1VG5A 2K0BX 2XV4S 1XSDA 2KP6A 4FETA 3OSGA 5FLXK 3A4CA 4XSZF 1W5SA 5GPCA 3GLIA 2ZMEA 4XICA 4CYCA 2Y69H 4JI6M 4P96A 4MO7A 4XLCA 1Z7LA 5E3LA 1G59A 1UM8A 4MQ9F 5J3LA 4BLCA 1W7PB 1K3XA 3Q8GA 2XSZA 1JKQC 2W48A 3K8ZA 2HXOA 3I64A 1WKMA 3HJQA 2J7OA 4MGZE 3GLIB 4JI7M 2HOAA 3MJ5A 1G2HA 2BXZA 4B48A 2PEXA 2IAIA 2ESNA 4OU0A 1VNDA 2V1CA 1BI0A 1EH6A 4F93B 3CCMI 1ETXA 3WE3A 4ZDPA 5DDGA 1KQ8A 5ITQA 2RGHA 2JT1A 5IYBJ 5L3EA 4KISA 3HB9A 4HOBA 3TDUC 2V1DA 1J59A 2B3TA 4E7IA 1F4KA 2K9LA 3P9CA 1RUOA 5DCMA 4HZFA 1L3LA 1F43A 3F8FA 2OU2A 2DJNA 1GVNA 3C58A 4QHTA 3H35A 1AHDP 1RKTA 2VB6A 3DBHB 2EH3A 3HHHA 4M6VA 1P4XA 1PRBA 1Z3YA 3LA7A 4XOPA 4HNUA 3JRFA 2LVSA 1TF0B 1VZ0A 2CYYA 2JRTA 1HKSA 4X62M 1Z5CA 5DCMB 2EFPA 1ZRDA 5D5UB 2R7UA 3FXLA 3HHXA 1RRJA 5JFRA 1FOWA 2F5DA 2Y21A 2DHRA 1YUBA 1O3SA 2HKOA 2P5LC 1F1ZA 2L7KA 4MTEA 4BJTA 1WGNA 2DI3A 3FBIB 3RKXA 3PO3J 2MROB 4HL4A 4EJUA 3HOUJ 1TR8A 2TDXA 3NQOA 1BJZA 4OOIA 4U7BA 1I50J 2VE9A 4ESBA 3H9JA 3J80S 3TWMA 2LVOC 4IVNA 4N4OB 2QNJA 2GXGA 2IA2A 3PIPF 3FZVA 3A01A 2DDBA 4L4UA 2DA4A 3FMSA 4RB0A 2AS5F 4XNFA 3G1OA 3Q3SA 4RAZA 1IN7A 1XMKA 4IRGA 3GPPA 1YG2A 1IY0A 3LMMA 1IGNA 2HOTA 1D8JA 1WJ7A 3X2QH 2HNHA 1R4MB 1V33A 1H6UA 4A69C 3CC7I 4ABZA 1JGGA 5DFLA 3J7BA 1HLVA 3C18A 4IL6C 4CCLA 2PLYA 5IOZA 1FMVA 4Z6YA 2ETHA 4R71A 3U1KA 3VYSB 3HX3A 1BIAA 4XLPF 3WE2A 3KOXE 4HLYA 1LUJB 2ELKA 1WJDA 2X51A 3AAFA 3A42A 3DQVC 5D8KB 4U87A 1XXHE 5FJ8J 2HZDA 4D82A 2RKHA 4LG0A 2O03A 3MMPA 2F5NA 2DMTA 2EFNA 3I5UA 3KEYA 1X2MA 3K0LA 4PJ0C 5DEQA 3ZXSA 2W00A 4JP0A 3KDSE 4BQOA 3E6DA 3EQLF 2VLAA 1V5GA 2D7GA 2W85A 4FX0A 3RTRA 4BXFA 1A31A 2PMUA 2GM4A 2M34A 2W1OA 2BXYA 3ZOBA 2EFOA 2M4KA 1JUMA 5JI3E 3QP5A 3GZNB 3IAS2 4LG0B 4FW9A 2Y0SN 2AHQA 1TGUA 3F23A 3M9AA 3GLFE 4MQVA 3GO8A 4RGRA 3PFIA 4XM3A 3GRVA 1RNLA 3PUFA 4OMZA 4NSRA 1SD4A 2ADUA 2YU3A 3ABTA 1Z05A 3V8JA 1GKIA 1I3AA 2HU9A 2VF7A 2RNJA 3BQYA 5HLIA 3BOQA 3SATA 2E5NA 3BZ6A 1OMIA 3SYTA 3IECA 4I8OA 2OV7A 2GQQA 3HRMA 4WURA 1G8XA 2XFTA 2DWZB 2ZMEC 3A45A 2RRUA 3BPVA 1R00A 2DMNA 1XNQM 3OYJA 1JQJC 1ETWA 5DV5A 3KLNA 1Z5AA 1ULYA 2FRHA 1NO1A 2XFSA 1Z6RA 4AIDA 2DAEA 2MH9A 2JY7A 2COMA 2KIMA 2BWEA 1DPUA 3B6AA 4BE0A 5KAIC 5FFXA 4YFNF 3KE2A 3B89A 1EJ9A 2DT5A 2ZBKB 2PMHA 4RB2C 4Y3OA 4G7HF 1QVRA 4KN4X 2K3FA 2DWMA 3EUHA 4QSHA 4I01A 2HKJA 2X85A 2KZUA 3I4MJ 5M5XJ 3PNVA 2BOLA 4DV4M 1J5YA 3FD9A 1I4WA 2ZO4A 3FK7A 2L2DA 1W4MA 3GTOJ 1TTEA 3PUBA 1X1DA 4EJWA 2QBYB 1IG7A 1V54H 2JUJA 3PSFA 3R4KA 4A3DJ 2TCTA 1TW2A 4M3EA 2YUSA 4LRTA 1D1BA 3CDIA 1XG1A 3QAHA 4OINF 5GTIC 3KYLA 2L09A 2DW4A 2VQLA 3IAM2 1R5LA 2VPRA 1ETYA 3GMEA 3F92A 1DGWY 3V7RA 1IXZA 3O6BB 5E1ZB 2KRFA 1K7AA 1VQ9I 4LG3A 1FSHA 2XAHA 3PJRA 3FKEA 2XAFA 2DI0A 2E5ZA 1JKOC 2HHHM 4BXXJ 1BI2A 3DOAA 3GLGB 4CCKA 5CVUA 3I56I 1UG2A 3FK6A 2LTPA 3HXLA 2CS3A 2ID3A 2DJIA 5JR3A 3J7AO 3W6KB 9ANTA 3FE3A 2PBIA 3V42A 5F1JA 2JVGA 1YI2I 4WK8F 1O3TA 3OYEA 2DNAA 4NOOB 3DLAA 1YIJI 2KHMA 4XLHA 3WGHA 3GFIA 3RZOJ 2E34A 1E3HA 2DA7A 3JR5A 3V8KA 4B43A 3BDDA 1VDLA 3CF2A 3HJSA 1ETVA 2QUFA 3V76A 4R8HA 1IXCA 1V5FA 4G6DA 1HXDA 5FTJA 2R65A 5ILUA 1IRGA 2XSDC 1C7YA 2XVCA 3AG3H 1WJAA 2L4MA 3CJQB 5BPDA 1HW2A 2DCEA 1R1UA 4IOAF 3IWFA 3SMSA 4L16A 3N05A 4OIRF 5IT3A 1PJQA 4LJAA 3GZ5A 2HXIA 4L9NA 1P6RA 2LKXA 4LFBM 2ZJ2A 1JTYA 3DTIA 1HSJA 3MQ0A 3LSRA 3ILKA 4QHSA 1GL7A 3GRRA 2HQRA 3SEQA 3BR5A 2F5PA 3TE6A 5ED4A 3CF6E 3ERED 3WTZA 1ORKA 4EEFG 4LJ7A 3W0LB 3CMAI 5E20A 4IZZA 4HW0A 4M3BA 1V4RA 4HA8A 1NJFA 3IWZA 2IVMA 4UVAA 4BQQA 2V9KA 2DAMA 4PUSA 2CV1A 3BTLA 2EJSA 1TQPA 3U6EA 4C3JJ 2Y9YA 5JVTA 3GQ3A 4GYGA 4MHGA 2A69F 5D6FA 4RB1A 4YELA 3I54A 2D45A 4OMYA 4G4OA 1VTNC 4CUGA 5IT9Z 3SYKA 1X1BA 2DPDA 1YITI 2HVSA 4A3VB 2X6OA 4B44A 2P5TA 3SDGA 1WJ5A 3QPSA 2J5OA 2VQCA 3HBLA 3Q9SA 4IBCA 1GLNA 4JX5A 3SQNA 2JPBA 3VKGA 3CUQB 3RCOA 3VYTB 4YEJA 2A61A 1YHQI 2LR8A 4AZFA 2MFZA 1Y39A 3WTUC 2ACJA 1OKRA 3U60A 2HVRA 5M5YJ 1T33A 3VDUA 1OFIA 2FJ1A 3KEQA 4M3DA 2ZJPF 1QUTA 3L7WA 5KQ8A 4IHYA 5FTNA 4V2GA 1IRFA 3IL2A 1NNJA 1MW7A 1LE8A 3GTQJ 1ZRCA 2DFFA 1IJWC 1X37A 3HOYJ 4WP2A 4CCNA 1MDMB 2GAUA 3U60B 1LFPA 3FHNA 2XAUA 5K5QA 4UHTA 3EUHC 5FKMA 1S7OA 3U21A 3HSRA 1V34A 4LIUA 3SHFA 1OQYA 2GIVA 3KP1E 4L5IA 4U0VA 1REPC 3OS2A 4L6V6 1R6BX 3E1SA 3K1PA 1X4PA 1IUYA 1K83J 4G6ZA 3IH4A 4XK4A 3EYYA 3F0CA 1U9OA 3HIFA 1NVMA 1IUFA 2E2IJ 1EFUB 1W36D 1LFBA 2OF7A 1VQKI 3FYDA 5J1YA 3JAMK 4G4NA 1PJTA 1JB0F 5D6EA 1JT0A 2DA2A 3PSIA 3VK8A 1D0YA 3IRQA 4FE7A 3F21A 4CSWA 5HNFA 1H8AC 4RAYA 3KOYE 2QM3A 2CEAA 2G5GX 5JHUA 3HHYA 1IXSB 2NVTJ 1KONA 4DR2M 3KCCA 1SXJE 4XOTA 5L3BA 5FRNA 1WZ2A 4CCOA 1R5GA 3DBRB 1OCTC 1KU7A 4B3TM 1A36A 4JX4A 3COAC 1ZQ9A 1ZARA 1UHSA 4BACA 3K2AA 3MZHA 4BS9A 1MH3A 2WTEA 3OYCA 3HHZA 2GXAA 2JK3A 3F3XA 3ZMDA 2PQ8A 4J00A 1ZMWA 5HLGA 1GUUA 4G7ZF 1ZKGA 3WGIA 2XAJA 4R3DA 3JW4A 3R6SA 4BYYA 3JR9A 1OJLA 2I5UA 2HOSA 2R7OA 4ASNA 3CCUI 2IS2A 1I5ZA 1MNDA 3B73A 3SAWA 3HKZN 2V9PA 2MH2A 2E5LM 5DM6F 1J0RA 4AI6A 3G1LA 3L2QA 3G73A 4XK8F 4AU7A 1AOYA 1CUKA 1UJ8A 2CW0F 2ZXHA 4FVMA 2HQNA 2DU9A 2FF4A 1U2WA 3HPHA 1LEBA 2CSOA 1GHCA 1MX0A 2H8RA 3GBGA 2VDBB 5A2QZ 2F6CA 2NVXJ 5FLMJ 4XBOA 2UXXA 1IY2A 2DHYA 2BYVE 4CZZA 4FCVA 4GMQA 1SFXA 2JSPA 2JTVA 5LFAA 2CU7A 3MN2A 4NRWA 3WHLA 3BT9A 4JYKA 4KMUX 3LSHA 2MGQA 3HRUA 1KU9A 3MFKA 3S1QJ 2DK5A 2KZSA 3AV0A 3BY6A 2H6CA 4M3FA 5C4XJ 4DR5M 4U7DA 3TBIA 1QUSA 2ISZA 4TV7A 5F0HA 4HSRA 2X49A 3CJTB 4LF6M 3DZDA 2E7XA 2XIGA 1BM9A 3W2VA 2P7VB 2HYGD 3ZCOA 5CJ9A 4JOMA 3WODF 3WU0A 4GDFA 2ID6A 3VLFB 1MMSA 2LH9A 1GABA 1E9SA 3ECOA 2XF7A 2F4MB 5HVQC 2LREA 2W25A 4I09A 3HOXJ 3J7AY 4B4CA 2VN2A 4A3FJ 4OIOF 3OOUA 2ZB9A 2LNBA 2M9HA 2Z2SB 3H9QA 4V19K 1T56A 3KSXA 2Q1ZB 2IPQX 3WTSC 1KGSA 1K4SA 1WJFA 2BW3A 2HWJA 3U6SA 3NRVA 3UJNA 2XGCA 4A6DA 2G0EA 3QRFF 1LPQA 3HJ8A 5EJCA 1MSFC 5ITRA 2JN6A 3CC2I 3RGPA 1A04A 1E94E 1BOBA 2ZNZA 4NB5A 3CJNA 3L9FA 1PJSA 2XUBA 3CCLI 1X3ZB 2IJLA 2XHKA 1KA8A 1B9MA 2JY8A 1HQYE 3HC7A 4XSXF 4AKHA 2DTRA 2E1OA 1E32A 4HEA2 5KCMA 2AHMA 4DV1M 1TNTA 2L4AA 3CESA 3J27B 3DWLE 3RPQA 3BC8A 3A1YA 1U6GA 5BOXA 3ZQIA 3ULQB 1FYLA 2QQAA 4LGWA 5E6JA 3FKIJ 3CCEI 2CHGA 4UUVA 5EXXA 1C1KA 5IREB 5DD8A 1RR8C 2XAGA 1MBGA 3PXGA 1KYIA 2LY1A 3MVPA 3EPZA 3J80K 4E7KA 2Q0OA 3KFWX 1IY1A 3QPLA 1USSA 5BR8M 3FTEA 5FB2A 1IAWA 4PFOA 5D4SA 4A6EA 3T1HM 1SXJD 4OVZB 3K4MA 3J7ZI 1ZGWA 2FSWA 1DGHA 1SEUA 3I51A 1WJCA 2APLA 1QAQA 2XDVA 2VQFM 3QYEA 3BR6A 3T6PA 4ESJA 1GJSA 2AO9A 4EM2A 1QRYA 2ESHA 5LHIA 2O6GE 1VQNI 2CV2A 1NTCA 2EWNA 3K1NA 2GQFA 1FYMA 4FX4A 1O57A 2DZOB 4DR7M 1TZLA 1ZQ3P 1DGHB 1Z6TA 2CO5A 3EYIA 2R4JA 1HDDC 1UHWA 2W24A 3C2HA 3KLOA 1UZCA 1PYVA 2GOMA 2LBFA 3WG7H 5LHHA 4I7HA 1RETA 4D5FA 4I0BA 3O8HA 5GAHJ 1VQ8I 3LOCA 1G71A 2CUFA 3OTOM 4LRSA 3ZP5A 2M87A 2H5XA 4AG5A 2QWWA 4IBEA 4OX9M 3S15J 4DUZM 3K4JA 1IZ1A 3F8NA 4A5MA 2G7HA 2GA1A 2PI0A 2P0WA 4O3MA 1F4IA 2Q2EB 3PNYA 1R5ID 1TTYA 2R7QA 3D0SA 4IBDA 1I3QJ 5IYDJ 4A0XA 1RPWA 3OS1A 2VBZA 1H9GA 4B7FA 1GL6A 2VT3A 2Q8KA 3J81S 1IN4A 4D80A 4JI4M 2L54A 1C0WA 2IS1A 2VJJA 4ZYEA 3FX3A 2WY8Q 1LDJA 1I6XA 1GT0C 3ML6A 2C9OA 1N36M 2W7NA 2XSJC 2BBYA 3SC3A 5EGOA 3IH3A 4IQJA 4G4RA 4FCWA 3M8JA 4LFUA 3AL0C 3CD6I 2L3DA 2C9CA 3HUGA 1GJTA 1U5TA 2HPIA
chains in the Genus database with same CATH topology
1XB2B 2MROB 3ESWB 1AIPC 1ZV1A 1DO2A 1T43A 1TR8A 1HJPA 2HWJA 3E46A 1OQYA 2MGWA 1VEKA 2ZTDA 2K9DA 2LVOC 2L4EA 1DV0A 3F92A 2QNJA 1VQ1A 1R4GA 1E94E 4Q7JA 2DI0A 1V92A 2LVNC 1Y8GA 3BBZA 3LCVB 1X3ZB 4F2LA 1EFUB 1PGYA 1WJ7A 2JY8A 1HQYE 2JNHA 3FRHA 4DBGB 2LTUA 3FE3A 1VEGA 1MN3A 2DNAA 2KHHA 5DFLA 1GO5A 1TP4A 1QZEA 1ZMUA 4R71A 2DAGA 2MR9A 1VDLA 1KYIA 3GLGE 3K9OA 1XXHE 1UFZA 3MMPA 1A5TA 1C7YA 1IM2A 2DENA 2KNVA 2KNAA 4G3OA 1X3WB 1OKSA 2R0IA 1VG5A 2K0BX 2OOBA 1OAIA 1ZMWA 3T6PA 2DKLA 2WZJA 2LVQD 2QHOB 2DAKA 3FRIA 2QSFX 3GLFE 2QSGX 2KNZA 4F1IA 1G41A 1IFYA 2BWBA 1CUKA 1ZMVA 4YIRX 2DAMA 2L4FA 1VEJA 2EJSA 3E21A 1Q02A 1WIVA 2LBCA 2LVPC 3IECA 2OOAA 1T6OA 2DHYA 2G3QA 2H5XA 2JY6B 2RRUA 2JY5A 3GLHE 3K9PA 1SG9A 1PVEA 2JZ0A 1WGLA 2EKKA 2DAIA 2DAEA 2JY7A 2LVAA 2BWEA 1OTRA 2B3TA 2JZ1A 1F4IA 2ZTCA 3GLIE 3B89A 1DO0A 1JR3E 3IHPA 1WGNA 2OO9A 2MJ5B 2DZLA 1P3QQ 2F4OB 4GEWA 1HT2E 1NV9A 1NV8A 2CWBA 1WHCA 2QSHX 2F4MB 3H4JA 5JI2E 1G3IA 1HT1E 1BVSA 1IXSA 2L2DA 1TTEA 1YLAA 2JP7A 4UN2B 4HEOA 1G4AE 2CP8A 2JUJA 3LCUA 4WP2A 2HAKA 2EKFA 1WR1B 2O25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XB2 B;  2MRO B;  3ESW B;  1AIP C;  1ZV1 A;  1DO2 A;  1T43 A;  1TR8 A;  1HJP A;  2HWJ A;  3E46 A;  1OQY A;  2MGW A;  1VEK A;  2ZTD A;  2K9D A;  2LVO C;  2L4E A;  1DV0 A;  3F92 A;  2QNJ A;  1VQ1 A;  1R4G A;  1E94 E;  4Q7J A;  2DI0 A;  1V92 A;  2LVN C;  1Y8G A;  3BBZ A;  3LCV B;  1X3Z B;  4F2L A;  1EFU B;  1PGY A;  1WJ7 A;  2JY8 A;  1HQY E;  2JNH A;  3FRH A;  4DBG B;  2LTU A;  3FE3 A;  1VEG A;  1MN3 A;  2DNA A;  2KHH A;  5DFL A;  1GO5 A;  1TP4 A;  1QZE A;  1ZMU A;  4R71 A;  2DAG A;  2MR9 A;  1VDL A;  1KYI A;  3GLG E;  3K9O A;  1XXH E;  1UFZ A;  3MMP A;  1A5T A;  1C7Y A;  1IM2 A;  2DEN A;  2KNV A;  2KNA A;  4G3O A;  1X3W B;  1OKS A;  2R0I A;  1VG5 A;  2K0B X;  2OOB A;  1OAI A;  1ZMW A;  3T6P A;  2DKL A;  2WZJ A;  2LVQ D;  2QHO B;  2DAK A;  3FRI A;  2QSF X;  3GLF E;  2QSG X;  2KNZ A;  4F1I A;  1G41 A;  1IFY A;  2BWB A;  1CUK A;  1ZMV A;  4YIR X;  2DAM A;  2L4F A;  1VEJ A;  2EJS A;  3E21 A;  1Q02 A;  1WIV A;  2LBC A;  2LVP C;  3IEC A;  2OOA A;  1T6O A;  2DHY A;  2G3Q A;  2H5X A;  2JY6 B;  2RRU A;  2JY5 A;  3GLH E;  3K9P A;  1SG9 A;  1PVE A;  2JZ0 A;  1WGL A;  2EKK A;  2DAI A;  2DAE A;  2JY7 A;  2LVA A;  2BWE A;  1OTR A;  2B3T A;  2JZ1 A;  1F4I A;  2ZTC A;  3GLI E;  3B89 A;  1DO0 A;  1JR3 E;  3IHP A;  1WGN A;  2OO9 A;  2MJ5 B;  2DZL A;  1P3Q Q;  2F4O B;  4GEW A;  1HT2 E;  1NV9 A;  1NV8 A;  2CWB A;  1WHC A;  2QSH X;  2F4M B;  3H4J A;  5JI2 E;  1G3I A;  1HT1 E;  1BVS A;  1IXS A;  2L2D A;  1TTE A;  1YLA A;  2JP7 A;  4UN2 B;  4HEO A;  1G4A E;  2CP8 A;  2JUJ A;  3LCU A;  4WP2 A;  2HAK A;  2EKF A;  1WR1 B;  2O25 A; 
#chains in the Genus database with same CATH topology
 2J5P A;  2FU4 A;  2M5W A;  1AIP C;  2VBX A;  4JI5 M;  3ESW B;  2YNM D;  3CP8 A;  3I53 A;  2XRO A;  3HHW A;  1QHH D;  4O6J A;  1G3T A;  4JI2 M;  3F22 A;  1XXH A;  5H37 D;  5LD2 C;  3I0T A;  2V1X A;  3AKZ A;  5M3M J;  2L7Z A;  1EIJ A;  3BR2 A;  4DBR A;  3N4M A;  1FYK A;  2J5Y A;  1K82 A;  2LFB A;  2EZK A;  1M1E B;  3CMM A;  3U61 A;  3TQS A;  1ENH A;  4S12 A;  3ABM H;  4L5E A;  2C99 A;  1QAN A;  2OBP A;  2VE8 A;  2KT0 A;  2JZY A;  3U9G A;  2VI6 A;  4Q48 A;  5HS9 A;  3AOG A;  3QWL A;  3SAU A;  2HDW A;  4ZC3 A;  4D5C A;  3V7C A;  3K2Z A;  5KNL A;  3SDB A;  1H9T A;  4JI0 M;  3SHG B;  3KS8 A;  2XGN A;  4MLO A;  2Y9Z A;  2YQZ A;  4BEH A;  1XWI A;  3ZQG A;  4HBL A;  3VB2 A;  1PM5 A;  3QU3 A;  4YIF A;  4DR3 M;  2KHH A;  2KDO A;  4I76 A;  2EFQ A;  1QZE A;  3GLX A;  1TH3 A;  3LW5 F;  1FJL A;  2LYC A;  4A3C J;  4RNA A;  1YJ9 I;  3ZR8 X;  3TGN A;  1SVO A;  3GLL A;  5GPA A;  4M6X A;  3FUW A;  4PT5 A;  1A35 A;  3SAV A;  4DR1 M;  3RPU D;  3L27 A;  1HNW M;  3TKY A;  1FEX A;  5FTM A;  3ZRG A;  2Y0S A;  2VJI A;  3GLF B;  1G6N A;  4FQG A;  1BOA A;  5FD5 A;  2BY0 A;  4B47 A;  4G12 A;  3BPX A;  3BJ6 A;  3K7A J;  4IJF A;  4M0D A;  1BI3 A;  1EH7 A;  1Y6I A;  3I3L A;  4GC5 A;  3T5X A;  3SJM A;  4A3I J;  2M7A A;  3KZZ A;  2RNG A;  1VQ6 I;  2B0L A;  5TJJ A;  1BC7 C;  3M8E A;  2HTJ A;  1XGO A;  4Y33 A;  3TED A;  2QHO B;  2EZI A;  3E6C C;  2QSF X;  2L9R A;  2R5Z B;  4LJ9 A;  3KP0 E;  4UB8 C;  4ON0 A;  5IP9 J;  4QLC U;  4RAG A;  2EA0 A;  4GFB A;  2R0Q C;  3RYP A;  4OWR B;  1T08 B;  1K78 A;  2K86 A;  3A0H C;  2CG4 A;  3OIO A;  2L7I A;  5J8F A;  3CCV I;  1HBX G;  5LRS A;  2DOA A;  5DTD A;  4TUW A;  5ILV A;  3BR1 A;  2JY6 B;  3LSM A;  2X1E A;  4OAZ A;  4BQN A;  1BW5 A;  1TLH B;  1E9R A;  1N34 M;  2NOG A;  3KPH A;  1YE9 A;  5A2Q S;  1OCP A;  4IHS A;  4E4H A;  4QOS A;  2LVA A;  3GXO A;  2A3S A;  4QWQ A;  2E1C A;  1MBH A;  4K2E A;  1S7E A;  3E4R A;  4DUY M;  2RC4 A;  3LAP A;  4A0Y A;  2L9S A;  3DFZ A;  5GTH C;  4Z8X A;  2L9V A;  1ZEL A;  2QCO A;  3PQK A;  1QDT A;  4LB6 B;  4ENN A;  2ZXI A;  4WXC A;  4LF5 M;  2FH0 A;  3FM3 A;  4D7N A;  1S3J A;  2DZL A;  5B5E C;  2ZME B;  1YYV A;  2ICW G;  4CYC B;  1ZGA A;  2LMD A;  4G8X A;  3F8B A;  2R46 A;  4I81 A;  2ECC A;  2KW0 A;  2GLO A;  1R36 A;  2D5V A;  4XL9 A;  3OSF A;  5HOO A;  2DZN B;  1HQC A;  3SMP A;  3CF0 A;  3U6Q A;  1Z0X A;  2EZH A;  2WA0 A;  1R49 A;  4ZPX A;  4M72 A;  2L7M P;  3LCU A;  5F3W A;  1S5L C;  2FOW A;  2X4A A;  3OOP A;  4G4Q A;  3FWE A;  1YFH A;  2WAQ N;  2Z9O A;  1UFM A;  1L0O C;  1T43 A;  4I98 B;  2CV0 A;  3C3W A;  1CF7 A;  4O5V A;  2ZJQ F;  3MCZ A;  3A98 B;  1G8P A;  1QZY A;  2DA3 A;  2QEN A;  3Q9V A;  3KP5 A;  4EJO A;  4WX9 A;  4M9S A;  4X66 M;  1R4G A;  4MM3 B;  4ANR A;  4YHH M;  3NBI A;  1LDK B;  2BVM A;  3J2P B;  1NSF A;  1L2C A;  4HLX A;  1U5T C;  1R2Z A;  1IDY A;  5CQE A;  2XB5 A;  4CA0 A;  3CUO A;  2KMU A;  4PK4 A;  2PG4 A;  1DPR A;  5C1B A;  2JSC A;  3OS0 A;  1LB2 A;  2CQ7 A;  1RI7 A;  2JMW A;  2QGU A;  3CDL A;  3JRE A;  1SFK A;  5GP9 A;  4E7S A;  3HSE A;  4UXN A;  2K9M A;  2FEZ A;  1OFC X;  1SAU A;  2FBH A;  3S1M J;  3MKZ A;  4ZYA A;  3LWF A;  1HST A;  2CQQ A;  3IG8 A;  2E60 A;  2LKP A;  3W68 A;  4RGU A;  1ZLJ A;  5CLS A;  2MBF A;  3OYF A;  2UXB M;  2LHC A;  3G6E I;  4V2F A;  1PUE E;  1VDD A;  5ILS A;  3DTE A;  1U3E M;  3OL4 A;  3OR1 C;  3BZC A;  1Y56 A;  1JKP C;  3S1N J;  4PCZ A;  5DYM A;  1TW3 A;  3T1B A;  4OU7 A;  4XON A;  1P7I A;  2LK2 A;  4KUM A;  1Z5B A;  5E18 F;  2VC0 A;  3KIO A;  4D0P A;  2DAO A;  5M5W J;  3A01 B;  2E71 A;  2OPF A;  4LJZ F;  3F8C A;  1RUN A;  1WI3 A;  2BGC A;  2XKP A;  1G41 A;  2JJ7 A;  3MKL A;  4WW0 A;  3GPX A;  1D0L A;  2HTS A;  4CIZ A;  1X2N A;  4LJ8 A;  4M74 A;  2RV8 A;  5M3F J;  3GTK J;  1NK2 P;  4G94 A;  4E7Z A;  3GFJ A;  3OYK A;  2L6O A;  2Z4R A;  1V3F A;  3PVS A;  3D5R C;  1WIV A;  4II3 A;  3WU2 C;  2XRL A;  5F6F A;  3O2P E;  3GWZ A;  5KVR A;  2LNH C;  1ZN2 A;  2P81 A;  1HW5 A;  3AG1 H;  4X1E A;  5E3O A;  1S3S A;  3H9G A;  4NHJ A;  3JCU C;  5FO5 A;  3R8F A;  2PX9 A;  1L2B A;  2X8A A;  2E2H J;  1B8I A;  3A03 A;  3GRU A;  2XC7 A;  1MJ9 A;  1IRX A;  1SG9 A;  3AG2 H;  2Y2Z A;  1T98 A;  4MNU A;  3TOA A;  1PJI A;  2DMU A;  5ERI A;  4BHC A;  1QZZ A;  3HU2 A;  2LRD A;  4AW4 A;  4C2M J;  3DKY A;  4H0E A;  2LF7 A;  1WXQ A;  1N77 A;  3IUO A;  3AJI B;  1HKT A;  2XZF A;  1TC3 C;  4NL4 H;  5IZ7 D;  5F0F A;  2F4V M;  2CHQ A;  2ISY A;  5B3S H;  3GUD A;  1BR2 A;  3KZI C;  3LSP A;  2R7W A;  1TWF J;  4HLQ A;  2JRM A;  2F4O B;  3K70 D;  2R45 A;  3GFL A;  2DFI A;  4RGX A;  1SD5 A;  4EJV A;  4IIW A;  4DYC A;  2BEO A;  2K27 A;  3CQZ J;  1G3I A;  3R60 A;  1BVS A;  2ZXJ A;  3SFI A;  5HLH A;  4M3G A;  1L8Q A;  2WAD A;  1FY7 A;  1O4X A;  1L1Z A;  3MWM A;  3PNT A;  3Q0V A;  2ZM6 M;  3ABK H;  4LZZ A;  4KA4 A;  1IBM M;  3HGG A;  3F6V A;  1XB2 B;  3FBN B;  3TDZ C;  1S72 I;  3TO7 A;  2KDZ A;  4X64 M;  3JR4 A;  4MGH A;  2LHG A;  1ZTR A;  4BU2 A;  5D8L B;  1W36 C;  5E17 F;  3MK6 A;  3Q8X A;  3B7N A;  1SXJ A;  5ITY A;  3TPZ A;  4AG6 A;  2ZTD A;  1D1C A;  2GA2 A;  3GO5 A;  3TOB A;  5HNH A;  5C4J J;  4RF1 A;  1MJG M;  3W2W A;  1LJ9 A;  3E7L A;  1XMX A;  1P2F A;  4J01 A;  4C30 A;  2RN7 A;  3GTG J;  4LLL A;  2EUC A;  3ZCB B;  1PDN C;  4L18 B;  2YR2 A;  2Z3Y A;  3P9I A;  3GQ5 A;  4PSW A;  1J7K A;  3RFW A;  1BIB A;  4XKC A;  2MH8 A;  2OTJ I;  1AKH A;  2DBB A;  3T38 A;  2L7H A;  2WSC F;  3DPL C;  1S9H A;  2DN0 A;  1F5T A;  1Z7U A;  1JHH A;  1HA8 A;  1B1B A;  3HSF A;  1A6Q A;  2FD5 A;  1Z21 A;  1BN5 A;  2RQP A;  1X19 A;  4Y52 J;  2M45 A;  2MLK A;  4IBF A;  4Y4R A;  1P9Q C;  4IO9 F;  4KNY A;  1TT5 B;  2R44 A;  4BNC A;  4UNO A;  2CGP A;  3FTD A;  2O7O A;  2DEN A;  1MZB A;  3HKZ A;  4GHL A;  2NNN A;  2LXE A;  4IBG A;  3K1M A;  2NQ8 C;  5ITU A;  2JUC A;  2XRN A;  3F9K A;  2R5Y A;  4RF0 A;  1I39 A;  2OOB A;  4FWH A;  2D2W A;  2IP2 A;  5KK1 A;  1R9T J;  4NSO B;  4S0H B;  1TQI A;  2M30 A;  4PGG A;  1K6O A;  1BA5 A;  2LVQ D;  1AA7 A;  1KYW A;  4GKK M;  4GKJ M;  2CUZ A;  1YW9 A;  2VON A;  1G3S A;  3FXK A;  5LBQ A;  1GDT A;  2UUC M;  3K92 A;  1R1T A;  5DNY A;  4DNC A;  4LLG F;  3I4V A;  1IFY A;  3TW7 A;  3ZH9 B;  2FML A;  3OR2 C;  1Z67 A;  2MAB A;  1JKR C;  1BBY A;  2KIS A;  2DA1 A;  1WPK A;  1ONV A;  3KP7 A;  3KSJ A;  2AXL A;  4M9Z A;  3GTJ J;  2LVP C;  3M6A A;  1XPX A;  2V6E A;  3HM5 A;  4FWG A;  2WSF F;  2CWE A;  3ELK A;  2QQB A;  5DUK A;  1KQ0 A;  1XD7 A;  3GLH E;  3K9P A;  5EEA A;  3D8B A;  4X0G A;  4F7Z A;  1IC8 A;  1OIZ A;  2O8X A;  3TW6 A;  2KIQ A;  1J2X A;  4ZTJ A;  1QDR A;  1HF0 A;  2FQ3 A;  3T0Y A;  1JR3 E;  2RGV A;  4BHP A;  3P7N A;  3FF5 A;  5K7F A;  4GIP A;  2K3P A;  2UXN A;  3KP2 A;  2MJ5 B;  4YG2 F;  1SD6 A;  2Y0Q A;  2QZ4 A;  3DFG A;  3L28 A;  2CWB A;  3K1J A;  3K10 A;  1WHC A;  1WRJ A;  1BC8 C;  4HNT A;  4G6T B;  1T2K A;  3C2G A;  2EA4 A;  4LFC M;  3RE8 A;  3DV8 A;  4L5J A;  2JA5 J;  2Z16 A;  3ABL H;  3L25 A;  3EET A;  3U6O A;  1YS7 A;  3ZMV A;  2JP7 A;  4B7G A;  2R6F A;  3BG5 A;  4PDG A;  4ITQ A;  2YSR A;  2IT0 A;  1MU5 A;  5E79 C;  2V1U A;  4HV6 A;  3RPU A;  2BY2 A;  3EIE A;  2FMY A;  5JI6 A;  2CRG A;  3J81 Z;  5IT9 K;  2H94 A;  1QPI A;  2Y20 A;  1LDD A;  2VT2 A;  4DV0 M;  5K5O A;  5F64 A;  2R4G A;  4IHW A;  3BOS A;  3QOP A;  5L3F A;  5KAF C;  1IN6 A;  4NNJ A;  3DKW A;  3P9K A;  3IKT A;  1V92 A;  3UK6 A;  2O01 F;  3L09 A;  4KOD A;  4BE2 A;  2OQG A;  3LFK A;  3D8L A;  3HU3 A;  5LHG A;  1FOK A;  1PGY A;  2JNH A;  4DBG B;  2COB A;  5ITT A;  4DV2 M;  2F5S A;  2BNK A;  1R6R A;  3ZQL A;  1SXJ C;  3M07 A;  3FUT A;  2A05 A;  4AM3 A;  2VII A;  1YS6 A;  4XOR A;  4RS8 A;  2V6Z M;  3BR3 A;  3CCS I;  4II2 A;  2FE3 A;  4ZTF A;  4JN6 A;  2RAE A;  3V7S A;  4LFA M;  1NG6 A;  3CME I;  1HDP A;  5F1R A;  3A02 A;  5E8I A;  4XRS A;  3HTU A;  2DQR A;  1LE8 B;  2F5Q A;  2AXT C;  4I2O A;  1UFZ A;  2EV0 A;  2K02 A;  3REO A;  3VPR A;  4IJE A;  4XKB A;  2BY1 A;  3FUV A;  1MMA A;  2CW7 A;  3TP0 A;  4XKV A;  3SYL A;  3FXR A;  5FSW A;  3FXU A;  4N0B A;  3L2R A;  4IF4 A;  2IRF G;  2R0I A;  2JXN A;  1YSY A;  4Y7N J;  3W2A A;  2X9D A;  3H36 A;  3QU6 A;  3ECH A;  3I4P A;  1R71 A;  5EXS A;  4EGZ A;  3HU1 A;  2H27 A;  3BG3 A;  3OYL A;  1W7P D;  1QAO A;  4YII A;  1BR4 A;  2UXC M;  2VUM J;  3GZ6 A;  2KNZ A;  4F1I A;  2V6C A;  4S05 A;  4FD2 A;  2EV6 A;  4XKW A;  4GCV A;  1LNW A;  2L4F A;  4LGM A;  1XC8 A;  2XZU A;  1XMO M;  1DGG A;  1FPQ A;  1RC9 A;  3VOE A;  5J4V A;  3M1E A;  4MFE A;  3HGI A;  1ZK8 A;  4RGS A;  4I02 A;  3D5L A;  3FKJ A;  3ZMU A;  3IRR A;  1Y1W J;  4CDG A;  4CCM A;  1Z91 A;  3I58 A;  3RDI A;  2ZSI B;  3R9X B;  1WGX A;  3BG9 A;  5CPR B;  2L7F P;  3MAJ A;  1F9N A;  4DV6 M;  3HZJ A;  3TMO A;  2DVW B;  4LIV A;  1ZGJ A;  2DMQ A;  4HX8 A;  2HYF A;  1ZG1 A;  3NBX X;  5H2F C;  5H6Q A;  3NWL A;  2P4W A;  4JXJ A;  4CCJ A;  3D1N I;  3PM1 A;  3PQJ A;  4QPO A;  4YFK F;  3MKW B;  3TWK A;  1W1W E;  3LST A;  1NHA A;  4IQ4 A;  1I6H J;  2ECB A;  3NWS A;  3L1P A;  2H1K A;  3E5U A;  5KO3 A;  3M7G A;  4E7L A;  2R3S A;  4IKF A;  4KN7 X;  3CCR I;  2KRC A;  1VFC A;  1OCC H;  4NC8 A;  4YRV A;  1JR3 D;  1P92 A;  1P3Q Q;  4LG2 A;  4GYI A;  1Q3B A;  1NV9 A;  3DEW A;  1GXP A;  3E5X A;  5B1A H;  1O3R A;  1QZM A;  3FTC A;  2OCC H;  3QOE A;  3L2V A;  2Z4S A;  3FYC A;  2OJE D;  4PJJ A;  1EV7 A;  1YLA A;  3E9S A;  1HR0 M;  2E2J J;  1H0M A;  1S8N A;  5A2Q K;  1AU7 A;  2KKO A;  4AYB A;  1U78 A;  2I10 A;  2X6Y A;  4EGY A;  4LOC A;  3PL8 A;  5FKO A;  2VL8 A;  1N78 A;  4L78 A;  2XGX A;  4CHU A;  3L2W A;  3U2R A;  1QVU A;  3FTF A;  4W1U A;  4E6K G;  4JI8 M;  4JV5 M;  1R2Y A;  2F5O A;  5CVV A;  1PP7 U;  3GCM A;  1T39 A;  5FTK A;  2HYJ A;  4LJ4 A;  2WB1 N;  4ZZD A;  5HDK A;  1HCR A;  3GTL J;  1FTT A;  1VF9 A;  2IXS A;  4B3M M;  2K9Q A;  3FXQ A;  3JTH A;  5CVR A;  4AUX A;  4CH7 A;  3U6D A;  3AL0 B;  4BKX A;  3L29 A;  3SFZ A;  2EV5 A;  1JHF A;  5F08 A;  2QP9 X;  1D0Z A;  2VBY A;  2G8L A;  1SMY F;  1TWC J;  3CP2 A;  5D5X B;  3BR0 A;  4EJT A;  2C98 A;  4LLN A;  4RA2 A;  2K6B A;  2MC3 A;  3FM5 A;  3WHC A;  2QPA A;  1OFH A;  7CAT A;  1FBQ A;  2JVH A;  3ASN H;  3THG A;  1B72 A;  2HQA A;  4GH9 A;  2M1B A;  1IV8 A;  3K2L A;  1E2X A;  2M0M A;  4HV5 A;  2FOK A;  4EMS A;  1BW6 A;  2YPR A;  2P8T A;  4L8R C;  1XDU A;  2Z1D A;  4OAY A;  2KNV A;  5JLX A;  1YX5 A;  2HWV A;  4G3O A;  4I99 C;  4MGI E;  1JUS A;  1UCR A;  2BW3 B;  4M0W A;  1GVD A;  2EIM H;  3S8P A;  3TO9 A;  1FT9 A;  2M7B A;  2OUM A;  3FMQ A;  3OYH A;  4B09 A;  3W6V A;  3KOW E;  2DKL A;  1OIS A;  3HRT A;  4QOZ C;  1SMT A;  1MBJ A;  2UUA M;  3L00 A;  3FRI A;  2LG4 A;  3MHV C;  4ZJZ A;  2ZAM A;  4H4K C;  4OW0 A;  1ON2 A;  2IGK A;  3RI4 A;  2IGM A;  2X1D A;  2L5Q A;  2OCE A;  5B66 C;  3OYM A;  1K61 A;  3H3U A;  1EF4 A;  4E7J A;  1UG0 A;  4U0W A;  3WG9 A;  1DU0 A;  1FIP A;  2Y0T A;  2LBC A;  1OYI A;  3D5S C;  3VK7 A;  2K5C A;  2M0C A;  4K0K M;  2DYR H;  4QNR A;  1YQA A;  3B7Z A;  2KQR A;  3O3K A;  1YRN A;  1DU6 A;  3M8F A;  1WHU A;  3VDP A;  2L2O A;  1XSX A;  3U6C A;  2UXD M;  2OAZ A;  2HOE A;  2NOJ B;  1ZAO A;  1VQ7 I;  2JZ0 A;  4M73 A;  5CQG A;  5L3G A;  1JE8 A;  1ORY B;  5IWA M;  4BHB A;  3J7Y J;  2Y48 A;  2JWT A;  1T38 A;  1NK3 P;  2MD5 A;  3FXJ A;  4DR6 M;  5E3M A;  1U8R A;  4B1R A;  2LP0 A;  3H0G J;  4LD5 A;  1DO0 A;  2ZXW H;  1R23 A;  4PSX A;  1FBS A;  2O0Y A;  3ASO H;  4YY3 M;  3OL3 A;  3IG5 A;  2WAQ A;  3AG4 H;  2FXA A;  4RBO A;  2PJR A;  2VOP A;  2DA5 A;  2UU9 M;  4C3H J;  1TWA J;  3DPT A;  3K9T A;  3QP6 A;  4CZC A;  3E6B A;  5DYG A;  2R7F A;  3HRS A;  3HJE A;  5L8R F;  3WTX C;  2GNO A;  3T15 A;  1Y0N A;  4LF4 M;  1CGP A;  2YS9 A;  4NQW A;  1QBJ A;  2W57 A;  3W6J B;  2X1C A;  2LBF B;  3ABU A;  4IHV A;  2ZFU A;  1EH8 A;  4L9V A;  2ME6 A;  2YFQ A;  1DGB A;  2E35 A;  2ELJ A;  1OCO H;  1VEK A;  3R0J A;  1DV0 A;  1MBF A;  1QA6 A;  1N75 A;  2TRT A;  2UUB M;  3LAJ A;  1ITY A;  2AQE A;  2FE8 A;  1LKX A;  2XAQ A;  6PAX A;  1X1A A;  5EZH A;  4HYE A;  2K40 A;  4QIW N;  3DEE A;  4MEY F;  2OD5 A;  3F72 A;  3TL4 X;  2VXD A;  1ZYR F;  4FAS D;  2FFJ A;  4JI3 M;  2KZV A;  1QAM A;  3O8G A;  5HS8 A;  5K7H A;  1J9I A;  2LDU A;  2DFH A;  2IBD A;  2I7N A;  2CW8 A;  1EE8 A;  1E3O C;  3LVV A;  2IS4 A;  2R7T A;  4MGR A;  4Z2Y A;  3DTK A;  1NY6 A;  3I59 A;  1YTY A;  2MR9 A;  2CUE A;  2NVQ J;  3SAS A;  2LY9 A;  2WAF A;  2HL7 A;  1MMN A;  3K9O A;  3V4G A;  5EGO B;  3OYN A;  4QNM A;  1D8K A;  3M1C A;  2XPV A;  2R93 J;  4BBA A;  3CGW A;  4RMN A;  2UZK A;  3Q5F A;  3BTI A;  5KHD A;  1IM2 A;  3HUG B;  1U5T B;  2DMP A;  2VC1 A;  1IRZ A;  3ZPL A;  1WVR A;  1AWC A;  2PJP A;  4NXM M;  1X3W B;  4U88 A;  4R1H A;  3WTV C;  3KP4 A;  2JA8 J;  4L15 A;  1XXH B;  1RES A;  2VKH A;  4UV9 A;  4IBI A;  1DP3 A;  1GV5 A;  5DUI A;  3U61 B;  3U5Z A;  3DBL B;  1TDH A;  5IP7 J;  2YU9 J;  2Z3X A;  3KX2 A;  3T8R A;  5J6X A;  2QSG X;  3BCB A;  1O7L A;  3ZQH A;  1NHW C;  3BTC A;  2VKD A;  4F92 B;  1Y8Q B;  1XGN A;  3LQR A;  1ZMV A;  4GC9 A;  4R7G A;  2MG4 A;  1SVM A;  4BEH B;  1Q02 A;  5HS7 A;  5IPA A;  5LLQ A;  4FCT A;  5AIP A;  3I04 M;  4HF2 A;  3DF8 A;  4XQF A;  1T6S A;  2EBI A;  2G3Q A;  4LCB A;  4NRV A;  5CVI A;  1GXQ A;  4LF7 M;  1DDN A;  2RDP A;  3KEO A;  2JY5 A;  3SXY A;  1JI8 A;  3K70 C;  1RZ4 A;  1YIO A;  4HQM A;  1OTR A;  5LEJ A;  2XGD A;  4LZJ A;  2PMZ N;  1QU3 A;  4IJA A;  2LLK A;  2XF3 A;  1HNX M;  1NHG C;  2K7L A;  4A93 J;  5TIS C;  2F48 A;  4I5S A;  1XX5 A;  1JXS A;  2K47 A;  3ZMT A;  1ZHF A;  2IW5 A;  2KLO A;  4OIP F;  2I7P A;  4ZYH A;  4P9U A;  1DGF A;  1FP2 A;  3I71 A;  1HT2 E;  2DO7 A;  5IYC J;  1KFV A;  2CRU A;  4Q47 A;  3ZQ7 A;  1LVK A;  1OLT A;  4CGY B;  2QSH X;  2A6H F;  2WAE A;  3CO7 C;  1EA3 A;  4Y13 A;  2WWY A;  1BI1 A;  1Q1V A;  2LH0 A;  3JRD A;  2F5V A;  3G4S I;  4UN2 B;  1NJG A;  4HEO A;  2XAS A;  3J7A S;  2VKE A;  2E7W A;  2DLL A;  2W84 A;  5EP3 A;  4DV3 M;  4L9T A;  1K78 B;  3T8T A;  3C2B A;  4M6Y A;  2WSE F;  1HJP A;  3SAR A;  2ME0 A;  2PN6 A;  3EUA A;  2QA4 I;  4C3I J;  4P9F A;  2R7X A;  3LA2 A;  2BE5 F;  2N8G A;  4NXN M;  1SFU A;  5DYI A;  2D7E A;  1VQ1 A;  2RRE A;  5FLX Z;  1P7J A;  2KRK A;  3ZMS A;  4LJ6 A;  1YOV B;  2KA6 B;  2LVN C;  5BS6 A;  4DR4 M;  1W7P A;  3JRI A;  3UKG A;  1DP7 P;  1Y8G A;  3LCV B;  4A3M J;  2VAS A;  1Z1D A;  3LQQ A;  5LRR A;  4KMF A;  2J7N A;  3OWT A;  5E1X A;  2M8E A;  5LGN A;  3S17 J;  1MMG A;  1HC8 A;  1HW1 A;  2JQ7 A;  4C9Y A;  2IA0 A;  3WTY C;  2HQ5 A;  1OIP A;  3OYA A;  2UWM A;  1ETO A;  5J1U A;  4AWX B;  3WTT C;  2HVQ A;  3NWT A;  1TH2 A;  1TH4 A;  1MKM A;  2A6E F;  4GGG A;  5FFZ A;  4X6A J;  1ACI A;  3FIW A;  2NS0 A;  5DM7 F;  1T95 A;  2AQF A;  3QOD A;  1LEA A;  4XN3 A;  1J75 A;  3QPT A;  5E3N A;  1ZG3 A;  5BQT A;  5HDG A;  2FOI C;  2CHV A;  1KYZ A;  3OYD A;  4PDI A;  4NDL A;  1VQM I;  2B7E A;  1XMQ M;  5BMZ A;  1OKS A;  3GLH A;  8CAT A;  4HX4 A;  1ETK A;  1WH5 A;  2IA1 A;  4LK0 F;  5ICF A;  2XPW A;  4MH0 E;  5J40 A;  3VDX A;  2OTL I;  2OZ6 A;  1U9N A;  3CF5 F;  3MEX A;  5EP2 A;  2WZJ A;  2O61 A;  4WCG A;  2R92 J;  5H6R A;  4D1Q A;  2VPL A;  3JRA A;  4KDP A;  4CGZ A;  1JR3 A;  2X48 A;  2E1M C;  1P4A A;  2EQR A;  3BQZ A;  4ENJ A;  3GLH B;  2OC6 A;  4LJ5 A;  3BZK A;  3W3C A;  1MJA A;  2BHY A;  3S93 A;  2M4G A;  3E97 A;  3QQA A;  4YFX F;  1JJ8 C;  4MIM A;  5AON A;  2CMP A;  3BG6 A;  2GBY A;  1WSU A;  1B9N A;  3T1Y M;  4CJ6 A;  1T6O A;  3GW2 A;  2P6S A;  2Y31 A;  2DYS H;  2KEB A;  2VJ5 A;  3ROU A;  2LY2 A;  3LSK A;  4P17 A;  1MD0 A;  2GXB A;  2HGC A;  2H6B A;  1SAX A;  3H4M A;  3HKP A;  2DXI A;  1PVE A;  5BPV A;  2M5Z A;  1FIA A;  1OYY A;  3DP7 A;  4HAM A;  3SZG A;  5CKT A;  3GRY A;  1HOM A;  2LC2 A;  1Q39 A;  3AOE A;  2NXN B;  4UVC A;  5FRO A;  4EM1 A;  2VIX A;  2DDA A;  3R0A A;  4Q4Z F;  3FDY A;  5GAE J;  4KYW A;  5D4R A;  4DZJ A;  2ELH A;  2O5R A;  3LA3 A;  2FQ4 A;  1MSE C;  3GPU A;  2HZT A;  4DJA A;  4A3B J;  2FA5 A;  3GP1 A;  3K4K A;  4RDU A;  1JUP A;  3H4J A;  3JSP A;  1FBU A;  4KLN A;  4GO1 A;  3BWG A;  5ITX A;  2QQ8 A;  2GOX B;  1PJR A;  4ZYD A;  2A68 F;  4UUS A;  3ZQC A;  1RIO H;  3VOD A;  3V8L A;  4XLA A;  3VSK A;  3LNQ A;  4Y15 A;  1O7F A;  1SVL A;  3F6O A;  2IGN A;  2VBW A;  1QHG A;  3KP3 A;  3VYU B;  5F27 A;  4DOZ A;  3DA1 A;  4MB7 A;  2CE7 A;  2WC2 A;  3UNG C;  2DOE A;  2MGW A;  3HOT A;  3U6M A;  4UUS B;  2HDD A;  2K9D A;  2XF6 A;  4REZ A;  4LIT A;  2CQX A;  1B8I B;  3HOS A;  1A5J A;  1IN5 A;  4KO8 A;  3NEU A;  3KP6 A;  4HG2 A;  3RJP A;  2EO2 A;  2ZAO A;  4Q7J A;  3DPU A;  3AFH A;  1QYR A;  1ODD A;  1XGS A;  3H1C A;  1VQ5 I;  2DWL A;  4MGY E;  4A3G J;  1ZR4 A;  4F2L A;  3CTW B;  2BJW A;  2H1L A;  3OV8 A;  3FRH A;  1IN8 A;  2CJJ A;  2ZNY A;  3I9V 2;  1JTX A;  4BAY A;  5IOY A;  1VEG A;  1XNR M;  1KU3 A;  1MIJ A;  4B08 A;  4A3K J;  2A07 F;  3BP8 A;  5ICG A;  1J09 A;  1GO5 A;  2UV1 A;  4HF1 A;  4WF2 A;  4LF8 M;  4OIQ F;  1UEL B;  2E36 A;  3LL7 A;  2NS7 A;  1N33 M;  2IS6 A;  4C2T A;  2QCU A;  5F0C A;  3OY9 A;  4EAT A;  3U1D A;  2KJB A;  2OZU A;  2HDC A;  1D2N A;  3F8M A;  1K3W A;  1LVA A;  2EFW A;  1XTA A;  1A5T A;  2ZSH B;  1WFX A;  3HPG A;  3MKY B;  4KIF A;  5JHF A;  4A5N A;  2EA2 A;  2KNA A;  1R22 A;  1ON1 A;  2VQG A;  2ZBK A;  2K4B A;  4PCQ A;  4UVB A;  1WQ2 A;  2QKL B;  2R7R A;  5FD6 A;  1SXJ B;  1LV7 A;  3FXM A;  1D0X A;  3HHG A;  3LFU A;  3OMY A;  3JRH A;  4PJL A;  3RKY A;  1X4O A;  1YW7 A;  5LGT A;  3CDH A;  1EKE A;  1X1C A;  2V26 A;  1FOX A;  2VOO A;  1ZAE A;  4B3R M;  1N32 M;  3ERM A;  1OCR H;  1ZLK A;  2QBY A;  2BWB A;  2F4I A;  2XH9 A;  5J4Y A;  4YIR X;  2RVC A;  2F5F A;  2K9N A;  1VEJ A;  1R7R A;  3L2A A;  2QZ8 A;  3CO6 C;  4RM2 A;  2HFH A;  1AKH B;  4CHT B;  1T3T A;  4CO8 A;  2MSY A;  2N35 A;  2LF8 A;  3FMR A;  4IPA A;  2EB7 A;  1LFU P;  2M3A A;  2KIU A;  2ZJR F;  3HOZ J;  4JBA A;  1XS9 A;  4BBR J;  2DTZ A;  1B4A A;  2O3F A;  5IP6 A;  1XCB A;  2L01 A;  2LWX A;  3MZY A;  1FZP B;  2D7H A;  5H20 A;  2EKK A;  3GEZ A;  4P1W A;  5HLT A;  3M4O J;  2KXE A;  2X6W A;  2FUG 2;  4HPQ A;  3ZQQ A;  4J19 A;  3GLG A;  3GLI E;  2BVL A;  4RLQ A;  1FNN A;  4BE1 A;  1IBK M;  2H8W A;  1FMW A;  1V55 H;  3KS4 A;  3JRB A;  2STT A;  1AUA A;  5TRD A;  4D9J A;  4HX7 A;  5ICE A;  2R5Y B;  1XDS A;  3MMY B;  4WXD A;  1DQU A;  3RKW A;  3SEZ A;  1TNS A;  2FX0 A;  3HEF A;  1YJN I;  1NV8 A;  3JTG A;  2HS5 A;  4DV5 M;  3E0J B;  2QF7 A;  4CXF A;  4JI1 M;  1HT1 E;  3SZT A;  3K6G A;  2R62 A;  3WHK A;  2WB1 A;  4XID A;  1G4A E;  1MBE A;  3VFD A;  1IXR C;  3AOE C;  2MW8 A;  4EV0 A;  1Y1V J;  3G1M A;  1E17 A;  2DWN A;  5C3E J;  3UR3 C;  2NVU B;  2HCB A;  5FGM A;  3HL2 A;  4PGH A;  3KW6 A;  4DV7 M;  1RKW A;  2LSO A;  3U6P A;  1SAN A;  1QVT A;  1YX3 A;  3E3V A;  4UV8 A;  3M0E A;  1D3Y A;  1SD7 A;  4ZZL A;  2EZL A;  2K9S A;  3VSL A;  3CCJ I;  4MGK E;  3BBZ A;  3GX4 X;  5FLX S;  3HYI A;  3IP4 B;  1OYW A;  4PFP A;  3CC4 I;  3UGJ A;  1L1T A;  1H88 C;  3WTW C;  4F3Q A;  1R7J A;  2YX7 A;  2ZCW A;  3GVA A;  1K4T A;  1LTM A;  3KFU G;  1W5C C;  4B3X A;  3ZC7 B;  1FX7 A;  4KIB A;  4BQA A;  2MLG A;  3C7J A;  5LGU A;  4M9X A;  3QPH A;  3HGY A;  1QPM A;  3B74 A;  1WH7 A;  1FC3 A;  2OQR A;  4P16 A;  2L02 A;  5KPR A;  1W0T A;  2V7F A;  4M71 A;  3K4N A;  1X3U A;  3J81 K;  3CUQ A;  1O3Q A;  2DT7 B;  4W5W A;  2Z8Y M;  4UB6 C;  4GIT A;  3W67 A;  3VFZ A;  3EUK L;  2R7Z J;  2DFE A;  5EG0 A;  2OA4 A;  5ITX E;  1FSE A;  2WY7 Q;  1CQT A;  1FLI A;  2L9N A;  4LGY A;  5EXT A;  1X1P A;  4BY7 J;  1APL C;  4N9I A;  3WU1 B;  1YO5 C;  1SFE A;  2EIJ H;  2FS1 A;  2BHZ A;  5J47 A;  4KT6 A;  3CJR B;  3WGG A;  2R7S A;  2NRA C;  1STZ A;  3FUX A;  2Y75 A;  5KPT A;  3FUU A;  1MDM A;  5E26 A;  2ZKZ A;  3RIR A;  5EG0 B;  4N4N B;  4L0Z B;  1T8I A;  1UB9 A;  3LSJ A;  3RSN A;  3H3Z A;  5FKL A;  2NAZ A;  3OYI A;  2LKS A;  2JPC A;  2O8K A;  1BR1 A;  3B02 A;  3ZMZ A;  3S2W A;  5K1Y A;  4BUP A;  1S29 A;  2HKX A;  3HY5 A;  3ZQF A;  1XHB A;  4W97 A;  4ANJ A;  1K6Y A;  3HG9 A;  3G3Z A;  1HNZ M;  2W4S A;  1Z3X A;  2X0L A;  2XGE A;  2ZTC A;  2GZW A;  2KL4 A;  3KYD B;  4G9Y A;  1GVJ A;  4CIS A;  2M2E A;  3ZGK A;  4FTH A;  3HWS A;  2QKM B;  3E5Q A;  1ERD A;  2ERC A;  1X58 A;  5E8G A;  2EJR A;  2Z33 A;  2QVO A;  4IHT A;  4B7H A;  1MJB A;  3BRO A;  2OO9 A;  3K69 A;  5LMN M;  4LY6 A;  3QAU A;  3SBJ A;  2KJC A;  3ONQ A;  3JAM Z;  1B59 A;  4HQE A;  3GTP J;  4XN0 A;  5EEH A;  2V9V A;  2XSZ D;  1G3W A;  2CFX A;  2R4E A;  2NS8 A;  4ZH4 F;  1R5H A;  3C3D A;  3W0F A;  1IXS A;  3Q0U A;  2JWS A;  1S7A A;  1YW8 A;  3IHU A;  3IH2 A;  4LMY A;  2FBI A;  1TBX A;  4DW6 A;  4BDZ A;  2E1N A;  3CCQ I;  2PFB A;  3L2C A;  2CP8 A;  3IV5 A;  3N97 A;  2KPM A;  1Y0U A;  1JGS A;  1TT0 A;  1WGL A;  4IBK A;  4DIQ A;  1VQL I;  4S04 A;  5HDN A;  4ENK A;  1YJW I;  2VQH A;  3HOV J;  4PJN A;  2BJV A;  2E19 A;  3CTA A;  3QYB A;  2ZC2 A;  1I94 M;  2VXZ A;  3DCF A;  4QPQ A;  1WI9 A;  2XPU A;  3OIQ A;  3UMM A;  5L3D A;  3G71 I;  4G7O F;  3E6M A;  5LEK A;  4A3E J;  4D7M A;  3H0D A;  5FKN A;  5JVG F;  1D5Y A;  1I1G A;  5DCF A;  3OYG A;  4KIG A;  3VEP A;  4A12 A;  2RKO A;  2EIN H;  1ETQ A;  2XKO A;  3A0B C;  1FJG M;  3KYC B;  5J1R A;  1HKQ A;  5EYR A;  2O9L A;  1QNT A;  1MN3 A;  1W0U A;  3S3O A;  4B8X A;  1J5E M;  2MD0 A;  4JQF A;  2JA6 J;  3C9P A;  4MEX F;  2G7U A;  2Y0M A;  3CMY A;  3GPY A;  3VWB A;  4FT8 A;  5EF6 A;  2P5K A;  3NAU A;  1LQ1 A;  2DAG A;  1IDZ A;  3K4C A;  1Q3C A;  2VQE M;  4I4L A;  3C1D A;  5FKK A;  1XB4 A;  3GLG E;  1A6I A;  1D0M A;  1RU3 A;  2A6T A;  1T0F A;  2V1N A;  2X6X A;  2QEX I;  4HNV A;  4BY1 J;  2XF5 A;  1D1A A;  3DU6 A;  3OIP A;  3DKX A;  3LSG A;  5AIQ A;  2F5C A;  4DZP A;  4KIT B;  4WXH A;  1MGT A;  5GKN A;  4NUB A;  3NAR A;  4XMY A;  5BNG A;  2DPU A;  1I1S A;  1R1V A;  1OAI A;  2V79 A;  2RQQ A;  2P7C B;  1R58 A;  2RGO A;  1SFO J;  3WHB A;  4BL0 B;  1TWG J;  1NG7 A;  2DAK A;  1YLF A;  4FE4 A;  4BDY A;  3K4L A;  3H3V K;  4MFD A;  4E70 A;  5D5V B;  1WJB A;  3CUQ C;  2XEP A;  4KT0 F;  4AVZ A;  4KFC A;  2KDL A;  2CUJ A;  3S3M A;  3E21 A;  3BJO A;  1XCV A;  1IO2 A;  1ZH5 A;  4PZJ A;  2M60 A;  1XC5 A;  4HST A;  2PMZ A;  2ZAN A;  4I0A A;  4XLE A;  2YX4 A;  2WV1 A;  3RYR A;  2R7D A;  4R79 A;  1ZRF A;  3S14 J;  3I4Y A;  2ZFW A;  4HDV A;  4BJ6 C;  4NC6 A;  1OR7 A;  4KT5 C;  2YR0 A;  5GAG J;  1B72 B;  2FNA A;  4FWD A;  4RB3 C;  2DQL A;  3ZN1 A;  2DAI A;  2C5R A;  2D1H A;  1Z9C A;  2EPF A;  2JZ1 A;  1ZR2 A;  4EM0 B;  2GWR A;  3H5R A;  2IEK A;  3DEU A;  3RQI A;  2BY3 A;  2HI3 A;  2FNP A;  1TL8 A;  5KPZ A;  3GF2 A;  3IHP A;  2CQN A;  2Z5U A;  4N9H A;  3I01 M;  5GAD J;  4PJM A;  5FRM A;  4A3J J;  1W5T A;  1ZRE A;  5B1B H;  2VOD A;  2LD5 A;  3B7Q A;  3KVW A;  1JT6 A;  3BCA A;  4AKG A;  1H89 C;  1MNM C;  4QTR A;  2Z99 A;  2C6Y A;  4AQY M;  4AIK A;  1IF1 A;  5EZG A;  1S6L A;  5JI2 E;  3JRG A;  4UUT A;  4JYA M;  4RKU F;  3VYR B;  2JA7 J;  1Z59 A;  2G9W A;  2DK8 A;  2NVY J;  2XLJ A;  4MTD A;  4F52 A;  3H5N A;  1UHM A;  3H5A A;  4Y17 A;  3J80 Z;  1BL0 A;  5JLW A;  4PD2 A;  5IY5 H;  4XGI A;  2EKF A;  1WR1 B;  4OVZ A;  4DGW B;  1DO2 A;  3IKV A;  3CCY A;  4ZDL A;  2P5V A;  1RR7 A;  3E46 A;  1IW7 F;  4AD9 A;  1YRN B;  3A2K A;  3SZP A;  1Y8R B;  3ISP A;  2L4E A;  4DYQ A;  4A0Z A;  3FIS A;  1MBK A;  4FHT A;  4JX6 A;  1XMA A;  1NH3 A;  4P55 A;  1KZH A;  2QYO A;  5TGT A;  3M3Y J;  1D5V A;  4XBF A;  2C96 A;  1KSF X;  2MC4 A;  3S32 A;  1Z77 A;  1WJE A;  4XRS G;  2KRH A;  3VKH A;  4GRI A;  5DD4 A;  2LTU A;  3UZU A;  4IBB A;  1XN7 A;  3G2B A;  4ITV A;  3KET A;  3A46 A;  3FXO A;  2DOD A;  1D0K A;  4L0Y B;  1TP4 A;  5C44 J;  2DA6 A;  3OYB A;  3RKQ A;  2PJR B;  2OQ4 A;  3RZD J;  1Q1H A;  5EDN A;  4IRH A;  4AVP A;  4D81 A;  2X4H A;  5KQD A;  5LMU M;  3B6C A;  5HOD A;  3ZN0 A;  1IBL M;  4A2U A;  1DUX C;  1UAA A;  3ZQJ A;  1P4W A;  3QYF A;  3TO6 A;  3S2H J;  2A5W A;  5EXP A;  2LOO A;  2HPM A;  2Q2E A;  4NQW B;  5J8C A;  2R18 A;  4IXA A;  3L26 A;  4HF0 A;  3BJA A;  5DS9 A;  2FBK A;  3HTS B;  2DT6 A;  3TQN A;  4LF9 M;  1WCM J;  5D5W B;  3S3N A;  2L0K A;  4CYD A;  3MD2 A;  3RQ4 A;  1UST A;  2STW A;  2EK5 A;  3TP3 A;  1N25 A;  5E1W A;  1R4N B;  2DOF A;  2WBM A;  3KZY A;  5F04 A;  3BTJ A;  3BG7 A;  4XLN F;  4AIJ A;  5IT9 S;  3CLO A;  3Q0W A;  5EEG A;  4WWC A;  1KQ9 A;  2CQK A;  4ENM A;  2HR3 A;  5EQT A;  2CFO A;  4BBS J;  5BPI A;  2KFD A;  1T0F C;  3MZ8 A;  4RM3 A;  4KIC A;  3RGS A;  2IGO A;  2QQ9 A;  4B3A A;  2NNY A;  5CVJ A;  1VI0 A;  3P5J A;  4RLF A;  4FIS A;  1OCZ H;  2VF8 A;  1PUF A;  3CZ6 A;  2F2E A;  1I27 A;  4F91 B;  1PP8 F;  5CYV A;  4RAF A;  4AIH A;  1E0E A;  1QO0 D;  4EQQ A;  2OOA A;  2K85 A;  1DGR M;  4X65 M;  2JUG A;  3I4N J;  2M8G X;  5FTL A;  3DLL F;  3DXJ F;  1TDZ A;  3L2U A;  5EP4 A;  3I59 B;  5K7Z A;  4NBQ A;  3C3E A;  1NNU C;  5L3C A;  1QGP A;  1PJJ A;  3PIO F;  4BGD A;  3U6L A;  4IBJ A;  3TWL A;  1PUF B;  2D1V A;  3PFY A;  2E1M B;  4C2U A;  3JRC A;  3LVW A;  3R61 A;  4ETS A;  4IRI A;  1QQW A;  1OAO C;  2BV6 A;  4I6Z A;  3CLQ A;  4XR6 A;  1CF7 B;  1MMD A;  4UY8 I;  4GXO A;  4ZYG A;  2JA2 A;  2Y30 A;  1U0J A;  2MA3 A;  4BJ5 C;  1IV6 A;  1E3P A;  4GEW A;  1OR7 C;  1POG A;  3K4B A;  4L9J A;  4AYB N;  3JSO A;  2UUZ A;  1VQ4 I;  3S2D J;  5K5R A;  4HRI A;  5FLV A;  4GHA A;  1U8B A;  3U5Z B;  3IC7 A;  4FCY A;  4DBQ A;  3I55 I;  3EIH A;  2WV0 A;  2HEO A;  2I8D A;  2NYX A;  4BXU A;  4KJZ A;  2KIF A;  3S16 J;  3JAM S;  1FTZ A;  1VQP I;  4JK1 X;  3GLF A;  4IOC F;  3KXE C;  4ESF A;  2HAK A;  4XLF A;  2O25 A;  1L2D A;  2BZT A;  4A3L J;  1OPC A;  2W82 A;  1ZV1 A;  3KOZ E;  1MNE A;  3GFM A;  1XGM A;  2P6T A;  4AKI A;  1VQO I;  2R7V A;  2GIZ A;  2H1R A;  3LSI A;  1KU2 A;  3HOW J;  1BJA A;  1V5E A;  4Y28 F;  1B6A A;  1UMQ A;  3GQ4 A;  1QQI A;  1SC7 A;  2VKV A;  2F5E A;  4P5O A;  4KHP M;  4EVI A;  4EIW A;  4XRM A;  2KRU A;  1MH4 A;  2R5Z A;  2QLZ A;  4DYR A;  4HDU A;  2KZG A;  2Z7J A;  4IX7 A;  1G4D A;  3GTM J;  2CH0 A;  1JJ6 C;  3PO2 J;  4E7H A;  1ZG5 A;  5C18 A;  4XRF A;  1TQM A;  4LB5 A;  1FP1 D;  2EIL H;  2A5Y B;  3HDD A;  4BH9 A;  2OPT A;  4U0Y A;  1K79 A;  4CIC A;  3S1R J;  3H92 A;  2MYS A;  3DU5 A;  1FWZ A;  1G3Y A;  3BXW A;  1ZMU A;  1GV2 A;  4LK1 F;  4II7 A;  5EP1 A;  4IEJ A;  4PDK A;  4DQ2 A;  3GYH X;  1TWH J;  2H09 A;  1FOY A;  2B9S A;  1WWX A;  1XSV A;  1IQP A;  2K4J A;  4G6Q A;  3BLY A;  2V4J C;  3EDP A;  5ICC A;  2XB0 X;  4NC7 A;  4AC0 A;  4F55 A;  3FHZ A;  1NY5 A;  3B9P A;  4IHX A;  2B63 J;  2VJ4 A;  4ZDO A;  1F36 A;  2EIK H;  4BB9 A;  4B3S M;  4Q5S F;  1VG5 A;  2K0B X;  2XV4 S;  1XSD A;  2KP6 A;  4FET A;  3OSG A;  5FLX K;  3A4C A;  4XSZ F;  1W5S A;  5GPC A;  3GLI A;  2ZME A;  4XIC A;  4CYC A;  2Y69 H;  4JI6 M;  4P96 A;  4MO7 A;  4XLC A;  1Z7L A;  5E3L A;  1G59 A;  1UM8 A;  4MQ9 F;  5J3L A;  4BLC A;  1W7P B;  1K3X A;  3Q8G A;  2XSZ A;  1JKQ C;  2W48 A;  3K8Z A;  2HXO A;  3I64 A;  1WKM A;  3HJQ A;  2J7O A;  4MGZ E;  3GLI B;  4JI7 M;  2HOA A;  3MJ5 A;  1G2H A;  2BXZ A;  4B48 A;  2PEX A;  2IAI A;  2ESN A;  4OU0 A;  1VND A;  2V1C A;  1BI0 A;  1EH6 A;  4F93 B;  3CCM I;  1ETX A;  3WE3 A;  4ZDP A;  5DDG A;  1KQ8 A;  5ITQ A;  2RGH A;  2JT1 A;  5IYB J;  5L3E A;  4KIS A;  3HB9 A;  4HOB A;  3TDU C;  2V1D A;  1J59 A;  2B3T A;  4E7I A;  1F4K A;  2K9L A;  3P9C A;  1RUO A;  5DCM A;  4HZF A;  1L3L A;  1F43 A;  3F8F A;  2OU2 A;  2DJN A;  1GVN A;  3C58 A;  4QHT A;  3H35 A;  1AHD P;  1RKT A;  2VB6 A;  3DBH B;  2EH3 A;  3HHH A;  4M6V A;  1P4X A;  1PRB A;  1Z3Y A;  3LA7 A;  4XOP A;  4HNU A;  3JRF A;  2LVS A;  1TF0 B;  1VZ0 A;  2CYY A;  2JRT A;  1HKS A;  4X62 M;  1Z5C A;  5DCM B;  2EFP A;  1ZRD A;  5D5U B;  2R7U A;  3FXL A;  3HHX A;  1RRJ A;  5JFR A;  1FOW A;  2F5D A;  2Y21 A;  2DHR A;  1YUB A;  1O3S A;  2HKO A;  2P5L C;  1F1Z A;  2L7K A;  4MTE A;  4BJT A;  1WGN A;  2DI3 A;  3FBI B;  3RKX A;  3PO3 J;  2MRO B;  4HL4 A;  4EJU A;  3HOU J;  1TR8 A;  2TDX A;  3NQO A;  1BJZ A;  4OOI A;  4U7B A;  1I50 J;  2VE9 A;  4ESB A;  3H9J A;  3J80 S;  3TWM A;  2LVO C;  4IVN A;  4N4O B;  2QNJ A;  2GXG A;  2IA2 A;  3PIP F;  3FZV A;  3A01 A;  2DDB A;  4L4U A;  2DA4 A;  3FMS A;  4RB0 A;  2AS5 F;  4XNF A;  3G1O A;  3Q3S A;  4RAZ A;  1IN7 A;  1XMK A;  4IRG A;  3GPP A;  1YG2 A;  1IY0 A;  3LMM A;  1IGN A;  2HOT A;  1D8J A;  1WJ7 A;  3X2Q H;  2HNH A;  1R4M B;  1V33 A;  1H6U A;  4A69 C;  3CC7 I;  4ABZ A;  1JGG A;  5DFL A;  3J7B A;  1HLV A;  3C18 A;  4IL6 C;  4CCL A;  2PLY A;  5IOZ A;  1FMV A;  4Z6Y A;  2ETH A;  4R71 A;  3U1K A;  3VYS B;  3HX3 A;  1BIA A;  4XLP F;  3WE2 A;  3KOX E;  4HLY A;  1LUJ B;  2ELK A;  1WJD A;  2X51 A;  3AAF A;  3A42 A;  3DQV C;  5D8K B;  4U87 A;  1XXH E;  5FJ8 J;  2HZD A;  4D82 A;  2RKH A;  4LG0 A;  2O03 A;  3MMP A;  2F5N A;  2DMT A;  2EFN A;  3I5U A;  3KEY A;  1X2M A;  3K0L A;  4PJ0 C;  5DEQ A;  3ZXS A;  2W00 A;  4JP0 A;  3KDS E;  4BQO A;  3E6D A;  3EQL F;  2VLA A;  1V5G A;  2D7G A;  2W85 A;  4FX0 A;  3RTR A;  4BXF A;  1A31 A;  2PMU A;  2GM4 A;  2M34 A;  2W1O A;  2BXY A;  3ZOB A;  2EFO A;  2M4K A;  1JUM A;  5JI3 E;  3QP5 A;  3GZN B;  3IAS 2;  4LG0 B;  4FW9 A;  2Y0S N;  2AHQ A;  1TGU A;  3F23 A;  3M9A A;  3GLF E;  4MQV A;  3GO8 A;  4RGR A;  3PFI A;  4XM3 A;  3GRV A;  1RNL A;  3PUF A;  4OMZ A;  4NSR A;  1SD4 A;  2ADU A;  2YU3 A;  3ABT A;  1Z05 A;  3V8J A;  1GKI A;  1I3A A;  2HU9 A;  2VF7 A;  2RNJ A;  3BQY A;  5HLI A;  3BOQ A;  3SAT A;  2E5N A;  3BZ6 A;  1OMI A;  3SYT A;  3IEC A;  4I8O A;  2OV7 A;  2GQQ A;  3HRM A;  4WUR A;  1G8X A;  2XFT A;  2DWZ B;  2ZME C;  3A45 A;  2RRU A;  3BPV A;  1R00 A;  2DMN A;  1XNQ M;  3OYJ A;  1JQJ C;  1ETW A;  5DV5 A;  3KLN A;  1Z5A A;  1ULY A;  2FRH A;  1NO1 A;  2XFS A;  1Z6R A;  4AID A;  2DAE A;  2MH9 A;  2JY7 A;  2COM A;  2KIM A;  2BWE A;  1DPU A;  3B6A A;  4BE0 A;  5KAI C;  5FFX A;  4YFN F;  3KE2 A;  3B89 A;  1EJ9 A;  2DT5 A;  2ZBK B;  2PMH A;  4RB2 C;  4Y3O A;  4G7H F;  1QVR A;  4KN4 X;  2K3F A;  2DWM A;  3EUH A;  4QSH A;  4I01 A;  2HKJ A;  2X85 A;  2KZU A;  3I4M J;  5M5X J;  3PNV A;  2BOL A;  4DV4 M;  1J5Y A;  3FD9 A;  1I4W A;  2ZO4 A;  3FK7 A;  2L2D A;  1W4M A;  3GTO J;  1TTE A;  3PUB A;  1X1D A;  4EJW A;  2QBY B;  1IG7 A;  1V54 H;  2JUJ A;  3PSF A;  3R4K A;  4A3D J;  2TCT A;  1TW2 A;  4M3E A;  2YUS A;  4LRT A;  1D1B A;  3CDI A;  1XG1 A;  3QAH A;  4OIN F;  5GTI C;  3KYL A;  2L09 A;  2DW4 A;  2VQL A;  3IAM 2;  1R5L A;  2VPR A;  1ETY A;  3GME A;  3F92 A;  1DGW Y;  3V7R A;  1IXZ A;  3O6B B;  5E1Z B;  2KRF A;  1K7A A;  1VQ9 I;  4LG3 A;  1FSH A;  2XAH A;  3PJR A;  3FKE A;  2XAF A;  2DI0 A;  2E5Z A;  1JKO C;  2HHH M;  4BXX J;  1BI2 A;  3DOA A;  3GLG B;  4CCK A;  5CVU A;  3I56 I;  1UG2 A;  3FK6 A;  2LTP A;  3HXL A;  2CS3 A;  2ID3 A;  2DJI A;  5JR3 A;  3J7A O;  3W6K B;  9ANT A;  3FE3 A;  2PBI A;  3V42 A;  5F1J A;  2JVG A;  1YI2 I;  4WK8 F;  1O3T A;  3OYE A;  2DNA A;  4NOO B;  3DLA A;  1YIJ I;  2KHM A;  4XLH A;  3WGH A;  3GFI A;  3RZO J;  2E34 A;  1E3H A;  2DA7 A;  3JR5 A;  3V8K A;  4B43 A;  3BDD A;  1VDL A;  3CF2 A;  3HJS A;  1ETV A;  2QUF A;  3V76 A;  4R8H A;  1IXC A;  1V5F A;  4G6D A;  1HXD A;  5FTJ A;  2R65 A;  5ILU A;  1IRG A;  2XSD C;  1C7Y A;  2XVC A;  3AG3 H;  1WJA A;  2L4M A;  3CJQ B;  5BPD A;  1HW2 A;  2DCE A;  1R1U A;  4IOA F;  3IWF A;  3SMS A;  4L16 A;  3N05 A;  4OIR F;  5IT3 A;  1PJQ A;  4LJA A;  3GZ5 A;  2HXI A;  4L9N A;  1P6R A;  2LKX A;  4LFB M;  2ZJ2 A;  1JTY A;  3DTI A;  1HSJ A;  3MQ0 A;  3LSR A;  3ILK A;  4QHS A;  1GL7 A;  3GRR A;  2HQR A;  3SEQ A;  3BR5 A;  2F5P A;  3TE6 A;  5ED4 A;  3CF6 E;  3ERE D;  3WTZ A;  1ORK A;  4EEF G;  4LJ7 A;  3W0L B;  3CMA I;  5E20 A;  4IZZ A;  4HW0 A;  4M3B A;  1V4R A;  4HA8 A;  1NJF A;  3IWZ A;  2IVM A;  4UVA A;  4BQQ A;  2V9K A;  2DAM A;  4PUS A;  2CV1 A;  3BTL A;  2EJS A;  1TQP A;  3U6E A;  4C3J J;  2Y9Y A;  5JVT A;  3GQ3 A;  4GYG A;  4MHG A;  2A69 F;  5D6F A;  4RB1 A;  4YEL A;  3I54 A;  2D45 A;  4OMY A;  4G4O A;  1VTN C;  4CUG A;  5IT9 Z;  3SYK A;  1X1B A;  2DPD A;  1YIT I;  2HVS A;  4A3V B;  2X6O A;  4B44 A;  2P5T A;  3SDG A;  1WJ5 A;  3QPS A;  2J5O A;  2VQC A;  3HBL A;  3Q9S A;  4IBC A;  1GLN A;  4JX5 A;  3SQN A;  2JPB A;  3VKG A;  3CUQ B;  3RCO A;  3VYT B;  4YEJ A;  2A61 A;  1YHQ I;  2LR8 A;  4AZF A;  2MFZ A;  1Y39 A;  3WTU C;  2ACJ A;  1OKR A;  3U60 A;  2HVR A;  5M5Y J;  1T33 A;  3VDU A;  1OFI A;  2FJ1 A;  3KEQ A;  4M3D A;  2ZJP F;  1QUT A;  3L7W A;  5KQ8 A;  4IHY A;  5FTN A;  4V2G A;  1IRF A;  3IL2 A;  1NNJ A;  1MW7 A;  1LE8 A;  3GTQ J;  1ZRC A;  2DFF A;  1IJW C;  1X37 A;  3HOY J;  4WP2 A;  4CCN A;  1MDM B;  2GAU A;  3U60 B;  1LFP A;  3FHN A;  2XAU A;  5K5Q A;  4UHT A;  3EUH C;  5FKM A;  1S7O A;  3U21 A;  3HSR A;  1V34 A;  4LIU A;  3SHF A;  1OQY A;  2GIV A;  3KP1 E;  4L5I A;  4U0V A;  1REP C;  3OS2 A;  4L6V 6;  1R6B X;  3E1S A;  3K1P A;  1X4P A;  1IUY A;  1K83 J;  4G6Z A;  3IH4 A;  4XK4 A;  3EYY A;  3F0C A;  1U9O A;  3HIF A;  1NVM A;  1IUF A;  2E2I J;  1EFU B;  1W36 D;  1LFB A;  2OF7 A;  1VQK I;  3FYD A;  5J1Y A;  3JAM K;  4G4N A;  1PJT A;  1JB0 F;  5D6E A;  1JT0 A;  2DA2 A;  3PSI A;  3VK8 A;  1D0Y A;  3IRQ A;  4FE7 A;  3F21 A;  4CSW A;  5HNF A;  1H8A C;  4RAY A;  3KOY E;  2QM3 A;  2CEA A;  2G5G X;  5JHU A;  3HHY A;  1IXS B;  2NVT J;  1KON A;  4DR2 M;  3KCC A;  1SXJ E;  4XOT A;  5L3B A;  5FRN A;  1WZ2 A;  4CCO A;  1R5G A;  3DBR B;  1OCT C;  1KU7 A;  4B3T M;  1A36 A;  4JX4 A;  3COA C;  1ZQ9 A;  1ZAR A;  1UHS A;  4BAC A;  3K2A A;  3MZH A;  4BS9 A;  1MH3 A;  2WTE A;  3OYC A;  3HHZ A;  2GXA A;  2JK3 A;  3F3X A;  3ZMD A;  2PQ8 A;  4J00 A;  1ZMW A;  5HLG A;  1GUU A;  4G7Z F;  1ZKG A;  3WGI A;  2XAJ A;  4R3D A;  3JW4 A;  3R6S A;  4BYY A;  3JR9 A;  1OJL A;  2I5U A;  2HOS A;  2R7O A;  4ASN A;  3CCU I;  2IS2 A;  1I5Z A;  1MND A;  3B73 A;  3SAW A;  3HKZ N;  2V9P A;  2MH2 A;  2E5L M;  5DM6 F;  1J0R A;  4AI6 A;  3G1L A;  3L2Q A;  3G73 A;  4XK8 F;  4AU7 A;  1AOY A;  1CUK A;  1UJ8 A;  2CW0 F;  2ZXH A;  4FVM A;  2HQN A;  2DU9 A;  2FF4 A;  1U2W A;  3HPH A;  1LEB A;  2CSO A;  1GHC A;  1MX0 A;  2H8R A;  3GBG A;  2VDB B;  5A2Q Z;  2F6C A;  2NVX J;  5FLM J;  4XBO A;  2UXX A;  1IY2 A;  2DHY A;  2BYV E;  4CZZ A;  4FCV A;  4GMQ A;  1SFX A;  2JSP A;  2JTV A;  5LFA A;  2CU7 A;  3MN2 A;  4NRW A;  3WHL A;  3BT9 A;  4JYK A;  4KMU X;  3LSH A;  2MGQ A;  3HRU A;  1KU9 A;  3MFK A;  3S1Q J;  2DK5 A;  2KZS A;  3AV0 A;  3BY6 A;  2H6C A;  4M3F A;  5C4X J;  4DR5 M;  4U7D A;  3TBI A;  1QUS A;  2ISZ A;  4TV7 A;  5F0H A;  4HSR A;  2X49 A;  3CJT B;  4LF6 M;  3DZD A;  2E7X A;  2XIG A;  1BM9 A;  3W2V A;  2P7V B;  2HYG D;  3ZCO A;  5CJ9 A;  4JOM A;  3WOD F;  3WU0 A;  4GDF A;  2ID6 A;  3VLF B;  1MMS A;  2LH9 A;  1GAB A;  1E9S A;  3ECO A;  2XF7 A;  2F4M B;  5HVQ C;  2LRE A;  2W25 A;  4I09 A;  3HOX J;  3J7A Y;  4B4C A;  2VN2 A;  4A3F J;  4OIO F;  3OOU A;  2ZB9 A;  2LNB A;  2M9H A;  2Z2S B;  3H9Q A;  4V19 K;  1T56 A;  3KSX A;  2Q1Z B;  2IPQ X;  3WTS C;  1KGS A;  1K4S A;  1WJF A;  2BW3 A;  2HWJ A;  3U6S A;  3NRV A;  3UJN A;  2XGC A;  4A6D A;  2G0E A;  3QRF F;  1LPQ A;  3HJ8 A;  5EJC A;  1MSF C;  5ITR A;  2JN6 A;  3CC2 I;  3RGP A;  1A04 A;  1E94 E;  1BOB A;  2ZNZ A;  4NB5 A;  3CJN A;  3L9F A;  1PJS A;  2XUB A;  3CCL I;  1X3Z B;  2IJL A;  2XHK A;  1KA8 A;  1B9M A;  2JY8 A;  1HQY E;  3HC7 A;  4XSX F;  4AKH A;  2DTR A;  2E1O A;  1E32 A;  4HEA 2;  5KCM A;  2AHM A;  4DV1 M;  1TNT A;  2L4A A;  3CES A;  3J27 B;  3DWL E;  3RPQ A;  3BC8 A;  3A1Y A;  1U6G A;  5BOX A;  3ZQI A;  3ULQ B;  1FYL A;  2QQA A;  4LGW A;  5E6J A;  3FKI J;  3CCE I;  2CHG A;  4UUV A;  5EXX A;  1C1K A;  5IRE B;  5DD8 A;  1RR8 C;  2XAG A;  1MBG A;  3PXG A;  1KYI A;  2LY1 A;  3MVP A;  3EPZ A;  3J80 K;  4E7K A;  2Q0O A;  3KFW X;  1IY1 A;  3QPL A;  1USS A;  5BR8 M;  3FTE A;  5FB2 A;  1IAW A;  4PFO A;  5D4S A;  4A6E A;  3T1H M;  1SXJ D;  4OVZ B;  3K4M A;  3J7Z I;  1ZGW A;  2FSW A;  1DGH A;  1SEU A;  3I51 A;  1WJC A;  2APL A;  1QAQ A;  2XDV A;  2VQF M;  3QYE A;  3BR6 A;  3T6P A;  4ESJ A;  1GJS A;  2AO9 A;  4EM2 A;  1QRY A;  2ESH A;  5LHI A;  2O6G E;  1VQN I;  2CV2 A;  1NTC A;  2EWN A;  3K1N A;  2GQF A;  1FYM A;  4FX4 A;  1O57 A;  2DZO B;  4DR7 M;  1TZL A;  1ZQ3 P;  1DGH B;  1Z6T A;  2CO5 A;  3EYI A;  2R4J A;  1HDD C;  1UHW A;  2W24 A;  3C2H A;  3KLO A;  1UZC A;  1PYV A;  2GOM A;  2LBF A;  3WG7 H;  5LHH A;  4I7H A;  1RET A;  4D5F A;  4I0B A;  3O8H A;  5GAH J;  1VQ8 I;  3LOC A;  1G71 A;  2CUF A;  3OTO M;  4LRS A;  3ZP5 A;  2M87 A;  2H5X A;  4AG5 A;  2QWW A;  4IBE A;  4OX9 M;  3S15 J;  4DUZ M;  3K4J A;  1IZ1 A;  3F8N A;  4A5M A;  2G7H A;  2GA1 A;  2PI0 A;  2P0W A;  4O3M A;  1F4I A;  2Q2E B;  3PNY A;  1R5I D;  1TTY A;  2R7Q A;  3D0S A;  4IBD A;  1I3Q J;  5IYD J;  4A0X A;  1RPW A;  3OS1 A;  2VBZ A;  1H9G A;  4B7F A;  1GL6 A;  2VT3 A;  2Q8K A;  3J81 S;  1IN4 A;  4D80 A;  4JI4 M;  2L54 A;  1C0W A;  2IS1 A;  2VJJ A;  4ZYE A;  3FX3 A;  2WY8 Q;  1LDJ A;  1I6X A;  1GT0 C;  3ML6 A;  2C9O A;  1N36 M;  2W7N A;  2XSJ C;  2BBY A;  3SC3 A;  5EGO A;  3IH3 A;  4IQJ A;  4G4R A;  4FCW A;  3M8J A;  4LFU A;  3AL0 C;  3CD6 I;  2L3D A;  2C9C A;  3HUG A;  1GJT A;  1U5T A;  2HPI A; 
#chains in the Genus database with same CATH homology
 1XB2 B;  2MRO B;  3ESW B;  1AIP C;  1ZV1 A;  1DO2 A;  1T43 A;  1TR8 A;  1HJP A;  2HWJ A;  3E46 A;  1OQY A;  2MGW A;  1VEK A;  2ZTD A;  2K9D A;  2LVO C;  2L4E A;  1DV0 A;  3F92 A;  2QNJ A;  1VQ1 A;  1R4G A;  1E94 E;  4Q7J A;  2DI0 A;  1V92 A;  2LVN C;  1Y8G A;  3BBZ A;  3LCV B;  1X3Z B;  4F2L A;  1EFU B;  1PGY A;  1WJ7 A;  2JY8 A;  1HQY E;  2JNH A;  3FRH A;  4DBG B;  2LTU A;  3FE3 A;  1VEG A;  1MN3 A;  2DNA A;  2KHH A;  5DFL A;  1GO5 A;  1TP4 A;  1QZE A;  1ZMU A;  4R71 A;  2DAG A;  2MR9 A;  1VDL A;  1KYI A;  3GLG E;  3K9O A;  1XXH E;  1UFZ A;  3MMP A;  1A5T A;  1C7Y A;  1IM2 A;  2DEN A;  2KNV A;  2KNA A;  4G3O A;  1X3W B;  1OKS A;  2R0I A;  1VG5 A;  2K0B X;  2OOB A;  1OAI A;  1ZMW A;  3T6P A;  2DKL A;  2WZJ A;  2LVQ D;  2QHO B;  2DAK A;  3FRI A;  2QSF X;  3GLF E;  2QSG X;  2KNZ A;  4F1I A;  1G41 A;  1IFY A;  2BWB A;  1CUK A;  1ZMV A;  4YIR X;  2DAM A;  2L4F A;  1VEJ A;  2EJS A;  3E21 A;  1Q02 A;  1WIV A;  2LBC A;  2LVP C;  3IEC A;  2OOA A;  1T6O A;  2DHY A;  2G3Q A;  2H5X A;  2JY6 B;  2RRU A;  2JY5 A;  3GLH E;  3K9P A;  1SG9 A;  1PVE A;  2JZ0 A;  1WGL A;  2EKK A;  2DAI A;  2DAE A;  2JY7 A;  2LVA A;  2BWE A;  1OTR A;  2B3T A;  2JZ1 A;  1F4I A;  2ZTC A;  3GLI E;  3B89 A;  1DO0 A;  1JR3 E;  3IHP A;  1WGN A;  2OO9 A;  2MJ5 B;  2DZL A;  1P3Q Q;  2F4O B;  4GEW A;  1HT2 E;  1NV9 A;  1NV8 A;  2CWB A;  1WHC A;  2QSH X;  2F4M B;  3H4J A;  5JI2 E;  1G3I A;  1HT1 E;  1BVS A;  1IXS A;  2L2D A;  1TTE A;  1YLA A;  2JP7 A;  4UN2 B;  4HEO A;  1G4A E;  2CP8 A;  2JUJ A;  3LCU A;  4WP2 A;  2HAK A;  2EKF A;  1WR1 B;  2O25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...