2QSFX

Crystal structure of the rad4-rad23 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
104
Chain Sequence
IGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAVGSFQVDYTPEDDQAISRLCELGFERDLVIQVYFACDKNEEAAANILFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of DNA damage by the Rad4 nucleotide excision repair protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD4
total genus 33
structure length 104
sequence length 141
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00627 UBA UBA/TS-N domain
X PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2qsfX02
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2qsfX01
1ZV1A 2RRUA 1R4GA 5JI2E 4GEWA 2K9DA 3GLHE 3IECA 2DI0A 2KHHA 1KYIA 4F1IA 2JY7A 3FRHA 3K9OA 2LVAA 2DAEA 1VEJA 2ZTDA 1EFUB 3E46A 5DFLA 3LCVB 2OOAA 1ZMUA 2ZTCA 2JY8A 2QSGX 2B3TA 3GLGE 2CWBA 2JNHA 4HEOA 1OTRA 2MROB 3H4JA 4UN2B 2G3QA 2DNAA 1UFZA 2LTUA 1VG5A 1Y8GA 2LBCA 3E21A 1A5TA 2DZLA 1WIVA 1G3IA 1DV0A 1G4AE 1PVEA 2DENA 1TP4A 2KNAA 1JR3E 1Q02A 1V92A 1WHCA 2OO9A 1P3QQ 1IM2A 2F4MB 2JY6B 2WZJA 1G41A 1YLAA 2QNJA 1ZMWA 2L2DA 2KNZA 1IXSA 2K0BX 2JP7A 2QSFX 4Q7JA 3K9PA 2L4FA 2JZ0A 1VDLA 1WGLA 1TR8A 1DO2A 1NV9A 2CP8A 1IFYA 1PGYA 2EJSA 2H5XA 2KNVA 1QZEA 1WR1B 1ZMVA 2MGWA 3T6PA 1BVSA 4F2LA 4WP2A 1NV8A 3IHPA 1C7YA 2MJ5B 3B89A 2DAGA 3BBZA 1F4IA 2F4OB 2L4EA 1E94E 3ESWB 1XXHE 2DAIA 1VEGA 2DKLA 2LVNC 2EKKA 1VEKA 1HQYE 2JUJA 1DO0A 3GLFE 2EKFA 3GLIE 1HT1E 1CUKA 2QHOB 3FE3A 1HJPA 1T43A 2DAKA 4YIRX 1GO5A 1AIPC 2BWBA 1MN3A 2LVPC 3F92A 2JZ1A 2OOBA 2O25A 3LCUA 2LVOC 1HT2E 4G3OA 2JY5A 1VQ1A 1WJ7A 3MMPA 2QSHX 1X3WB 2MR9A 1WGNA 3FRIA 4R71A 4DBGB 2DHYA 2DAMA 1OAIA 1X3ZB 2HWJA 1T6OA 1XB2B 1OQYA 1SG9A 1TTEA 1OKSA 2HAKA 2R0IA 2LVQD 2BWEA
chains in the Genus database with same CATH superfamily
3HGGA 1GV5A 5FTJA 3GFMA 3RKXA 2W82A 1YITI 1ZRCA 5F0HA 3VSKA 4NUBA 1N75A 1QHHD 5E26A 2AHQA 2W57A 1LV7A 2XSZA 4PSXA 4XKBA 4UVAA 2VPRA 4ZYHA 2VBWA 3HX3A 3MN2A 2V79A 3K70D 4BB9A 4JYKA 1WCMJ 3DKWA 1ZK8A 2F5CA 2LBFB 1U5TC 3OYIA 2ZAMA 2Y9YA 3BROA 1L2CA 1WQ2A 2PMUA 3CP8A 3GF2A 3RKWA 1XGNA 2EZHA 3TEDA 4BLCA 2HEOA 3GPYA 1OFCX 3S1NJ 2HNHA 2QSGX 3VPRA 2B3TA 1UZCA 1NG7A 2DLLA 2QF7A 2LRDA 4R8HA 4UN2B 1TNTA 3L7WA 1RR7A 4FW9A 4LD5A 4IHXA 1X4OA 2KP6A 5JLWA 1D2NA 2MC4A 3SAVA 1SANA 3G1LA 4JI8M 1KGSA 2O01F 5CQEA 2KNAA 2LH0A 3I55I 2ZSHB 2X9DA 3ASOH 2NVUB 4AIJA 3WG9A 2ZJQF 1R4NB 4EJWA 5C4JJ 1F9NA 4OVZA 4M9ZA 1K4TA 1IXSA 4S05A 2FRHA 4CUGA 2HOEA 4QTRA 5BS6A 1ZAOA 1LVAA 4KMFA 3F6VA 3DLLF 1TR8A 4I7HA 1QUSA 4DBRA 4HDUA 2EB7A 2ZSIB 2H5XA 1MBHA 3V8JA 2GOXB 5FTLA 3OYLA 1YQAA 2IT0A 2XLJA 1IRXA 1XSXA 3I54A 1JKQC 4HF2A 4LJZF 3KYCB 2IAIA 4D82A 2G9WA 1GJTA 5IPAA 2DMUA 2JPBA 4ENJA 2IXSA 4HZFA 2KT0A 2F4OB 4XLPF 2Q0OA 1HNXM 4RB2C 3AFHA 4YY3M 3U21A 2QZ4A 1OPCA 5HVQC 2O7OA 4A0XA 2JUJA 1PJRA 3TOAA 1DO0A 1D1BA 2R7UA 1YS7A 4IHYA 3FE3A 3JR5A 2OCEA 3VYUB 3LVWA 5GAGJ 3K6GA 3L28A 2JWSA 3JAMZ 3LSPA 1F4KA 1MMAA 3E97A 4CA0A 1FOYA 2R46A 3WGHA 5GTIC 3LCUA 3UKGA 2VOOA 5AONA 2IS6A 1T56A 2FE3A 2JPCA 3KZZA 4LIUA 3A2KA 1XC5A 1GDTA 4MGKE 2KIQA 4HLQA 4YFKF 3R8FA 2EJRA 4YRVA 1IRFA 2HXOA 4PCZA 1I3QJ 1J2XA 2DAMA 4EATA 2O5RA 1OAOC 1MJBA 4XSXF 3JR4A 1BJZA 4DV7M 1WJBA 3BQYA 1AUAA 3BR5A 3PSFA 3TDZC 4YFXF 5E3OA 2R7ZJ 4QPOA 1SFOJ 1RNLA 3UZUA 5KNLA 3DBLB 1KYZA 3S16J 4IBCA 1T3TA 5LHHA 2Z9OA 3R60A 4KICA 4OU7A 2X6YA 2K9DA 1IUFA 3GLHE 1E3PA 2E36A 5E79C 4BXUA 4UUSB 1IV6A 4L9VA 2DT7B 4E70A 2Z16A 3ABUA 1HQCA 1XTAA 2R0QC 2Z4RA 3C2BA 3DP7A 3WG7H 3JRFA 3S2HJ 3L2CA 1R58A 1I5ZA 2RVCA 3NWSA 3OV8A 4B43A 2Y0MA 4RDUA 5IYDJ 3PXGA 1BIAA 2BY3A 3RQIA 3DFZA 1S29A 2NOJB 4KN7X 2CWBA 2GZWA 4U7BA 2EFQA 4YEJA 5C44J 3NQOA 5BPVA 1W7PA 5E1ZB 4BS9A 5J8CA 3VFDA 4M72A 3K1PA 4ZYDA 5F08A 5EG0A 2WADA 3SEZA 3DPLC 3G1OA 2FF4A 3Q8GA 2QP9X 3CD6I 3CMYA 4IRHA 4XICA 1TH2A 1K4SA 1ACIA 1OCZH 2V4JC 1OLTA 4GYIA 2FMYA 5IP9J 4J19A 3RPUD 2F2EA 2WY7Q 3QQAA 5LEKA 1PJTA 4B3MM 5J6XA 4IL6C 2NYXA 2XF7A 2Y0SA 4JN6A 2UZKA 4U0VA 4BACA 1IW7F 4ZYGA 5EYRA 4X65M 2DMQA 2XAFA 4IRGA 1TT0A 2VT2A 4NBQA 1RR8C 3OTOM 2MGWA 2Y21A 2XPWA 3A4CA 3Q9VA 4IPAA 3HOTA 4HQEA 1B72A 5FTKA 4ZZLA 4II2A 4QHSA 4WP2A 2DOEA 3AOEC 3R61A 4QSHA 4OAZA 4X1EA 1ZG5A 4K2EA 5FTMA 3Q0WA 2BNKA 2VBZA 3GX4X 1P4XA 3OY9A 1E94E 2R93J 1Y6IA 1ZGAA 4L0ZB 1ETXA 1UHWA 2WWYA 2HYJA 1WGXA 3J27B 1AWCA 4A3CJ 3CLOA 1JXSA 3QU3A 1MZBA 4XLEA 1IDZA 5FKNA 3A01B 1GXPA 2EUCA 2VJ5A 2RGOA 3P9CA 3ZQJA 4Q47A 4I99C 1SXJA 2VJIA 3PUFA 3M8FA 3CCUI 3PM1A 1Z6RA 3CJRB 1MSEC 1JT0A 4LG3A 2COMA 3E4RA 3M4OJ 2LVPC 1XWIA 3H36A 3OL3A 4G6QA 5ICCA 3GZ6A 3WHCA 5J1YA 3DTEA 5TRDA 4NSOB 1QU3A 4ITQA 3W6KB 4BHCA 3GTGJ 1K61A 2E19A 3BTCA 1A6IA 5DCMB 2MR9A 1WGNA 3GRYA 1W36D 3TE6A 4ETSA 4IQJA 4A0YA 3L2RA 1V4RA 5FFZA 2EWNA 4KITB 3CUQB 2HDDA 2XF6A 1T6OA 4RAGA 4AWXB 5LHIA 1VQ9I 2HQ5A 3I58A 3WTYC 3D8LA 5IT9Z 1ZV1A 1D5YA 2VC0A 5FFXA 1QNTA 1G4DA 4PT5A 2STWA 4M6YA 3C3EA 4LB5A 1D0ZA 2D45A 1UM8A 1FYMA 2JA5J 1DP7P 4HNTA 3QOPA 2BGCA 1FMWA 3FMRA 3SYLA 3CTWB 1LFBA 1B9MA 1SXJE 4PUSA 5GPAA 1YJNI 1HDDC 1MNDA 2M4GA 3FDYA 4IVNA 1O4XA 2M5WA 2JXNA 2M8GX 1FC3A 2VXZA 4V19K 2Z7JA 3J80Z 1MJ9A 4L0YB 2XIGA 2JY8A 3ILKA 5LD2C 3JSOA 2R5ZA 3DBRB 2ISYA 3HTUA 1TH3A 3MD2A 4XKVA 4YFNF 5K5QA 1ETWA 3B7ZA 2FUG2 1E3HA 1D5VA 1ETKA 4IO9F 3HOSA 2LNHC 2EO2A 3H5NA 2L3DA 2QKLB 1F5TA 3DKXA 3K4KA 4DW6A 3ONQA 5LBQA 3MCZA 4BQAA 2FE8A 4WF2A 3H3VK 4X6AJ 4GITA 2LC2A 4A93J 1I3AA 3HY5A 2RN7A 2UUAM 4A6DA 5ICFA 1FYKA 4S04A 2CGPA 1P9QC 2HS5A 1TQMA 1Z67A 2JY6B 4FQGA 4IJAA 3MEXA 1YLAA 1Y8QB 4CH7A 2BJVA 2LYCA 3IAM2 3CO7C 1EF4A 3WTTC 3K1NA 4XRSA 4KIBA 3GCMA 1BA5A 2E71A 4FD2A 4N9HA 3JRCA 1IY1A 2F5DA 1MMGA 2DA6A 2R7WA 2JA6J 2M0CA 2YX7A 1PGYA 4I5SA 3WHBA 2PG4A 3EIHA 3ZXSA 2EA4A 3VYSB 3C9PA 5H20A 2LVSA 3W68A 3CESA 3KE2A 2IS1A 3CCRI 2Y2ZA 3F23A 3KCCA 2MJ5B 4BXXJ 3ROUA 3LSTA 3CGWA 4DV0M 4ZYEA 1LNWA 2LH9A 5EG0B 2R44A 3QYEA 2Y48A 3H3ZA 3GTMJ 1XSDA 4G4OA 1HQYE 1WH7A 4AKIA 1DU0A 1HNWM 3I0TA 4LLNA 1AOYA 5CQGA 2OAZA 1Z3YA 2QYOA 1W4MA 1ZREA 2DOAA 2C98A 4B4CA 1J75A 1QAQA 2KZSA 3CMAI 2R4EA 2CJJA 3EUHC 2DK5A 1PUFB 4CYCA 2APLA 1WI9A 2TCTA 2GIVA 5ERIA 1BOBA 4KLNA 2A5YB 1O3TA 2DTZA 2BHYA 4BHPA 5ITYA 4LFCM 2E7WA 3F22A 2YSRA 3WTSC 1G3WA 1MSFC 4BQNA 1QDRA 1ZYRF 4IZZA 2F4IA 3KZYA 2XGXA 3JREA 1MMNA 1K78B 4DJAA 1OQYA 2ELJA 2FJ1A 2IVMA 3ISPA 1OKSA 1X2MA 2CW7A 1S8NA 2RGHA 2QVOA 2CHVA 4KUMA 3RDIA 2GM4A 3ZQIA 4E7HA 4X0GA 1N33M 1MDMB 3BR2A 4R7GA 1VDDA 2XROA 1X1AA 4A3IJ 4AG5A 1USSA 3SHFA 4F1IA 2Z99A 4AIDA 5J4YA 3ZQLA 1FOKA 4NL4H 1D0MA 3E5QA 4EQQA 4BE0A 1VQMI 3M8EA 1YO5C 2MC3A 2JVHA 2LR8A 4P96A 3OYMA 2R45A 3OYBA 2EZLA 3VYTB 2ZTDA 2Y31A 3SDGA 4Y3OA 1ERDA 1O3SA 2X6OA 1R49A 4FE7A 2D7HA 4UB8C 2OTLI 5EGOA 3WTWC 1XNRM 4O5VA 1OISA 1OFHA 2UV1A 4JI2M 3I4MJ 4BKXA 1DU6A 5LMNM 3U6LA 3DBHB 2G3QA 5AIPA 3HHWA 1R1VA 1YS6A 1VG5A 3KDSE 2CMPA 3N4MA 2HVRA 5F1JA 1R9TJ 1YI2I 4LGMA 5C4XJ 1G4AE 2UWMA 3JRIA 3VK8A 2L54A 4IRIA 1T98A 1BI3A 4LF6M 1Z1DA 2A69F 2CUFA 3HL2A 2R5ZB 5H2FC 3OYDA 1A36A 2HI3A 2OO9A 2WSCF 1TQPA 4BGDA 5KAFC 3IV5A 1UCRA 1FYLA 2QGUA 3FZVA 2HDCA 3H9JA 2YS9A 3KP7A 2BXYA 2W84A 2LHGA 4AD9A 2MA3A 2V1XA 5ILUA 2VDBB 3K9PA 5J3LA 3CF6E 2QPAA 1XN7A 4A3DJ 3I4NJ 4B48A 1VQPI 3EYIA 4BBAA 4V2GA 3HSEA 1RRJA 3KX2A 1G8XA 4M73A 3V4GA 4EMSA 2R4JA 4OIPF 2CQ7A 5F6FA 3LA7A 3E6BA 3DF8A 5FLXK 1IDYA 4RGSA 2BBYA 2FEZA 3K8ZA 3BBZA 5KPZA 1XB4A 4X66M 4LF7M 1UMQA 5ICGA 4RS8A 2BOLA 2WAQN 3HOUJ 3MK6A 2BHZA 2WBMA 4OOIA 2LBFA 2KZUA 2FOIC 3LAJA 5GP9A 3HOXJ 3KOZE 3LWFA 3CC2I 4MGIE 2EKFA 2NQ8C 3GLFA 4PJMA 2B7EA 3L2UA 4XMYA 2O8XA 2F4VM 3RKYA 4JX6A 4G7ZF 4IHSA 3PIOF 1ZG1A 4MB7A 3GYHX 1GT0C 3WTXC 3HB9A 1ETOA 2DZOB 1XSVA 2IGMA 4E4HA 2AS5F 5E3LA 3B9PA 4P1WA 4DUYM 3BG5A 1HKQA 2R18A 1B8IA 1HOMA 4PDIA 2QSHX 2CV2A 5JHFA 2HXIA 3TWLA 2LDUA 4IKFA 1BR2A 1KU2A 2CEAA 4R71A 2IA2A 2KFDA 4XQFA 2PX9A 2X1CA 4HEA2 2ACJA 3IG5A 3L2AA 2N8GA 2XSJC 2CO5A 3BWGA 3IWZA 4E6KG 1WSUA 1R2YA 4IJFA 3SARA 1JTYA 1TWCJ 2UXCM 3CTAA 4GH9A 2KLOA 5E18F 1X2NA 5FTNA 3P9IA 2KW0A 2O9LA 4U88A 1NNJA 3C18A 4J00A 3U60A 2E5LM 2XSDC 2KJBA 3K4JA 3IH3A 2K47A 2LVAA 2UUCM 3S3OA 1BJAA 1VEJA 3BJOA 3KEOA 3DPUA 3FTEA 3LCVB 2DMPA 1ZQ9A 3AV0A 2QLZA 3ERMA 1G3TA 2R5YB 3LW5F 3IG8A 4DV4M 4KIGA 5GAEJ 5LMUM 2GXBA 2KRCA 4L8RC 5JI6A 1MU5A 1YIJI 2IS2A 1JI8A 2DWLA 4CSWA 4IEJA 3F8CA 1AKHB 4KIFA 3VFZA 2K9SA 4NNJA 1S7OA 1A5TA 2M60A 2UXDM 1WIVA 2OCCH 2QENA 4AZFA 4UUVA 2F5EA 2Z3XA 2DENA 2HFHA 4ENMA 4DV1M 3QU6A 2LOOA 3TWMA 4XLFA 4EJOA 2HL7A 3KOXE 1QQWA 3S8PA 2CQNA 3T1BA 1A35A 2WV0A 2XC7A 1LUJB 3ABMH 4UV9A 4M0WA 4I09A 1KU3A 3AL0C 3I53A 4II7A 3E5XA 5GAHJ 2C9CA 2ID3A 3I4YA 2K0BX 2DJIA 4EM2A 4DR2M 4DV2M 3M8JA 3CCMI 4LFUA 4EGYA 2YU9J 3I71A 1VDLA 1WGLA 3G1MA 3AG1H 3BR0A 4ASNA 3I4PA 5D8KB 2WAEA 4BBSJ 5BPIA 2ZKZA 1FJLA 2H6BA 3LSRA 2KNVA 1S7AA 2RKHA 2H1KA 4DZPA 1VQLI 2BW3A 1K3XA 1K7AA 2OBPA 4BUPA 2DA1A 1ZGWA 3NRVA 1RC9A 1JQJC 4QOSA 1R7JA 3M1CA 4A3KJ 4B3TM 1DGRM 4WURA 1J9IA 2CQXA 4RAFA 3T5XA 1WJ5A 3T8RA 2EILH 1DUXC 2LVNC 4DIQA 5DNYA 3C2HA 4ZH4F 4F92B 4G9YA 3JRDA 3TQNA 2VKDA 3S3MA 3DFGA 1O7FA 3L1PA 2L7HA 4Y17A 5DD4A 1T43A 1IN7A 3KP2A 3NAUA 5HNFA 4GHLA 1TTYA 3VKHA 4YIRX 2Q1ZB 3K2LA 4EJVA 2X51A 1P4AA 1OJLA 1W7PB 3MKZA 4G7HF 3G71I 1EH8A 2E35A 4HPQA 4HYEA 3FM3A 3K70C 3ECOA 1TC3C 1D3YA 3P5JA 4ANJA 5F3WA 5LGUA 1O3QA 1IAWA 4N9IA 5E8IA 2WV1A 2R65A 3DEWA 4RLFA 1ORKA 4D0PA 1ZN2A 3FKJA 2DN0A 3CMEI 1BR4A 1ULYA 3GWZA 4OX9M 2M7BA 3FXOA 2K9NA 3OOUA 3QYFA 4RB0A 1BOAA 2HWJA 4NDLA 5L3BA 1T8IA 2VQFM 1OMIA 2XDVA 3W2VA 1SG9A 5HODA 4RM3A 1L2DA 1MBEA 2HAKA 1P7JA 5JVGF 1H9GA 3FUXA 2OQGA 5AIQA 4JI7M 2DWMA 3ZN1A 1CF7A 2MGQA 3HZJA 3WODF 5LGTA 3F0CA 1LDKB 1SVLA 4DR6M 2QM3A 1DDNA 1Y0UA 4YELA 3IECA 2QQBA 3UJNA 4JQFA 2ZXWH 1J5EM 2DBBA 3I59B 4BEHA 5ICEA 2JUGA 5DCMA 3U6SA 5E6JA 1DGWY 1FSHA 1G59A 1IN5A 1XCBA 2E1MC 2OTJI 2UUBM 1MNMC 2M45A 4XLNF 4E7KA 3KFWX 2CH0A 3IUOA 4RGRA 1TH4A 3TO7A 3QWLA 4ENKA 3AAFA 4YHHM 2LF7A 1ODDA 4P17A 4QLCU 4G6TB 2EA0A 3FXKA 1WJEA 2V9KA 2ELKA 2VASA 3IRRA 1I6HJ 1G2HA 2FQ4A 3FKEA 1YTYA 1QVRA 3E1SA 2GA2A 5DV5A 5CVIA 3ZQGA 3OYAA 2DMTA 3K4MA 1MMDA 1ETYA 1KONA 4FT8A 5DYIA 3B74A 3HXLA 1FTTA 5EJCA 2DA2A 1JUPA 2EFOA 3PO3J 3LSGA 4M0DA 1A04A 1OIZA 1KU9A 2GXGA 1LQ1A 2ISZA 3JRAA 5EZGA 4HF1A 2P7VB 4KFCA 2L2DA 3FISA 1AKHA 2CSOA 1BIBA 1D8KA 1TWFJ 4LIVA 3QP5A 4I02A 1IO2A 2XAQA 4B8XA 2GIZA 2OV7A 1MBKA 3KP6A 1T38A 2LFBA 1YJWI 1GVJA 3UGJA 4JI1M 2ZNYA 3BR1A 2R5YA 3HOVJ 1YW9A 2OJED 1WH5A 2XHKA 1B9NA 1Y8RB 4BNCA 3PL8A 1LEBA 3O6BB 1YG2A 1NVMA 1VQKI 2UXXA 1T33A 4C3IJ 2O61A 2H6CA 3WU0A 3B73A 3KVWA 4LJ8A 3B89A 3BJ6A 1FWZA 2O8KA 2ERCA 4HSRA 3B02A 2EPFA 1SD4A 1XXHE 2HGCA 2Y0TA 2DKLA 2RAEA 2WAFA 4BDYA 1ZLKA 2ZFWA 4LJAA 5CJ9A 5F04A 3HEFA 3K10A 4NXNM 4FX4A 4MQ9F 5DUIA 4QHTA 4B3XA 1G8PA 3SXYA 2DFHA 4B09A 1N36M 1FJGM 2YPRA 2FH0A 2VE8A 4PFPA 2VIIA 4Y4RA 5D6FA 2XB0X 3JSPA 1H6UA 2DFIA 3VODA 2MG4A 2GNOA 1EA3A 2DO7A 5HLIA 3RKQA 4AVPA 5JI3E 3JRGA 1R5ID 4B47A 3J80K 4A3LJ 2XVCA 3D5RC 2XAHA 3HJEA 3F8NA 4HX7A 2DXIA 2ZMEA 2QA4I 1WJCA 1HDPA 3FTFA 2FNAA 3SAWA 3A42A 4L9TA 3K7AJ 1WZ2A 2KRFA 2A07F 5LEJA 1QVUA 4B3SM 1H0MA 2V1CA 4HBLA 4JP0A 4D9JA 3GPPA 4IIWA 3S14J 2RQQA 1OYWA 4UB6C 4Z8XA 2FMLA 4LMYA 1G71A 3RJPA 4YG2F 3A45A 4NB5A 3K1JA 4A3BJ 1DGFA 5LLQA 4XN3A 2QBYB 5D8LB 1IF1A 5B5EC 1EFUB 1GHCA 3HBLA 1YW8A 2CV0A 1B6AA 1W36C 2OOAA 3HTSB 2CS3A 3K4LA 1MBJA 4GKKM 4NC6A 1T2KA 4HAMA 4N4OB 1U78A 5GTHC 3JAMS 2JA2A 4MH0E 1YX5A 1U5TB 1X58A 1Q3BA 2V6CA 3LOCA 3O8HA 1IQPA 3ZC7B 1OFIA 3HJ8A 4PCQA 4S0HB 3I56I 3OMYA 2LWXA 4RB1A 3DV8A 1PJIA 2XKPA 3SATA 1Q1HA 1WFXA 2STTA 1FOWA 3F21A 2M1BA 4LF4M 3OR1C 3CCLI 4FCYA 1P7IA 2K4BA 4EJUA 3DPTA 2VJJA 3WTUC 5ITQA 4A0ZA 1P3QQ 1IM2A 5HDNA 2PN6A 4AYBN 3P9KA 3ZCBB 2IRFG 4M9SA 4DR4M 4C2MJ 4OIOF 4M3EA 5LRRA 3K92A 1IXZA 4FVMA 4Q7JA 3HU1A 3SMSA 4JOMA 1BM9A 2DVWB 1N32M 5H6RA 3JRHA 4E7JA 3L29A 5HS9A 2FD5A 2Y69H 3J81Z 4ESJA 3Q3SA 4NC8A 4MIMA 4CJ6A 4BY1J 1PJQA 3MFKA 2EJSA 1XGOA 4LGYA 4AYBA 1ZTRA 2BZTA 3U6CA 3CZ6A 4RGUA 5ILSA 5B1AH 2KIMA 3FXJA 3Q9SA 1VNDA 4DR7M 1NV8A 1IY0A 4CCOA 3IHPA 5E3NA 2Y9ZA 2PI0A 2HU9A 2KDOA 5KVRA 3S2DJ 5F0CA 1ITYA 4RKUF 2L5QA 4XSZF 3HDDA 1NJFA 4DZJA 3KW6A 2ECCA 1PRBA 2ZANA 2HYFA 3GXOA 2O6GE 4OIQF 4KMUX 2H8WA 3QPTA 1JJ8C 2W4SA 2LY2A 1JUMA 2LNBA 3DEEA 3ERED 2FBIA 1MH4A 3AOEA 1MD0A 4KT0F 1FOXA 3CF2A 1FMVA 3FBIB 2VF8A 1U8RA 2GA1A 1E2XA 4FHTA 3BJAA 1H89C 3M6AA 4IOAF 4E7LA 3RZDJ 1QPMA 2QKMB 2JZ1A 3I01M 2P5LC 2EFPA 3IH4A 4MTDA 2EIMH 1NHAA 4ZYAA 4D1QA 2HKOA 4ZDOA 1ZG3A 1SAXA 2HCBA 1XCVA 1OCOH 1WJ7A 4CZCA 3D1NI 3ZMDA 1HKTA 2HQAA 3AG4H 5J4VA 4GYGA 3TDUC 4HOBA 1S7EA 3H0GJ 1IRGA 3ZRGA 2XAJA 3CCJI 3BG6A 2WC2A 2VBXA 3DTIA 4RB3C 3K1MA 2RRUA 2DZNB 3I9V2 4KJZA 4LFBM 5K5OA 3HSFA 2ZMEC 5DD8A 3RFWA 4PGGA 4GEWA 3S17J 3HHHA 2QZ8A 2CYYA 2H8RA 1XPXA 1ZR2A 2JY7A 4Y28F 4P9FA 1LVKA 3PFIA 1Q39A 3VK7A 2W24A 3GW2A 5JVTA 2DAEA 2E2HJ 3V7RA 2K3PA 3PVSA 1WJDA 4DOZA 3BTLA 2NS7A 1ENHA 2MD5A 1SFKA 4Z6YA 2ZJPF 2L01A 3S2WA 2HR3A 4KHPM 3AKZA 2W00A 3FUTA 2X1EA 4EVIA 5BQTA 2GAUA 2YNMD 5DYGA 3IKTA 1MX0A 1QGPA 2JRTA 2CUEA 5L3DA 2R92J 3GLGB 2VQCA 1JE8A 4JBAA 4HQMA 4WCGA 2PMHA 2M2EA 2FBHA 4AKHA 1Z91A 2JT1A 3CCSI 3RPUA 2OC6A 2KRUA 2DNAA 4F3QA 3JAMK 2F5NA 4CYCB 1X3UA 1SMYF 1F36A 1V3FA 4DBQA 5BR8M 2C6YA 2LKXA 3PNTA 4BAYA 4BU2A 2CUZA 2LLKA 3KSXA 3J81S 3SASA 4GKJM 2IS4A 4XLAA 3TP3A 1UG0A 1Z77A 4A69C 3CC4I 1U9OA 2HDWA 4G94A 1A31A 4H4KC 2XV4S 1FT9A 1JT6A 1X4PA 2X4AA 1D1CA 3CJQB 5KCMA 4IBGA 1DP3A 1K6OA 2DT5A 3W3CA 2D2WA 4XLHA 1PJSA 3DKYA 4GIPA 4LRTA 2CUJA 2JUCA 1IFYA 1GXQA 2XGNA 2OQ4A 3T6PA 2K4JA 3ZQHA 1BVSA 1KSFX 5EP2A 4F2LA 1FEXA 2M5ZA 3GTQJ 5KPTA 3GBGA 1QAMA 3OYKA 4C9YA 2GXAA 1MJAA 2JMWA 1W1WE 1ZR4A 1UHSA 3AOGA 3O3KA 1HW2A 4I76A 5DDGA 4ZPXA 2ZJRF 3RSNA 5EF6A 3WE3A 2IA1A 2LP0A 3L2WA 2K86A 3AG2H 2L4EA 1O57A 3I04M 3HM5A 2TDXA 3GTKJ 3ABTA 4LB6B 2A5WA 4KODA 1VEGA 1WHUA 1VEKA 2ID6A 1VI0A 3GLFE 2DQLA 3WU2C 4D7MA 1R5LA 2D1HA 2AHMA 2P0WA 1YE9A 2JVGA 3HUGA 4XGIA 1RUNA 1V33A 2Y20A 4KT6A 2O25A 1TBXA 2LY1A 1R6BX 2LVOC 2DODA 1XG1A 4R3DA 2XRNA 4D5FA 5HDKA 4XRSG 3R6SA 2V26A 3L2VA 3EQLF 1RKWA 4P5OA 4X62M 1RUOA 2C9OA 5HLHA 2R7SA 2XGCA 4QNRA 3L2QA 1X3WB 1QBJA 1RPWA 2DDBA 3UNGC 2HTJA 3HOWJ 3ZMVA 2JK3A 2TRTA 1KU7A 1REPC 4C30A 3E6MA 3L25A 3ML6A 2HZDA 1POGA 2FXAA 2E1MB 4B08A 5D6EA 3J7AY 5DTDA 4LG2A 2LK2A 3TKYA 3LSMA 3HPGA 2ECBA 3DOAA 1TL8A 1Y0NA 4ON0A 5FKLA 3GLHA 1I1GA 1LKXA 1XGMA 2MSYA 2EZKA 3QAHA 5EEAA 1QPIA 2QBYA 1JHHA 2HQNA 1KYIA 2JRMA 3KLOA 5M5WJ 2VXDA 3THGA 1SFEA 3OIOA 5J40A 1AHDP 3I64A 2R62A 2VKHA 2PQ8A 3ABKH 2CU7A 3TW7A 5C3EJ 2IEKA 3JR9A 5JLXA 2G5GX 2X4HA 5L3CA 3OYHA 5BOXA 4DR3M 3FK7A 1ZMUA 2E2JJ 1MW7A 3M7GA 4L5EA 1TW2A 3GLGE 1U5TA 3FMQA 3OS1A 2JNHA 2CRGA 1W0TA 4CHTB 3FIWA 2LG4A 1NNUC 1QQIA 4A3JJ 2EFWA 3CCYA 1JKPC 3HHYA 4XRMA 4JI5M 3U61A 2LHCA 5A2QK 3PNVA 1E32A 4MHGA 5K1YA 1FSEA 2HZTA 1VQNI 1H8AC 3BPXA 3BG3A 2V9VA 4U0WA 3TGNA 3OYJA 1WHCA 4BJ6C 2RDPA 2ZNZA 5E20A 1OR7A 2F4MB 4CIZA 3MWMA 4HSTA 1IV8A 4ZDPA 1QDTA 1EJ9A 1NK3P 5JHUA 1ZMWA 3LA3A 2A6HF 3F72A 1R22A 1YSYA 1WI3A 5M3MJ 4CCJA 5IWAM 4BQQA 1Z7UA 4B44A 3F3XA 4UHTA 4I81A 1WRJA 3U60B 1DO2A 3BY6A 4XM3A 2HOTA 1Q1VA 3V7SA 1ZLJA 1PJJA 3Q0UA 4DYCA 5FD6A 3HGIA 5IREB 2K02A 1RESA 3GLGA 3TO9A 2JA8J 4BE2A 3J7BA 3KS8A 2RQPA 4M3GA 2R7VA 2E7XA 3FTCA 2EV0A 3S1QJ 4BJ5C 3TL4X 1UB9A 1ORYB 4AQYM 2IGOA 2Z1DA 3QP6A 3FMSA 1LE8B 2LREA 2RGVA 3IRQA 4MGHA 3GQ3A 2E1NA 4LK1F 3PQKA 2R3SA 1HXDA 2BJWA 4HV5A 3GRUA 1UHMA 1OIPA 1YIOA 2EKKA 2Y0QA 2E1OA 2PFBA 3TW6A 5JR3A 5DM6F 1D0LA 1KQ8A 4MGYE 1GVNA 4CO8A 5IP6A 3ABLH 1IY2A 2IBDA 4HV6A 3ZR8X 1XDUA 2E5NA 2GBYA 3OYNA 1HJPA 4II3A 3KZIC 1TLHB 1U2WA 3AG3H 4L9NA 4AIHA 5FRNA 2DI3A 2ADUA 1GL6A 2V6ZM 3IL2A 2LXEA 1JUSA 1TZLA 5CPRB 1R2ZA 1P2FA 4P55A 3GPUA 2MW8A 3BZ6A 3O8GA 1HA8A 4IJEA 4DYQA 2F5VA 1NG6A 4HL4A 1RI7A 4M3DA 2F5FA 2R7RA 5IYBJ 3ZQFA 2CRUA 2Z5UA 2XAUA 3W2WA 1B8IB 1QANA 4EM1A 2DA4A 3VDXA 2FA5A 5IP7J 2DU9A 2QEXI 2YR0A 2JZYA 3C3WA 3E0JB 1BI0A 4HNVA 1SMTA 3DEUA 4M3FA 2E34A 2XRLA 2Z3YA 3IKVA 2C99A 1W5SA 4PFOA 3KSJA 3PFYA 2UUZA 2VN2A 2NS8A 1T39A 2EIJH 2X85A 2VKEA 5CLSA 2KQRA 4I0AA 3BTIA 3SYTA 4NHJA 2HOSA 1XXHA 3GFIA 1APLC 2IP2A 4UNOA 1GLNA 1HNZM 1IXCA 1HBXG 3QPHA 1P4WA 4XLCA 3FUUA 4DR5M 4JXJA 3VLFB 1ZHFA 2LKSA 3RGSA 4OMYA 1SFXA 4DR1M 1U3EM 2LSOA 4AC0A 5K5RA 8CATA 4CGYB 4LJ4A 3FXQA 1KA8A 4L5IA 4BH9A 1SD6A 2ZBKA 1NO1A 3G3ZA 2HQRA 1Q3CA 3M3YJ 1JTXA 4A3MJ 4ZDLA 3RIRA 2JSCA 2L6OA 3SFIA 3ZMTA 1XX5A 2K5CA 4LF8M 3B6AA 2DMNA 4B3RM 3ZOBA 3GLHB 3HHGA 3HRUA 3HOZJ 3CMMA 2DK8A 5K7HA 1S9HA 2NAZA 3I5UA 2DA5A 2WAQA 2GOMA 2O3FA 1DV0A 3KLNA 4E7ZA 1LJ9A 5D5WB 3MZHA 2ZJ2A 1PVEA 3K0LA 1D8JA 1K3WA 2Q2EB 4A12A 3EUAA 1TDHA 3KIOA 2L9RA 1S3SA 1JR3E 4CGZA 3SJMA 3M1EA 4M6VA 2BEOA 1OYYA 3BT9A 2NVQJ 4LG0B 3QPLA 2VUMJ 4G7OF 3H9QA 1ETVA 3KPHA 4WXDA 1QA6A 1XNQM 4RM2A 5B66C 3FX3A 2Q2EA 1HSJA 3S32A 3J81K 4LJ5A 1SD7A 5L3EA 4DQ2A 4NRVA 3BXWA 2KHMA 4JK1X 1VQ5I 1E17A 3IWFA 4KDPA 4NXMM 2VPLA 1WR1B 4AW4A 1LPQA 4LGWA 3FWEA 5A2QZ 4D80A 2J7NA 4UVBA 1XDSA 3W0FA 1BBYA 1LDJA 1GL7A 2OF7A 3JW4A 3G6EI 3S3NA 4QPQA 3GQ5A 1O3RA 3V76A 4IBIA 1R23A 1J5YA 3OWTA 4YIIA 2HVSA 1NK2P 1Z0XA 1F4IA 2QQ9A 4RGXA 2DA7A 1VF9A 1X1BA 4RMNA 3OS2A 2DTRA 2DAIA 2V1DA 1DGGA 2DWZB 3D8BA 5F0FA 2CFXA 3MKYB 4IBDA 2RKOA 2JA7J 3A98B 1NHWC 3HOYJ 5EQTA 1HT1E 1QVTA 1JR3A 1NSFA 3GQ4A 1Y1VJ 4I98B 2MABA 2BVLA 4DV6M 2HVQA 5IOZA 2A61A 2XEPA 3F6OA 3SEQA 4L6V6 1YRNB 4W1UA 2QUFA 1IXSB 1MN3A 3X2QH 1VTNC 3Q5FA 5HOOA 2OOBA 2DQRA 2MLKA 3CUQA 2JWTA 4ABZA 3DTKA 3U6EA 4G3OA 2JY5A 4JYAM 4PDKA 1CF7B 4I01A 1LE8A 2CFOA 1SXJB 5C1BA 4I2OA 1JKOC 2R6FA 3TQSA 2UXBM 2FOWA 5FB2A 3VEPA 3CO6C 3ZQCA 1YYVA 1HC8A 1OAIA 1TW3A 4GC9A 4O6JA 4BBRJ 5IYCJ 1JB0F 3E6DA 5E1XA 1TTEA 2HWVA 2CW8A 4KT5C 3KETA 2W85A 4I4LA 4OU0A 2K9LA 5KPRA 1FP2A 1KZHA 1IGNA 2ELHA 2K7LA 2KRHA 2I8DA 1R4GA 5JI2E 1L1ZA 1G3SA 2XFTA 1U9NA 4PGHA 1OCPA 4MNUA 2FOKA 4PJLA 1UFMA 5E1WA 4QNMA 1I6XA 1E3OC 2DI0A 1M1EB 2KHHA 2VJ4A 2H09A 4BE1A 4LOCA 3H5RA 1XD7A 2XASA 1IZ1A 1O7LA 3C1DA 3I59A 1MBGA 1VQOI 3RI4A 1STZA 3H3UA 2KZVA 3HRMA 5FLMJ 2E2IJ 4NRWA 3EUHA 2X49A 4B7FA 1HR0M 4A2UA 2CHQA 1HW1A 3LVVA 1IN4A 2IPQX 4F91B 3HU3A 3A03A 3K9TA 1SAUA 3REOA 4BY7J 4A3GJ 5E3MA 4RNAA 3HKZN 1XS9A 4TUWA 4AIKA 2OPTA 1G3YA 2OZ6A 5DYMA 3TOBA 3FK6A 3OSGA 5J1UA 2HKJA 4FX0A 3FHZA 4A3EJ 2HPIA 2H94A 4JI6M 2KJCA 1J59A 1UFZA 5EXXA 3FXMA 4PDGA 4WK8F 3RCOA 2L4AA 5EXSA 2DFFA 1SC7A 9ANTA 1VFCA 2IGNA 5KAIC 3J2PB 5J1RA 5D4SA 3P7NA 4D5CA 3HSRA 4WW0A 4QOZC 4LY6A 2CWEA 5EEGA 5GKNA 1JGSA 1FBSA 2H1LA 3PSIA 2VI6A 3BQZA 2OU2A 2WZJA 2L7KA 3UK6A 3DU5A 1W7PD 4OMZA 2QSFX 2JP7A 4XN0A 4LRSA 1B1BA 3DWLE 1JJ6C 3U6MA 2FS1A 1N77A 4XRFA 4MLOA 3A0BC 2Z4SA 3GLFB 3ULQB 2KDZA 4Y15A 4IF4A 4LG0A 2H1RA 1QO0D 1BN5A 5GPCA 1I39A 5H6QA 2PLYA 2W7NA 4KA4A 2X48A 2XZUA 2DAGA 2BW3B 1MGTA 4F7ZA 2QQAA 3BOSA 3CJTB 5EXPA 1RKTA 3PUBA 4NQWB 4CICA 3H5AA 3IHUA 1FNNA 4RAZA 4RAYA 5EP4A 4A5NA 4UUTA 4N0BA 3J7AO 2K27A 3OYCA 3U6DA 4HF0A 4CXFA 4N4NB 3ASNH 2KRKA 3G73A 2XSZD 3A02A 1IBLM 4UUSA 1FLIA 1FTZA 3GTOJ 3U6PA 4FWHA 1W0UA 2VL8A 1D1AA 3HKPA 2O0YA 3JTGA 3QYBA 4A3VB 1D0YA 4Y7NJ 3R4KA 4EIWA 1S72I 2V1NA 4DBGB 3F8BA 1XXHB 3A1YA 4I0BA 2NNNA 4ZZDA 3C7JA 3L27A 4U0YA 3OYGA 4IHVA 4ANRA 2VC1A 3GP1A 4CYDA 4I6ZA 2V9PA 4FCWA 2ZO4A 3DU6A 4PK4A 3S1MJ 3GEZA 2ESHA 3KYDB 3GUDA 1L2BA 2NVYJ 3Q8XA 3QPSA 2F6CA 2GLOA 3T1HM 2X0LA 3HYIA 2X6XA 2ESNA 3FRHA 3CDHA 3K9OA 4L4UA 4DV5M 3KP4A 5CKTA 2G0EA 3OIPA 2IW5A 3E46A 1LB2A 3SZPA 1V5GA 2X1DA 3LAPA 2JTVA 3GLXA 2D1VA 2NVTJ 4R1HA 3FTDA 2QCUA 3VOEA 4G12A 3TO6A 4MEYF 4GCVA 1SXJC 1OCCH 3FXRA 5FLXZ 4L78A 4HLXA 1I27A 4HEOA 4D7NA 3GPXA 2A6EF 3C3DA 1ZARA 2L7ZA 3CCEI 1R71A 1VQ6I 2P6TA 1E9RA 3J80S 2LTUA 3ZGKA 3DQVC 3E9SA 1Y8GA 1MH3A 3CQZJ 2LBCA 2J5PA 4Y33A 2FFJA 2ZC2A 4G8XA 5EGOB 2R7XA 1XMQM 1EH6A 5B3SH 2EZIA 3EDPA 3W6VA 4IHTA 4LJ7A 3BTJA 4XOPA 1I1SA 2CQQA 1QZMA 3ZH9B 2H27A 4BXFA 3WU1B 1Q02A 4CDGA 1MNEA 4FE4A 4C3HJ 5LRSA 5ITXE 2M7AA 5EDNA 3G2BA 2KMUA 2PMZN 3J7ZI 4TV7A 4A6EA 1H88C 2EV6A 2ZM6M 4OVZB 4AM3A 3N97A 3COAC 4B1RA 4ENNA 2M0MA 5CVRA 2HOAA 4E7SA 4XONA 3BR6A 3RYRA 5L3GA 1QZYA 2A68F 4LITA 3MHVC 4AUXA 1BI2A 3KS4A 3K4NA 1PUFA 2XB5A 2Y0SN 4PD2A 3CUOA 3BZKA 3K2AA 1QZZA 3ZMUA 1OCTC 5L8RF 3CDLA 1L1TA 1HSTA 4H0EA 3W2AA 2HYGD 2QWWA 2IJLA 1ONVA 1GVDA 4B7HA 4G4RA 1XMXA 5TISC 1N34M 4FASD 4UXNA 2J5OA 1X1PA 4G6ZA 4WX9A 1C7YA 2W25A 1TT5B 1LFUP 2YU3A 2LTPA 2OUMA 3A46A 4JX5A 4XNFA 1S3JA 3NBXX 1DPRA 4PJ0C 4MTEA 1XMKA 1GKIA 5K7FA 1Z9CA 1MMSA 4XR6A 5FO5A 1LTMA 2EINH 1VQ4I 3K4BA 2YUSA 3L9FA 3CCQI 1YRNA 2MD0A 1W5CC 4C2UA 1CUKA 4BDZA 2E60A 1DQUA 2K9QA 2CQKA 5DM7F 2M3AA 3T1YM 1X37A 2KDLA 2XF5A 4X64M 2L9SA 2DAKA 3QODA 3BG7A 2C96A 1BC8C 2ZB9A 1VQ7I 3H92A 2BYVE 3IH2A 3QAUA 1P6RA 3AL0B 3GLIA 5HS7A 3SBJA 3FHNA 4MO7A 5CVUA 4ZTJA 1R5GA 2BY0A 1IUYA 3MMYB 1ZQ3P 4GGGA 3HU2A 1YUBA 5C18A 2Z8YM 4OIRF 1WVRA 5IT3A 1IJWC 4RF1A 3FBNB 2B9SA 1TNSA 2DHYA 1FIAA 3KEYA 2RV8A 2EFNA 3GRRA 1XB2B 1L0OC 3BOQA 2V7FA 1IC8A 3OR2C 5BPDA 4XBFA 3VKGA 2HTSA 2RNJA 1EIJA 3F9KA 3A0HC 1GJSA 1YW7A 4HG2A 5B1BH 2CHGA 1EKEA 3GTPJ 1C1KA 3HUGB 4G4QA 4EV0A 1YJ9I 2K3FA 4JI3M 4AI6A 2KIFA 2ZXJA 3HC7A 2VE9A 1PP7U 2D7GA 3RGPA 2KPMA 2O03A 2P7CB 2DDAA 1TF0B 3E3VA 1ZRDA 1KYWA 3OSFA 3LMMA 2B63J 4IQ4A 5GADJ 4KYWA 3KP3A 1WPKA 4V2FA 3NARA 2AXTC 3H4MA 2IGKA 2G7HA 5KK1A 1FBQA 2AQEA 1HLVA 5DFLA 3PO2J 5F64A 1XGSA 2BY1A 3MKWB 2P5TA 2DAOA 4FWGA 2YX4A 3CDIA 2A3SA 5TGTA 4IBBA 1R5HA 2FBKA 1ZAEA 3M07A 4BHBA 3SHGB 3EYYA 5DCFA 1QAOA 2CG4A 4GC5A 1QHGA 3H4JA 4LZJA 1AU7A 1ON1A 1HW5A 3E21A 2EQRA 3B7QA 1VZ0A 2JSPA 3OOPA 3T38A 2VIXA 3HIFA 3LSKA 5EEHA 2XPUA 4MGRA 3FYCA 4QWQA 3BZCA 3L26A 4LF9M 3C2GA 1YOVB 2ZBKB 2VQEM 4IX7A 1DPUA 3NEUA 1K79A 1EH7A 2UXNA 2M9HA 4OW0A 3SC3A 1T6SA 3L09A 3VB2A 3EIEA 1UG2A 3DXJF 2MYSA 4GRIA 1Z59A 1J0RA 3KEQA 3WE2A 4IBFA 2VB6A 2LKPA 3HRSA 2OD5A 1KQ9A 1T08B 4HW0A 2XAGA 1FY7A 1ZKGA 4JI4M 2W1OA 5FROA 3VSLA 4FCTA 3BC8A 5ILVA 3R0JA 4NQWA 2ZFUA 1SFUA 2BY2A 2WSEF 5F1RA 2VONA 1A6QA 3LFUA 1D0XA 1GV2A 1FBUA 3KFUG 1RIOH 3F8FA 2DFEA 1TWGJ 3H0DA 3WHLA 4CCKA 2VQLA 1OCRH 4BL0B 3ESWB 2BV6A 2IA0A 4G4NA 4DUZM 5EP3A 4IBKA 1YHQI 4B7GA 2A05A 3MKLA 3RPQA 4CCNA 4JI0M 2K85A 4RBOA 5KO3A 1Y1WJ 3GLIE 4JV5M 3BLYA 2KISA 4M9XA 2ME0A 3V8KA 1R1UA 3ZMSA 3HG9A 3G4SI 2WY8Q 3D5LA 1K83J 2L02A 3ECHA 1ETQA 1SEUA 3GFLA 5TJJA 2VODA 2L7FP 1GO5A 3JRBA 4K0KM 2WSFF 2L7IA 2PJPA 4RF0A 5FLXS 4M71A 3GO5A 2XGDA 3GRVA 2RNGA 2F48A 5EP1A 2XUBA 3U1DA 5D5VB 3CJNA 4MQVA 2CW0F 1K78A 2V6EA 4LF5M 5LHGA 3PNYA 3S1RJ 3FYDA 3ZMZA 3KP5A 1V54H 3RYPA 4UY8I 2ICWG 1NH3A 1TWAJ 1LEAA 3ELKA 2PMZA 4XORA 3D0SA 5KQ8A 1J7KA 1P92A 3IAS2 4OWRB 4CZZA 1IRZA 2WB1A 1BC7C 3S93A 3DZDA 1AA7A 3K69A 5JFRA 4PSWA 1EV7A 2FQ3A 3DCFA 3LFKA 2DJNA 4FISA 4QIWN 4Q48A 2VKVA 3SZGA 1NTCA 3U5ZA 7CATA 1YX3A 3QOEA 2DPUA 4CCMA 2DA3A 4EGZA 4XBOA 3S15J 3GLLA 3ZPLA 1SVOA 5FKOA 4L9JA 3F8MA 3LSIA 2Q8KA 2L2OA 3U61B 1YLFA 1EE8A 2CV1A 4GHAA 4F93B 5J8FA 4WWCA 1USTA 1I94M 2FSWA 2M34A 1Z3XA 2ZTCA 5D4RA 3KP1E 5ITTA 4KISA 2R7TA 4REZA 4XK8F 4GO1A 4NOOB 1IN6A 4BEHB 1NY6A 4Q4ZF 3ZN0A 3KOYE 5CYVA 2B0LA 1U0JA 5HLTA 2LF8A 3FKIJ 2I7PA 2PBIA 3OYEA 3VYRB 4Z2YA 2HHHM 1B72B 1UAAA 4W97A 4IXAA 1FPQA 3TBIA 1G3IA 2K9MA 2KZGA 3U2RA 2D5VA 3NBIA 4PJNA 2LY9A 4XKWA 2ME6A 4FWDA 3H1CA 2NOGA 3UMMA 1D0KA 3T15A 2MLGA 3V7CA 1V55H 2YQZA 4ZJZA 1XMAA 2NNYA 1HCRA 1LDDA 4LK0F 1Y56A 2FNPA 2ZAOA 2KL4A 4LLLA 1PYVA 3FF5A 1SVMA 1ZGJA 2M87A 4ZTFA 2DT6A 3MQ0A 5HLGA 2DYSH 1MBFA 3GVAA 3ZP5A 1NV9A 3WGIA 1RZ4A 1XHBA 2BE5F 5CVVA 1YFHA 1BL0A 5ITRA 5IOYA 1DGHB 3RTRA 3HHZA 2L0KA 4L5JA 2X6WA 3EUKL 3BCBA 3NWLA 2M4KA 3VWBA 3CLQA 2DHRA 4ITVA 1B59A 2OA4A 4LFAM 3N05A 3UR3C 3ZQQA 1DGBA 3D5SC 3CCVI 1NY5A 2MH8A 1Z21A 2WA0A 5ED4A 3KOWE 1Z5CA 5ITUA 4Q5SF 1W5TA 5E17F 3HWSA 2BXZA 2COBA 1PM5A 2JN6A 1SD5A 5KHDA 5M5XJ 1VQ8I 1X1CA 1JR3D 3OYFA 2RREA 5M3FJ 3RZOJ 2P5KA 2NVXJ 2JJ7A 4OINF 2RC4A 1JKRC 2J5YA 3GLIB 4U7DA 4DYRA 3WHKA 3LSHA 2VQHA 5H37D 3SQNA 5IY5H 1E9SA 2DPDA 1AIPC 1XC8A 5M5YJ 4IBEA 3F92A 3CF5F 3V8LA 4JX4A 2LMDA 3BDDA 1ON2A 1GABA 1R4MB 4FETA 4M74A 3IC7A 1VQ1A 3ZCOA 3PJRA 3MMPA 3RQ4A 4XOTA 2ZMEB 4D81A 4A5MA 4FCVA 4L15A 2F5SA 3FRIA 4UVCA 4LJ6A 1C0WA 2F5QA 4EM0B 1Z6TA 1T0FC 4MGZE 1FZPB 2XGEA 1R1TA 4C2TA 3H35A 1IN8A 2R7OA 4BQOA 3CF0A 4OAYA 3GTJJ 1X19A 3M9AA 3SAUA 1PDNC 3SDBA 3LA2A 4G6DA 1S5LC 4HNUA 2R0IA 2LVQD 2BWEA 2MFZA 5HDGA 1F43A 4RA2A 2E1CA 4AVZA 3LNQA 3HPHA 2EK5A 2OZUA 2EH3A 3U1KA 1KQ0A 2VOPA 1K6YA 1X1DA 4MFEA 3RE8A 2LD5A 3H9GA 4EJTA 2XH9A 2AO9A 2G8LA 2DCEA 1BI1A 1IBMM 1N25A 1BR1A 3T8TA 1PP8F 3HKZA 2GQFA 3HJSA 4FTHA 5HS8A 4A3FJ 4MFDA 3KXEC 4IOCF 2I10A 3E6CC 1QUTA 1N78A 1DGHA 1I4WA 2NS0A 5K7ZA 5FD5A 3SYKA 4LZZA 2VLAA 4XIDA 3HJQA 3ZQ7A 1OTRA 2KA6B 4L16A 2MROB 2BVMA 2L9VA 3NWTA 3KYLA 2K6BA 1TQIA 1K82A 5FLVA 5A2QS 3EETA 1FP1D 3MZYA 4IBJA 2Z33A 1TP4A 1JHFA 2DW4A 4DGWB 4BYYA 2MH9A 1V5EA 5BNGA 1V92A 3WTVC 2ZXIA 1H9TA 2NRAC 3FD9A 3DLAA 3SMPA 3HHXA 1G41A 2QNJA 2F5OA 4LJ9A 3OIQA 2KNZA 1WJAA 5DUKA 2EA2A 3MVPA 1TWHJ 3LQRA 2J7OA 3U6OA 2DYRH 4MM3B 2E5ZA 2JZ0A 3B6CA 4CHUA 4R79A 2CP8A 3VDPA 3I4VA 1B4AA 4AU7A 4J01A 2YR2A 3R9XB 3BP8A 1QZEA 1ZMVA 4AKGA 3CUQC 3GFJA 3SZTA 4P16A 2XFSA 4WXHA 2X8AA 1ZRFA 3MZ8A 3EPZA 2G7UA 5F27A 1IXRC 1UELB 4B3AA 2JQ7A 4GDFA 1TDZA 4Y52J 1IBKM 4W5WA 1I50J 1WXQA 1V34A 2M30A 1WKMA 3PIPF 2NXNB 3O2PE 1MIJA 2P6SA 2R7QA 2R4GA 5LFAA 1HKSA 5EXTA 5EZHA 3W6JB 5FRMA 3FXUA 3PQJA 5E8GA 3GMEA 3W0LB 3TWKA 2I7NA 2HKXA 4EEFG 1S6LA 1L3LA 3CC7I 4NC7A 5L3FA 2R7FA 1F1ZA 3JCUC 4AG6A 2DWNA 1L8QA 4CISA 2ZXHA 2KIUA 1GUUA 3Q0VA 3WTZA 1HT2E 3R0AA 4YIFA 2ETHA 3QRFF 1CQTA 1HF0A 3GTLJ 3KP0E 3TPZA 3W67A 5FJ8J 1X3ZB 1WWXA 1JGGA 4I8OA 5BMZA 2P5VA 3IP4B 5FKMA 3U9GA 4RLQA 4PZJA 4XL9A 4NSRA 3J7AS 4XKCA 2I5UA 3DA1A 1R36A 1Z05A 3LSJA 3FM5A 4LLGF 4CCLA 1T0FA 2L9NA 2MH2A 3V42A 4DNCA 1MKMA 1MJGM 2EV5A 2Z2SB 2PJRB 5DS9A 2W48A 3C58A 3GZNB 1PUEE 5J47A 3BR3A 5CVJA 2MBFA 2P81A 3LL7A 4KN4X 2HPMA 2PJRA 3E7LA 2A6TA 4HA8A 1ZELA 2K40A 3B7NA 1R6RA 4ESBA 3K2ZA 3U6QA 3K4CA 3MAJA 4HLYA 2FU4A 4XK4A 1FIPA 1BW5A 2WTEA 2PEXA 1QYRA 2M8EA 1BW6A 3FXLA 3J7YJ 3TP0A 1Z5BA 1U6GA 2L09A 4KO8A 4IHWA 2OPFA 3AJIB 2ZCWA 4DV3M 2C5RA 3GZ5A 2EBIA 4U87A 3TMOA 2EIKH 1IG7A 5HNHA 2DZLA 3BCAA 5D5UB 1LFPA 3T0YA 1RU3A 4HX4A 2QQ8A 1WJFA 1KFVA 3GO8A 2XKOA 3M0EA 2P8TA 4UV8A 4Y13A 5LGNA 6PAXA 2AXLA 3OS0A 4O3MA 4GXOA 3VDUA 2P4WA 2VBYA 4L18B 1G6NA 3I3LA 4WXCA 2V1UA 3I51A 2D7EA 1Y39A 3L00A 3HGYA 1FX7A 2L4FA 1OKRA 3E5UA 2OQRA 5FGMA 3BPVA 3U5ZB 5FKKA 4M3BA 4MEXF 4F55A 1OYIA 2YFQA 5IZ7D 4PJJA 4ESFA 1A5JA 1ZH5A 2GQQA 2L4MA 3OL4A 5DEQA 3WGGA 1CGPA 4M6XA 2VT3A 1TGUA 4GFBA 1U8BA 1UJ8A 3SFZA 3MJ5A 5FSWA 3FUWA 2KXEA 2DOFA 2VF7A 1T95A 2VQGA 2FX0A 4LCBA 1J09A 1RETA 2GWRA 2KKOA 3FUVA 1NJGA 2XZFA 1NHGC 1XMOM 4P9UA 2QHOB 2N35A 4S12A 3A01A 3LQQA 2Y75A 4BJTA 2BWBA 4HRIA 1Z7LA 4HX8A 2QCOA 2CE7A 5D5XB 1R7RA 2XPVA 3HRTA 1MDMA 2XF3A 3JTHA 2KEBA 3CP2A 2F5PA 1E0EA 1Z5AA 4GMQA 5IT9S 5IT9K 2L7MP 4E7IA 1V5FA 1R00A 2Y30A 4ZC3A 5ITXA 5KQDA 1QRYA 4F52A 2AQFA 4HDVA 1OR7C 1SXJD 4C3JJ 3BG9A 4KNYA 2UU9M 2WB1N 2R7DA
chains in the Genus database with same CATH topology
1ZV1A 2RRUA 1R4GA 5JI2E 4GEWA 2K9DA 3GLHE 3IECA 2DI0A 2KHHA 1KYIA 4F1IA 2JY7A 3FRHA 3K9OA 2LVAA 2DAEA 1VEJA 2ZTDA 1EFUB 3E46A 5DFLA 3LCVB 2OOAA 1ZMUA 2ZTCA 2JY8A 2QSGX 2B3TA 3GLGE 2CWBA 2JNHA 4HEOA 1OTRA 2MROB 3H4JA 4UN2B 2G3QA 2DNAA 1UFZA 2LTUA 1VG5A 1Y8GA 2LBCA 3E21A 1A5TA 2DZLA 1WIVA 1G3IA 1DV0A 1G4AE 1PVEA 2DENA 1TP4A 2KNAA 1JR3E 1Q02A 1V92A 1WHCA 2OO9A 1P3QQ 1IM2A 2F4MB 2JY6B 2WZJA 1G41A 1YLAA 2QNJA 1ZMWA 2L2DA 2KNZA 1IXSA 2K0BX 2JP7A 2QSFX 4Q7JA 3K9PA 2L4FA 2JZ0A 1VDLA 1WGLA 1TR8A 1DO2A 1NV9A 2CP8A 1IFYA 1PGYA 2EJSA 2H5XA 2KNVA 1QZEA 1WR1B 1ZMVA 2MGWA 3T6PA 1BVSA 4F2LA 4WP2A 1NV8A 3IHPA 1C7YA 2MJ5B 3B89A 2DAGA 3BBZA 1F4IA 2F4OB 2L4EA 1E94E 3ESWB 1XXHE 2DAIA 1VEGA 2DKLA 2LVNC 2EKKA 1VEKA 1HQYE 2JUJA 1DO0A 3GLFE 2EKFA 3GLIE 1HT1E 1CUKA 2QHOB 3FE3A 1HJPA 1T43A 2DAKA 4YIRX 1GO5A 1AIPC 2BWBA 1MN3A 2LVPC 3F92A 2JZ1A 2OOBA 2O25A 3LCUA 2LVOC 1HT2E 4G3OA 2JY5A 1VQ1A 1WJ7A 3MMPA 2QSHX 1X3WB 2MR9A 1WGNA 3FRIA 4R71A 4DBGB 2DHYA 2DAMA 1OAIA 1X3ZB 2HWJA 1T6OA 1XB2B 1OQYA 1SG9A 1TTEA 1OKSA 2HAKA 2R0IA 2LVQD 2BWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZV1 A;  2RRU A;  1R4G A;  5JI2 E;  4GEW A;  2K9D A;  3GLH E;  3IEC A;  2DI0 A;  2KHH A;  1KYI A;  4F1I A;  2JY7 A;  3FRH A;  3K9O A;  2LVA A;  2DAE A;  1VEJ A;  2ZTD A;  1EFU B;  3E46 A;  5DFL A;  3LCV B;  2OOA A;  1ZMU A;  2ZTC A;  2JY8 A;  2QSG X;  2B3T A;  3GLG E;  2CWB A;  2JNH A;  4HEO A;  1OTR A;  2MRO B;  3H4J A;  4UN2 B;  2G3Q A;  2DNA A;  1UFZ A;  2LTU A;  1VG5 A;  1Y8G A;  2LBC A;  3E21 A;  1A5T A;  2DZL A;  1WIV A;  1G3I A;  1DV0 A;  1G4A E;  1PVE A;  2DEN A;  1TP4 A;  2KNA A;  1JR3 E;  1Q02 A;  1V92 A;  1WHC A;  2OO9 A;  1P3Q Q;  1IM2 A;  2F4M B;  2JY6 B;  2WZJ A;  1G41 A;  1YLA A;  2QNJ A;  1ZMW A;  2L2D A;  2KNZ A;  1IXS A;  2K0B X;  2JP7 A;  2QSF X;  4Q7J A;  3K9P A;  2L4F A;  2JZ0 A;  1VDL A;  1WGL A;  1TR8 A;  1DO2 A;  1NV9 A;  2CP8 A;  1IFY A;  1PGY A;  2EJS A;  2H5X A;  2KNV A;  1QZE A;  1WR1 B;  1ZMV A;  2MGW A;  3T6P A;  1BVS A;  4F2L A;  4WP2 A;  1NV8 A;  3IHP A;  1C7Y A;  2MJ5 B;  3B89 A;  2DAG A;  3BBZ A;  1F4I A;  2F4O B;  2L4E A;  1E94 E;  3ESW B;  1XXH E;  2DAI A;  1VEG A;  2DKL A;  2LVN C;  2EKK A;  1VEK A;  1HQY E;  2JUJ A;  1DO0 A;  3GLF E;  2EKF A;  3GLI E;  1HT1 E;  1CUK A;  2QHO B;  3FE3 A;  1HJP A;  1T43 A;  2DAK A;  4YIR X;  1GO5 A;  1AIP C;  2BWB A;  1MN3 A;  2LVP C;  3F92 A;  2JZ1 A;  2OOB A;  2O25 A;  3LCU A;  2LVO C;  1HT2 E;  4G3O A;  2JY5 A;  1VQ1 A;  1WJ7 A;  3MMP A;  2QSH X;  1X3W B;  2MR9 A;  1WGN A;  3FRI A;  4R71 A;  4DBG B;  2DHY A;  2DAM A;  1OAI A;  1X3Z B;  2HWJ A;  1T6O A;  1XB2 B;  1OQY A;  1SG9 A;  1TTE A;  1OKS A;  2HAK A;  2R0I A;  2LVQ D;  2BWE A; 
#chains in the Genus database with same CATH topology
 3HGG A;  1GV5 A;  5FTJ A;  3GFM A;  3RKX A;  2W82 A;  1YIT I;  1ZRC A;  5F0H A;  3VSK A;  4NUB A;  1N75 A;  1QHH D;  5E26 A;  2AHQ A;  2W57 A;  1LV7 A;  2XSZ A;  4PSX A;  4XKB A;  4UVA A;  2VPR A;  4ZYH A;  2VBW A;  3HX3 A;  3MN2 A;  2V79 A;  3K70 D;  4BB9 A;  4JYK A;  1WCM J;  3DKW A;  1ZK8 A;  2F5C A;  2LBF B;  1U5T C;  3OYI A;  2ZAM A;  2Y9Y A;  3BRO A;  1L2C A;  1WQ2 A;  2PMU A;  3CP8 A;  3GF2 A;  3RKW A;  1XGN A;  2EZH A;  3TED A;  4BLC A;  2HEO A;  3GPY A;  1OFC X;  3S1N J;  2HNH A;  2QSG X;  3VPR A;  2B3T A;  1UZC A;  1NG7 A;  2DLL A;  2QF7 A;  2LRD A;  4R8H A;  4UN2 B;  1TNT A;  3L7W A;  1RR7 A;  4FW9 A;  4LD5 A;  4IHX A;  1X4O A;  2KP6 A;  5JLW A;  1D2N A;  2MC4 A;  3SAV A;  1SAN A;  3G1L A;  4JI8 M;  1KGS A;  2O01 F;  5CQE A;  2KNA A;  2LH0 A;  3I55 I;  2ZSH B;  2X9D A;  3ASO H;  2NVU B;  4AIJ A;  3WG9 A;  2ZJQ F;  1R4N B;  4EJW A;  5C4J J;  1F9N A;  4OVZ A;  4M9Z A;  1K4T A;  1IXS A;  4S05 A;  2FRH A;  4CUG A;  2HOE A;  4QTR A;  5BS6 A;  1ZAO A;  1LVA A;  4KMF A;  3F6V A;  3DLL F;  1TR8 A;  4I7H A;  1QUS A;  4DBR A;  4HDU A;  2EB7 A;  2ZSI B;  2H5X A;  1MBH A;  3V8J A;  2GOX B;  5FTL A;  3OYL A;  1YQA A;  2IT0 A;  2XLJ A;  1IRX A;  1XSX A;  3I54 A;  1JKQ C;  4HF2 A;  4LJZ F;  3KYC B;  2IAI A;  4D82 A;  2G9W A;  1GJT A;  5IPA A;  2DMU A;  2JPB A;  4ENJ A;  2IXS A;  4HZF A;  2KT0 A;  2F4O B;  4XLP F;  2Q0O A;  1HNX M;  4RB2 C;  3AFH A;  4YY3 M;  3U21 A;  2QZ4 A;  1OPC A;  5HVQ C;  2O7O A;  4A0X A;  2JUJ A;  1PJR A;  3TOA A;  1DO0 A;  1D1B A;  2R7U A;  1YS7 A;  4IHY A;  3FE3 A;  3JR5 A;  2OCE A;  3VYU B;  3LVW A;  5GAG J;  3K6G A;  3L28 A;  2JWS A;  3JAM Z;  3LSP A;  1F4K A;  1MMA A;  3E97 A;  4CA0 A;  1FOY A;  2R46 A;  3WGH A;  5GTI C;  3LCU A;  3UKG A;  2VOO A;  5AON A;  2IS6 A;  1T56 A;  2FE3 A;  2JPC A;  3KZZ A;  4LIU A;  3A2K A;  1XC5 A;  1GDT A;  4MGK E;  2KIQ A;  4HLQ A;  4YFK F;  3R8F A;  2EJR A;  4YRV A;  1IRF A;  2HXO A;  4PCZ A;  1I3Q J;  1J2X A;  2DAM A;  4EAT A;  2O5R A;  1OAO C;  1MJB A;  4XSX F;  3JR4 A;  1BJZ A;  4DV7 M;  1WJB A;  3BQY A;  1AUA A;  3BR5 A;  3PSF A;  3TDZ C;  4YFX F;  5E3O A;  2R7Z J;  4QPO A;  1SFO J;  1RNL A;  3UZU A;  5KNL A;  3DBL B;  1KYZ A;  3S16 J;  4IBC A;  1T3T A;  5LHH A;  2Z9O A;  3R60 A;  4KIC A;  4OU7 A;  2X6Y A;  2K9D A;  1IUF A;  3GLH E;  1E3P A;  2E36 A;  5E79 C;  4BXU A;  4UUS B;  1IV6 A;  4L9V A;  2DT7 B;  4E70 A;  2Z16 A;  3ABU A;  1HQC A;  1XTA A;  2R0Q C;  2Z4R A;  3C2B A;  3DP7 A;  3WG7 H;  3JRF A;  3S2H J;  3L2C A;  1R58 A;  1I5Z A;  2RVC A;  3NWS A;  3OV8 A;  4B43 A;  2Y0M A;  4RDU A;  5IYD J;  3PXG A;  1BIA A;  2BY3 A;  3RQI A;  3DFZ A;  1S29 A;  2NOJ B;  4KN7 X;  2CWB A;  2GZW A;  4U7B A;  2EFQ A;  4YEJ A;  5C44 J;  3NQO A;  5BPV A;  1W7P A;  5E1Z B;  4BS9 A;  5J8C A;  3VFD A;  4M72 A;  3K1P A;  4ZYD A;  5F08 A;  5EG0 A;  2WAD A;  3SEZ A;  3DPL C;  3G1O A;  2FF4 A;  3Q8G A;  2QP9 X;  3CD6 I;  3CMY A;  4IRH A;  4XIC A;  1TH2 A;  1K4S A;  1ACI A;  1OCZ H;  2V4J C;  1OLT A;  4GYI A;  2FMY A;  5IP9 J;  4J19 A;  3RPU D;  2F2E A;  2WY7 Q;  3QQA A;  5LEK A;  1PJT A;  4B3M M;  5J6X A;  4IL6 C;  2NYX A;  2XF7 A;  2Y0S A;  4JN6 A;  2UZK A;  4U0V A;  4BAC A;  1IW7 F;  4ZYG A;  5EYR A;  4X65 M;  2DMQ A;  2XAF A;  4IRG A;  1TT0 A;  2VT2 A;  4NBQ A;  1RR8 C;  3OTO M;  2MGW A;  2Y21 A;  2XPW A;  3A4C A;  3Q9V A;  4IPA A;  3HOT A;  4HQE A;  1B72 A;  5FTK A;  4ZZL A;  4II2 A;  4QHS A;  4WP2 A;  2DOE A;  3AOE C;  3R61 A;  4QSH A;  4OAZ A;  4X1E A;  1ZG5 A;  4K2E A;  5FTM A;  3Q0W A;  2BNK A;  2VBZ A;  3GX4 X;  1P4X A;  3OY9 A;  1E94 E;  2R93 J;  1Y6I A;  1ZGA A;  4L0Z B;  1ETX A;  1UHW A;  2WWY A;  2HYJ A;  1WGX A;  3J27 B;  1AWC A;  4A3C J;  3CLO A;  1JXS A;  3QU3 A;  1MZB A;  4XLE A;  1IDZ A;  5FKN A;  3A01 B;  1GXP A;  2EUC A;  2VJ5 A;  2RGO A;  3P9C A;  3ZQJ A;  4Q47 A;  4I99 C;  1SXJ A;  2VJI A;  3PUF A;  3M8F A;  3CCU I;  3PM1 A;  1Z6R A;  3CJR B;  1MSE C;  1JT0 A;  4LG3 A;  2COM A;  3E4R A;  3M4O J;  2LVP C;  1XWI A;  3H36 A;  3OL3 A;  4G6Q A;  5ICC A;  3GZ6 A;  3WHC A;  5J1Y A;  3DTE A;  5TRD A;  4NSO B;  1QU3 A;  4ITQ A;  3W6K B;  4BHC A;  3GTG J;  1K61 A;  2E19 A;  3BTC A;  1A6I A;  5DCM B;  2MR9 A;  1WGN A;  3GRY A;  1W36 D;  3TE6 A;  4ETS A;  4IQJ A;  4A0Y A;  3L2R A;  1V4R A;  5FFZ A;  2EWN A;  4KIT B;  3CUQ B;  2HDD A;  2XF6 A;  1T6O A;  4RAG A;  4AWX B;  5LHI A;  1VQ9 I;  2HQ5 A;  3I58 A;  3WTY C;  3D8L A;  5IT9 Z;  1ZV1 A;  1D5Y A;  2VC0 A;  5FFX A;  1QNT A;  1G4D A;  4PT5 A;  2STW A;  4M6Y A;  3C3E A;  4LB5 A;  1D0Z A;  2D45 A;  1UM8 A;  1FYM A;  2JA5 J;  1DP7 P;  4HNT A;  3QOP A;  2BGC A;  1FMW A;  3FMR A;  3SYL A;  3CTW B;  1LFB A;  1B9M A;  1SXJ E;  4PUS A;  5GPA A;  1YJN I;  1HDD C;  1MND A;  2M4G A;  3FDY A;  4IVN A;  1O4X A;  2M5W A;  2JXN A;  2M8G X;  1FC3 A;  2VXZ A;  4V19 K;  2Z7J A;  3J80 Z;  1MJ9 A;  4L0Y B;  2XIG A;  2JY8 A;  3ILK A;  5LD2 C;  3JSO A;  2R5Z A;  3DBR B;  2ISY A;  3HTU A;  1TH3 A;  3MD2 A;  4XKV A;  4YFN F;  5K5Q A;  1ETW A;  3B7Z A;  2FUG 2;  1E3H A;  1D5V A;  1ETK A;  4IO9 F;  3HOS A;  2LNH C;  2EO2 A;  3H5N A;  2L3D A;  2QKL B;  1F5T A;  3DKX A;  3K4K A;  4DW6 A;  3ONQ A;  5LBQ A;  3MCZ A;  4BQA A;  2FE8 A;  4WF2 A;  3H3V K;  4X6A J;  4GIT A;  2LC2 A;  4A93 J;  1I3A A;  3HY5 A;  2RN7 A;  2UUA M;  4A6D A;  5ICF A;  1FYK A;  4S04 A;  2CGP A;  1P9Q C;  2HS5 A;  1TQM A;  1Z67 A;  2JY6 B;  4FQG A;  4IJA A;  3MEX A;  1YLA A;  1Y8Q B;  4CH7 A;  2BJV A;  2LYC A;  3IAM 2;  3CO7 C;  1EF4 A;  3WTT C;  3K1N A;  4XRS A;  4KIB A;  3GCM A;  1BA5 A;  2E71 A;  4FD2 A;  4N9H A;  3JRC A;  1IY1 A;  2F5D A;  1MMG A;  2DA6 A;  2R7W A;  2JA6 J;  2M0C A;  2YX7 A;  1PGY A;  4I5S A;  3WHB A;  2PG4 A;  3EIH A;  3ZXS A;  2EA4 A;  3VYS B;  3C9P A;  5H20 A;  2LVS A;  3W68 A;  3CES A;  3KE2 A;  2IS1 A;  3CCR I;  2Y2Z A;  3F23 A;  3KCC A;  2MJ5 B;  4BXX J;  3ROU A;  3LST A;  3CGW A;  4DV0 M;  4ZYE A;  1LNW A;  2LH9 A;  5EG0 B;  2R44 A;  3QYE A;  2Y48 A;  3H3Z A;  3GTM J;  1XSD A;  4G4O A;  1HQY E;  1WH7 A;  4AKI A;  1DU0 A;  1HNW M;  3I0T A;  4LLN A;  1AOY A;  5CQG A;  2OAZ A;  1Z3Y A;  2QYO A;  1W4M A;  1ZRE A;  2DOA A;  2C98 A;  4B4C A;  1J75 A;  1QAQ A;  2KZS A;  3CMA I;  2R4E A;  2CJJ A;  3EUH C;  2DK5 A;  1PUF B;  4CYC A;  2APL A;  1WI9 A;  2TCT A;  2GIV A;  5ERI A;  1BOB A;  4KLN A;  2A5Y B;  1O3T A;  2DTZ A;  2BHY A;  4BHP A;  5ITY A;  4LFC M;  2E7W A;  3F22 A;  2YSR A;  3WTS C;  1G3W A;  1MSF C;  4BQN A;  1QDR A;  1ZYR F;  4IZZ A;  2F4I A;  3KZY A;  2XGX A;  3JRE A;  1MMN A;  1K78 B;  4DJA A;  1OQY A;  2ELJ A;  2FJ1 A;  2IVM A;  3ISP A;  1OKS A;  1X2M A;  2CW7 A;  1S8N A;  2RGH A;  2QVO A;  2CHV A;  4KUM A;  3RDI A;  2GM4 A;  3ZQI A;  4E7H A;  4X0G A;  1N33 M;  1MDM B;  3BR2 A;  4R7G A;  1VDD A;  2XRO A;  1X1A A;  4A3I J;  4AG5 A;  1USS A;  3SHF A;  4F1I A;  2Z99 A;  4AID A;  5J4Y A;  3ZQL A;  1FOK A;  4NL4 H;  1D0M A;  3E5Q A;  4EQQ A;  4BE0 A;  1VQM I;  3M8E A;  1YO5 C;  2MC3 A;  2JVH A;  2LR8 A;  4P96 A;  3OYM A;  2R45 A;  3OYB A;  2EZL A;  3VYT B;  2ZTD A;  2Y31 A;  3SDG A;  4Y3O A;  1ERD A;  1O3S A;  2X6O A;  1R49 A;  4FE7 A;  2D7H A;  4UB8 C;  2OTL I;  5EGO A;  3WTW C;  1XNR M;  4O5V A;  1OIS A;  1OFH A;  2UV1 A;  4JI2 M;  3I4M J;  4BKX A;  1DU6 A;  5LMN M;  3U6L A;  3DBH B;  2G3Q A;  5AIP A;  3HHW A;  1R1V A;  1YS6 A;  1VG5 A;  3KDS E;  2CMP A;  3N4M A;  2HVR A;  5F1J A;  1R9T J;  1YI2 I;  4LGM A;  5C4X J;  1G4A E;  2UWM A;  3JRI A;  3VK8 A;  2L54 A;  4IRI A;  1T98 A;  1BI3 A;  4LF6 M;  1Z1D A;  2A69 F;  2CUF A;  3HL2 A;  2R5Z B;  5H2F C;  3OYD A;  1A36 A;  2HI3 A;  2OO9 A;  2WSC F;  1TQP A;  4BGD A;  5KAF C;  3IV5 A;  1UCR A;  1FYL A;  2QGU A;  3FZV A;  2HDC A;  3H9J A;  2YS9 A;  3KP7 A;  2BXY A;  2W84 A;  2LHG A;  4AD9 A;  2MA3 A;  2V1X A;  5ILU A;  2VDB B;  3K9P A;  5J3L A;  3CF6 E;  2QPA A;  1XN7 A;  4A3D J;  3I4N J;  4B48 A;  1VQP I;  3EYI A;  4BBA A;  4V2G A;  3HSE A;  1RRJ A;  3KX2 A;  1G8X A;  4M73 A;  3V4G A;  4EMS A;  2R4J A;  4OIP F;  2CQ7 A;  5F6F A;  3LA7 A;  3E6B A;  3DF8 A;  5FLX K;  1IDY A;  4RGS A;  2BBY A;  2FEZ A;  3K8Z A;  3BBZ A;  5KPZ A;  1XB4 A;  4X66 M;  4LF7 M;  1UMQ A;  5ICG A;  4RS8 A;  2BOL A;  2WAQ N;  3HOU J;  3MK6 A;  2BHZ A;  2WBM A;  4OOI A;  2LBF A;  2KZU A;  2FOI C;  3LAJ A;  5GP9 A;  3HOX J;  3KOZ E;  3LWF A;  3CC2 I;  4MGI E;  2EKF A;  2NQ8 C;  3GLF A;  4PJM A;  2B7E A;  3L2U A;  4XMY A;  2O8X A;  2F4V M;  3RKY A;  4JX6 A;  4G7Z F;  4IHS A;  3PIO F;  1ZG1 A;  4MB7 A;  3GYH X;  1GT0 C;  3WTX C;  3HB9 A;  1ETO A;  2DZO B;  1XSV A;  2IGM A;  4E4H A;  2AS5 F;  5E3L A;  3B9P A;  4P1W A;  4DUY M;  3BG5 A;  1HKQ A;  2R18 A;  1B8I A;  1HOM A;  4PDI A;  2QSH X;  2CV2 A;  5JHF A;  2HXI A;  3TWL A;  2LDU A;  4IKF A;  1BR2 A;  1KU2 A;  2CEA A;  4R71 A;  2IA2 A;  2KFD A;  4XQF A;  2PX9 A;  2X1C A;  4HEA 2;  2ACJ A;  3IG5 A;  3L2A A;  2N8G A;  2XSJ C;  2CO5 A;  3BWG A;  3IWZ A;  4E6K G;  1WSU A;  1R2Y A;  4IJF A;  3SAR A;  1JTY A;  1TWC J;  2UXC M;  3CTA A;  4GH9 A;  2KLO A;  5E18 F;  1X2N A;  5FTN A;  3P9I A;  2KW0 A;  2O9L A;  4U88 A;  1NNJ A;  3C18 A;  4J00 A;  3U60 A;  2E5L M;  2XSD C;  2KJB A;  3K4J A;  3IH3 A;  2K47 A;  2LVA A;  2UUC M;  3S3O A;  1BJA A;  1VEJ A;  3BJO A;  3KEO A;  3DPU A;  3FTE A;  3LCV B;  2DMP A;  1ZQ9 A;  3AV0 A;  2QLZ A;  3ERM A;  1G3T A;  2R5Y B;  3LW5 F;  3IG8 A;  4DV4 M;  4KIG A;  5GAE J;  5LMU M;  2GXB A;  2KRC A;  4L8R C;  5JI6 A;  1MU5 A;  1YIJ I;  2IS2 A;  1JI8 A;  2DWL A;  4CSW A;  4IEJ A;  3F8C A;  1AKH B;  4KIF A;  3VFZ A;  2K9S A;  4NNJ A;  1S7O A;  1A5T A;  2M60 A;  2UXD M;  1WIV A;  2OCC H;  2QEN A;  4AZF A;  4UUV A;  2F5E A;  2Z3X A;  2DEN A;  2HFH A;  4ENM A;  4DV1 M;  3QU6 A;  2LOO A;  3TWM A;  4XLF A;  4EJO A;  2HL7 A;  3KOX E;  1QQW A;  3S8P A;  2CQN A;  3T1B A;  1A35 A;  2WV0 A;  2XC7 A;  1LUJ B;  3ABM H;  4UV9 A;  4M0W A;  4I09 A;  1KU3 A;  3AL0 C;  3I53 A;  4II7 A;  3E5X A;  5GAH J;  2C9C A;  2ID3 A;  3I4Y A;  2K0B X;  2DJI A;  4EM2 A;  4DR2 M;  4DV2 M;  3M8J A;  3CCM I;  4LFU A;  4EGY A;  2YU9 J;  3I71 A;  1VDL A;  1WGL A;  3G1M A;  3AG1 H;  3BR0 A;  4ASN A;  3I4P A;  5D8K B;  2WAE A;  4BBS J;  5BPI A;  2ZKZ A;  1FJL A;  2H6B A;  3LSR A;  2KNV A;  1S7A A;  2RKH A;  2H1K A;  4DZP A;  1VQL I;  2BW3 A;  1K3X A;  1K7A A;  2OBP A;  4BUP A;  2DA1 A;  1ZGW A;  3NRV A;  1RC9 A;  1JQJ C;  4QOS A;  1R7J A;  3M1C A;  4A3K J;  4B3T M;  1DGR M;  4WUR A;  1J9I A;  2CQX A;  4RAF A;  3T5X A;  1WJ5 A;  3T8R A;  2EIL H;  1DUX C;  2LVN C;  4DIQ A;  5DNY A;  3C2H A;  4ZH4 F;  4F92 B;  4G9Y A;  3JRD A;  3TQN A;  2VKD A;  3S3M A;  3DFG A;  1O7F A;  3L1P A;  2L7H A;  4Y17 A;  5DD4 A;  1T43 A;  1IN7 A;  3KP2 A;  3NAU A;  5HNF A;  4GHL A;  1TTY A;  3VKH A;  4YIR X;  2Q1Z B;  3K2L A;  4EJV A;  2X51 A;  1P4A A;  1OJL A;  1W7P B;  3MKZ A;  4G7H F;  3G71 I;  1EH8 A;  2E35 A;  4HPQ A;  4HYE A;  3FM3 A;  3K70 C;  3ECO A;  1TC3 C;  1D3Y A;  3P5J A;  4ANJ A;  5F3W A;  5LGU A;  1O3Q A;  1IAW A;  4N9I A;  5E8I A;  2WV1 A;  2R65 A;  3DEW A;  4RLF A;  1ORK A;  4D0P A;  1ZN2 A;  3FKJ A;  2DN0 A;  3CME I;  1BR4 A;  1ULY A;  3GWZ A;  4OX9 M;  2M7B A;  3FXO A;  2K9N A;  3OOU A;  3QYF A;  4RB0 A;  1BOA A;  2HWJ A;  4NDL A;  5L3B A;  1T8I A;  2VQF M;  1OMI A;  2XDV A;  3W2V A;  1SG9 A;  5HOD A;  4RM3 A;  1L2D A;  1MBE A;  2HAK A;  1P7J A;  5JVG F;  1H9G A;  3FUX A;  2OQG A;  5AIQ A;  4JI7 M;  2DWM A;  3ZN1 A;  1CF7 A;  2MGQ A;  3HZJ A;  3WOD F;  5LGT A;  3F0C A;  1LDK B;  1SVL A;  4DR6 M;  2QM3 A;  1DDN A;  1Y0U A;  4YEL A;  3IEC A;  2QQB A;  3UJN A;  4JQF A;  2ZXW H;  1J5E M;  2DBB A;  3I59 B;  4BEH A;  5ICE A;  2JUG A;  5DCM A;  3U6S A;  5E6J A;  1DGW Y;  1FSH A;  1G59 A;  1IN5 A;  1XCB A;  2E1M C;  2OTJ I;  2UUB M;  1MNM C;  2M45 A;  4XLN F;  4E7K A;  3KFW X;  2CH0 A;  3IUO A;  4RGR A;  1TH4 A;  3TO7 A;  3QWL A;  4ENK A;  3AAF A;  4YHH M;  2LF7 A;  1ODD A;  4P17 A;  4QLC U;  4G6T B;  2EA0 A;  3FXK A;  1WJE A;  2V9K A;  2ELK A;  2VAS A;  3IRR A;  1I6H J;  1G2H A;  2FQ4 A;  3FKE A;  1YTY A;  1QVR A;  3E1S A;  2GA2 A;  5DV5 A;  5CVI A;  3ZQG A;  3OYA A;  2DMT A;  3K4M A;  1MMD A;  1ETY A;  1KON A;  4FT8 A;  5DYI A;  3B74 A;  3HXL A;  1FTT A;  5EJC A;  2DA2 A;  1JUP A;  2EFO A;  3PO3 J;  3LSG A;  4M0D A;  1A04 A;  1OIZ A;  1KU9 A;  2GXG A;  1LQ1 A;  2ISZ A;  3JRA A;  5EZG A;  4HF1 A;  2P7V B;  4KFC A;  2L2D A;  3FIS A;  1AKH A;  2CSO A;  1BIB A;  1D8K A;  1TWF J;  4LIV A;  3QP5 A;  4I02 A;  1IO2 A;  2XAQ A;  4B8X A;  2GIZ A;  2OV7 A;  1MBK A;  3KP6 A;  1T38 A;  2LFB A;  1YJW I;  1GVJ A;  3UGJ A;  4JI1 M;  2ZNY A;  3BR1 A;  2R5Y A;  3HOV J;  1YW9 A;  2OJE D;  1WH5 A;  2XHK A;  1B9N A;  1Y8R B;  4BNC A;  3PL8 A;  1LEB A;  3O6B B;  1YG2 A;  1NVM A;  1VQK I;  2UXX A;  1T33 A;  4C3I J;  2O61 A;  2H6C A;  3WU0 A;  3B73 A;  3KVW A;  4LJ8 A;  3B89 A;  3BJ6 A;  1FWZ A;  2O8K A;  2ERC A;  4HSR A;  3B02 A;  2EPF A;  1SD4 A;  1XXH E;  2HGC A;  2Y0T A;  2DKL A;  2RAE A;  2WAF A;  4BDY A;  1ZLK A;  2ZFW A;  4LJA A;  5CJ9 A;  5F04 A;  3HEF A;  3K10 A;  4NXN M;  4FX4 A;  4MQ9 F;  5DUI A;  4QHT A;  4B3X A;  1G8P A;  3SXY A;  2DFH A;  4B09 A;  1N36 M;  1FJG M;  2YPR A;  2FH0 A;  2VE8 A;  4PFP A;  2VII A;  4Y4R A;  5D6F A;  2XB0 X;  3JSP A;  1H6U A;  2DFI A;  3VOD A;  2MG4 A;  2GNO A;  1EA3 A;  2DO7 A;  5HLI A;  3RKQ A;  4AVP A;  5JI3 E;  3JRG A;  1R5I D;  4B47 A;  3J80 K;  4A3L J;  2XVC A;  3D5R C;  2XAH A;  3HJE A;  3F8N A;  4HX7 A;  2DXI A;  2ZME A;  2QA4 I;  1WJC A;  1HDP A;  3FTF A;  2FNA A;  3SAW A;  3A42 A;  4L9T A;  3K7A J;  1WZ2 A;  2KRF A;  2A07 F;  5LEJ A;  1QVU A;  4B3S M;  1H0M A;  2V1C A;  4HBL A;  4JP0 A;  4D9J A;  3GPP A;  4IIW A;  3S14 J;  2RQQ A;  1OYW A;  4UB6 C;  4Z8X A;  2FML A;  4LMY A;  1G71 A;  3RJP A;  4YG2 F;  3A45 A;  4NB5 A;  3K1J A;  4A3B J;  1DGF A;  5LLQ A;  4XN3 A;  2QBY B;  5D8L B;  1IF1 A;  5B5E C;  1EFU B;  1GHC A;  3HBL A;  1YW8 A;  2CV0 A;  1B6A A;  1W36 C;  2OOA A;  3HTS B;  2CS3 A;  3K4L A;  1MBJ A;  4GKK M;  4NC6 A;  1T2K A;  4HAM A;  4N4O B;  1U78 A;  5GTH C;  3JAM S;  2JA2 A;  4MH0 E;  1YX5 A;  1U5T B;  1X58 A;  1Q3B A;  2V6C A;  3LOC A;  3O8H A;  1IQP A;  3ZC7 B;  1OFI A;  3HJ8 A;  4PCQ A;  4S0H B;  3I56 I;  3OMY A;  2LWX A;  4RB1 A;  3DV8 A;  1PJI A;  2XKP A;  3SAT A;  1Q1H A;  1WFX A;  2STT A;  1FOW A;  3F21 A;  2M1B A;  4LF4 M;  3OR1 C;  3CCL I;  4FCY A;  1P7I A;  2K4B A;  4EJU A;  3DPT A;  2VJJ A;  3WTU C;  5ITQ A;  4A0Z A;  1P3Q Q;  1IM2 A;  5HDN A;  2PN6 A;  4AYB N;  3P9K A;  3ZCB B;  2IRF G;  4M9S A;  4DR4 M;  4C2M J;  4OIO F;  4M3E A;  5LRR A;  3K92 A;  1IXZ A;  4FVM A;  4Q7J A;  3HU1 A;  3SMS A;  4JOM A;  1BM9 A;  2DVW B;  1N32 M;  5H6R A;  3JRH A;  4E7J A;  3L29 A;  5HS9 A;  2FD5 A;  2Y69 H;  3J81 Z;  4ESJ A;  3Q3S A;  4NC8 A;  4MIM A;  4CJ6 A;  4BY1 J;  1PJQ A;  3MFK A;  2EJS A;  1XGO A;  4LGY A;  4AYB A;  1ZTR A;  2BZT A;  3U6C A;  3CZ6 A;  4RGU A;  5ILS A;  5B1A H;  2KIM A;  3FXJ A;  3Q9S A;  1VND A;  4DR7 M;  1NV8 A;  1IY0 A;  4CCO A;  3IHP A;  5E3N A;  2Y9Z A;  2PI0 A;  2HU9 A;  2KDO A;  5KVR A;  3S2D J;  5F0C A;  1ITY A;  4RKU F;  2L5Q A;  4XSZ F;  3HDD A;  1NJF A;  4DZJ A;  3KW6 A;  2ECC A;  1PRB A;  2ZAN A;  2HYF A;  3GXO A;  2O6G E;  4OIQ F;  4KMU X;  2H8W A;  3QPT A;  1JJ8 C;  2W4S A;  2LY2 A;  1JUM A;  2LNB A;  3DEE A;  3ERE D;  2FBI A;  1MH4 A;  3AOE A;  1MD0 A;  4KT0 F;  1FOX A;  3CF2 A;  1FMV A;  3FBI B;  2VF8 A;  1U8R A;  2GA1 A;  1E2X A;  4FHT A;  3BJA A;  1H89 C;  3M6A A;  4IOA F;  4E7L A;  3RZD J;  1QPM A;  2QKM B;  2JZ1 A;  3I01 M;  2P5L C;  2EFP A;  3IH4 A;  4MTD A;  2EIM H;  1NHA A;  4ZYA A;  4D1Q A;  2HKO A;  4ZDO A;  1ZG3 A;  1SAX A;  2HCB A;  1XCV A;  1OCO H;  1WJ7 A;  4CZC A;  3D1N I;  3ZMD A;  1HKT A;  2HQA A;  3AG4 H;  5J4V A;  4GYG A;  3TDU C;  4HOB A;  1S7E A;  3H0G J;  1IRG A;  3ZRG A;  2XAJ A;  3CCJ I;  3BG6 A;  2WC2 A;  2VBX A;  3DTI A;  4RB3 C;  3K1M A;  2RRU A;  2DZN B;  3I9V 2;  4KJZ A;  4LFB M;  5K5O A;  3HSF A;  2ZME C;  5DD8 A;  3RFW A;  4PGG A;  4GEW A;  3S17 J;  3HHH A;  2QZ8 A;  2CYY A;  2H8R A;  1XPX A;  1ZR2 A;  2JY7 A;  4Y28 F;  4P9F A;  1LVK A;  3PFI A;  1Q39 A;  3VK7 A;  2W24 A;  3GW2 A;  5JVT A;  2DAE A;  2E2H J;  3V7R A;  2K3P A;  3PVS A;  1WJD A;  4DOZ A;  3BTL A;  2NS7 A;  1ENH A;  2MD5 A;  1SFK A;  4Z6Y A;  2ZJP F;  2L01 A;  3S2W A;  2HR3 A;  4KHP M;  3AKZ A;  2W00 A;  3FUT A;  2X1E A;  4EVI A;  5BQT A;  2GAU A;  2YNM D;  5DYG A;  3IKT A;  1MX0 A;  1QGP A;  2JRT A;  2CUE A;  5L3D A;  2R92 J;  3GLG B;  2VQC A;  1JE8 A;  4JBA A;  4HQM A;  4WCG A;  2PMH A;  2M2E A;  2FBH A;  4AKH A;  1Z91 A;  2JT1 A;  3CCS I;  3RPU A;  2OC6 A;  2KRU A;  2DNA A;  4F3Q A;  3JAM K;  2F5N A;  4CYC B;  1X3U A;  1SMY F;  1F36 A;  1V3F A;  4DBQ A;  5BR8 M;  2C6Y A;  2LKX A;  3PNT A;  4BAY A;  4BU2 A;  2CUZ A;  2LLK A;  3KSX A;  3J81 S;  3SAS A;  4GKJ M;  2IS4 A;  4XLA A;  3TP3 A;  1UG0 A;  1Z77 A;  4A69 C;  3CC4 I;  1U9O A;  2HDW A;  4G94 A;  1A31 A;  4H4K C;  2XV4 S;  1FT9 A;  1JT6 A;  1X4P A;  2X4A A;  1D1C A;  3CJQ B;  5KCM A;  4IBG A;  1DP3 A;  1K6O A;  2DT5 A;  3W3C A;  2D2W A;  4XLH A;  1PJS A;  3DKY A;  4GIP A;  4LRT A;  2CUJ A;  2JUC A;  1IFY A;  1GXQ A;  2XGN A;  2OQ4 A;  3T6P A;  2K4J A;  3ZQH A;  1BVS A;  1KSF X;  5EP2 A;  4F2L A;  1FEX A;  2M5Z A;  3GTQ J;  5KPT A;  3GBG A;  1QAM A;  3OYK A;  4C9Y A;  2GXA A;  1MJA A;  2JMW A;  1W1W E;  1ZR4 A;  1UHS A;  3AOG A;  3O3K A;  1HW2 A;  4I76 A;  5DDG A;  4ZPX A;  2ZJR F;  3RSN A;  5EF6 A;  3WE3 A;  2IA1 A;  2LP0 A;  3L2W A;  2K86 A;  3AG2 H;  2L4E A;  1O57 A;  3I04 M;  3HM5 A;  2TDX A;  3GTK J;  3ABT A;  4LB6 B;  2A5W A;  4KOD A;  1VEG A;  1WHU A;  1VEK A;  2ID6 A;  1VI0 A;  3GLF E;  2DQL A;  3WU2 C;  4D7M A;  1R5L A;  2D1H A;  2AHM A;  2P0W A;  1YE9 A;  2JVG A;  3HUG A;  4XGI A;  1RUN A;  1V33 A;  2Y20 A;  4KT6 A;  2O25 A;  1TBX A;  2LY1 A;  1R6B X;  2LVO C;  2DOD A;  1XG1 A;  4R3D A;  2XRN A;  4D5F A;  5HDK A;  4XRS G;  3R6S A;  2V26 A;  3L2V A;  3EQL F;  1RKW A;  4P5O A;  4X62 M;  1RUO A;  2C9O A;  5HLH A;  2R7S A;  2XGC A;  4QNR A;  3L2Q A;  1X3W B;  1QBJ A;  1RPW A;  2DDB A;  3UNG C;  2HTJ A;  3HOW J;  3ZMV A;  2JK3 A;  2TRT A;  1KU7 A;  1REP C;  4C30 A;  3E6M A;  3L25 A;  3ML6 A;  2HZD A;  1POG A;  2FXA A;  2E1M B;  4B08 A;  5D6E A;  3J7A Y;  5DTD A;  4LG2 A;  2LK2 A;  3TKY A;  3LSM A;  3HPG A;  2ECB A;  3DOA A;  1TL8 A;  1Y0N A;  4ON0 A;  5FKL A;  3GLH A;  1I1G A;  1LKX A;  1XGM A;  2MSY A;  2EZK A;  3QAH A;  5EEA A;  1QPI A;  2QBY A;  1JHH A;  2HQN A;  1KYI A;  2JRM A;  3KLO A;  5M5W J;  2VXD A;  3THG A;  1SFE A;  3OIO A;  5J40 A;  1AHD P;  3I64 A;  2R62 A;  2VKH A;  2PQ8 A;  3ABK H;  2CU7 A;  3TW7 A;  5C3E J;  2IEK A;  3JR9 A;  5JLX A;  2G5G X;  2X4H A;  5L3C A;  3OYH A;  5BOX A;  4DR3 M;  3FK7 A;  1ZMU A;  2E2J J;  1MW7 A;  3M7G A;  4L5E A;  1TW2 A;  3GLG E;  1U5T A;  3FMQ A;  3OS1 A;  2JNH A;  2CRG A;  1W0T A;  4CHT B;  3FIW A;  2LG4 A;  1NNU C;  1QQI A;  4A3J J;  2EFW A;  3CCY A;  1JKP C;  3HHY A;  4XRM A;  4JI5 M;  3U61 A;  2LHC A;  5A2Q K;  3PNV A;  1E32 A;  4MHG A;  5K1Y A;  1FSE A;  2HZT A;  1VQN I;  1H8A C;  3BPX A;  3BG3 A;  2V9V A;  4U0W A;  3TGN A;  3OYJ A;  1WHC A;  4BJ6 C;  2RDP A;  2ZNZ A;  5E20 A;  1OR7 A;  2F4M B;  4CIZ A;  3MWM A;  4HST A;  1IV8 A;  4ZDP A;  1QDT A;  1EJ9 A;  1NK3 P;  5JHU A;  1ZMW A;  3LA3 A;  2A6H F;  3F72 A;  1R22 A;  1YSY A;  1WI3 A;  5M3M J;  4CCJ A;  5IWA M;  4BQQ A;  1Z7U A;  4B44 A;  3F3X A;  4UHT A;  4I81 A;  1WRJ A;  3U60 B;  1DO2 A;  3BY6 A;  4XM3 A;  2HOT A;  1Q1V A;  3V7S A;  1ZLJ A;  1PJJ A;  3Q0U A;  4DYC A;  5FD6 A;  3HGI A;  5IRE B;  2K02 A;  1RES A;  3GLG A;  3TO9 A;  2JA8 J;  4BE2 A;  3J7B A;  3KS8 A;  2RQP A;  4M3G A;  2R7V A;  2E7X A;  3FTC A;  2EV0 A;  3S1Q J;  4BJ5 C;  3TL4 X;  1UB9 A;  1ORY B;  4AQY M;  2IGO A;  2Z1D A;  3QP6 A;  3FMS A;  1LE8 B;  2LRE A;  2RGV A;  3IRQ A;  4MGH A;  3GQ3 A;  2E1N A;  4LK1 F;  3PQK A;  2R3S A;  1HXD A;  2BJW A;  4HV5 A;  3GRU A;  1UHM A;  1OIP A;  1YIO A;  2EKK A;  2Y0Q A;  2E1O A;  2PFB A;  3TW6 A;  5JR3 A;  5DM6 F;  1D0L A;  1KQ8 A;  4MGY E;  1GVN A;  4CO8 A;  5IP6 A;  3ABL H;  1IY2 A;  2IBD A;  4HV6 A;  3ZR8 X;  1XDU A;  2E5N A;  2GBY A;  3OYN A;  1HJP A;  4II3 A;  3KZI C;  1TLH B;  1U2W A;  3AG3 H;  4L9N A;  4AIH A;  5FRN A;  2DI3 A;  2ADU A;  1GL6 A;  2V6Z M;  3IL2 A;  2LXE A;  1JUS A;  1TZL A;  5CPR B;  1R2Z A;  1P2F A;  4P55 A;  3GPU A;  2MW8 A;  3BZ6 A;  3O8G A;  1HA8 A;  4IJE A;  4DYQ A;  2F5V A;  1NG6 A;  4HL4 A;  1RI7 A;  4M3D A;  2F5F A;  2R7R A;  5IYB J;  3ZQF A;  2CRU A;  2Z5U A;  2XAU A;  3W2W A;  1B8I B;  1QAN A;  4EM1 A;  2DA4 A;  3VDX A;  2FA5 A;  5IP7 J;  2DU9 A;  2QEX I;  2YR0 A;  2JZY A;  3C3W A;  3E0J B;  1BI0 A;  4HNV A;  1SMT A;  3DEU A;  4M3F A;  2E34 A;  2XRL A;  2Z3Y A;  3IKV A;  2C99 A;  1W5S A;  4PFO A;  3KSJ A;  3PFY A;  2UUZ A;  2VN2 A;  2NS8 A;  1T39 A;  2EIJ H;  2X85 A;  2VKE A;  5CLS A;  2KQR A;  4I0A A;  3BTI A;  3SYT A;  4NHJ A;  2HOS A;  1XXH A;  3GFI A;  1APL C;  2IP2 A;  4UNO A;  1GLN A;  1HNZ M;  1IXC A;  1HBX G;  3QPH A;  1P4W A;  4XLC A;  3FUU A;  4DR5 M;  4JXJ A;  3VLF B;  1ZHF A;  2LKS A;  3RGS A;  4OMY A;  1SFX A;  4DR1 M;  1U3E M;  2LSO A;  4AC0 A;  5K5R A;  8CAT A;  4CGY B;  4LJ4 A;  3FXQ A;  1KA8 A;  4L5I A;  4BH9 A;  1SD6 A;  2ZBK A;  1NO1 A;  3G3Z A;  2HQR A;  1Q3C A;  3M3Y J;  1JTX A;  4A3M J;  4ZDL A;  3RIR A;  2JSC A;  2L6O A;  3SFI A;  3ZMT A;  1XX5 A;  2K5C A;  4LF8 M;  3B6A A;  2DMN A;  4B3R M;  3ZOB A;  3GLH B;  3HHG A;  3HRU A;  3HOZ J;  3CMM A;  2DK8 A;  5K7H A;  1S9H A;  2NAZ A;  3I5U A;  2DA5 A;  2WAQ A;  2GOM A;  2O3F A;  1DV0 A;  3KLN A;  4E7Z A;  1LJ9 A;  5D5W B;  3MZH A;  2ZJ2 A;  1PVE A;  3K0L A;  1D8J A;  1K3W A;  2Q2E B;  4A12 A;  3EUA A;  1TDH A;  3KIO A;  2L9R A;  1S3S A;  1JR3 E;  4CGZ A;  3SJM A;  3M1E A;  4M6V A;  2BEO A;  1OYY A;  3BT9 A;  2NVQ J;  4LG0 B;  3QPL A;  2VUM J;  4G7O F;  3H9Q A;  1ETV A;  3KPH A;  4WXD A;  1QA6 A;  1XNQ M;  4RM2 A;  5B66 C;  3FX3 A;  2Q2E A;  1HSJ A;  3S32 A;  3J81 K;  4LJ5 A;  1SD7 A;  5L3E A;  4DQ2 A;  4NRV A;  3BXW A;  2KHM A;  4JK1 X;  1VQ5 I;  1E17 A;  3IWF A;  4KDP A;  4NXM M;  2VPL A;  1WR1 B;  4AW4 A;  1LPQ A;  4LGW A;  3FWE A;  5A2Q Z;  4D80 A;  2J7N A;  4UVB A;  1XDS A;  3W0F A;  1BBY A;  1LDJ A;  1GL7 A;  2OF7 A;  3JW4 A;  3G6E I;  3S3N A;  4QPQ A;  3GQ5 A;  1O3R A;  3V76 A;  4IBI A;  1R23 A;  1J5Y A;  3OWT A;  4YII A;  2HVS A;  1NK2 P;  1Z0X A;  1F4I A;  2QQ9 A;  4RGX A;  2DA7 A;  1VF9 A;  1X1B A;  4RMN A;  3OS2 A;  2DTR A;  2DAI A;  2V1D A;  1DGG A;  2DWZ B;  3D8B A;  5F0F A;  2CFX A;  3MKY B;  4IBD A;  2RKO A;  2JA7 J;  3A98 B;  1NHW C;  3HOY J;  5EQT A;  1HT1 E;  1QVT A;  1JR3 A;  1NSF A;  3GQ4 A;  1Y1V J;  4I98 B;  2MAB A;  2BVL A;  4DV6 M;  2HVQ A;  5IOZ A;  2A61 A;  2XEP A;  3F6O A;  3SEQ A;  4L6V 6;  1YRN B;  4W1U A;  2QUF A;  1IXS B;  1MN3 A;  3X2Q H;  1VTN C;  3Q5F A;  5HOO A;  2OOB A;  2DQR A;  2MLK A;  3CUQ A;  2JWT A;  4ABZ A;  3DTK A;  3U6E A;  4G3O A;  2JY5 A;  4JYA M;  4PDK A;  1CF7 B;  4I01 A;  1LE8 A;  2CFO A;  1SXJ B;  5C1B A;  4I2O A;  1JKO C;  2R6F A;  3TQS A;  2UXB M;  2FOW A;  5FB2 A;  3VEP A;  3CO6 C;  3ZQC A;  1YYV A;  1HC8 A;  1OAI A;  1TW3 A;  4GC9 A;  4O6J A;  4BBR J;  5IYC J;  1JB0 F;  3E6D A;  5E1X A;  1TTE A;  2HWV A;  2CW8 A;  4KT5 C;  3KET A;  2W85 A;  4I4L A;  4OU0 A;  2K9L A;  5KPR A;  1FP2 A;  1KZH A;  1IGN A;  2ELH A;  2K7L A;  2KRH A;  2I8D A;  1R4G A;  5JI2 E;  1L1Z A;  1G3S A;  2XFT A;  1U9N A;  4PGH A;  1OCP A;  4MNU A;  2FOK A;  4PJL A;  1UFM A;  5E1W A;  4QNM A;  1I6X A;  1E3O C;  2DI0 A;  1M1E B;  2KHH A;  2VJ4 A;  2H09 A;  4BE1 A;  4LOC A;  3H5R A;  1XD7 A;  2XAS A;  1IZ1 A;  1O7L A;  3C1D A;  3I59 A;  1MBG A;  1VQO I;  3RI4 A;  1STZ A;  3H3U A;  2KZV A;  3HRM A;  5FLM J;  2E2I J;  4NRW A;  3EUH A;  2X49 A;  4B7F A;  1HR0 M;  4A2U A;  2CHQ A;  1HW1 A;  3LVV A;  1IN4 A;  2IPQ X;  4F91 B;  3HU3 A;  3A03 A;  3K9T A;  1SAU A;  3REO A;  4BY7 J;  4A3G J;  5E3M A;  4RNA A;  3HKZ N;  1XS9 A;  4TUW A;  4AIK A;  2OPT A;  1G3Y A;  2OZ6 A;  5DYM A;  3TOB A;  3FK6 A;  3OSG A;  5J1U A;  2HKJ A;  4FX0 A;  3FHZ A;  4A3E J;  2HPI A;  2H94 A;  4JI6 M;  2KJC A;  1J59 A;  1UFZ A;  5EXX A;  3FXM A;  4PDG A;  4WK8 F;  3RCO A;  2L4A A;  5EXS A;  2DFF A;  1SC7 A;  9ANT A;  1VFC A;  2IGN A;  5KAI C;  3J2P B;  5J1R A;  5D4S A;  3P7N A;  4D5C A;  3HSR A;  4WW0 A;  4QOZ C;  4LY6 A;  2CWE A;  5EEG A;  5GKN A;  1JGS A;  1FBS A;  2H1L A;  3PSI A;  2VI6 A;  3BQZ A;  2OU2 A;  2WZJ A;  2L7K A;  3UK6 A;  3DU5 A;  1W7P D;  4OMZ A;  2QSF X;  2JP7 A;  4XN0 A;  4LRS A;  1B1B A;  3DWL E;  1JJ6 C;  3U6M A;  2FS1 A;  1N77 A;  4XRF A;  4MLO A;  3A0B C;  2Z4S A;  3GLF B;  3ULQ B;  2KDZ A;  4Y15 A;  4IF4 A;  4LG0 A;  2H1R A;  1QO0 D;  1BN5 A;  5GPC A;  1I39 A;  5H6Q A;  2PLY A;  2W7N A;  4KA4 A;  2X48 A;  2XZU A;  2DAG A;  2BW3 B;  1MGT A;  4F7Z A;  2QQA A;  3BOS A;  3CJT B;  5EXP A;  1RKT A;  3PUB A;  4NQW B;  4CIC A;  3H5A A;  3IHU A;  1FNN A;  4RAZ A;  4RAY A;  5EP4 A;  4A5N A;  4UUT A;  4N0B A;  3J7A O;  2K27 A;  3OYC A;  3U6D A;  4HF0 A;  4CXF A;  4N4N B;  3ASN H;  2KRK A;  3G73 A;  2XSZ D;  3A02 A;  1IBL M;  4UUS A;  1FLI A;  1FTZ A;  3GTO J;  3U6P A;  4FWH A;  1W0U A;  2VL8 A;  1D1A A;  3HKP A;  2O0Y A;  3JTG A;  3QYB A;  4A3V B;  1D0Y A;  4Y7N J;  3R4K A;  4EIW A;  1S72 I;  2V1N A;  4DBG B;  3F8B A;  1XXH B;  3A1Y A;  4I0B A;  2NNN A;  4ZZD A;  3C7J A;  3L27 A;  4U0Y A;  3OYG A;  4IHV A;  4ANR A;  2VC1 A;  3GP1 A;  4CYD A;  4I6Z A;  2V9P A;  4FCW A;  2ZO4 A;  3DU6 A;  4PK4 A;  3S1M J;  3GEZ A;  2ESH A;  3KYD B;  3GUD A;  1L2B A;  2NVY J;  3Q8X A;  3QPS A;  2F6C A;  2GLO A;  3T1H M;  2X0L A;  3HYI A;  2X6X A;  2ESN A;  3FRH A;  3CDH A;  3K9O A;  4L4U A;  4DV5 M;  3KP4 A;  5CKT A;  2G0E A;  3OIP A;  2IW5 A;  3E46 A;  1LB2 A;  3SZP A;  1V5G A;  2X1D A;  3LAP A;  2JTV A;  3GLX A;  2D1V A;  2NVT J;  4R1H A;  3FTD A;  2QCU A;  3VOE A;  4G12 A;  3TO6 A;  4MEY F;  4GCV A;  1SXJ C;  1OCC H;  3FXR A;  5FLX Z;  4L78 A;  4HLX A;  1I27 A;  4HEO A;  4D7N A;  3GPX A;  2A6E F;  3C3D A;  1ZAR A;  2L7Z A;  3CCE I;  1R71 A;  1VQ6 I;  2P6T A;  1E9R A;  3J80 S;  2LTU A;  3ZGK A;  3DQV C;  3E9S A;  1Y8G A;  1MH3 A;  3CQZ J;  2LBC A;  2J5P A;  4Y33 A;  2FFJ A;  2ZC2 A;  4G8X A;  5EGO B;  2R7X A;  1XMQ M;  1EH6 A;  5B3S H;  2EZI A;  3EDP A;  3W6V A;  4IHT A;  4LJ7 A;  3BTJ A;  4XOP A;  1I1S A;  2CQQ A;  1QZM A;  3ZH9 B;  2H27 A;  4BXF A;  3WU1 B;  1Q02 A;  4CDG A;  1MNE A;  4FE4 A;  4C3H J;  5LRS A;  5ITX E;  2M7A A;  5EDN A;  3G2B A;  2KMU A;  2PMZ N;  3J7Z I;  4TV7 A;  4A6E A;  1H88 C;  2EV6 A;  2ZM6 M;  4OVZ B;  4AM3 A;  3N97 A;  3COA C;  4B1R A;  4ENN A;  2M0M A;  5CVR A;  2HOA A;  4E7S A;  4XON A;  3BR6 A;  3RYR A;  5L3G A;  1QZY A;  2A68 F;  4LIT A;  3MHV C;  4AUX A;  1BI2 A;  3KS4 A;  3K4N A;  1PUF A;  2XB5 A;  2Y0S N;  4PD2 A;  3CUO A;  3BZK A;  3K2A A;  1QZZ A;  3ZMU A;  1OCT C;  5L8R F;  3CDL A;  1L1T A;  1HST A;  4H0E A;  3W2A A;  2HYG D;  2QWW A;  2IJL A;  1ONV A;  1GVD A;  4B7H A;  4G4R A;  1XMX A;  5TIS C;  1N34 M;  4FAS D;  4UXN A;  2J5O A;  1X1P A;  4G6Z A;  4WX9 A;  1C7Y A;  2W25 A;  1TT5 B;  1LFU P;  2YU3 A;  2LTP A;  2OUM A;  3A46 A;  4JX5 A;  4XNF A;  1S3J A;  3NBX X;  1DPR A;  4PJ0 C;  4MTE A;  1XMK A;  1GKI A;  5K7F A;  1Z9C A;  1MMS A;  4XR6 A;  5FO5 A;  1LTM A;  2EIN H;  1VQ4 I;  3K4B A;  2YUS A;  3L9F A;  3CCQ I;  1YRN A;  2MD0 A;  1W5C C;  4C2U A;  1CUK A;  4BDZ A;  2E60 A;  1DQU A;  2K9Q A;  2CQK A;  5DM7 F;  2M3A A;  3T1Y M;  1X37 A;  2KDL A;  2XF5 A;  4X64 M;  2L9S A;  2DAK A;  3QOD A;  3BG7 A;  2C96 A;  1BC8 C;  2ZB9 A;  1VQ7 I;  3H92 A;  2BYV E;  3IH2 A;  3QAU A;  1P6R A;  3AL0 B;  3GLI A;  5HS7 A;  3SBJ A;  3FHN A;  4MO7 A;  5CVU A;  4ZTJ A;  1R5G A;  2BY0 A;  1IUY A;  3MMY B;  1ZQ3 P;  4GGG A;  3HU2 A;  1YUB A;  5C18 A;  2Z8Y M;  4OIR F;  1WVR A;  5IT3 A;  1IJW C;  4RF1 A;  3FBN B;  2B9S A;  1TNS A;  2DHY A;  1FIA A;  3KEY A;  2RV8 A;  2EFN A;  3GRR A;  1XB2 B;  1L0O C;  3BOQ A;  2V7F A;  1IC8 A;  3OR2 C;  5BPD A;  4XBF A;  3VKG A;  2HTS A;  2RNJ A;  1EIJ A;  3F9K A;  3A0H C;  1GJS A;  1YW7 A;  4HG2 A;  5B1B H;  2CHG A;  1EKE A;  3GTP J;  1C1K A;  3HUG B;  4G4Q A;  4EV0 A;  1YJ9 I;  2K3F A;  4JI3 M;  4AI6 A;  2KIF A;  2ZXJ A;  3HC7 A;  2VE9 A;  1PP7 U;  2D7G A;  3RGP A;  2KPM A;  2O03 A;  2P7C B;  2DDA A;  1TF0 B;  3E3V A;  1ZRD A;  1KYW A;  3OSF A;  3LMM A;  2B63 J;  4IQ4 A;  5GAD J;  4KYW A;  3KP3 A;  1WPK A;  4V2F A;  3NAR A;  2AXT C;  3H4M A;  2IGK A;  2G7H A;  5KK1 A;  1FBQ A;  2AQE A;  1HLV A;  5DFL A;  3PO2 J;  5F64 A;  1XGS A;  2BY1 A;  3MKW B;  2P5T A;  2DAO A;  4FWG A;  2YX4 A;  3CDI A;  2A3S A;  5TGT A;  4IBB A;  1R5H A;  2FBK A;  1ZAE A;  3M07 A;  4BHB A;  3SHG B;  3EYY A;  5DCF A;  1QAO A;  2CG4 A;  4GC5 A;  1QHG A;  3H4J A;  4LZJ A;  1AU7 A;  1ON1 A;  1HW5 A;  3E21 A;  2EQR A;  3B7Q A;  1VZ0 A;  2JSP A;  3OOP A;  3T38 A;  2VIX A;  3HIF A;  3LSK A;  5EEH A;  2XPU A;  4MGR A;  3FYC A;  4QWQ A;  3BZC A;  3L26 A;  4LF9 M;  3C2G A;  1YOV B;  2ZBK B;  2VQE M;  4IX7 A;  1DPU A;  3NEU A;  1K79 A;  1EH7 A;  2UXN A;  2M9H A;  4OW0 A;  3SC3 A;  1T6S A;  3L09 A;  3VB2 A;  3EIE A;  1UG2 A;  3DXJ F;  2MYS A;  4GRI A;  1Z59 A;  1J0R A;  3KEQ A;  3WE2 A;  4IBF A;  2VB6 A;  2LKP A;  3HRS A;  2OD5 A;  1KQ9 A;  1T08 B;  4HW0 A;  2XAG A;  1FY7 A;  1ZKG A;  4JI4 M;  2W1O A;  5FRO A;  3VSL A;  4FCT A;  3BC8 A;  5ILV A;  3R0J A;  4NQW A;  2ZFU A;  1SFU A;  2BY2 A;  2WSE F;  5F1R A;  2VON A;  1A6Q A;  3LFU A;  1D0X A;  1GV2 A;  1FBU A;  3KFU G;  1RIO H;  3F8F A;  2DFE A;  1TWG J;  3H0D A;  3WHL A;  4CCK A;  2VQL A;  1OCR H;  4BL0 B;  3ESW B;  2BV6 A;  2IA0 A;  4G4N A;  4DUZ M;  5EP3 A;  4IBK A;  1YHQ I;  4B7G A;  2A05 A;  3MKL A;  3RPQ A;  4CCN A;  4JI0 M;  2K85 A;  4RBO A;  5KO3 A;  1Y1W J;  3GLI E;  4JV5 M;  3BLY A;  2KIS A;  4M9X A;  2ME0 A;  3V8K A;  1R1U A;  3ZMS A;  3HG9 A;  3G4S I;  2WY8 Q;  3D5L A;  1K83 J;  2L02 A;  3ECH A;  1ETQ A;  1SEU A;  3GFL A;  5TJJ A;  2VOD A;  2L7F P;  1GO5 A;  3JRB A;  4K0K M;  2WSF F;  2L7I A;  2PJP A;  4RF0 A;  5FLX S;  4M71 A;  3GO5 A;  2XGD A;  3GRV A;  2RNG A;  2F48 A;  5EP1 A;  2XUB A;  3U1D A;  5D5V B;  3CJN A;  4MQV A;  2CW0 F;  1K78 A;  2V6E A;  4LF5 M;  5LHG A;  3PNY A;  3S1R J;  3FYD A;  3ZMZ A;  3KP5 A;  1V54 H;  3RYP A;  4UY8 I;  2ICW G;  1NH3 A;  1TWA J;  1LEA A;  3ELK A;  2PMZ A;  4XOR A;  3D0S A;  5KQ8 A;  1J7K A;  1P92 A;  3IAS 2;  4OWR B;  4CZZ A;  1IRZ A;  2WB1 A;  1BC7 C;  3S93 A;  3DZD A;  1AA7 A;  3K69 A;  5JFR A;  4PSW A;  1EV7 A;  2FQ3 A;  3DCF A;  3LFK A;  2DJN A;  4FIS A;  4QIW N;  4Q48 A;  2VKV A;  3SZG A;  1NTC A;  3U5Z A;  7CAT A;  1YX3 A;  3QOE A;  2DPU A;  4CCM A;  2DA3 A;  4EGZ A;  4XBO A;  3S15 J;  3GLL A;  3ZPL A;  1SVO A;  5FKO A;  4L9J A;  3F8M A;  3LSI A;  2Q8K A;  2L2O A;  3U61 B;  1YLF A;  1EE8 A;  2CV1 A;  4GHA A;  4F93 B;  5J8F A;  4WWC A;  1UST A;  1I94 M;  2FSW A;  2M34 A;  1Z3X A;  2ZTC A;  5D4R A;  3KP1 E;  5ITT A;  4KIS A;  2R7T A;  4REZ A;  4XK8 F;  4GO1 A;  4NOO B;  1IN6 A;  4BEH B;  1NY6 A;  4Q4Z F;  3ZN0 A;  3KOY E;  5CYV A;  2B0L A;  1U0J A;  5HLT A;  2LF8 A;  3FKI J;  2I7P A;  2PBI A;  3OYE A;  3VYR B;  4Z2Y A;  2HHH M;  1B72 B;  1UAA A;  4W97 A;  4IXA A;  1FPQ A;  3TBI A;  1G3I A;  2K9M A;  2KZG A;  3U2R A;  2D5V A;  3NBI A;  4PJN A;  2LY9 A;  4XKW A;  2ME6 A;  4FWD A;  3H1C A;  2NOG A;  3UMM A;  1D0K A;  3T15 A;  2MLG A;  3V7C A;  1V55 H;  2YQZ A;  4ZJZ A;  1XMA A;  2NNY A;  1HCR A;  1LDD A;  4LK0 F;  1Y56 A;  2FNP A;  2ZAO A;  2KL4 A;  4LLL A;  1PYV A;  3FF5 A;  1SVM A;  1ZGJ A;  2M87 A;  4ZTF A;  2DT6 A;  3MQ0 A;  5HLG A;  2DYS H;  1MBF A;  3GVA A;  3ZP5 A;  1NV9 A;  3WGI A;  1RZ4 A;  1XHB A;  2BE5 F;  5CVV A;  1YFH A;  1BL0 A;  5ITR A;  5IOY A;  1DGH B;  3RTR A;  3HHZ A;  2L0K A;  4L5J A;  2X6W A;  3EUK L;  3BCB A;  3NWL A;  2M4K A;  3VWB A;  3CLQ A;  2DHR A;  4ITV A;  1B59 A;  2OA4 A;  4LFA M;  3N05 A;  3UR3 C;  3ZQQ A;  1DGB A;  3D5S C;  3CCV I;  1NY5 A;  2MH8 A;  1Z21 A;  2WA0 A;  5ED4 A;  3KOW E;  1Z5C A;  5ITU A;  4Q5S F;  1W5T A;  5E17 F;  3HWS A;  2BXZ A;  2COB A;  1PM5 A;  2JN6 A;  1SD5 A;  5KHD A;  5M5X J;  1VQ8 I;  1X1C A;  1JR3 D;  3OYF A;  2RRE A;  5M3F J;  3RZO J;  2P5K A;  2NVX J;  2JJ7 A;  4OIN F;  2RC4 A;  1JKR C;  2J5Y A;  3GLI B;  4U7D A;  4DYR A;  3WHK A;  3LSH A;  2VQH A;  5H37 D;  3SQN A;  5IY5 H;  1E9S A;  2DPD A;  1AIP C;  1XC8 A;  5M5Y J;  4IBE A;  3F92 A;  3CF5 F;  3V8L A;  4JX4 A;  2LMD A;  3BDD A;  1ON2 A;  1GAB A;  1R4M B;  4FET A;  4M74 A;  3IC7 A;  1VQ1 A;  3ZCO A;  3PJR A;  3MMP A;  3RQ4 A;  4XOT A;  2ZME B;  4D81 A;  4A5M A;  4FCV A;  4L15 A;  2F5S A;  3FRI A;  4UVC A;  4LJ6 A;  1C0W A;  2F5Q A;  4EM0 B;  1Z6T A;  1T0F C;  4MGZ E;  1FZP B;  2XGE A;  1R1T A;  4C2T A;  3H35 A;  1IN8 A;  2R7O A;  4BQO A;  3CF0 A;  4OAY A;  3GTJ J;  1X19 A;  3M9A A;  3SAU A;  1PDN C;  3SDB A;  3LA2 A;  4G6D A;  1S5L C;  4HNU A;  2R0I A;  2LVQ D;  2BWE A;  2MFZ A;  5HDG A;  1F43 A;  4RA2 A;  2E1C A;  4AVZ A;  3LNQ A;  3HPH A;  2EK5 A;  2OZU A;  2EH3 A;  3U1K A;  1KQ0 A;  2VOP A;  1K6Y A;  1X1D A;  4MFE A;  3RE8 A;  2LD5 A;  3H9G A;  4EJT A;  2XH9 A;  2AO9 A;  2G8L A;  2DCE A;  1BI1 A;  1IBM M;  1N25 A;  1BR1 A;  3T8T A;  1PP8 F;  3HKZ A;  2GQF A;  3HJS A;  4FTH A;  5HS8 A;  4A3F J;  4MFD A;  3KXE C;  4IOC F;  2I10 A;  3E6C C;  1QUT A;  1N78 A;  1DGH A;  1I4W A;  2NS0 A;  5K7Z A;  5FD5 A;  3SYK A;  4LZZ A;  2VLA A;  4XID A;  3HJQ A;  3ZQ7 A;  1OTR A;  2KA6 B;  4L16 A;  2MRO B;  2BVM A;  2L9V A;  3NWT A;  3KYL A;  2K6B A;  1TQI A;  1K82 A;  5FLV A;  5A2Q S;  3EET A;  1FP1 D;  3MZY A;  4IBJ A;  2Z33 A;  1TP4 A;  1JHF A;  2DW4 A;  4DGW B;  4BYY A;  2MH9 A;  1V5E A;  5BNG A;  1V92 A;  3WTV C;  2ZXI A;  1H9T A;  2NRA C;  3FD9 A;  3DLA A;  3SMP A;  3HHX A;  1G41 A;  2QNJ A;  2F5O A;  4LJ9 A;  3OIQ A;  2KNZ A;  1WJA A;  5DUK A;  2EA2 A;  3MVP A;  1TWH J;  3LQR A;  2J7O A;  3U6O A;  2DYR H;  4MM3 B;  2E5Z A;  2JZ0 A;  3B6C A;  4CHU A;  4R79 A;  2CP8 A;  3VDP A;  3I4V A;  1B4A A;  4AU7 A;  4J01 A;  2YR2 A;  3R9X B;  3BP8 A;  1QZE A;  1ZMV A;  4AKG A;  3CUQ C;  3GFJ A;  3SZT A;  4P16 A;  2XFS A;  4WXH A;  2X8A A;  1ZRF A;  3MZ8 A;  3EPZ A;  2G7U A;  5F27 A;  1IXR C;  1UEL B;  4B3A A;  2JQ7 A;  4GDF A;  1TDZ A;  4Y52 J;  1IBK M;  4W5W A;  1I50 J;  1WXQ A;  1V34 A;  2M30 A;  1WKM A;  3PIP F;  2NXN B;  3O2P E;  1MIJ A;  2P6S A;  2R7Q A;  2R4G A;  5LFA A;  1HKS A;  5EXT A;  5EZH A;  3W6J B;  5FRM A;  3FXU A;  3PQJ A;  5E8G A;  3GME A;  3W0L B;  3TWK A;  2I7N A;  2HKX A;  4EEF G;  1S6L A;  1L3L A;  3CC7 I;  4NC7 A;  5L3F A;  2R7F A;  1F1Z A;  3JCU C;  4AG6 A;  2DWN A;  1L8Q A;  4CIS A;  2ZXH A;  2KIU A;  1GUU A;  3Q0V A;  3WTZ A;  1HT2 E;  3R0A A;  4YIF A;  2ETH A;  3QRF F;  1CQT A;  1HF0 A;  3GTL J;  3KP0 E;  3TPZ A;  3W67 A;  5FJ8 J;  1X3Z B;  1WWX A;  1JGG A;  4I8O A;  5BMZ A;  2P5V A;  3IP4 B;  5FKM A;  3U9G A;  4RLQ A;  4PZJ A;  4XL9 A;  4NSR A;  3J7A S;  4XKC A;  2I5U A;  3DA1 A;  1R36 A;  1Z05 A;  3LSJ A;  3FM5 A;  4LLG F;  4CCL A;  1T0F A;  2L9N A;  2MH2 A;  3V42 A;  4DNC A;  1MKM A;  1MJG M;  2EV5 A;  2Z2S B;  2PJR B;  5DS9 A;  2W48 A;  3C58 A;  3GZN B;  1PUE E;  5J47 A;  3BR3 A;  5CVJ A;  2MBF A;  2P81 A;  3LL7 A;  4KN4 X;  2HPM A;  2PJR A;  3E7L A;  2A6T A;  4HA8 A;  1ZEL A;  2K40 A;  3B7N A;  1R6R A;  4ESB A;  3K2Z A;  3U6Q A;  3K4C A;  3MAJ A;  4HLY A;  2FU4 A;  4XK4 A;  1FIP A;  1BW5 A;  2WTE A;  2PEX A;  1QYR A;  2M8E A;  1BW6 A;  3FXL A;  3J7Y J;  3TP0 A;  1Z5B A;  1U6G A;  2L09 A;  4KO8 A;  4IHW A;  2OPF A;  3AJI B;  2ZCW A;  4DV3 M;  2C5R A;  3GZ5 A;  2EBI A;  4U87 A;  3TMO A;  2EIK H;  1IG7 A;  5HNH A;  2DZL A;  3BCA A;  5D5U B;  1LFP A;  3T0Y A;  1RU3 A;  4HX4 A;  2QQ8 A;  1WJF A;  1KFV A;  3GO8 A;  2XKO A;  3M0E A;  2P8T A;  4UV8 A;  4Y13 A;  5LGN A;  6PAX A;  2AXL A;  3OS0 A;  4O3M A;  4GXO A;  3VDU A;  2P4W A;  2VBY A;  4L18 B;  1G6N A;  3I3L A;  4WXC A;  2V1U A;  3I51 A;  2D7E A;  1Y39 A;  3L00 A;  3HGY A;  1FX7 A;  2L4F A;  1OKR A;  3E5U A;  2OQR A;  5FGM A;  3BPV A;  3U5Z B;  5FKK A;  4M3B A;  4MEX F;  4F55 A;  1OYI A;  2YFQ A;  5IZ7 D;  4PJJ A;  4ESF A;  1A5J A;  1ZH5 A;  2GQQ A;  2L4M A;  3OL4 A;  5DEQ A;  3WGG A;  1CGP A;  4M6X A;  2VT3 A;  1TGU A;  4GFB A;  1U8B A;  1UJ8 A;  3SFZ A;  3MJ5 A;  5FSW A;  3FUW A;  2KXE A;  2DOF A;  2VF7 A;  1T95 A;  2VQG A;  2FX0 A;  4LCB A;  1J09 A;  1RET A;  2GWR A;  2KKO A;  3FUV A;  1NJG A;  2XZF A;  1NHG C;  1XMO M;  4P9U A;  2QHO B;  2N35 A;  4S12 A;  3A01 A;  3LQQ A;  2Y75 A;  4BJT A;  2BWB A;  4HRI A;  1Z7L A;  4HX8 A;  2QCO A;  2CE7 A;  5D5X B;  1R7R A;  2XPV A;  3HRT A;  1MDM A;  2XF3 A;  3JTH A;  2KEB A;  3CP2 A;  2F5P A;  1E0E A;  1Z5A A;  4GMQ A;  5IT9 S;  5IT9 K;  2L7M P;  4E7I A;  1V5F A;  1R00 A;  2Y30 A;  4ZC3 A;  5ITX A;  5KQD A;  1QRY A;  4F52 A;  2AQF A;  4HDV A;  1OR7 C;  1SXJ D;  4C3J J;  3BG9 A;  4KNY A;  2UU9 M;  2WB1 N;  2R7D A; 
#chains in the Genus database with same CATH homology
 1ZV1 A;  2RRU A;  1R4G A;  5JI2 E;  4GEW A;  2K9D A;  3GLH E;  3IEC A;  2DI0 A;  2KHH A;  1KYI A;  4F1I A;  2JY7 A;  3FRH A;  3K9O A;  2LVA A;  2DAE A;  1VEJ A;  2ZTD A;  1EFU B;  3E46 A;  5DFL A;  3LCV B;  2OOA A;  1ZMU A;  2ZTC A;  2JY8 A;  2QSG X;  2B3T A;  3GLG E;  2CWB A;  2JNH A;  4HEO A;  1OTR A;  2MRO B;  3H4J A;  4UN2 B;  2G3Q A;  2DNA A;  1UFZ A;  2LTU A;  1VG5 A;  1Y8G A;  2LBC A;  3E21 A;  1A5T A;  2DZL A;  1WIV A;  1G3I A;  1DV0 A;  1G4A E;  1PVE A;  2DEN A;  1TP4 A;  2KNA A;  1JR3 E;  1Q02 A;  1V92 A;  1WHC A;  2OO9 A;  1P3Q Q;  1IM2 A;  2F4M B;  2JY6 B;  2WZJ A;  1G41 A;  1YLA A;  2QNJ A;  1ZMW A;  2L2D A;  2KNZ A;  1IXS A;  2K0B X;  2JP7 A;  2QSF X;  4Q7J A;  3K9P A;  2L4F A;  2JZ0 A;  1VDL A;  1WGL A;  1TR8 A;  1DO2 A;  1NV9 A;  2CP8 A;  1IFY A;  1PGY A;  2EJS A;  2H5X A;  2KNV A;  1QZE A;  1WR1 B;  1ZMV A;  2MGW A;  3T6P A;  1BVS A;  4F2L A;  4WP2 A;  1NV8 A;  3IHP A;  1C7Y A;  2MJ5 B;  3B89 A;  2DAG A;  3BBZ A;  1F4I A;  2F4O B;  2L4E A;  1E94 E;  3ESW B;  1XXH E;  2DAI A;  1VEG A;  2DKL A;  2LVN C;  2EKK A;  1VEK A;  1HQY E;  2JUJ A;  1DO0 A;  3GLF E;  2EKF A;  3GLI E;  1HT1 E;  1CUK A;  2QHO B;  3FE3 A;  1HJP A;  1T43 A;  2DAK A;  4YIR X;  1GO5 A;  1AIP C;  2BWB A;  1MN3 A;  2LVP C;  3F92 A;  2JZ1 A;  2OOB A;  2O25 A;  3LCU A;  2LVO C;  1HT2 E;  4G3O A;  2JY5 A;  1VQ1 A;  1WJ7 A;  3MMP A;  2QSH X;  1X3W B;  2MR9 A;  1WGN A;  3FRI A;  4R71 A;  4DBG B;  2DHY A;  2DAM A;  1OAI A;  1X3Z B;  2HWJ A;  1T6O A;  1XB2 B;  1OQY A;  1SG9 A;  1TTE A;  1OKS A;  2HAK A;  2R0I A;  2LVQ D;  2BWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...