2QSFX

Crystal structure of the rad4-rad23 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
104
Chain Sequence
IGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAVGSFQVDYTPEDDQAISRLCELGFERDLVIQVYFACDKNEEAAANILFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of DNA damage by the Rad4 nucleotide excision repair protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD4
total genus 33
structure length 104
sequence length 141
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00627 UBA UBA/TS-N domain
X PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2qsfX02
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2qsfX01
2KHHA 1V92A 1G41A 1WGLA 1Y8GA 2EKKA 1OAIA 2CP8A 3K9OA 1HT1E 4F2LA 4F1IA 1WHCA 4R71A 1TP4A 5JI2E 2JY7A 2HWJA 1NV8A 1PGYA 2JZ0A 2QSFX 3T6PA 2F4MB 1Q02A 1GO5A 2DAMA 2LVAA 1WGNA 2ZTDA 4GEWA 1VEGA 3FE3A 3IHPA 5DFLA 2KNVA 2K9DA 3E21A 2OOBA 1TR8A 1XXHE 2LTUA 1WJ7A 1HJPA 1IXSA 2CWBA 3ESWB 1IM2A 2EJSA 1CUKA 1OTRA 2R0IA 2B3TA 3GLGE 1NV9A 1QZEA 3LCVB 1BVSA 3MMPA 4WP2A 1VQ1A 2JY8A 2MR9A 1A5TA 2JZ1A 2QHOB 3B89A 2LVQD 1ZMUA 2LBCA 1IFYA 1P3QQ 2DI0A 1EFUB 1DV0A 2KNZA 1OKSA 4DBGB 1X3ZB 2LVOC 2MJ5B 1UFZA 3E46A 1T43A 1PVEA 4UN2B 2DKLA 2JP7A 2RRUA 1SG9A 2EKFA 4Q7JA 2MGWA 2QSGX 1XB2B 2L2DA 1YLAA 3LCUA 1E94E 2LVNC 2WZJA 2DAKA 3BBZA 1OQYA 2ZTCA 2DAIA 1WIVA 1C7YA 3FRHA 4HEOA 1DO0A 2G3QA 1TTEA 2L4EA 4YIRX 2OOAA 2DNAA 1HQYE 2H5XA 3GLIE 2BWBA 1T6OA 2JY6B 1VEJA 2JY5A 1G4AE 2L4FA 2DHYA 4G3OA 1HT2E 2JUJA 3FRIA 1AIPC 1F4IA 2KNAA 1WR1B 1MN3A 2LVPC 2JNHA 1DO2A 1ZV1A 2DAEA 2DENA 2O25A 1VEKA 3F92A 2F4OB 1G3IA 2QNJA 2DZLA 2HAKA 2OO9A 1R4GA 3K9PA 3H4JA 1KYIA 1ZMVA 3IECA 3GLFE 3GLHE 1ZMWA 1VDLA 1X3WB 1VG5A 2MROB 1JR3E 2QSHX 2K0BX 2BWEA 2DAGA
chains in the Genus database with same CATH superfamily
2A05A 2LY2A 4AI6A 2ELKA 2IAIA 3VDPA 4Y17A 1Q3CA 3M6AA 3HSRA 2C96A 2DOEA 2QEXI 4IJEA 1SD5A 3PQJA 4NRWA 4XK4A 3U21A 1SVLA 1KA8A 3D8LA 2XEPA 1GJSA 4B7FA 2Y0QA 1R23A 2B7EA 4QHTA 3PNTA 5J3LA 3GLHA 2FEZA 2GXGA 2M0CA 1G3WA 3JSPA 3HTSB 3WE3A 1YS7A 1GHCA 3L25A 2E19A 2XPWA 5CQGA 2DFHA 4S12A 3BWGA 3J81K 2F5EA 5BPVA 2D1VA 4CJ6A 2KIMA 2HS5A 3HUGA 5IPAA 1ZK8A 2WAQN 4LJ7A 4JQFA 1OYIA 3KIOA 3L29A 1G3YA 2M0MA 3PSIA 4WX9A 3FE3A 5DUIA 3W6KB 3HXLA 3JR4A 3B02A 4XN0A 2K27A 3BZ6A 2VQHA 3EETA 1J9IA 5FTMA 1UG2A 2X0LA 1QNTA 5EP3A 3HHZA 2M4GA 5ILSA 2F5QA 1YJ9I 1IXSA 2CE7A 3GPXA 1LQ1A 1G59A 5ITUA 1Y39A 2HHHM 5H6RA 3I59B 2HNHA 3FTCA 4G4QA 4GGGA 1NV9A 2JN6A 1IGNA 1DPUA 3BJ6A 2BY3A 2KT0A 3Q0VA 2X1EA 2E1MC 1V5FA 3UJNA 3OYMA 4HNUA 4EGZA 5J40A 2O3FA 1BI3A 1JHFA 4RB2C 1GV2A 3CO7C 2I8DA 3QAHA 2BHYA 1JI8A 2V26A 3KP6A 4E7SA 4A0XA 5ICGA 3FD9A 2M4KA 3OYKA 2GZWA 4C3JJ 5IYDJ 2Z9OA 2R4GA 1W7PD 3SXYA 2R46A 3CJRB 3ZCBB 2KISA 2XHKA 4NBQA 3CC7I 4FQGA 1D3YA 3U6MA 3F8MA 3NWTA 5LRRA 3DPUA 1XB2B 1R9TJ 2MGQA 2ECCA 2HZTA 4YFNF 2H09A 2DAOA 3HGGA 4JI8M 1V5EA 5K5RA 2R4JA 3O3KA 2WY7Q 3CP8A 5E1WA 2COBA 3RTRA 2DAKA 1G6NA 1V4RA 2QF7A 4MQVA 2N8GA 4FCVA 4MLOA 2HYGD 2OPTA 4HEOA 4RGUA 4F92B 2L4EA 1YOVB 1YIJI 1EH6A 1AUAA 2BEOA 3BJAA 2DNAA 1B59A 2EFOA 4PJNA 3A01B 4LJ9A 2KRFA 2VONA 2ZXHA 1JTYA 2W84A 1IXCA 1GVNA 2Z4RA 4AZFA 2DWMA 1F5TA 2K9QA 3RPUA 5FLVA 3KYCB 3FRIA 3IL2A 2L7FP 3J80Z 2V1NA 5JFRA 5DD4A 1LUJB 1B6AA 1IRZA 1JKOC 1ZV1A 1UG0A 3SHGB 3I55I 1A6IA 3CMEI 4YIIA 2IS2A 1FLIA 1DP7P 2OO9A 1UM8A 3HHGA 3FDYA 2XAHA 4ZC3A 2XSZD 2WAFA 1MJGM 4MGKE 3GLFE 2EQRA 3ZMDA 1JR3D 2A5YB 4Y13A 2STWA 4I4LA 4II2A 1NVMA 2QBYA 3JR5A 3BJOA 3LSIA 1BL0A 2D7EA 3LAPA 4GHLA 2OQGA 3CF6E 5EZHA 5H6QA 5LRSA 2XZUA 1LFBA 4KIBA 2VT2A 1SXJD 3WTZA 1REPC 1FMWA 1W5CC 1Y0UA 3OS0A 4F1IA 2CQNA 4DYRA 2H6CA 1WPKA 4XSZF 4BEHA 2V1CA 1MGTA 2E5NA 3T6PA 3HU1A 2MD5A 3W68A 3ML6A 1KQ0A 4AWXB 4EIWA 2QCOA 2VB6A 3SFIA 5FROA 1T56A 3FHZA 3GF2A 1X4PA 1WJEA 2FBHA 4II7A 2DA6A 1LE8A 4HF2A 4KA4A 1G8PA 5B1AH 3S2DJ 1G4DA 1BA5A 2IXSA 3ABKH 1N34M 2MH2A 2WV1A 2X1DA 4PCQA 3I58A 5EXSA 3GLLA 3GTGJ 3QODA 3LA7A 2M87A 5LFAA 1VQKI 4B4CA 3S3NA 1XXHE 3CF2A 3H0DA 2VDBB 1YSYA 1TC3C 2JA5J 4KDPA 2GQFA 4D81A 1BJAA 1FBUA 2FSWA 5KK1A 4ETSA 3LNQA 4G6DA 2WB1N 5A2QS 3I9V2 2M34A 1YHQI 1Y8QB 3UMMA 2X6WA 5FGMA 4S05A 3JRIA 1L8QA 3BROA 4B3AA 1E9SA 4YFKF 2KFDA 1EIJA 4HLXA 1A5TA 2JZ1A 1H89C 4AKGA 3BTLA 3CF5F 3HDDA 1SEUA 2L6OA 3NQOA 5EEGA 3VK7A 4FE4A 4BHPA 2XF5A 2XC7A 1D5YA 1SFXA 2A5WA 2CW7A 5E1ZB 1BW5A 4RKUF 3KFWX 3GQ5A 4PT5A 1OKSA 4XR6A 3M4OJ 3L2RA 1Y56A 1DU0A 3A0BC 2DZOB 1BIAA 1WI9A 1T33A 4NXNM 2P5VA 2X6XA 2CEAA 2Z33A 1MBGA 1IY0A 3S3OA 2DKLA 1ULYA 4BUPA 4IBGA 1OPCA 3KX2A 1H88C 3TO6A 1YLAA 3BQZA 3K4JA 4Y7NJ 1LVAA 4KT0F 1FY7A 2PN6A 2QA4I 4FASD 2WZJA 3TGNA 3K4MA 1VQ8I 3QPSA 1DU6A 3TQSA 5LHHA 5M5XJ 2PJPA 2H6BA 4E4HA 2YFQA 2CRGA 4ZTFA 2E60A 1HQYE 4HF0A 5EQTA 2QQ9A 2R7QA 1HDDC 1Q39A 1ZG1A 2HDCA 3TWLA 4AIKA 4A12A 1WH7A 2A61A 4UUTA 2XB5A 4Y4RA 3SEQA 4MGZE 4D1QA 2X51A 4CSWA 3BG9A 2DENA 3J7AO 5LD2C 1ZGJA 4JI0M 3FYDA 2O03A 3J81Z 2CGPA 4G7HF 4W97A 4LG2A 3U60A 3EUHC 5FKNA 4H0EA 4E7IA 5L3GA 3DF8A 3HKZA 5IP7J 1FOXA 4ESJA 2X9DA 1XXHA 2Z99A 3S1RJ 3GTLJ 2LY1A 2M45A 2VL8A 3BZCA 1GT0C 2KKOA 2HKXA 3HBLA 2EK5A 1BN5A 2PMZN 3O2PE 2KMUA 4C2UA 2VODA 3QU3A 4CYDA 3OWTA 3S8PA 3FUVA 4FD2A 4ZYAA 1VQ5I 4I0BA 2W1OA 2NQ8C 3UR3C 5DDGA 3K4KA 4KN7X 3BPXA 3E9SA 3HGIA 3FZVA 5JLWA 3U6QA 4L18B 3ECHA 3QPTA 3GLFA 2UXDM 5CVUA 4CYCA 2OC6A 1GO5A 5HDKA 1IDYA 4BGDA 3V42A 5LHIA 5IT9S 1NY5A 1XMXA 4UVAA 5F1RA 4G4OA 1XNRM 3SMPA 3W3CA 2RV8A 1XDSA 5D5VB 3HOTA 4A3IJ 3BLYA 3D8BA 3LA3A 4NXMM 4UVBA 1GDTA 1Z6TA 2CUEA 3ONQA 1W5TA 1WXQA 1HDPA 1NO1A 1HNWM 4BQOA 4CXFA 1UB9A 2JSPA 5M5YJ 3GFIA 3BR1A 2KPMA 3IWZA 1ZRCA 2H1KA 2R62A 2W57A 4A0YA 3VOEA 3HJEA 1TWCJ 4EJUA 3A2KA 3Q3SA 3GLGE 4A3GJ 1KQ9A 1KFVA 5DV5A 2RKOA 1VTNC 2VE9A 1I1GA 2QHOB 2HCBA 3I54A 1IN7A 2GOMA 3HL2A 2X4AA 1FMVA 3FKJA 5GKNA 5HNFA 1L2BA 3CUQB 2NOGA 3QP6A 1N33M 1ETOA 4XLFA 1Z67A 3HU3A 2UV1A 4E7LA 2LVOC 1QDRA 4JI2M 4D5CA 1UFZA 3CUOA 2ZAOA 2VASA 4M3EA 1G71A 2E7XA 2JP7A 4IIWA 2XV4S 2NNYA 3ILKA 1FYLA 4CCMA 1TLHB 3A4CA 4WWCA 4WXHA 2E2IJ 2JJ7A 5L8RF 4BXXJ 1P7IA 3GMEA 4GCVA 2L7KA 2FU4A 4ZJZA 1HQCA 4OX9M 4GDFA 2JA2A 1ZQ3P 1T08B 4FETA 1KYWA 1OCZH 3ZQJA 4BY1J 5FTKA 2X4HA 2FD5A 2EJRA 4LF5M 4UXNA 3I71A 1K83J 4LLLA 5F08A 4M6VA 1STZA 4DR3M 1IBKM 4M6XA 1B8IB 4R1HA 2JY6B 2TDXA 2YQZA 4HX8A 4BDZA 4MQ9F 3FXUA 2A6EF 2HI3A 4XIDA 2I7NA 4OIPF 2JA8J 2JUJA 4PJJA 1QVUA 3G71I 2ZSIB 2DMUA 1ZG5A 1VQLI 4DIQA 2WSFF 3C58A 2IGMA 3KYDB 1B9NA 2LNHC 1OMIA 2WSCF 3A42A 1X1DA 1V54H 2XPUA 3GXOA 4IRGA 4QSHA 2QNJA 2HAKA 4MHGA 1WZ2A 4B7HA 2V1UA 2YNMD 1KYIA 3AOGA 2P5KA 1VDLA 4DYQA 1Z3XA 1J5YA 3B7ZA 3KETA 4HRIA 4HLQA 4GKJM 1TT0A 4OIOF 1DV0A 2HKJA 3RZOJ 3K8ZA 2HQ5A 1JUPA 4BQAA 2PI0A 4B3MM 1YRNB 2R7ZJ 2CUJA 2R93J 1YO5C 5IT9K 3HB9A 4IBJA 1OCRH 3H5RA 4XSXF 4IKFA 3HHYA 1R49A 1FZPB 3C3EA 3BCAA 2JZ0A 3DP7A 2K47A 3KYLA 2QCUA 1U6GA 4EV0A 1QBJA 1SXJE 3SARA 1C0WA 2F4MB 1FIPA 5CVRA 2BW3A 2HWVA 3H5AA 1IRGA 5D4RA 1XG1A 3O8HA 4FWHA 3M9AA 2Q2EB 1ZHFA 5DTDA 2K86A 2R7VA 1XDUA 2OTJI 1Z1DA 4IBFA 3MWMA 1NY6A 5FFXA 1T0FC 3FM5A 3OIQA 2LTUA 1W36D 1DPRA 1HJPA 3NWSA 1OTRA 2V4JC 3H0GJ 2DTZA 4LF9M 3H9JA 5BNGA 1OISA 1ZR2A 3FUWA 1BOBA 3FXKA 4LZZA 2MA3A 4LLNA 4M71A 1UHMA 4ZDLA 5C4XJ 4JOMA 1DGWY 3MZ8A 1PP7U 1QYRA 1LB2A 2LH9A 1OFCX 3DPTA 1F43A 5L3EA 1WJ5A 4JXJA 4BDYA 4G7OF 4AG6A 2KL4A 4I99C 5GTHC 1EFUB 2VF7A 2F5NA 2KZVA 2LC2A 3SZGA 4B1RA 3LVWA 4B08A 1FNNA 3S2WA 1IQPA 2QQAA 4ON0A 5E3NA 2ZFUA 2LYCA 4RM3A 1SG9A 3VYTB 2EKFA 4XBOA 3CJTB 1GV5A 3V76A 1OCOH 3K4LA 4WXDA 1R5GA 3TEDA 3FTEA 1USSA 2RGHA 2WA0A 2XRLA 3LMMA 2CS3A 1WIVA 3OL3A 3ZN0A 5JR3A 1P6RA 5K7ZA 2K85A 4E7JA 4WCGA 1QZMA 1IW7F 2VIXA 4G6QA 3F21A 4IZZA 5E18F 1M1EB 1XGOA 2R7UA 1MH3A 2L4FA 1BJZA 4REZA 1PYVA 2KQRA 3LFUA 2P6TA 1GXQA 1HW5A 2MW8A 2G8LA 3M07A 1TQIA 3N97A 4W5WA 2DTRA 4O3MA 4JV5M 1IDZA 1GVJA 1XD7A 1DO2A 2DAEA 1U5TC 7CATA 1XC8A 1VEKA 1XB4A 5CLSA 3S1NJ 4E6KG 4P5OA 2ZAMA 4P1WA 1YUBA 3GW2A 1NHAA 2AQFA 1R4GA 2K5CA 4AM3A 1W5SA 4AVZA 2H27A 4ZDPA 1SMTA 1SFEA 5JHUA 3VKHA 2JRMA 1IRXA 3BR5A 4IBBA 1VG5A 1MJ9A 2HOEA 2QSHX 2R7SA 3BG3A 4CZCA 2V6EA 4X1EA 3BTIA 3C3DA 1AOYA 2AS5F 2OV7A 1P7JA 3FK6A 2KZUA 1G41A 2ERCA 1Z5CA 1J5EM 3E3VA 4IO9F 1W7PB 3K9OA 5ITRA 5IP6A 1QZZA 1R36A 4JBAA 3U61B 2XB0X 1NV8A 4QOSA 3ZXSA 2M60A 3G1LA 3TDUC 1J0RA 1YX5A 4PJ0C 2GIVA 1WH5A 2L9NA 4IJFA 2G5GX 3RKQA 4U7BA 3DTEA 1WJCA 2DODA 3WU1B 3J7AY 1H8AC 3UNGC 3KSJA 3CP2A 3UKGA 2ZTDA 2EWNA 3GFMA 1NG6A 1BBYA 2KRKA 3UZUA 1P4XA 1SD6A 1BM9A 4MEYF 4XNFA 4I76A 3TQNA 4RDUA 4LCBA 4HOBA 4C3HJ 4LF7M 4ENKA 1I6XA 5HOOA 2EA2A 3JRBA 1X1BA 3MHVC 3JRFA 2ZJRF 1HA8A 4LRTA 3DLAA 3BOQA 1PJJA 3E6MA 5HS8A 1FYKA 2D45A 4DQ2A 4DYCA 3P9IA 4L9NA 2BZTA 1ZAEA 3KPHA 4HX4A 4LF6M 4V2FA 1PUFA 1WFXA 5LGUA 4J19A 5C1BA 4DV1M 2WADA 4IL6C 2CMPA 1VQ6I 1OYWA 3U6DA 1SD7A 4PDKA 1J09A 1AU7A 3HHXA 1V3FA 2MABA 3ZRGA 1K3XA 2Q8KA 1O57A 4BE2A 2DI0A 3DQVC 1AA7A 2QPAA 4IBEA 2Q0OA 2TRTA 3I04M 2DVWB 3I3LA 2ESNA 1B4AA 2IVMA 2CV0A 3GCMA 2VKVA 1KU7A 1IF1A 2M7BA 2W00A 2HXOA 2MYSA 1Z91A 2RRUA 1W7PA 4L5EA 3KOYE 5FTLA 4LG0B 3E6BA 2RGVA 2EV5A 3D0SA 4BU2A 4LIVA 4X6AJ 4XRFA 4BBAA 1PJRA 5CQEA 3I4PA 1QDTA 1XN7A 3RYPA 5F6FA 4P17A 4OINF 2L9RA 3ZMSA 3O8GA 3PL8A 2VQGA 5EP4A 4YY3M 1LTMA 4Y3OA 1SANA 3QPHA 2ZJPF 4A3BJ 4DOZA 4I02A 5A2QZ 2H5XA 3RYRA 4A5NA 5EP2A 4NQWA 5EG0B 2GBYA 4G94A 2JRTA 2E1CA 3FX3A 2MBFA 3GFLA 3T8TA 2OQRA 1MZBA 2A6TA 2FUG2 5L3DA 3BTJA 4PFPA 1V5GA 5EP1A 2XKOA 4DBRA 3I4YA 1R4NB 2O25A 2F4OB 2HDWA 3G73A 3FKEA 3TOBA 3RPQA 2XGEA 2VQEM 4QPOA 5LGNA 3RSNA 2JWTA 3BP8A 2O0YA 3K4BA 4BS9A 1T3TA 1ZMVA 2XGDA 1D0ZA 3LSKA 4M74A 4ENJA 1WGXA 2L0KA 4UUSB 1GKIA 1MMDA 1VQPI 2FF4A 5HLTA 5DYMA 4M73A 2Y9YA 1RR8C 1JT0A 1JGSA 4KISA 2RREA 5CVJA 2MH8A 4RF0A 1PJQA 3FXLA 3IC7A 1GJTA 4BY7J 5GPCA 2D7HA 2WSEF 1RRJA 4XBFA 1HC8A 2XAUA 5KQDA 2LSOA 2DA1A 2KXEA 4CCKA 2CP8A 3JRHA 2E5ZA 1H6UA 4RNAA 5BQTA 2W82A 3H3UA 1HSJA 2O5RA 2LRDA 2VOOA 5IOZA 1FSEA 3KVWA 2K9MA 3BG7A 3GO5A 2OUMA 4II3A 3AL0C 2PX9A 4XK8F 5EJCA 3OY9A 5DCMB 2DW4A 2WY8Q 6PAXA 3WG7H 4C3IJ 2QLZA 1BC7C 5FRNA 2J5OA 1JJ6C 3SC3A 2R4EA 5KPRA 3KP4A 3H1CA 4ANJA 1MNDA 5JHFA 1I5ZA 2VBXA 4JX4A 2XF3A 4OMZA 4L78A 4OVZB 1R1UA 3ZMUA 2JQ7A 3MEXA 1QGPA 3WGGA 4CUGA 2PLYA 3C2GA 3WODF 2W24A 1DGRM 3DPLC 1NJFA 3MAJA 3D5SC 3KS4A 3GYHX 3RQ4A 2RN7A 4Z8XA 2NOJB 1PRBA 2JXNA 1TNTA 4HSRA 4PK4A 5TISC 3MMPA 3Q9VA 5E3MA 4J00A 2VPRA 4DR2M 2BJVA 3ASNH 2M1BA 3B89A 3FWEA 4C2TA 1WWXA 4FX0A 1WHUA 4G4RA 5EG0A 2W25A 4KHPM 3ZQHA 4LG3A 1CGPA 1U5TA 3E97A 2ZXIA 4KFCA 2IGOA 1LNWA 1LPQA 2E1OA 3TMOA 2I7PA 1SMYF 1PVEA 1GL7A 1XSVA 3OR1C 1F36A 2YR0A 1BI0A 4LJ5A 1R2YA 4QTRA 3PJRA 3EUAA 2MGWA 5DM6F 4DR1M 3ZC7B 1BW6A 5BS6A 1ZGWA 3C2BA 1RU3A 1K78A 4WXCA 4DBQA 2GWRA 5FD6A 2J7NA 1C7YA 3MKWB 4M3BA 2IW5A 1LJ9A 4ASNA 1TTEA 3WHKA 2BHZA 3KEYA 2EA4A 4N9HA 3DV8A 4XOPA 2BOLA 2EZLA 2XGXA 4IHVA 2FOIC 2COMA 3H3VK 4IQJA 3L2AA 4LFBM 1NTCA 3RGSA 1Q1VA 3GVAA 3A03A 4GH9A 4IEJA 5J1RA 4OVZA 2CH0A 1AIPC 1TGUA 1I94M 3TO7A 3HOSA 1MMGA 1Z7LA 1QO0D 2Y0SN 3BC8A 2VPLA 3F6VA 1G3IA 2P0WA 3WTVC 1W0UA 4L9VA 3KP2A 1VFCA 5KVRA 5F64A 2LLKA 2VKEA 4D7MA 1BI1A 2DYSH 3JTGA 1ON1A 4W1UA 4M0WA 2F4VM 1X3WB 1YX3A 4UB8C 3QOPA 5BMZA 4QNMA 2QYOA 1R5LA 3Q8XA 2WB1A 1YW9A 3OIOA 4PSXA 4UVCA 2KHHA 2E2HJ 4CCNA 1N36M 2ZXJA 3WTSC 1Y8GA 2V1DA 3SYLA 4QHSA 5E17F 2IP2A 4BBSJ 4KJZA 4QWQA 2DCEA 2DYRH 5ITTA 3CCSI 3S15J 1DUXC 2AHMA 3SJMA 4ENNA 8CATA 2EB7A 3OYGA 2HEOA 3HSEA 3K0LA 2ID6A 4I01A 1Q02A 4NB5A 3ISPA 3VYRB 2K40A 1TW2A 2DWNA 4CGYB 4RS8A 2LTPA 2CW0F 1IXSB 1ERDA 3S93A 3KDSE 2KIQA 1VEGA 2Y2ZA 3H5NA 1R2ZA 4A3KJ 3I4VA 1XSXA 2BVLA 1MU5A 2DJIA 2NS0A 1FEXA 1PJIA 1YQAA 2LK2A 4D82A 3SASA 1FP2A 3U6OA 1T39A 3ERED 2V6ZM 2P5TA 1WI3A 1WJ7A 4DJAA 1N32M 4Y15A 4MGHA 3CQZJ 2D5VA 4OAYA 2EZIA 2XSDC 2R0IA 4IBDA 2KIFA 3F8NA 3W6VA 2DJNA 4UHTA 1QZEA 4GRIA 1VQMI 1FWZA 5DCFA 4RBOA 2F5FA 2UWMA 4MIMA 3Q0UA 3RCOA 3TKYA 4BLCA 4ESFA 1VF9A 2H94A 3DZDA 2J5PA 3AG1H 4M6YA 3WHBA 2PQ8A 3JRGA 1QZYA 2VQLA 3NARA 3HKZN 1IV6A 4LLGF 2PBIA 2JTVA 2FBIA 1Y6IA 1VDDA 2CRUA 3GLFB 2VXDA 2KNZA 2ICWG 3OR2C 2LY9A 2AHQA 2XH9A 4MGIE 2B0LA 2LKPA 1L0OC 4PDGA 2QM3A 5F0CA 3GTKJ 3CJQB 3WGIA 4LJ6A 1S7EA 3HPHA 3K6GA 3OYBA 3IRRA 3DBHB 2NVXJ 3K10A 3RZDJ 5F04A 5IYCJ 3DEEA 3R6SA 3TDZC 5HDGA 4CDGA 5DM7F 2I5UA 1KYZA 5J47A 2HDDA 1L2CA 4CH7A 3J7AS 4BL0B 3HOVJ 1E0EA 3ABMH 2L09A 2IA1A 4BXUA 1FIAA 3DTIA 4XKVA 5EEHA 4DV5M 1QUTA 3HWSA 4I98B 3FUTA 3SZTA 3CLQA 4ZPXA 2VI6A 5JI6A 4P55A 4MTDA 3H92A 3BZKA 3LAJA 1FX7A 4KITB 1QRYA 4AIDA 1OIZA 4RLFA 4DV6M 2RC4A 4I6ZA 2WBMA 4YELA 5FKLA 4HV6A 2DPDA 2M8GX 3DU5A 2R0QC 3WHLA 4LB6B 2XAFA 4FWGA 4LGWA 2IJLA 3CTAA 2DMPA 4F7ZA 2DMTA 4M9ZA 3HYIA 3NEUA 2DT5A 1OFIA 3HJSA 1AHDP 3M1EA 2DA5A 5ICCA 3EYYA 3S16J 3ERMA 2KEBA 3WU0A 3HEFA 1LEAA 1BR4A 1R1VA 2HPIA 2E36A 1XWIA 3RIRA 1HLVA 4A93J 3IG5A 1R58A 4LB5A 4UB6C 4DGWB 4FW9A 3SMSA 2B63J 2MROB 1Z05A 2V6CA 3K70D 4BE1A 3CCRI 4AW4A 1KU3A 2M9HA 3H3ZA 4NL4H 2NXNB 2EINH 2RVCA 3PFYA 1K78B 2DLLA 2MC4A 1NNUC 1LFPA 1TDZA 1IN6A 2BW3B 1GUUA 4YRVA 3ZQLA 1K7AA 1OLTA 3Q0WA 4A5MA 4YFXF 2XAJA 1LV7A 2BXZA 1RNLA 3R4KA 4HL4A 4A3VB 2R92J 4PGGA 2STTA 3K2AA 2DFIA 2P7VB 1MKMA 4HSTA 4LK0F 3NWLA 2XPVA 3SDBA 1XPXA 5KQ8A 3GLGB 3OYCA 1MW7A 5HS7A 1HW2A 2P7CB 3HU2A 2LVAA 3HC7A 1SXJA 1PJSA 1Z59A 2HTSA 2M5WA 1X4OA 3SFZA 1JQJC 2CUZA 2MD0A 2X6YA 4MO7A 3RJPA 3E21A 4XLPF 4G6TB 1IN8A 4O6JA 2F5SA 1Q1HA 3VSLA 1LDDA 1U78A 3M8FA 2F2EA 2LG4A 2FMLA 2IS1A 2XSZA 5C44J 1HKTA 2VE8A 1SFKA 2PEXA 2RKHA 3F8CA 1BIBA 3U9GA 5J6XA 2UXXA 2Y0SA 4CCLA 2CHGA 4L0ZB 3VODA 1XMKA 1GABA 3PSFA 4WP2A 2EFWA 2HVSA 3LFKA 4DUZM 1QPMA 2DK8A 3A45A 3KZIC 3R8FA 3TOAA 1EA3A 4CHUA 3FMRA 1IFYA 5IOYA 5L3BA 5FLMJ 1LE8B 2FH0A 4BYYA 2QZ4A 2UUAM 1I27A 4M3DA 1T8IA 2Y48A 1APLC 2L7MP 1EJ9A 2XFSA 1O7LA 4B44A 1U0JA 2K4JA 1IXZA 1WKMA 3AL0B 4B3SM 2OCEA 2ZBKA 1MBFA 3KZYA 3SAUA 3V7RA 3IG8A 3L2WA 5FLXS 1DDNA 3HRMA 3CMAI 1X3UA 5HLHA 1FP1D 2GLOA 4BJTA 1ON2A 1EKEA 2PMZA 5J4YA 2JPCA 3IKVA 1X58A 3JRAA 3N4MA 5CKTA 2FE3A 1A31A 1ZN2A 3CO6C 5GPAA 5F3WA 4RLQA 1X1AA 1NK2P 1K79A 2LOOA 1S72I 3HJQA 2QZ8A 4LFCM 1XC5A 2HZDA 2VF8A 1HF0A 1RC9A 3EUHA 3ZQ7A 2ZC2A 4KIFA 3Q5FA 2O9LA 1MH4A 2LVPC 2JNHA 4I0AA 4L4UA 4BHBA 4EM2A 3HOXJ 4HF1A 4A3LJ 2Q2EA 3K2LA 3MQ0A 2F5OA 2UXBM 3E7LA 3DOAA 4NC6A 1I1SA 2Y30A 1O4XA 1MNMC 4Z2YA 3H4JA 1MBKA 5ICFA 2YR2A 3DBRB 3GRUA 3DLLF 3RQIA 2BY2A 2NVTJ 1E32A 3DEWA 2ISYA 5DYGA 2ETHA 4XRSA 3DKYA 1NK3P 1FT9A 4IPAA 2LH0A 3TW7A 3KLOA 4HNTA 1Q3BA 2O8KA 5DS9A 4F93B 2L02A 3S1MJ 5EZGA 1QU3A 2EKKA 1MMAA 5KNLA 3ABTA 4NNJA 2LKXA 4K2EA 1TWHJ 3K4NA 4L0YB 4LG0A 1NJGA 2HWJA 1PGYA 2A6HF 4Y52J 5E3LA 3RGPA 2QSFX 4ZYDA 1I6HJ 2H8WA 1FTTA 1D1BA 3X2QH 4ZZDA 1BR2A 5K7FA 2WWYA 5GADJ 2E1MB 3BOSA 3LSTA 3OYFA 2F4IA 2M30A 3EDPA 5F0HA 1LKXA 3KE2A 4XICA 3J7ZI 4RGXA 1TL8A 5E6JA 4ANRA 3ROUA 4BQNA 1FTZA 3J81S 3JRCA 2K02A 1WSUA 2H1RA 2HTJA 4B09A 2EFNA 4B7GA 1K4SA 4FT8A 4DZPA 4CO8A 2DK5A 2WV0A 3AG4H 3FHNA 4ZZLA 1PUFB 4BAYA 2JA7J 3L09A 2N35A 4FISA 2HOTA 2CWBA 3U60B 1XMOM 4IHXA 1IY1A 4RMNA 3FUXA 4CA0A 3WTXC 4HG2A 4FWDA 2L7HA 2CWEA 3MVPA 1RKTA 1ORYB 1Y0NA 5ERIA 3OYLA 3M3YJ 2LNBA 3P7NA 3SAVA 1RKWA 2RDPA 4N4OB 5J4VA 2HQAA 3OSGA 5AIPA 2NS7A 1RI7A 1XNQM 3SZPA 3FXMA 4D9JA 3LSPA 2DPUA 1P3QQ 2ESHA 3I51A 4NSOB 2EIMH 2VBYA 2X48A 4GMQA 4BHCA 2L7IA 3HUGB 2XIGA 3ZQCA 1UAAA 5CJ9A 1W36C 4I81A 2DDBA 5C3EJ 5D6FA 4AYBA 1MDMA 3MJ5A 2LR8A 3QYBA 3SHFA 4A69C 3OYDA 5FB2A 4KN4X 1PJTA 3PQKA 4ABZA 1ETKA 1TH4A 2E34A 2V79A 3ZCOA 2BGCA 4Q7JA 1TW3A 4HDUA 4DV7M 1OR7A 3K1PA 3CUQA 1O3TA 4KICA 4XGIA 3KP3A 3WHCA 4E7ZA 3BY6A 5D5XB 3W2AA 1IY2A 3TE6A 3KS8A 3BBZA 1Z7UA 1OQYA 2ZTCA 1F4KA 4IHSA 4XLHA 2CQKA 1SFOJ 4A3JJ 4LF8M 2FRHA 2C9OA 4U0YA 5ITXE 2ZANA 4V2GA 2A3SA 4A0ZA 3Q8GA 2OU2A 3PUBA 2VOPA 3GPUA 3HOUJ 5E26A 3KOXE 2BYVE 2HVQA 1HT2E 2RNGA 1ZG3A 5TGTA 1MX0A 4FCWA 4IBCA 1XHBA 3U6EA 2BV6A 2HOAA 4LJ8A 1OCCH 1RETA 2Z1DA 2K9LA 3JAMK 3VSKA 3EUKL 1Z5BA 1DGBA 4Z6YA 2C6YA 1QANA 2D7GA 2R45A 3Q9SA 2DZLA 1MNEA 3AKZA 1L2DA 4IXAA 4L9TA 2OQ4A 2R3SA 3GBGA 4EQQA 2ZCWA 2Y21A 5FKMA 1VQOI 2CU7A 3GLHE 3B6CA 3JR9A 3E6CC 2M2EA 1YFHA 1E17A 2OCCH 3DXJF 2JUCA 3AG2H 3LSRA 4C30A 3E4RA 3GP1A 1S9HA 5IYBJ 3KP5A 5LLQA 3U6PA 2MLGA 1USTA 1OYYA 3BG6A 3ULQB 3A46A 1SFUA 2JPBA 3U2RA 2C99A 2CUFA 3BTCA 3OYHA 1Y8RB 3ZP5A 3F9KA 2IBDA 3LSJA 2Z4SA 3DWLE 5E3OA 5IT9Z 2VQFM 5BPIA 3GLIB 1T98A 2EBIA 1W1WE 2WAQA 1YLFA 3KEQA 4GYGA 3BG5A 2JUGA 2Y31A 1P2FA 4BEHB 1K3WA 4JI4M 3THGA 3PFIA 1OJLA 4EM0B 3AOEC 4EJOA 3I4MJ 1EE8A 4U88A 4N4NB 1OKRA 4HDVA 1TQMA 2ZFWA 3R61A 5EF6A 3CCJI 2YU3A 1OFHA 4MM3B 4P96A 2HYJA 3AJIB 2YX4A 5ICEA 5LGTA 2R65A 2CV1A 3JAMZ 1YIOA 3TPZA 3BCBA 4CICA 2XGCA 3P5JA 1TR8A 1KGSA 3LVVA 1MMNA 3GTPJ 3OOUA 4GFBA 3HTUA 4P9UA 2OBPA 1Z9CA 4PJMA 3PNYA 3V8KA 3PO2J 4LOCA 1G3TA 3HHHA 2CFOA 4AVPA 4IRHA 3HSFA 3J7BA 1G3SA 1WVRA 1FSHA 1IV8A 3IHUA 1ONVA 2JY8A 1A04A 5D8KB 4WURA 4CZZA 2FQ4A 4XQFA 1HW1A 3C3WA 5C4JJ 3P9KA 3GUDA 2OF7A 4G6ZA 1R7JA 4DNCA 3SBJA 2K3PA 3JTHA 1T38A 4OMYA 3G1OA 1JXSA 2VJ4A 3FBNB 5FLXZ 3A01A 4G9YA 2FMYA 3FK7A 3GLXA 1RIOH 3FXRA 5B66C 3JRDA 5FFZA 3H35A 2PJRA 4A3CJ 2G9WA 2MJ5B 5IP9J 2G7UA 2A68F 5D4SA 4HQEA 4UN2B 3DKXA 2M8EA 5HVQC 3HX3A 1IXRC 4JI5M 2XAQA 2YU9J 2DFFA 3CCYA 2XDVA 2ME0A 2YSRA 1YRNA 4V19K 3WE2A 4HV5A 1G2HA 1J59A 1X37A 3N05A 4GKKM 1Z5AA 3VFDA 4OIQF 2G3QA 2ZBKB 3KOWE 4PGHA 2X1CA 1IG7A 1NHWC 4IHWA 2LKSA 2EILH 4IF4A 1MJAA 3O6BB 1FPQA 5M3FJ 2DHRA 2FQ3A 2KW0A 4RF1A 3KZZA 2LXEA 1WR1B 1UZCA 4M72A 1I4WA 1ENHA 5H20A 1Z6RA 4DR6M 2WAEA 5IT3A 2CW8A 4N9IA 2E35A 2R18A 1JKPC 2G7HA 1R5ID 1R6BX 4YEJA 3RKXA 4E7KA 3FUUA 3K69A 5EGOA 1OIPA 3BR0A 4JX6A 4YIFA 2VLAA 1ZREA 2ZMEC 3FIWA 2D2WA 3FXJA 3T38A 3HRUA 4Q47A 4YG2F 1JR3E 1ETQA 2M7AA 1D0YA 1S29A 1ZRFA 1YI2I 3REOA 1RUNA 3S32A 2JMWA 3WTTC 1QQWA 1YYVA 1TBXA 4I7HA 4KMFA 2H1LA 4LGMA 1HT1E 2P6SA 3TWMA 3K1MA 4NQWB 5EEAA 3GFJA 1HNZM 5EGOB 2X8AA 1HNXM 2QBYB 3ZH9B 4RGSA 1K6OA 3GLGA 1VQ9I 1GVDA 1HKSA 4DV0M 2IA2A 3RDIA 5L3CA 1HR0M 4MTEA 4JI7M 1H9TA 3MCZA 2IGKA 4FVMA 4F91B 1UJ8A 3M1CA 3GTQJ 4QLCU 3DFGA 3AG3H 1ZR4A 1QAOA 2AXTC 1E3OC 5DNYA 5FKKA 4DR7M 1MSEC 2BXYA 3CC4I 4OU7A 2P4WA 1XTAA 3CCQI 4XN3A 1E3HA 3SYKA 5D5WB 4XLCA 1IM2A 4PFOA 1ODDA 3FM3A 1S5LC 3BPVA 1EV7A 3NBIA 4JP0A 4A3EJ 2EZKA 4BKXA 3FTFA 2Z2SB 4EJTA 2FS1A 1IO2A 4JK1X 1BVSA 3OYJA 4A3DJ 3OSFA 2F5DA 4ITVA 2OA4A 1A36A 3RKYA 4J01A 2O7OA 1UHWA 4A3FJ 5HNHA 2CHQA 3TP3A 1NNJA 1QUSA 1T2KA 1I50J 3U1KA 3GQ4A 4RAYA 1R1TA 3LW5F 5JLXA 3HJ8A 2K6BA 5FSWA 4AIJA 2QQBA 3HIFA 4CYCB 1U2WA 1WCMJ 3I4NJ 2P81A 3KCCA 3MZHA 3E5QA 3E46A 3CMMA 3KW6A 5ITXA 1N78A 2ISZA 2K7LA 3VPRA 2OPFA 2GXAA 1K61A 4MH0E 2PFBA 3OYNA 2OJED 3L9FA 1D5VA 2EV0A 3HRSA 4WW0A 4HYEA 1VNDA 2DO7A 3GEZA 1B9MA 2IRFG 1Z3YA 1ACIA 3LSMA 4E7HA 3HZJA 1XGMA 4IHYA 3GTOJ 2DA2A 1VI0A 1SVOA 4X64M 2GM4A 2OOAA 3B9PA 3OS2A 2ZJ2A 3I01M 2LF8A 3GLIE 1O7FA 3F8FA 1ETYA 3BT9A 3I59A 2A69F 3TBIA 1B72B 1VQ7I 2XFTA 5E8IA 1G4AE 1CF7A 4YHHM 4AD9A 4L16A 4I8OA 2VBZA 4XL9A 4MNUA 3C7JA 5EXTA 3L2VA 3T8RA 1Z77A 4WK8F 2KNAA 1JUMA 2DMNA 3COAC 1MN3A 3KP1E 1RR7A 4MGRA 2Y75A 3CLOA 1R6RA 2LF7A 2GOXB 2VKDA 1P4WA 4C2MJ 1FBSA 4Q4ZF 3MK6A 1GL6A 4Q5SF 3C2HA 4HA8A 3K9PA 3W6JB 2Y20A 2J5YA 5DD8A 4CHTB 1ZMWA 1E9RA 1QHHD 5KPTA 2JVHA 3GZNB 3ZR8X 1NHGC 2VJIA 5K1YA 5F0FA 5LEJA 4DR5M 1ZKGA 3MN2A 4B47A 2DAGA 1TDHA 1JKQC 2XZFA 2QP9X 3DKWA 2XVCA 4B3XA 3IAM2 1T0FA 4KMUX 3PIPF 4K0KM 4LF4M 3TWKA 4KIGA 3KXEC 3E5XA 2EH3A 4S04A 4LY6A 3U6SA 3CTWB 5LBQA 1TP4A 2L5QA 2XRNA 3B73A 2M5ZA 3QWLA 4LIUA 1POGA 1RZ4A 2VUMJ 3CDLA 1U3EM 3AV0A 1ZYRF 3ZGKA 2R5YA 2PMUA 2NNNA 1X19A 1UELB 2VBWA 2V9PA 2DAMA 3ZQIA 2LHGA 2E71A 4IX7A 1C1KA 1O3QA 2DFEA 3T1BA 4ZYHA 5HS9A 3ECOA 2DZNB 2ZMEA 1H9GA 2KNVA 4EMSA 2R7WA 1S6LA 4L5JA 3PVSA 1TTYA 2QKLB 4QIWN 1JGGA 2E7WA 3JSOA 2EJSA 1ZGAA 1N77A 4RM2A 2MG4A 1I3AA 3C1DA 4GO1A 5D8LB 3R9XB 3WG9A 3IH3A 1J2XA 2YUSA 3QU6A 5EYRA 3GPPA 1D2NA 1GLNA 5E79C 4EEFG 4KUMA 4LJAA 2CV2A 3DA1A 3GZ5A 2VC0A 4U0WA 1X1CA 2XLJA 2HU9A 3SAWA 2L7ZA 3GX4X 2L9SA 2GAUA 2Z8YM 2Y0MA 4RAFA 4BH9A 4F55A 1IUYA 2R5ZB 1MIJA 3KP0E 4LMYA 2DI3A 2E5LM 2OZ6A 4AIHA 2R7DA 2FOKA 5ITYA 4XONA 3W0LB 3GQ3A 1T6SA 2L01A 3WTUC 4GITA 2JZYA 1L3LA 1ORKA 2C9CA 1X2NA 2LWXA 3QP5A 4GXOA 5E8GA 3L28A 1X1PA 1N75A 3B6AA 1YJNI 3SQNA 2ZO4A 2FNAA 2Y0TA 4KT5C 3L00A 2LVNC 5D6EA 5FO5A 3FKIJ 3UGJA 3C9PA 3BXWA 2FNPA 4LJ4A 2WTEA 3S14J 2LBFB 2W4SA 2DAIA 2L54A 4GYIA 2EIKH 3CJNA 2BVMA 4PUSA 1WJBA 4AC0A 3MFKA 3QOEA 3FRHA 1FYMA 3B74A 4NSRA 3R0JA 2JK3A 3SEZA 2LD5A 2BBYA 3EQLF 2E1NA 2UXNA 3FMQA 4LD5A 3U1DA 2UZKA 4NUBA 5E1XA 4BE0A 1JE8A 4KNYA 1B72A 3AAFA 1ETXA 3K70C 2JY5A 4B8XA 1PM5A 2F5VA 3GO8A 3VFZA 4G3OA 1YITI 1JTXA 3CCUI 2IS6A 2Q1ZB 2GA1A 2DQLA 3IUOA 4AUXA 5FTJA 1OCTC 1D0LA 5F1JA 4HBLA 1YE9A 2XSJC 3QAUA 3BR3A 1ZTRA 1EH8A 2JVGA 3CZ6A 4UY8I 5KAIC 3CCVI 3TW6A 2CHVA 3IECA 5EXXA 1EH7A 1VZ0A 4BB9A 2YX7A 4OAZA 3JW4A 3GTJJ 5GTIC 4M0DA 4I5SA 2BE5F 1I39A 1U8RA 2ZNYA 3WGHA 2BY0A 2BWEA 3P9CA 4WF2A 2V9KA 1W4MA 2CJJA 1ZLKA 1V33A 2EV6A 2FA5A 1HXDA 4HLYA 1V92A 3A0HC 2IS4A 2Z7JA 3OYIA 4DR4M 4DUYM 4OWRB 5JVGF 2W85A 3LOCA 2X6OA 4F2LA 4R71A 2APLA 3ZQQA 2JY7A 3K2ZA 1B8IA 1FJLA 4M9XA 4CGZA 3BDDA 5LMUM 5HDNA 3MKYB 2IA0A 2K9SA 4GC9A 3H9GA 4BJ6C 2LREA 1IBLM 2LVSA 2F5PA 2KZSA 4XORA 4HEA2 4MEXF 4P16A 3I0TA 1MJBA 3KP7A 3BQYA 3TO9A 2FXAA 1V34A 3I5UA 2LMDA 4IBIA 3A1YA 3J80S 3OOPA 1XCVA 4NDLA 1XMQM 1JHHA 4BJ5C 1IRFA 3KFUG 1NSFA 2ACJA 4IBKA 5CYVA 4UUSA 5KPZA 1FBQA 3LA2A 1Y1WJ 3R0AA 3NAUA 1DQUA 2E2JJ 4JN6A 3ZQFA 4X65M 5J8CA 1YTYA 4TV7A 3A02A 4PZJA 4CCOA 4MB7A 3L2UA 4LGYA 1V55H 2DQRA 2LVQD 1A5JA 1LFUP 3L1PA 2LBCA 3GTMJ 5J1UA 3L2QA 4H4KC 1DGFA 1XCBA 3HHWA 2QWWA 4U87A 4DBGB 3EIHA 1NH3A 1IZ1A 4D80A 1X3ZB 1D0KA 2VJJA 5IWAM 1MBJA 3PO3J 1UHSA 2HVRA 3V8JA 3ASOH 3U6CA 3QQAA 1XS9A 3M8EA 1JJ8C 3GLHB 3G4SI 1QHGA 2HR3A 5IY5H 2UUBM 3VK8A 1YW7A 1SD4A 3ZOBA 1YG2A 2MH9A 1F9NA 3I56I 3S17J 3G3ZA 3NRVA 3T1HM 4TUWA 4MFDA 5BR8M 3W2WA 5ILVA 2NVYJ 2R7RA 4M3GA 3OS1A 2BJWA 2QQ8A 5TRDA 4B3TM 3MMYB 4NOOB 4YIRX 3S3MA 4PSWA 1MD0A 4FCTA 3K1JA 2NAZA 4LK1F 3B7QA 2O01F 3OIPA 1N25A 1XSDA 2DT6A 2HFHA 1OAOC 2V7FA 4CCJA 3I64A 4OU0A 1JT6A 1U8BA 2R44A 1DGHA 4AKHA 1IUFA 2PMHA 3AOEA 1TNSA 3K1NA 3D5LA 4PD2A 3G2BA 4B43A 5KAFC 3J2PB 3OTOM 2O61A 4XLNF 3B7NA 1ZARA 5JVTA 5BOXA 2L2OA 3FF5A 3HOZJ 3HM5A 3QPLA 4DZJA 4MFEA 2OD5A 3RE8A 3CCLI 2GNOA 4PCZA 3VKGA 2Y9ZA 3M8JA 2KDZA 4IJAA 3EYIA 4CIZA 1IN4A 1IAWA 2J7OA 4GIPA 4X0GA 3PNVA 2K0BX 2KJBA 3WU2C 4BXFA 3A98B 2RNJA 3OYAA 2CQ7A 2G0EA 4M3FA 3HOYJ 1S7OA 1K82A 4G4NA 3T0YA 1OAIA 3VYSB 2ID3A 4UUVA 2R7TA 2DN0A 4RAZA 1I3QJ 3OV8A 2NYXA 2UUZA 1SXJC 4F3QA 1JB0F 4U7DA 1PUEE 4JI3M 1ZAOA 4XMYA 2Z16A 4E70A 5HODA 3T1YM 5FJ8J 1UCRA 2KRHA 1R4MB 1IJWC 1L1TA 4OOIA 3ZMTA 1P92A 2VC1A 2HGCA 4HPQA 5FKOA 2D1HA 3LQQA 3DCFA 1S3SA 5FTNA 2PG4A 4GEWA 1J75A 3CDIA 3PUFA 5CVIA 3T5XA 3SATA 1J7KA 2VT3A 5DFLA 1ZELA 3V8LA 1QAQA 2K9DA 2XF6A 4NRVA 4G12A 4HQMA 5A2QK 1AKHB 1EF4A 1PP8F 3SDGA 1IC8A 4DV2M 2ELJA 3ESWB 1L1ZA 2MC3A 5F27A 3ZQGA 4LZJA 4EJWA 2EFPA 5TJJA 5IZ7D 2B3TA 5D5UB 4PJLA 5HLIA 3RKWA 2KHMA 2DA7A 4EVIA 2F6CA 2DOFA 4UNOA 1VQ1A 4NC8A 4FX4A 2ELHA 3GWZA 4XLAA 1AWCA 3NBXX 4UV9A 1WRJA 1ZMUA 3VLFB 4RA2A 3K9TA 1U9OA 5GAGJ 3VDXA 3ZMVA 1O3SA 3QYFA 3V7CA 2QVOA 2KDOA 2R5YB 4A6DA 5KO3A 2DOAA 3U5ZA 1O3RA 4A2UA 1T43A 4M9SA 1DP3A 3HRTA 1LDJA 4D0PA 3GZ6A 2KJCA 2CQXA 3JREA 4IOAF 3S2HJ 4HW0A 4PDIA 5J1YA 2F48A 4LRSA 2I10A 2GXBA 1Z0XA 2A07F 1RUOA 4IQ4A 2XAGA 2VKHA 2BY1A 1S8NA 4L5IA 2IPQX 3D1NI 4KT6A 4JX5A 5H37D 1ITYA 3ZN1A 4XRSG 3GRRA 5LMNM 2DT7B 1K6YA 2AO9A 1TH3A 2ZJQF 2X85A 3MKLA 4LJZF 4OW0A 4KYWA 2BWBA 2KRUA 4LFAM 2KDLA 2TCTA 3V7SA 3CCMI 1MMSA 2MLKA 2P5LC 3E0JB 3L26A 3VDUA 2DXIA 1KONA 1TWAJ 2ZNZA 1F1ZA 4QOZC 3K7AJ 2YS9A 2M3AA 3IWFA 3F92A 1P9QC 5KCMA 4HX7A 2NVUB 1IN5A 2W7NA 4B48A 1CF7B 2LHCA 2KZGA 4XLEA 5EXPA 3L27A 1XGSA 4XOTA 4CISA 4EGYA 3VYUB 2ME6A 2FBKA 3KLNA 1R7RA 2KRCA 2Z5UA 4FHTA 4BBRJ 1MDMB 4I09A 1D1CA 1KSFX 3E6DA 5DEQA 4AG5A 3FBIB 2OZUA 1ETWA 3ELKA 4HNVA 3IRQA 4X66M 3J27B 5CPRB 2WC2A 3FXQA 2VXZA 2JT1A 1XX5A 2EUCA 2CO5A 4HZFA 1GXPA 5GAEJ 5JI2E 3HGYA 3F23A 3QRFF 4X62M 2RQPA 2KLOA 5JI3E 1D0XA 2EFQA 1IBMM 4A3MJ 4R3DA 1TH2A 2IGNA 2XASA 2RAEA 4R8HA 3T15A 5K5QA 3MKZA 2RGOA 3VWBA 2CYYA 2X49A 3MZYA 2CQQA 2QGUA 2ADUA 3V4GA 4RAGA 4FE7A 2XROA 1WGNA 2VN2A 3F6OA 2R7OA 2XUBA 2HQNA 3L2CA 3PM1A 4JYKA 3HKPA 3HY5A 3VEPA 5ITQA 4DV3M 4EJVA 3GRYA 3QYEA 1LDKB 3IH2A 2K3FA 1D0MA 1LEBA 4XRMA 2UXCM 1R71A 4GC5A 1MBEA 3RI4A 2AQEA 2DDAA 2Z3YA 3CMYA 3F22A 2ECBA 1JUSA 5B1BH 4IVNA 2EPFA 4DW6A 5E20A 2OAZA 4XM3A 2YPRA 3DTKA 3DBLB 3K92A 2RQQA 2HPMA 4S0HB 3C18A 2O6GE 2UU9M 2QENA 4L9JA 1K4TA 2EZHA 3BR6A 3KSXA 3FXOA 2NVQJ 2KA6B 1VQ4I 3W0FA 2ZSHB 3IAS2 2HKOA 2FOWA 2L4MA 3F3XA 2DWLA 2AXLA 4DV4M 1BOAA 3PIOF 1OR7C 1YS6A 4R7GA 4KLNA 4GHAA 4IOCF 4BNCA 1U5TB 3OL4A 3SYTA 1D8KA 5L3FA 2UUCM 3R60A 4Y28F 3LSHA 3HG9A 4IHTA 2C5RA 1WQ2A 5KHDA 1H0MA 1B1BA 1Y1VJ 2V1XA 3PXGA 3G6EI 5HLGA 2LDUA 2OTLI 2R7FA 4A6EA 3ZPLA 4ESBA 1RPWA 4KODA 1DGGA 2DMQA 1T95A 4EM1A 2C98A 1SAXA 3G1MA 1SC7A 4D7NA 1DO0A 3OYEA 3L7WA 3M7GA 2K4BA 2F5CA 3CESA 4ZYEA 3WTWC 1A35A 4P9FA 4AU7A 1WJDA 5K5OA 3JAMS 1T6OA 1ETVA 1HOMA 2DHYA 2VIIA 4F52A 1RESA 1VQNI 3RFWA 1F4IA 3DU6A 3JCUC 3WTYC 1QA6A 2ZXWH 2ZKZA 5H2FC 4EATA 4AQYM 5DCMA 1FOYA 3TP0A 1YW8A 1BC8C 3ABLH 1TZLA 4BACA 5IREB 1HSTA 3MD2A 1MSFC 3E5UA 3CD6I 4RB3C 5J8FA 1MBHA 3F8BA 4OIRF 4B3RM 4L6V6 2VQCA 1QQIA 5B5EC 1QVTA 1R22A 4C9YA 1UMQA 1D8JA 2GIZA 2B9SA 3U6LA 4RB1A 2ZMEB 1HBXG 2CFXA 2R7XA 2ZB9A 3LWFA 1G8XA 1QPIA 3D5RC 3K4CA 2HXIA 4QNRA 1KU2A 1WJAA 1WGLA 2IEKA 3DEUA 1JKRC 4D5FA 1PDNC 1YJWI 3H9QA 1ZRDA 4ITQA 1KQ8A 5FRMA 1SVMA 5ED4A 3S1QJ 1WHCA 3ABUA 4L8RC 4BQQA 4ZH4F 5C18A 5DYIA 4G7ZF 3FISA 2PJRB 3IV5A 3CF0A 3U5ZB 2L3DA 1OCPA 1S7AA 1TWFJ 3IH4A 5AONA 4QPQA 2JA6J 5EDNA 2JWSA 3UK6A 4AKIA 1W0TA 4NHJA 4ZYGA 1LVKA 3IHPA 4O5VA 5AIQA 1TQPA 4ZDOA 1QVRA 2K9NA 5GP9A 3IP4B 1Z21A 1ZLJA 2DWZB 2OOBA 2FX0A 2LP0A 3H4MA 2CG4A 1FC3A 1JR3A 1SXJB 2DBBA 4ZTJA 1BI2A 2GQQA 2R6FA 2P8TA 1UFMA 1XXHB 1XMAA 1CUKA 3FMSA 3GRVA 2HQRA 3CGWA 1FJGM 4IRIA 2DA3A 3LCVB 3FTDA 5ILUA 3IKTA 2XF7A 1D1AA 1E3PA 2CSOA 2HL7A 4XKBA 2MR9A 4FCYA 3J80K 1AKHA 4RB0A 2EO2A 2LBFA 2V9VA 4ENMA 3RPUD 2NS8A 1FOWA 4Y33A 3KEOA 5LEKA 1S3JA 2EIJH 2IT0A 4JI6M 3GPYA 3CC2I 1ZH5A 2ZM6M 5FLXK 1KZHA 4FTHA 3W67A 5BPDA 1BR1A 3FYCA 3M0EA 3F72A 1P4AA 2LFBA 3EPZA 1E2XA 2W48A 5CVVA 3CDHA 4RGRA 2Y69H 1TWGJ 1KU9A 2EA0A 1NG7A 2HYFA 4LITA 3HOWJ 1XGNA 3GLIA 4U0VA 3LQRA 2QSGX 3W2VA 2L2DA 2Z3XA 4UV8A 3LCUA 2VJ5A 1E94E 4AYBN 5M3MJ 2R5ZA 2FFJA 3AFHA 2KP6A 3CCEI 4KO8A 1ZQ9A 4G8XA 4Q48A 2MFZA 4N0BA 5DUKA 4HAMA 3ZMZA 3OMYA 9ANTA 5K7HA 1R5HA 1X2MA 3HPGA 3VB2A 2MSYA 1CQTA 1TF0B 2QUFA 4LFUA 2H8RA 3DFZA 5FD5A 2FE8A 2HOSA 2O8XA 1TT5B 1HKQA 5GAHJ 3J7YJ 1FOKA 2FJ1A 2L9VA 3TL4X 1VEJA 1R00A 3I53A 4NC7A 3KOZE 2XKPA 1HCRA 4I2OA 4JI1M 3BR2A 3E1SA 2KIUA 4L15A 3F0CA 2QKMB 5M5WJ 3EIEA 2BNKA 3LSGA 2XGNA 1SAUA 4XKWA 4XKCA 1DGHB 3LL7A 2L4AA 3CUQC 5LHGA 1U9NA 3H36A 1A6QA 4R79A 4JYAM 2GA2A 2NRAC 3U61A 2DA4A 2JSCA 2DU9A 4MGYE 1WJFA 1QAMA 5B3SH
chains in the Genus database with same CATH topology
2KHHA 1V92A 1G41A 1WGLA 1Y8GA 2EKKA 1OAIA 2CP8A 3K9OA 1HT1E 4F2LA 4F1IA 1WHCA 4R71A 1TP4A 5JI2E 2JY7A 2HWJA 1NV8A 1PGYA 2JZ0A 2QSFX 3T6PA 2F4MB 1Q02A 1GO5A 2DAMA 2LVAA 1WGNA 2ZTDA 4GEWA 1VEGA 3FE3A 3IHPA 5DFLA 2KNVA 2K9DA 3E21A 2OOBA 1TR8A 1XXHE 2LTUA 1WJ7A 1HJPA 1IXSA 2CWBA 3ESWB 1IM2A 2EJSA 1CUKA 1OTRA 2R0IA 2B3TA 3GLGE 1NV9A 1QZEA 3LCVB 1BVSA 3MMPA 4WP2A 1VQ1A 2JY8A 2MR9A 1A5TA 2JZ1A 2QHOB 3B89A 2LVQD 1ZMUA 2LBCA 1IFYA 1P3QQ 2DI0A 1EFUB 1DV0A 2KNZA 1OKSA 4DBGB 1X3ZB 2LVOC 2MJ5B 1UFZA 3E46A 1T43A 1PVEA 4UN2B 2DKLA 2JP7A 2RRUA 1SG9A 2EKFA 4Q7JA 2MGWA 2QSGX 1XB2B 2L2DA 1YLAA 3LCUA 1E94E 2LVNC 2WZJA 2DAKA 3BBZA 1OQYA 2ZTCA 2DAIA 1WIVA 1C7YA 3FRHA 4HEOA 1DO0A 2G3QA 1TTEA 2L4EA 4YIRX 2OOAA 2DNAA 1HQYE 2H5XA 3GLIE 2BWBA 1T6OA 2JY6B 1VEJA 2JY5A 1G4AE 2L4FA 2DHYA 4G3OA 1HT2E 2JUJA 3FRIA 1AIPC 1F4IA 2KNAA 1WR1B 1MN3A 2LVPC 2JNHA 1DO2A 1ZV1A 2DAEA 2DENA 2O25A 1VEKA 3F92A 2F4OB 1G3IA 2QNJA 2DZLA 2HAKA 2OO9A 1R4GA 3K9PA 3H4JA 1KYIA 1ZMVA 3IECA 3GLFE 3GLHE 1ZMWA 1VDLA 1X3WB 1VG5A 2MROB 1JR3E 2QSHX 2K0BX 2BWEA 2DAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHH A;  1V92 A;  1G41 A;  1WGL A;  1Y8G A;  2EKK A;  1OAI A;  2CP8 A;  3K9O A;  1HT1 E;  4F2L A;  4F1I A;  1WHC A;  4R71 A;  1TP4 A;  5JI2 E;  2JY7 A;  2HWJ A;  1NV8 A;  1PGY A;  2JZ0 A;  2QSF X;  3T6P A;  2F4M B;  1Q02 A;  1GO5 A;  2DAM A;  2LVA A;  1WGN A;  2ZTD A;  4GEW A;  1VEG A;  3FE3 A;  3IHP A;  5DFL A;  2KNV A;  2K9D A;  3E21 A;  2OOB A;  1TR8 A;  1XXH E;  2LTU A;  1WJ7 A;  1HJP A;  1IXS A;  2CWB A;  3ESW B;  1IM2 A;  2EJS A;  1CUK A;  1OTR A;  2R0I A;  2B3T A;  3GLG E;  1NV9 A;  1QZE A;  3LCV B;  1BVS A;  3MMP A;  4WP2 A;  1VQ1 A;  2JY8 A;  2MR9 A;  1A5T A;  2JZ1 A;  2QHO B;  3B89 A;  2LVQ D;  1ZMU A;  2LBC A;  1IFY A;  1P3Q Q;  2DI0 A;  1EFU B;  1DV0 A;  2KNZ A;  1OKS A;  4DBG B;  1X3Z B;  2LVO C;  2MJ5 B;  1UFZ A;  3E46 A;  1T43 A;  1PVE A;  4UN2 B;  2DKL A;  2JP7 A;  2RRU A;  1SG9 A;  2EKF A;  4Q7J A;  2MGW A;  2QSG X;  1XB2 B;  2L2D A;  1YLA A;  3LCU A;  1E94 E;  2LVN C;  2WZJ A;  2DAK A;  3BBZ A;  1OQY A;  2ZTC A;  2DAI A;  1WIV A;  1C7Y A;  3FRH A;  4HEO A;  1DO0 A;  2G3Q A;  1TTE A;  2L4E A;  4YIR X;  2OOA A;  2DNA A;  1HQY E;  2H5X A;  3GLI E;  2BWB A;  1T6O A;  2JY6 B;  1VEJ A;  2JY5 A;  1G4A E;  2L4F A;  2DHY A;  4G3O A;  1HT2 E;  2JUJ A;  3FRI A;  1AIP C;  1F4I A;  2KNA A;  1WR1 B;  1MN3 A;  2LVP C;  2JNH A;  1DO2 A;  1ZV1 A;  2DAE A;  2DEN A;  2O25 A;  1VEK A;  3F92 A;  2F4O B;  1G3I A;  2QNJ A;  2DZL A;  2HAK A;  2OO9 A;  1R4G A;  3K9P A;  3H4J A;  1KYI A;  1ZMV A;  3IEC A;  3GLF E;  3GLH E;  1ZMW A;  1VDL A;  1X3W B;  1VG5 A;  2MRO B;  1JR3 E;  2QSH X;  2K0B X;  2BWE A;  2DAG A; 
#chains in the Genus database with same CATH topology
 2A05 A;  2LY2 A;  4AI6 A;  2ELK A;  2IAI A;  3VDP A;  4Y17 A;  1Q3C A;  3M6A A;  3HSR A;  2C96 A;  2DOE A;  2QEX I;  4IJE A;  1SD5 A;  3PQJ A;  4NRW A;  4XK4 A;  3U21 A;  1SVL A;  1KA8 A;  3D8L A;  2XEP A;  1GJS A;  4B7F A;  2Y0Q A;  1R23 A;  2B7E A;  4QHT A;  3PNT A;  5J3L A;  3GLH A;  2FEZ A;  2GXG A;  2M0C A;  1G3W A;  3JSP A;  3HTS B;  3WE3 A;  1YS7 A;  1GHC A;  3L25 A;  2E19 A;  2XPW A;  5CQG A;  2DFH A;  4S12 A;  3BWG A;  3J81 K;  2F5E A;  5BPV A;  2D1V A;  4CJ6 A;  2KIM A;  2HS5 A;  3HUG A;  5IPA A;  1ZK8 A;  2WAQ N;  4LJ7 A;  4JQF A;  1OYI A;  3KIO A;  3L29 A;  1G3Y A;  2M0M A;  3PSI A;  4WX9 A;  3FE3 A;  5DUI A;  3W6K B;  3HXL A;  3JR4 A;  3B02 A;  4XN0 A;  2K27 A;  3BZ6 A;  2VQH A;  3EET A;  1J9I A;  5FTM A;  1UG2 A;  2X0L A;  1QNT A;  5EP3 A;  3HHZ A;  2M4G A;  5ILS A;  2F5Q A;  1YJ9 I;  1IXS A;  2CE7 A;  3GPX A;  1LQ1 A;  1G59 A;  5ITU A;  1Y39 A;  2HHH M;  5H6R A;  3I59 B;  2HNH A;  3FTC A;  4G4Q A;  4GGG A;  1NV9 A;  2JN6 A;  1IGN A;  1DPU A;  3BJ6 A;  2BY3 A;  2KT0 A;  3Q0V A;  2X1E A;  2E1M C;  1V5F A;  3UJN A;  3OYM A;  4HNU A;  4EGZ A;  5J40 A;  2O3F A;  1BI3 A;  1JHF A;  4RB2 C;  1GV2 A;  3CO7 C;  2I8D A;  3QAH A;  2BHY A;  1JI8 A;  2V26 A;  3KP6 A;  4E7S A;  4A0X A;  5ICG A;  3FD9 A;  2M4K A;  3OYK A;  2GZW A;  4C3J J;  5IYD J;  2Z9O A;  2R4G A;  1W7P D;  3SXY A;  2R46 A;  3CJR B;  3ZCB B;  2KIS A;  2XHK A;  4NBQ A;  3CC7 I;  4FQG A;  1D3Y A;  3U6M A;  3F8M A;  3NWT A;  5LRR A;  3DPU A;  1XB2 B;  1R9T J;  2MGQ A;  2ECC A;  2HZT A;  4YFN F;  2H09 A;  2DAO A;  3HGG A;  4JI8 M;  1V5E A;  5K5R A;  2R4J A;  3O3K A;  2WY7 Q;  3CP8 A;  5E1W A;  2COB A;  3RTR A;  2DAK A;  1G6N A;  1V4R A;  2QF7 A;  4MQV A;  2N8G A;  4FCV A;  4MLO A;  2HYG D;  2OPT A;  4HEO A;  4RGU A;  4F92 B;  2L4E A;  1YOV B;  1YIJ I;  1EH6 A;  1AUA A;  2BEO A;  3BJA A;  2DNA A;  1B59 A;  2EFO A;  4PJN A;  3A01 B;  4LJ9 A;  2KRF A;  2VON A;  2ZXH A;  1JTY A;  2W84 A;  1IXC A;  1GVN A;  2Z4R A;  4AZF A;  2DWM A;  1F5T A;  2K9Q A;  3RPU A;  5FLV A;  3KYC B;  3FRI A;  3IL2 A;  2L7F P;  3J80 Z;  2V1N A;  5JFR A;  5DD4 A;  1LUJ B;  1B6A A;  1IRZ A;  1JKO C;  1ZV1 A;  1UG0 A;  3SHG B;  3I55 I;  1A6I A;  3CME I;  4YII A;  2IS2 A;  1FLI A;  1DP7 P;  2OO9 A;  1UM8 A;  3HHG A;  3FDY A;  2XAH A;  4ZC3 A;  2XSZ D;  2WAF A;  1MJG M;  4MGK E;  3GLF E;  2EQR A;  3ZMD A;  1JR3 D;  2A5Y B;  4Y13 A;  2STW A;  4I4L A;  4II2 A;  1NVM A;  2QBY A;  3JR5 A;  3BJO A;  3LSI A;  1BL0 A;  2D7E A;  3LAP A;  4GHL A;  2OQG A;  3CF6 E;  5EZH A;  5H6Q A;  5LRS A;  2XZU A;  1LFB A;  4KIB A;  2VT2 A;  1SXJ D;  3WTZ A;  1REP C;  1FMW A;  1W5C C;  1Y0U A;  3OS0 A;  4F1I A;  2CQN A;  4DYR A;  2H6C A;  1WPK A;  4XSZ F;  4BEH A;  2V1C A;  1MGT A;  2E5N A;  3T6P A;  3HU1 A;  2MD5 A;  3W68 A;  3ML6 A;  1KQ0 A;  4AWX B;  4EIW A;  2QCO A;  2VB6 A;  3SFI A;  5FRO A;  1T56 A;  3FHZ A;  3GF2 A;  1X4P A;  1WJE A;  2FBH A;  4II7 A;  2DA6 A;  1LE8 A;  4HF2 A;  4KA4 A;  1G8P A;  5B1A H;  3S2D J;  1G4D A;  1BA5 A;  2IXS A;  3ABK H;  1N34 M;  2MH2 A;  2WV1 A;  2X1D A;  4PCQ A;  3I58 A;  5EXS A;  3GLL A;  3GTG J;  3QOD A;  3LA7 A;  2M87 A;  5LFA A;  1VQK I;  4B4C A;  3S3N A;  1XXH E;  3CF2 A;  3H0D A;  2VDB B;  1YSY A;  1TC3 C;  2JA5 J;  4KDP A;  2GQF A;  4D81 A;  1BJA A;  1FBU A;  2FSW A;  5KK1 A;  4ETS A;  3LNQ A;  4G6D A;  2WB1 N;  5A2Q S;  3I9V 2;  2M34 A;  1YHQ I;  1Y8Q B;  3UMM A;  2X6W A;  5FGM A;  4S05 A;  3JRI A;  1L8Q A;  3BRO A;  4B3A A;  1E9S A;  4YFK F;  2KFD A;  1EIJ A;  4HLX A;  1A5T A;  2JZ1 A;  1H89 C;  4AKG A;  3BTL A;  3CF5 F;  3HDD A;  1SEU A;  2L6O A;  3NQO A;  5EEG A;  3VK7 A;  4FE4 A;  4BHP A;  2XF5 A;  2XC7 A;  1D5Y A;  1SFX A;  2A5W A;  2CW7 A;  5E1Z B;  1BW5 A;  4RKU F;  3KFW X;  3GQ5 A;  4PT5 A;  1OKS A;  4XR6 A;  3M4O J;  3L2R A;  1Y56 A;  1DU0 A;  3A0B C;  2DZO B;  1BIA A;  1WI9 A;  1T33 A;  4NXN M;  2P5V A;  2X6X A;  2CEA A;  2Z33 A;  1MBG A;  1IY0 A;  3S3O A;  2DKL A;  1ULY A;  4BUP A;  4IBG A;  1OPC A;  3KX2 A;  1H88 C;  3TO6 A;  1YLA A;  3BQZ A;  3K4J A;  4Y7N J;  1LVA A;  4KT0 F;  1FY7 A;  2PN6 A;  2QA4 I;  4FAS D;  2WZJ A;  3TGN A;  3K4M A;  1VQ8 I;  3QPS A;  1DU6 A;  3TQS A;  5LHH A;  5M5X J;  2PJP A;  2H6B A;  4E4H A;  2YFQ A;  2CRG A;  4ZTF A;  2E60 A;  1HQY E;  4HF0 A;  5EQT A;  2QQ9 A;  2R7Q A;  1HDD C;  1Q39 A;  1ZG1 A;  2HDC A;  3TWL A;  4AIK A;  4A12 A;  1WH7 A;  2A61 A;  4UUT A;  2XB5 A;  4Y4R A;  3SEQ A;  4MGZ E;  4D1Q A;  2X51 A;  4CSW A;  3BG9 A;  2DEN A;  3J7A O;  5LD2 C;  1ZGJ A;  4JI0 M;  3FYD A;  2O03 A;  3J81 Z;  2CGP A;  4G7H F;  4W97 A;  4LG2 A;  3U60 A;  3EUH C;  5FKN A;  4H0E A;  4E7I A;  5L3G A;  3DF8 A;  3HKZ A;  5IP7 J;  1FOX A;  4ESJ A;  2X9D A;  1XXH A;  2Z99 A;  3S1R J;  3GTL J;  2LY1 A;  2M45 A;  2VL8 A;  3BZC A;  1GT0 C;  2KKO A;  2HKX A;  3HBL A;  2EK5 A;  1BN5 A;  2PMZ N;  3O2P E;  2KMU A;  4C2U A;  2VOD A;  3QU3 A;  4CYD A;  3OWT A;  3S8P A;  3FUV A;  4FD2 A;  4ZYA A;  1VQ5 I;  4I0B A;  2W1O A;  2NQ8 C;  3UR3 C;  5DDG A;  3K4K A;  4KN7 X;  3BPX A;  3E9S A;  3HGI A;  3FZV A;  5JLW A;  3U6Q A;  4L18 B;  3ECH A;  3QPT A;  3GLF A;  2UXD M;  5CVU A;  4CYC A;  2OC6 A;  1GO5 A;  5HDK A;  1IDY A;  4BGD A;  3V42 A;  5LHI A;  5IT9 S;  1NY5 A;  1XMX A;  4UVA A;  5F1R A;  4G4O A;  1XNR M;  3SMP A;  3W3C A;  2RV8 A;  1XDS A;  5D5V B;  3HOT A;  4A3I J;  3BLY A;  3D8B A;  3LA3 A;  4NXM M;  4UVB A;  1GDT A;  1Z6T A;  2CUE A;  3ONQ A;  1W5T A;  1WXQ A;  1HDP A;  1NO1 A;  1HNW M;  4BQO A;  4CXF A;  1UB9 A;  2JSP A;  5M5Y J;  3GFI A;  3BR1 A;  2KPM A;  3IWZ A;  1ZRC A;  2H1K A;  2R62 A;  2W57 A;  4A0Y A;  3VOE A;  3HJE A;  1TWC J;  4EJU A;  3A2K A;  3Q3S A;  3GLG E;  4A3G J;  1KQ9 A;  1KFV A;  5DV5 A;  2RKO A;  1VTN C;  2VE9 A;  1I1G A;  2QHO B;  2HCB A;  3I54 A;  1IN7 A;  2GOM A;  3HL2 A;  2X4A A;  1FMV A;  3FKJ A;  5GKN A;  5HNF A;  1L2B A;  3CUQ B;  2NOG A;  3QP6 A;  1N33 M;  1ETO A;  4XLF A;  1Z67 A;  3HU3 A;  2UV1 A;  4E7L A;  2LVO C;  1QDR A;  4JI2 M;  4D5C A;  1UFZ A;  3CUO A;  2ZAO A;  2VAS A;  4M3E A;  1G71 A;  2E7X A;  2JP7 A;  4IIW A;  2XV4 S;  2NNY A;  3ILK A;  1FYL A;  4CCM A;  1TLH B;  3A4C A;  4WWC A;  4WXH A;  2E2I J;  2JJ7 A;  5L8R F;  4BXX J;  1P7I A;  3GME A;  4GCV A;  2L7K A;  2FU4 A;  4ZJZ A;  1HQC A;  4OX9 M;  4GDF A;  2JA2 A;  1ZQ3 P;  1T08 B;  4FET A;  1KYW A;  1OCZ H;  3ZQJ A;  4BY1 J;  5FTK A;  2X4H A;  2FD5 A;  2EJR A;  4LF5 M;  4UXN A;  3I71 A;  1K83 J;  4LLL A;  5F08 A;  4M6V A;  1STZ A;  4DR3 M;  1IBK M;  4M6X A;  1B8I B;  4R1H A;  2JY6 B;  2TDX A;  2YQZ A;  4HX8 A;  4BDZ A;  4MQ9 F;  3FXU A;  2A6E F;  2HI3 A;  4XID A;  2I7N A;  4OIP F;  2JA8 J;  2JUJ A;  4PJJ A;  1QVU A;  3G71 I;  2ZSI B;  2DMU A;  1ZG5 A;  1VQL I;  4DIQ A;  2WSF F;  3C58 A;  2IGM A;  3KYD B;  1B9N A;  2LNH C;  1OMI A;  2WSC F;  3A42 A;  1X1D A;  1V54 H;  2XPU A;  3GXO A;  4IRG A;  4QSH A;  2QNJ A;  2HAK A;  4MHG A;  1WZ2 A;  4B7H A;  2V1U A;  2YNM D;  1KYI A;  3AOG A;  2P5K A;  1VDL A;  4DYQ A;  1Z3X A;  1J5Y A;  3B7Z A;  3KET A;  4HRI A;  4HLQ A;  4GKJ M;  1TT0 A;  4OIO F;  1DV0 A;  2HKJ A;  3RZO J;  3K8Z A;  2HQ5 A;  1JUP A;  4BQA A;  2PI0 A;  4B3M M;  1YRN B;  2R7Z J;  2CUJ A;  2R93 J;  1YO5 C;  5IT9 K;  3HB9 A;  4IBJ A;  1OCR H;  3H5R A;  4XSX F;  4IKF A;  3HHY A;  1R49 A;  1FZP B;  3C3E A;  3BCA A;  2JZ0 A;  3DP7 A;  2K47 A;  3KYL A;  2QCU A;  1U6G A;  4EV0 A;  1QBJ A;  1SXJ E;  3SAR A;  1C0W A;  2F4M B;  1FIP A;  5CVR A;  2BW3 A;  2HWV A;  3H5A A;  1IRG A;  5D4R A;  1XG1 A;  3O8H A;  4FWH A;  3M9A A;  2Q2E B;  1ZHF A;  5DTD A;  2K86 A;  2R7V A;  1XDU A;  2OTJ I;  1Z1D A;  4IBF A;  3MWM A;  1NY6 A;  5FFX A;  1T0F C;  3FM5 A;  3OIQ A;  2LTU A;  1W36 D;  1DPR A;  1HJP A;  3NWS A;  1OTR A;  2V4J C;  3H0G J;  2DTZ A;  4LF9 M;  3H9J A;  5BNG A;  1OIS A;  1ZR2 A;  3FUW A;  1BOB A;  3FXK A;  4LZZ A;  2MA3 A;  4LLN A;  4M71 A;  1UHM A;  4ZDL A;  5C4X J;  4JOM A;  1DGW Y;  3MZ8 A;  1PP7 U;  1QYR A;  1LB2 A;  2LH9 A;  1OFC X;  3DPT A;  1F43 A;  5L3E A;  1WJ5 A;  4JXJ A;  4BDY A;  4G7O F;  4AG6 A;  2KL4 A;  4I99 C;  5GTH C;  1EFU B;  2VF7 A;  2F5N A;  2KZV A;  2LC2 A;  3SZG A;  4B1R A;  3LVW A;  4B08 A;  1FNN A;  3S2W A;  1IQP A;  2QQA A;  4ON0 A;  5E3N A;  2ZFU A;  2LYC A;  4RM3 A;  1SG9 A;  3VYT B;  2EKF A;  4XBO A;  3CJT B;  1GV5 A;  3V76 A;  1OCO H;  3K4L A;  4WXD A;  1R5G A;  3TED A;  3FTE A;  1USS A;  2RGH A;  2WA0 A;  2XRL A;  3LMM A;  2CS3 A;  1WIV A;  3OL3 A;  3ZN0 A;  5JR3 A;  1P6R A;  5K7Z A;  2K85 A;  4E7J A;  4WCG A;  1QZM A;  1IW7 F;  2VIX A;  4G6Q A;  3F21 A;  4IZZ A;  5E18 F;  1M1E B;  1XGO A;  2R7U A;  1MH3 A;  2L4F A;  1BJZ A;  4REZ A;  1PYV A;  2KQR A;  3LFU A;  2P6T A;  1GXQ A;  1HW5 A;  2MW8 A;  2G8L A;  3M07 A;  1TQI A;  3N97 A;  4W5W A;  2DTR A;  4O3M A;  4JV5 M;  1IDZ A;  1GVJ A;  1XD7 A;  1DO2 A;  2DAE A;  1U5T C;  7CAT A;  1XC8 A;  1VEK A;  1XB4 A;  5CLS A;  3S1N J;  4E6K G;  4P5O A;  2ZAM A;  4P1W A;  1YUB A;  3GW2 A;  1NHA A;  2AQF A;  1R4G A;  2K5C A;  4AM3 A;  1W5S A;  4AVZ A;  2H27 A;  4ZDP A;  1SMT A;  1SFE A;  5JHU A;  3VKH A;  2JRM A;  1IRX A;  3BR5 A;  4IBB A;  1VG5 A;  1MJ9 A;  2HOE A;  2QSH X;  2R7S A;  3BG3 A;  4CZC A;  2V6E A;  4X1E A;  3BTI A;  3C3D A;  1AOY A;  2AS5 F;  2OV7 A;  1P7J A;  3FK6 A;  2KZU A;  1G41 A;  2ERC A;  1Z5C A;  1J5E M;  3E3V A;  4IO9 F;  1W7P B;  3K9O A;  5ITR A;  5IP6 A;  1QZZ A;  1R36 A;  4JBA A;  3U61 B;  2XB0 X;  1NV8 A;  4QOS A;  3ZXS A;  2M60 A;  3G1L A;  3TDU C;  1J0R A;  1YX5 A;  4PJ0 C;  2GIV A;  1WH5 A;  2L9N A;  4IJF A;  2G5G X;  3RKQ A;  4U7B A;  3DTE A;  1WJC A;  2DOD A;  3WU1 B;  3J7A Y;  1H8A C;  3UNG C;  3KSJ A;  3CP2 A;  3UKG A;  2ZTD A;  2EWN A;  3GFM A;  1NG6 A;  1BBY A;  2KRK A;  3UZU A;  1P4X A;  1SD6 A;  1BM9 A;  4MEY F;  4XNF A;  4I76 A;  3TQN A;  4RDU A;  4LCB A;  4HOB A;  4C3H J;  4LF7 M;  4ENK A;  1I6X A;  5HOO A;  2EA2 A;  3JRB A;  1X1B A;  3MHV C;  3JRF A;  2ZJR F;  1HA8 A;  4LRT A;  3DLA A;  3BOQ A;  1PJJ A;  3E6M A;  5HS8 A;  1FYK A;  2D45 A;  4DQ2 A;  4DYC A;  3P9I A;  4L9N A;  2BZT A;  1ZAE A;  3KPH A;  4HX4 A;  4LF6 M;  4V2F A;  1PUF A;  1WFX A;  5LGU A;  4J19 A;  5C1B A;  4DV1 M;  2WAD A;  4IL6 C;  2CMP A;  1VQ6 I;  1OYW A;  3U6D A;  1SD7 A;  4PDK A;  1J09 A;  1AU7 A;  3HHX A;  1V3F A;  2MAB A;  3ZRG A;  1K3X A;  2Q8K A;  1O57 A;  4BE2 A;  2DI0 A;  3DQV C;  1AA7 A;  2QPA A;  4IBE A;  2Q0O A;  2TRT A;  3I04 M;  2DVW B;  3I3L A;  2ESN A;  1B4A A;  2IVM A;  2CV0 A;  3GCM A;  2VKV A;  1KU7 A;  1IF1 A;  2M7B A;  2W00 A;  2HXO A;  2MYS A;  1Z91 A;  2RRU A;  1W7P A;  4L5E A;  3KOY E;  5FTL A;  4LG0 B;  3E6B A;  2RGV A;  2EV5 A;  3D0S A;  4BU2 A;  4LIV A;  4X6A J;  4XRF A;  4BBA A;  1PJR A;  5CQE A;  3I4P A;  1QDT A;  1XN7 A;  3RYP A;  5F6F A;  4P17 A;  4OIN F;  2L9R A;  3ZMS A;  3O8G A;  3PL8 A;  2VQG A;  5EP4 A;  4YY3 M;  1LTM A;  4Y3O A;  1SAN A;  3QPH A;  2ZJP F;  4A3B J;  4DOZ A;  4I02 A;  5A2Q Z;  2H5X A;  3RYR A;  4A5N A;  5EP2 A;  4NQW A;  5EG0 B;  2GBY A;  4G94 A;  2JRT A;  2E1C A;  3FX3 A;  2MBF A;  3GFL A;  3T8T A;  2OQR A;  1MZB A;  2A6T A;  2FUG 2;  5L3D A;  3BTJ A;  4PFP A;  1V5G A;  5EP1 A;  2XKO A;  4DBR A;  3I4Y A;  1R4N B;  2O25 A;  2F4O B;  2HDW A;  3G73 A;  3FKE A;  3TOB A;  3RPQ A;  2XGE A;  2VQE M;  4QPO A;  5LGN A;  3RSN A;  2JWT A;  3BP8 A;  2O0Y A;  3K4B A;  4BS9 A;  1T3T A;  1ZMV A;  2XGD A;  1D0Z A;  3LSK A;  4M74 A;  4ENJ A;  1WGX A;  2L0K A;  4UUS B;  1GKI A;  1MMD A;  1VQP I;  2FF4 A;  5HLT A;  5DYM A;  4M73 A;  2Y9Y A;  1RR8 C;  1JT0 A;  1JGS A;  4KIS A;  2RRE A;  5CVJ A;  2MH8 A;  4RF0 A;  1PJQ A;  3FXL A;  3IC7 A;  1GJT A;  4BY7 J;  5GPC A;  2D7H A;  2WSE F;  1RRJ A;  4XBF A;  1HC8 A;  2XAU A;  5KQD A;  2LSO A;  2DA1 A;  2KXE A;  4CCK A;  2CP8 A;  3JRH A;  2E5Z A;  1H6U A;  4RNA A;  5BQT A;  2W82 A;  3H3U A;  1HSJ A;  2O5R A;  2LRD A;  2VOO A;  5IOZ A;  1FSE A;  3KVW A;  2K9M A;  3BG7 A;  3GO5 A;  2OUM A;  4II3 A;  3AL0 C;  2PX9 A;  4XK8 F;  5EJC A;  3OY9 A;  5DCM B;  2DW4 A;  2WY8 Q;  6PAX A;  3WG7 H;  4C3I J;  2QLZ A;  1BC7 C;  5FRN A;  2J5O A;  1JJ6 C;  3SC3 A;  2R4E A;  5KPR A;  3KP4 A;  3H1C A;  4ANJ A;  1MND A;  5JHF A;  1I5Z A;  2VBX A;  4JX4 A;  2XF3 A;  4OMZ A;  4L78 A;  4OVZ B;  1R1U A;  3ZMU A;  2JQ7 A;  3MEX A;  1QGP A;  3WGG A;  4CUG A;  2PLY A;  3C2G A;  3WOD F;  2W24 A;  1DGR M;  3DPL C;  1NJF A;  3MAJ A;  3D5S C;  3KS4 A;  3GYH X;  3RQ4 A;  2RN7 A;  4Z8X A;  2NOJ B;  1PRB A;  2JXN A;  1TNT A;  4HSR A;  4PK4 A;  5TIS C;  3MMP A;  3Q9V A;  5E3M A;  4J00 A;  2VPR A;  4DR2 M;  2BJV A;  3ASN H;  2M1B A;  3B89 A;  3FWE A;  4C2T A;  1WWX A;  4FX0 A;  1WHU A;  4G4R A;  5EG0 A;  2W25 A;  4KHP M;  3ZQH A;  4LG3 A;  1CGP A;  1U5T A;  3E97 A;  2ZXI A;  4KFC A;  2IGO A;  1LNW A;  1LPQ A;  2E1O A;  3TMO A;  2I7P A;  1SMY F;  1PVE A;  1GL7 A;  1XSV A;  3OR1 C;  1F36 A;  2YR0 A;  1BI0 A;  4LJ5 A;  1R2Y A;  4QTR A;  3PJR A;  3EUA A;  2MGW A;  5DM6 F;  4DR1 M;  3ZC7 B;  1BW6 A;  5BS6 A;  1ZGW A;  3C2B A;  1RU3 A;  1K78 A;  4WXC A;  4DBQ A;  2GWR A;  5FD6 A;  2J7N A;  1C7Y A;  3MKW B;  4M3B A;  2IW5 A;  1LJ9 A;  4ASN A;  1TTE A;  3WHK A;  2BHZ A;  3KEY A;  2EA4 A;  4N9H A;  3DV8 A;  4XOP A;  2BOL A;  2EZL A;  2XGX A;  4IHV A;  2FOI C;  2COM A;  3H3V K;  4IQJ A;  3L2A A;  4LFB M;  1NTC A;  3RGS A;  1Q1V A;  3GVA A;  3A03 A;  4GH9 A;  4IEJ A;  5J1R A;  4OVZ A;  2CH0 A;  1AIP C;  1TGU A;  1I94 M;  3TO7 A;  3HOS A;  1MMG A;  1Z7L A;  1QO0 D;  2Y0S N;  3BC8 A;  2VPL A;  3F6V A;  1G3I A;  2P0W A;  3WTV C;  1W0U A;  4L9V A;  3KP2 A;  1VFC A;  5KVR A;  5F64 A;  2LLK A;  2VKE A;  4D7M A;  1BI1 A;  2DYS H;  3JTG A;  1ON1 A;  4W1U A;  4M0W A;  2F4V M;  1X3W B;  1YX3 A;  4UB8 C;  3QOP A;  5BMZ A;  4QNM A;  2QYO A;  1R5L A;  3Q8X A;  2WB1 A;  1YW9 A;  3OIO A;  4PSX A;  4UVC A;  2KHH A;  2E2H J;  4CCN A;  1N36 M;  2ZXJ A;  3WTS C;  1Y8G A;  2V1D A;  3SYL A;  4QHS A;  5E17 F;  2IP2 A;  4BBS J;  4KJZ A;  4QWQ A;  2DCE A;  2DYR H;  5ITT A;  3CCS I;  3S15 J;  1DUX C;  2AHM A;  3SJM A;  4ENN A;  8CAT A;  2EB7 A;  3OYG A;  2HEO A;  3HSE A;  3K0L A;  2ID6 A;  4I01 A;  1Q02 A;  4NB5 A;  3ISP A;  3VYR B;  2K40 A;  1TW2 A;  2DWN A;  4CGY B;  4RS8 A;  2LTP A;  2CW0 F;  1IXS B;  1ERD A;  3S93 A;  3KDS E;  2KIQ A;  1VEG A;  2Y2Z A;  3H5N A;  1R2Z A;  4A3K J;  3I4V A;  1XSX A;  2BVL A;  1MU5 A;  2DJI A;  2NS0 A;  1FEX A;  1PJI A;  1YQA A;  2LK2 A;  4D82 A;  3SAS A;  1FP2 A;  3U6O A;  1T39 A;  3ERE D;  2V6Z M;  2P5T A;  1WI3 A;  1WJ7 A;  4DJA A;  1N32 M;  4Y15 A;  4MGH A;  3CQZ J;  2D5V A;  4OAY A;  2EZI A;  2XSD C;  2R0I A;  4IBD A;  2KIF A;  3F8N A;  3W6V A;  2DJN A;  4UHT A;  1QZE A;  4GRI A;  1VQM I;  1FWZ A;  5DCF A;  4RBO A;  2F5F A;  2UWM A;  4MIM A;  3Q0U A;  3RCO A;  3TKY A;  4BLC A;  4ESF A;  1VF9 A;  2H94 A;  3DZD A;  2J5P A;  3AG1 H;  4M6Y A;  3WHB A;  2PQ8 A;  3JRG A;  1QZY A;  2VQL A;  3NAR A;  3HKZ N;  1IV6 A;  4LLG F;  2PBI A;  2JTV A;  2FBI A;  1Y6I A;  1VDD A;  2CRU A;  3GLF B;  2VXD A;  2KNZ A;  2ICW G;  3OR2 C;  2LY9 A;  2AHQ A;  2XH9 A;  4MGI E;  2B0L A;  2LKP A;  1L0O C;  4PDG A;  2QM3 A;  5F0C A;  3GTK J;  3CJQ B;  3WGI A;  4LJ6 A;  1S7E A;  3HPH A;  3K6G A;  3OYB A;  3IRR A;  3DBH B;  2NVX J;  3K10 A;  3RZD J;  5F04 A;  5IYC J;  3DEE A;  3R6S A;  3TDZ C;  5HDG A;  4CDG A;  5DM7 F;  2I5U A;  1KYZ A;  5J47 A;  2HDD A;  1L2C A;  4CH7 A;  3J7A S;  4BL0 B;  3HOV J;  1E0E A;  3ABM H;  2L09 A;  2IA1 A;  4BXU A;  1FIA A;  3DTI A;  4XKV A;  5EEH A;  4DV5 M;  1QUT A;  3HWS A;  4I98 B;  3FUT A;  3SZT A;  3CLQ A;  4ZPX A;  2VI6 A;  5JI6 A;  4P55 A;  4MTD A;  3H92 A;  3BZK A;  3LAJ A;  1FX7 A;  4KIT B;  1QRY A;  4AID A;  1OIZ A;  4RLF A;  4DV6 M;  2RC4 A;  4I6Z A;  2WBM A;  4YEL A;  5FKL A;  4HV6 A;  2DPD A;  2M8G X;  3DU5 A;  2R0Q C;  3WHL A;  4LB6 B;  2XAF A;  4FWG A;  4LGW A;  2IJL A;  3CTA A;  2DMP A;  4F7Z A;  2DMT A;  4M9Z A;  3HYI A;  3NEU A;  2DT5 A;  1OFI A;  3HJS A;  1AHD P;  3M1E A;  2DA5 A;  5ICC A;  3EYY A;  3S16 J;  3ERM A;  2KEB A;  3WU0 A;  3HEF A;  1LEA A;  1BR4 A;  1R1V A;  2HPI A;  2E36 A;  1XWI A;  3RIR A;  1HLV A;  4A93 J;  3IG5 A;  1R58 A;  4LB5 A;  4UB6 C;  4DGW B;  4FW9 A;  3SMS A;  2B63 J;  2MRO B;  1Z05 A;  2V6C A;  3K70 D;  4BE1 A;  3CCR I;  4AW4 A;  1KU3 A;  2M9H A;  3H3Z A;  4NL4 H;  2NXN B;  2EIN H;  2RVC A;  3PFY A;  1K78 B;  2DLL A;  2MC4 A;  1NNU C;  1LFP A;  1TDZ A;  1IN6 A;  2BW3 B;  1GUU A;  4YRV A;  3ZQL A;  1K7A A;  1OLT A;  3Q0W A;  4A5M A;  4YFX F;  2XAJ A;  1LV7 A;  2BXZ A;  1RNL A;  3R4K A;  4HL4 A;  4A3V B;  2R92 J;  4PGG A;  2STT A;  3K2A A;  2DFI A;  2P7V B;  1MKM A;  4HST A;  4LK0 F;  3NWL A;  2XPV A;  3SDB A;  1XPX A;  5KQ8 A;  3GLG B;  3OYC A;  1MW7 A;  5HS7 A;  1HW2 A;  2P7C B;  3HU2 A;  2LVA A;  3HC7 A;  1SXJ A;  1PJS A;  1Z59 A;  2HTS A;  2M5W A;  1X4O A;  3SFZ A;  1JQJ C;  2CUZ A;  2MD0 A;  2X6Y A;  4MO7 A;  3RJP A;  3E21 A;  4XLP F;  4G6T B;  1IN8 A;  4O6J A;  2F5S A;  1Q1H A;  3VSL A;  1LDD A;  1U78 A;  3M8F A;  2F2E A;  2LG4 A;  2FML A;  2IS1 A;  2XSZ A;  5C44 J;  1HKT A;  2VE8 A;  1SFK A;  2PEX A;  2RKH A;  3F8C A;  1BIB A;  3U9G A;  5J6X A;  2UXX A;  2Y0S A;  4CCL A;  2CHG A;  4L0Z B;  3VOD A;  1XMK A;  1GAB A;  3PSF A;  4WP2 A;  2EFW A;  2HVS A;  3LFK A;  4DUZ M;  1QPM A;  2DK8 A;  3A45 A;  3KZI C;  3R8F A;  3TOA A;  1EA3 A;  4CHU A;  3FMR A;  1IFY A;  5IOY A;  5L3B A;  5FLM J;  1LE8 B;  2FH0 A;  4BYY A;  2QZ4 A;  2UUA M;  1I27 A;  4M3D A;  1T8I A;  2Y48 A;  1APL C;  2L7M P;  1EJ9 A;  2XFS A;  1O7L A;  4B44 A;  1U0J A;  2K4J A;  1IXZ A;  1WKM A;  3AL0 B;  4B3S M;  2OCE A;  2ZBK A;  1MBF A;  3KZY A;  3SAU A;  3V7R A;  3IG8 A;  3L2W A;  5FLX S;  1DDN A;  3HRM A;  3CMA I;  1X3U A;  5HLH A;  1FP1 D;  2GLO A;  4BJT A;  1ON2 A;  1EKE A;  2PMZ A;  5J4Y A;  2JPC A;  3IKV A;  1X58 A;  3JRA A;  3N4M A;  5CKT A;  2FE3 A;  1A31 A;  1ZN2 A;  3CO6 C;  5GPA A;  5F3W A;  4RLQ A;  1X1A A;  1NK2 P;  1K79 A;  2LOO A;  1S72 I;  3HJQ A;  2QZ8 A;  4LFC M;  1XC5 A;  2HZD A;  2VF8 A;  1HF0 A;  1RC9 A;  3EUH A;  3ZQ7 A;  2ZC2 A;  4KIF A;  3Q5F A;  2O9L A;  1MH4 A;  2LVP C;  2JNH A;  4I0A A;  4L4U A;  4BHB A;  4EM2 A;  3HOX J;  4HF1 A;  4A3L J;  2Q2E A;  3K2L A;  3MQ0 A;  2F5O A;  2UXB M;  3E7L A;  3DOA A;  4NC6 A;  1I1S A;  2Y30 A;  1O4X A;  1MNM C;  4Z2Y A;  3H4J A;  1MBK A;  5ICF A;  2YR2 A;  3DBR B;  3GRU A;  3DLL F;  3RQI A;  2BY2 A;  2NVT J;  1E32 A;  3DEW A;  2ISY A;  5DYG A;  2ETH A;  4XRS A;  3DKY A;  1NK3 P;  1FT9 A;  4IPA A;  2LH0 A;  3TW7 A;  3KLO A;  4HNT A;  1Q3B A;  2O8K A;  5DS9 A;  4F93 B;  2L02 A;  3S1M J;  5EZG A;  1QU3 A;  2EKK A;  1MMA A;  5KNL A;  3ABT A;  4NNJ A;  2LKX A;  4K2E A;  1TWH J;  3K4N A;  4L0Y B;  4LG0 A;  1NJG A;  2HWJ A;  1PGY A;  2A6H F;  4Y52 J;  5E3L A;  3RGP A;  2QSF X;  4ZYD A;  1I6H J;  2H8W A;  1FTT A;  1D1B A;  3X2Q H;  4ZZD A;  1BR2 A;  5K7F A;  2WWY A;  5GAD J;  2E1M B;  3BOS A;  3LST A;  3OYF A;  2F4I A;  2M30 A;  3EDP A;  5F0H A;  1LKX A;  3KE2 A;  4XIC A;  3J7Z I;  4RGX A;  1TL8 A;  5E6J A;  4ANR A;  3ROU A;  4BQN A;  1FTZ A;  3J81 S;  3JRC A;  2K02 A;  1WSU A;  2H1R A;  2HTJ A;  4B09 A;  2EFN A;  4B7G A;  1K4S A;  4FT8 A;  4DZP A;  4CO8 A;  2DK5 A;  2WV0 A;  3AG4 H;  3FHN A;  4ZZL A;  1PUF B;  4BAY A;  2JA7 J;  3L09 A;  2N35 A;  4FIS A;  2HOT A;  2CWB A;  3U60 B;  1XMO M;  4IHX A;  1IY1 A;  4RMN A;  3FUX A;  4CA0 A;  3WTX C;  4HG2 A;  4FWD A;  2L7H A;  2CWE A;  3MVP A;  1RKT A;  1ORY B;  1Y0N A;  5ERI A;  3OYL A;  3M3Y J;  2LNB A;  3P7N A;  3SAV A;  1RKW A;  2RDP A;  4N4O B;  5J4V A;  2HQA A;  3OSG A;  5AIP A;  2NS7 A;  1RI7 A;  1XNQ M;  3SZP A;  3FXM A;  4D9J A;  3LSP A;  2DPU A;  1P3Q Q;  2ESH A;  3I51 A;  4NSO B;  2EIM H;  2VBY A;  2X48 A;  4GMQ A;  4BHC A;  2L7I A;  3HUG B;  2XIG A;  3ZQC A;  1UAA A;  5CJ9 A;  1W36 C;  4I81 A;  2DDB A;  5C3E J;  5D6F A;  4AYB A;  1MDM A;  3MJ5 A;  2LR8 A;  3QYB A;  3SHF A;  4A69 C;  3OYD A;  5FB2 A;  4KN4 X;  1PJT A;  3PQK A;  4ABZ A;  1ETK A;  1TH4 A;  2E34 A;  2V79 A;  3ZCO A;  2BGC A;  4Q7J A;  1TW3 A;  4HDU A;  4DV7 M;  1OR7 A;  3K1P A;  3CUQ A;  1O3T A;  4KIC A;  4XGI A;  3KP3 A;  3WHC A;  4E7Z A;  3BY6 A;  5D5X B;  3W2A A;  1IY2 A;  3TE6 A;  3KS8 A;  3BBZ A;  1Z7U A;  1OQY A;  2ZTC A;  1F4K A;  4IHS A;  4XLH A;  2CQK A;  1SFO J;  4A3J J;  4LF8 M;  2FRH A;  2C9O A;  4U0Y A;  5ITX E;  2ZAN A;  4V2G A;  2A3S A;  4A0Z A;  3Q8G A;  2OU2 A;  3PUB A;  2VOP A;  3GPU A;  3HOU J;  5E26 A;  3KOX E;  2BYV E;  2HVQ A;  1HT2 E;  2RNG A;  1ZG3 A;  5TGT A;  1MX0 A;  4FCW A;  4IBC A;  1XHB A;  3U6E A;  2BV6 A;  2HOA A;  4LJ8 A;  1OCC H;  1RET A;  2Z1D A;  2K9L A;  3JAM K;  3VSK A;  3EUK L;  1Z5B A;  1DGB A;  4Z6Y A;  2C6Y A;  1QAN A;  2D7G A;  2R45 A;  3Q9S A;  2DZL A;  1MNE A;  3AKZ A;  1L2D A;  4IXA A;  4L9T A;  2OQ4 A;  2R3S A;  3GBG A;  4EQQ A;  2ZCW A;  2Y21 A;  5FKM A;  1VQO I;  2CU7 A;  3GLH E;  3B6C A;  3JR9 A;  3E6C C;  2M2E A;  1YFH A;  1E17 A;  2OCC H;  3DXJ F;  2JUC A;  3AG2 H;  3LSR A;  4C30 A;  3E4R A;  3GP1 A;  1S9H A;  5IYB J;  3KP5 A;  5LLQ A;  3U6P A;  2MLG A;  1UST A;  1OYY A;  3BG6 A;  3ULQ B;  3A46 A;  1SFU A;  2JPB A;  3U2R A;  2C99 A;  2CUF A;  3BTC A;  3OYH A;  1Y8R B;  3ZP5 A;  3F9K A;  2IBD A;  3LSJ A;  2Z4S A;  3DWL E;  5E3O A;  5IT9 Z;  2VQF M;  5BPI A;  3GLI B;  1T98 A;  2EBI A;  1W1W E;  2WAQ A;  1YLF A;  3KEQ A;  4GYG A;  3BG5 A;  2JUG A;  2Y31 A;  1P2F A;  4BEH B;  1K3W A;  4JI4 M;  3THG A;  3PFI A;  1OJL A;  4EM0 B;  3AOE C;  4EJO A;  3I4M J;  1EE8 A;  4U88 A;  4N4N B;  1OKR A;  4HDV A;  1TQM A;  2ZFW A;  3R61 A;  5EF6 A;  3CCJ I;  2YU3 A;  1OFH A;  4MM3 B;  4P96 A;  2HYJ A;  3AJI B;  2YX4 A;  5ICE A;  5LGT A;  2R65 A;  2CV1 A;  3JAM Z;  1YIO A;  3TPZ A;  3BCB A;  4CIC A;  2XGC A;  3P5J A;  1TR8 A;  1KGS A;  3LVV A;  1MMN A;  3GTP J;  3OOU A;  4GFB A;  3HTU A;  4P9U A;  2OBP A;  1Z9C A;  4PJM A;  3PNY A;  3V8K A;  3PO2 J;  4LOC A;  1G3T A;  3HHH A;  2CFO A;  4AVP A;  4IRH A;  3HSF A;  3J7B A;  1G3S A;  1WVR A;  1FSH A;  1IV8 A;  3IHU A;  1ONV A;  2JY8 A;  1A04 A;  5D8K B;  4WUR A;  4CZZ A;  2FQ4 A;  4XQF A;  1HW1 A;  3C3W A;  5C4J J;  3P9K A;  3GUD A;  2OF7 A;  4G6Z A;  1R7J A;  4DNC A;  3SBJ A;  2K3P A;  3JTH A;  1T38 A;  4OMY A;  3G1O A;  1JXS A;  2VJ4 A;  3FBN B;  5FLX Z;  3A01 A;  4G9Y A;  2FMY A;  3FK7 A;  3GLX A;  1RIO H;  3FXR A;  5B66 C;  3JRD A;  5FFZ A;  3H35 A;  2PJR A;  4A3C J;  2G9W A;  2MJ5 B;  5IP9 J;  2G7U A;  2A68 F;  5D4S A;  4HQE A;  4UN2 B;  3DKX A;  2M8E A;  5HVQ C;  3HX3 A;  1IXR C;  4JI5 M;  2XAQ A;  2YU9 J;  2DFF A;  3CCY A;  2XDV A;  2ME0 A;  2YSR A;  1YRN A;  4V19 K;  3WE2 A;  4HV5 A;  1G2H A;  1J59 A;  1X37 A;  3N05 A;  4GKK M;  1Z5A A;  3VFD A;  4OIQ F;  2G3Q A;  2ZBK B;  3KOW E;  4PGH A;  2X1C A;  1IG7 A;  1NHW C;  4IHW A;  2LKS A;  2EIL H;  4IF4 A;  1MJA A;  3O6B B;  1FPQ A;  5M3F J;  2DHR A;  2FQ3 A;  2KW0 A;  4RF1 A;  3KZZ A;  2LXE A;  1WR1 B;  1UZC A;  4M72 A;  1I4W A;  1ENH A;  5H20 A;  1Z6R A;  4DR6 M;  2WAE A;  5IT3 A;  2CW8 A;  4N9I A;  2E35 A;  2R18 A;  1JKP C;  2G7H A;  1R5I D;  1R6B X;  4YEJ A;  3RKX A;  4E7K A;  3FUU A;  3K69 A;  5EGO A;  1OIP A;  3BR0 A;  4JX6 A;  4YIF A;  2VLA A;  1ZRE A;  2ZME C;  3FIW A;  2D2W A;  3FXJ A;  3T38 A;  3HRU A;  4Q47 A;  4YG2 F;  1JR3 E;  1ETQ A;  2M7A A;  1D0Y A;  1S29 A;  1ZRF A;  1YI2 I;  3REO A;  1RUN A;  3S32 A;  2JMW A;  3WTT C;  1QQW A;  1YYV A;  1TBX A;  4I7H A;  4KMF A;  2H1L A;  4LGM A;  1HT1 E;  2P6S A;  3TWM A;  3K1M A;  4NQW B;  5EEA A;  3GFJ A;  1HNZ M;  5EGO B;  2X8A A;  1HNX M;  2QBY B;  3ZH9 B;  4RGS A;  1K6O A;  3GLG A;  1VQ9 I;  1GVD A;  1HKS A;  4DV0 M;  2IA2 A;  3RDI A;  5L3C A;  1HR0 M;  4MTE A;  4JI7 M;  1H9T A;  3MCZ A;  2IGK A;  4FVM A;  4F91 B;  1UJ8 A;  3M1C A;  3GTQ J;  4QLC U;  3DFG A;  3AG3 H;  1ZR4 A;  1QAO A;  2AXT C;  1E3O C;  5DNY A;  5FKK A;  4DR7 M;  1MSE C;  2BXY A;  3CC4 I;  4OU7 A;  2P4W A;  1XTA A;  3CCQ I;  4XN3 A;  1E3H A;  3SYK A;  5D5W B;  4XLC A;  1IM2 A;  4PFO A;  1ODD A;  3FM3 A;  1S5L C;  3BPV A;  1EV7 A;  3NBI A;  4JP0 A;  4A3E J;  2EZK A;  4BKX A;  3FTF A;  2Z2S B;  4EJT A;  2FS1 A;  1IO2 A;  4JK1 X;  1BVS A;  3OYJ A;  4A3D J;  3OSF A;  2F5D A;  4ITV A;  2OA4 A;  1A36 A;  3RKY A;  4J01 A;  2O7O A;  1UHW A;  4A3F J;  5HNH A;  2CHQ A;  3TP3 A;  1NNJ A;  1QUS A;  1T2K A;  1I50 J;  3U1K A;  3GQ4 A;  4RAY A;  1R1T A;  3LW5 F;  5JLX A;  3HJ8 A;  2K6B A;  5FSW A;  4AIJ A;  2QQB A;  3HIF A;  4CYC B;  1U2W A;  1WCM J;  3I4N J;  2P81 A;  3KCC A;  3MZH A;  3E5Q A;  3E46 A;  3CMM A;  3KW6 A;  5ITX A;  1N78 A;  2ISZ A;  2K7L A;  3VPR A;  2OPF A;  2GXA A;  1K61 A;  4MH0 E;  2PFB A;  3OYN A;  2OJE D;  3L9F A;  1D5V A;  2EV0 A;  3HRS A;  4WW0 A;  4HYE A;  1VND A;  2DO7 A;  3GEZ A;  1B9M A;  2IRF G;  1Z3Y A;  1ACI A;  3LSM A;  4E7H A;  3HZJ A;  1XGM A;  4IHY A;  3GTO J;  2DA2 A;  1VI0 A;  1SVO A;  4X64 M;  2GM4 A;  2OOA A;  3B9P A;  3OS2 A;  2ZJ2 A;  3I01 M;  2LF8 A;  3GLI E;  1O7F A;  3F8F A;  1ETY A;  3BT9 A;  3I59 A;  2A69 F;  3TBI A;  1B72 B;  1VQ7 I;  2XFT A;  5E8I A;  1G4A E;  1CF7 A;  4YHH M;  4AD9 A;  4L16 A;  4I8O A;  2VBZ A;  4XL9 A;  4MNU A;  3C7J A;  5EXT A;  3L2V A;  3T8R A;  1Z77 A;  4WK8 F;  2KNA A;  1JUM A;  2DMN A;  3COA C;  1MN3 A;  3KP1 E;  1RR7 A;  4MGR A;  2Y75 A;  3CLO A;  1R6R A;  2LF7 A;  2GOX B;  2VKD A;  1P4W A;  4C2M J;  1FBS A;  4Q4Z F;  3MK6 A;  1GL6 A;  4Q5S F;  3C2H A;  4HA8 A;  3K9P A;  3W6J B;  2Y20 A;  2J5Y A;  5DD8 A;  4CHT B;  1ZMW A;  1E9R A;  1QHH D;  5KPT A;  2JVH A;  3GZN B;  3ZR8 X;  1NHG C;  2VJI A;  5K1Y A;  5F0F A;  5LEJ A;  4DR5 M;  1ZKG A;  3MN2 A;  4B47 A;  2DAG A;  1TDH A;  1JKQ C;  2XZF A;  2QP9 X;  3DKW A;  2XVC A;  4B3X A;  3IAM 2;  1T0F A;  4KMU X;  3PIP F;  4K0K M;  4LF4 M;  3TWK A;  4KIG A;  3KXE C;  3E5X A;  2EH3 A;  4S04 A;  4LY6 A;  3U6S A;  3CTW B;  5LBQ A;  1TP4 A;  2L5Q A;  2XRN A;  3B73 A;  2M5Z A;  3QWL A;  4LIU A;  1POG A;  1RZ4 A;  2VUM J;  3CDL A;  1U3E M;  3AV0 A;  1ZYR F;  3ZGK A;  2R5Y A;  2PMU A;  2NNN A;  1X19 A;  1UEL B;  2VBW A;  2V9P A;  2DAM A;  3ZQI A;  2LHG A;  2E71 A;  4IX7 A;  1C1K A;  1O3Q A;  2DFE A;  3T1B A;  4ZYH A;  5HS9 A;  3ECO A;  2DZN B;  2ZME A;  1H9G A;  2KNV A;  4EMS A;  2R7W A;  1S6L A;  4L5J A;  3PVS A;  1TTY A;  2QKL B;  4QIW N;  1JGG A;  2E7W A;  3JSO A;  2EJS A;  1ZGA A;  1N77 A;  4RM2 A;  2MG4 A;  1I3A A;  3C1D A;  4GO1 A;  5D8L B;  3R9X B;  3WG9 A;  3IH3 A;  1J2X A;  2YUS A;  3QU6 A;  5EYR A;  3GPP A;  1D2N A;  1GLN A;  5E79 C;  4EEF G;  4KUM A;  4LJA A;  2CV2 A;  3DA1 A;  3GZ5 A;  2VC0 A;  4U0W A;  1X1C A;  2XLJ A;  2HU9 A;  3SAW A;  2L7Z A;  3GX4 X;  2L9S A;  2GAU A;  2Z8Y M;  2Y0M A;  4RAF A;  4BH9 A;  4F55 A;  1IUY A;  2R5Z B;  1MIJ A;  3KP0 E;  4LMY A;  2DI3 A;  2E5L M;  2OZ6 A;  4AIH A;  2R7D A;  2FOK A;  5ITY A;  4XON A;  3W0L B;  3GQ3 A;  1T6S A;  2L01 A;  3WTU C;  4GIT A;  2JZY A;  1L3L A;  1ORK A;  2C9C A;  1X2N A;  2LWX A;  3QP5 A;  4GXO A;  5E8G A;  3L28 A;  1X1P A;  1N75 A;  3B6A A;  1YJN I;  3SQN A;  2ZO4 A;  2FNA A;  2Y0T A;  4KT5 C;  3L00 A;  2LVN C;  5D6E A;  5FO5 A;  3FKI J;  3UGJ A;  3C9P A;  3BXW A;  2FNP A;  4LJ4 A;  2WTE A;  3S14 J;  2LBF B;  2W4S A;  2DAI A;  2L54 A;  4GYI A;  2EIK H;  3CJN A;  2BVM A;  4PUS A;  1WJB A;  4AC0 A;  3MFK A;  3QOE A;  3FRH A;  1FYM A;  3B74 A;  4NSR A;  3R0J A;  2JK3 A;  3SEZ A;  2LD5 A;  2BBY A;  3EQL F;  2E1N A;  2UXN A;  3FMQ A;  4LD5 A;  3U1D A;  2UZK A;  4NUB A;  5E1X A;  4BE0 A;  1JE8 A;  4KNY A;  1B72 A;  3AAF A;  1ETX A;  3K70 C;  2JY5 A;  4B8X A;  1PM5 A;  2F5V A;  3GO8 A;  3VFZ A;  4G3O A;  1YIT I;  1JTX A;  3CCU I;  2IS6 A;  2Q1Z B;  2GA1 A;  2DQL A;  3IUO A;  4AUX A;  5FTJ A;  1OCT C;  1D0L A;  5F1J A;  4HBL A;  1YE9 A;  2XSJ C;  3QAU A;  3BR3 A;  1ZTR A;  1EH8 A;  2JVG A;  3CZ6 A;  4UY8 I;  5KAI C;  3CCV I;  3TW6 A;  2CHV A;  3IEC A;  5EXX A;  1EH7 A;  1VZ0 A;  4BB9 A;  2YX7 A;  4OAZ A;  3JW4 A;  3GTJ J;  5GTI C;  4M0D A;  4I5S A;  2BE5 F;  1I39 A;  1U8R A;  2ZNY A;  3WGH A;  2BY0 A;  2BWE A;  3P9C A;  4WF2 A;  2V9K A;  1W4M A;  2CJJ A;  1ZLK A;  1V33 A;  2EV6 A;  2FA5 A;  1HXD A;  4HLY A;  1V92 A;  3A0H C;  2IS4 A;  2Z7J A;  3OYI A;  4DR4 M;  4DUY M;  4OWR B;  5JVG F;  2W85 A;  3LOC A;  2X6O A;  4F2L A;  4R71 A;  2APL A;  3ZQQ A;  2JY7 A;  3K2Z A;  1B8I A;  1FJL A;  4M9X A;  4CGZ A;  3BDD A;  5LMU M;  5HDN A;  3MKY B;  2IA0 A;  2K9S A;  4GC9 A;  3H9G A;  4BJ6 C;  2LRE A;  1IBL M;  2LVS A;  2F5P A;  2KZS A;  4XOR A;  4HEA 2;  4MEX F;  4P16 A;  3I0T A;  1MJB A;  3KP7 A;  3BQY A;  3TO9 A;  2FXA A;  1V34 A;  3I5U A;  2LMD A;  4IBI A;  3A1Y A;  3J80 S;  3OOP A;  1XCV A;  4NDL A;  1XMQ M;  1JHH A;  4BJ5 C;  1IRF A;  3KFU G;  1NSF A;  2ACJ A;  4IBK A;  5CYV A;  4UUS A;  5KPZ A;  1FBQ A;  3LA2 A;  1Y1W J;  3R0A A;  3NAU A;  1DQU A;  2E2J J;  4JN6 A;  3ZQF A;  4X65 M;  5J8C A;  1YTY A;  4TV7 A;  3A02 A;  4PZJ A;  4CCO A;  4MB7 A;  3L2U A;  4LGY A;  1V55 H;  2DQR A;  2LVQ D;  1A5J A;  1LFU P;  3L1P A;  2LBC A;  3GTM J;  5J1U A;  3L2Q A;  4H4K C;  1DGF A;  1XCB A;  3HHW A;  2QWW A;  4U87 A;  4DBG B;  3EIH A;  1NH3 A;  1IZ1 A;  4D80 A;  1X3Z B;  1D0K A;  2VJJ A;  5IWA M;  1MBJ A;  3PO3 J;  1UHS A;  2HVR A;  3V8J A;  3ASO H;  3U6C A;  3QQA A;  1XS9 A;  3M8E A;  1JJ8 C;  3GLH B;  3G4S I;  1QHG A;  2HR3 A;  5IY5 H;  2UUB M;  3VK8 A;  1YW7 A;  1SD4 A;  3ZOB A;  1YG2 A;  2MH9 A;  1F9N A;  3I56 I;  3S17 J;  3G3Z A;  3NRV A;  3T1H M;  4TUW A;  4MFD A;  5BR8 M;  3W2W A;  5ILV A;  2NVY J;  2R7R A;  4M3G A;  3OS1 A;  2BJW A;  2QQ8 A;  5TRD A;  4B3T M;  3MMY B;  4NOO B;  4YIR X;  3S3M A;  4PSW A;  1MD0 A;  4FCT A;  3K1J A;  2NAZ A;  4LK1 F;  3B7Q A;  2O01 F;  3OIP A;  1N25 A;  1XSD A;  2DT6 A;  2HFH A;  1OAO C;  2V7F A;  4CCJ A;  3I64 A;  4OU0 A;  1JT6 A;  1U8B A;  2R44 A;  1DGH A;  4AKH A;  1IUF A;  2PMH A;  3AOE A;  1TNS A;  3K1N A;  3D5L A;  4PD2 A;  3G2B A;  4B43 A;  5KAF C;  3J2P B;  3OTO M;  2O61 A;  4XLN F;  3B7N A;  1ZAR A;  5JVT A;  5BOX A;  2L2O A;  3FF5 A;  3HOZ J;  3HM5 A;  3QPL A;  4DZJ A;  4MFE A;  2OD5 A;  3RE8 A;  3CCL I;  2GNO A;  4PCZ A;  3VKG A;  2Y9Z A;  3M8J A;  2KDZ A;  4IJA A;  3EYI A;  4CIZ A;  1IN4 A;  1IAW A;  2J7O A;  4GIP A;  4X0G A;  3PNV A;  2K0B X;  2KJB A;  3WU2 C;  4BXF A;  3A98 B;  2RNJ A;  3OYA A;  2CQ7 A;  2G0E A;  4M3F A;  3HOY J;  1S7O A;  1K82 A;  4G4N A;  3T0Y A;  1OAI A;  3VYS B;  2ID3 A;  4UUV A;  2R7T A;  2DN0 A;  4RAZ A;  1I3Q J;  3OV8 A;  2NYX A;  2UUZ A;  1SXJ C;  4F3Q A;  1JB0 F;  4U7D A;  1PUE E;  4JI3 M;  1ZAO A;  4XMY A;  2Z16 A;  4E70 A;  5HOD A;  3T1Y M;  5FJ8 J;  1UCR A;  2KRH A;  1R4M B;  1IJW C;  1L1T A;  4OOI A;  3ZMT A;  1P92 A;  2VC1 A;  2HGC A;  4HPQ A;  5FKO A;  2D1H A;  3LQQ A;  3DCF A;  1S3S A;  5FTN A;  2PG4 A;  4GEW A;  1J75 A;  3CDI A;  3PUF A;  5CVI A;  3T5X A;  3SAT A;  1J7K A;  2VT3 A;  5DFL A;  1ZEL A;  3V8L A;  1QAQ A;  2K9D A;  2XF6 A;  4NRV A;  4G12 A;  4HQM A;  5A2Q K;  1AKH B;  1EF4 A;  1PP8 F;  3SDG A;  1IC8 A;  4DV2 M;  2ELJ A;  3ESW B;  1L1Z A;  2MC3 A;  5F27 A;  3ZQG A;  4LZJ A;  4EJW A;  2EFP A;  5TJJ A;  5IZ7 D;  2B3T A;  5D5U B;  4PJL A;  5HLI A;  3RKW A;  2KHM A;  2DA7 A;  4EVI A;  2F6C A;  2DOF A;  4UNO A;  1VQ1 A;  4NC8 A;  4FX4 A;  2ELH A;  3GWZ A;  4XLA A;  1AWC A;  3NBX X;  4UV9 A;  1WRJ A;  1ZMU A;  3VLF B;  4RA2 A;  3K9T A;  1U9O A;  5GAG J;  3VDX A;  3ZMV A;  1O3S A;  3QYF A;  3V7C A;  2QVO A;  2KDO A;  2R5Y B;  4A6D A;  5KO3 A;  2DOA A;  3U5Z A;  1O3R A;  4A2U A;  1T43 A;  4M9S A;  1DP3 A;  3HRT A;  1LDJ A;  4D0P A;  3GZ6 A;  2KJC A;  2CQX A;  3JRE A;  4IOA F;  3S2H J;  4HW0 A;  4PDI A;  5J1Y A;  2F48 A;  4LRS A;  2I10 A;  2GXB A;  1Z0X A;  2A07 F;  1RUO A;  4IQ4 A;  2XAG A;  2VKH A;  2BY1 A;  1S8N A;  4L5I A;  2IPQ X;  3D1N I;  4KT6 A;  4JX5 A;  5H37 D;  1ITY A;  3ZN1 A;  4XRS G;  3GRR A;  5LMN M;  2DT7 B;  1K6Y A;  2AO9 A;  1TH3 A;  2ZJQ F;  2X85 A;  3MKL A;  4LJZ F;  4OW0 A;  4KYW A;  2BWB A;  2KRU A;  4LFA M;  2KDL A;  2TCT A;  3V7S A;  3CCM I;  1MMS A;  2MLK A;  2P5L C;  3E0J B;  3L26 A;  3VDU A;  2DXI A;  1KON A;  1TWA J;  2ZNZ A;  1F1Z A;  4QOZ C;  3K7A J;  2YS9 A;  2M3A A;  3IWF A;  3F92 A;  1P9Q C;  5KCM A;  4HX7 A;  2NVU B;  1IN5 A;  2W7N A;  4B48 A;  1CF7 B;  2LHC A;  2KZG A;  4XLE A;  5EXP A;  3L27 A;  1XGS A;  4XOT A;  4CIS A;  4EGY A;  3VYU B;  2ME6 A;  2FBK A;  3KLN A;  1R7R A;  2KRC A;  2Z5U A;  4FHT A;  4BBR J;  1MDM B;  4I09 A;  1D1C A;  1KSF X;  3E6D A;  5DEQ A;  4AG5 A;  3FBI B;  2OZU A;  1ETW A;  3ELK A;  4HNV A;  3IRQ A;  4X66 M;  3J27 B;  5CPR B;  2WC2 A;  3FXQ A;  2VXZ A;  2JT1 A;  1XX5 A;  2EUC A;  2CO5 A;  4HZF A;  1GXP A;  5GAE J;  5JI2 E;  3HGY A;  3F23 A;  3QRF F;  4X62 M;  2RQP A;  2KLO A;  5JI3 E;  1D0X A;  2EFQ A;  1IBM M;  4A3M J;  4R3D A;  1TH2 A;  2IGN A;  2XAS A;  2RAE A;  4R8H A;  3T15 A;  5K5Q A;  3MKZ A;  2RGO A;  3VWB A;  2CYY A;  2X49 A;  3MZY A;  2CQQ A;  2QGU A;  2ADU A;  3V4G A;  4RAG A;  4FE7 A;  2XRO A;  1WGN A;  2VN2 A;  3F6O A;  2R7O A;  2XUB A;  2HQN A;  3L2C A;  3PM1 A;  4JYK A;  3HKP A;  3HY5 A;  3VEP A;  5ITQ A;  4DV3 M;  4EJV A;  3GRY A;  3QYE A;  1LDK B;  3IH2 A;  2K3F A;  1D0M A;  1LEB A;  4XRM A;  2UXC M;  1R71 A;  4GC5 A;  1MBE A;  3RI4 A;  2AQE A;  2DDA A;  2Z3Y A;  3CMY A;  3F22 A;  2ECB A;  1JUS A;  5B1B H;  4IVN A;  2EPF A;  4DW6 A;  5E20 A;  2OAZ A;  4XM3 A;  2YPR A;  3DTK A;  3DBL B;  3K92 A;  2RQQ A;  2HPM A;  4S0H B;  3C18 A;  2O6G E;  2UU9 M;  2QEN A;  4L9J A;  1K4T A;  2EZH A;  3BR6 A;  3KSX A;  3FXO A;  2NVQ J;  2KA6 B;  1VQ4 I;  3W0F A;  2ZSH B;  3IAS 2;  2HKO A;  2FOW A;  2L4M A;  3F3X A;  2DWL A;  2AXL A;  4DV4 M;  1BOA A;  3PIO F;  1OR7 C;  1YS6 A;  4R7G A;  4KLN A;  4GHA A;  4IOC F;  4BNC A;  1U5T B;  3OL4 A;  3SYT A;  1D8K A;  5L3F A;  2UUC M;  3R60 A;  4Y28 F;  3LSH A;  3HG9 A;  4IHT A;  2C5R A;  1WQ2 A;  5KHD A;  1H0M A;  1B1B A;  1Y1V J;  2V1X A;  3PXG A;  3G6E I;  5HLG A;  2LDU A;  2OTL I;  2R7F A;  4A6E A;  3ZPL A;  4ESB A;  1RPW A;  4KOD A;  1DGG A;  2DMQ A;  1T95 A;  4EM1 A;  2C98 A;  1SAX A;  3G1M A;  1SC7 A;  4D7N A;  1DO0 A;  3OYE A;  3L7W A;  3M7G A;  2K4B A;  2F5C A;  3CES A;  4ZYE A;  3WTW C;  1A35 A;  4P9F A;  4AU7 A;  1WJD A;  5K5O A;  3JAM S;  1T6O A;  1ETV A;  1HOM A;  2DHY A;  2VII A;  4F52 A;  1RES A;  1VQN I;  3RFW A;  1F4I A;  3DU6 A;  3JCU C;  3WTY C;  1QA6 A;  2ZXW H;  2ZKZ A;  5H2F C;  4EAT A;  4AQY M;  5DCM A;  1FOY A;  3TP0 A;  1YW8 A;  1BC8 C;  3ABL H;  1TZL A;  4BAC A;  5IRE B;  1HST A;  3MD2 A;  1MSF C;  3E5U A;  3CD6 I;  4RB3 C;  5J8F A;  1MBH A;  3F8B A;  4OIR F;  4B3R M;  4L6V 6;  2VQC A;  1QQI A;  5B5E C;  1QVT A;  1R22 A;  4C9Y A;  1UMQ A;  1D8J A;  2GIZ A;  2B9S A;  3U6L A;  4RB1 A;  2ZME B;  1HBX G;  2CFX A;  2R7X A;  2ZB9 A;  3LWF A;  1G8X A;  1QPI A;  3D5R C;  3K4C A;  2HXI A;  4QNR A;  1KU2 A;  1WJA A;  1WGL A;  2IEK A;  3DEU A;  1JKR C;  4D5F A;  1PDN C;  1YJW I;  3H9Q A;  1ZRD A;  4ITQ A;  1KQ8 A;  5FRM A;  1SVM A;  5ED4 A;  3S1Q J;  1WHC A;  3ABU A;  4L8R C;  4BQQ A;  4ZH4 F;  5C18 A;  5DYI A;  4G7Z F;  3FIS A;  2PJR B;  3IV5 A;  3CF0 A;  3U5Z B;  2L3D A;  1OCP A;  1S7A A;  1TWF J;  3IH4 A;  5AON A;  4QPQ A;  2JA6 J;  5EDN A;  2JWS A;  3UK6 A;  4AKI A;  1W0T A;  4NHJ A;  4ZYG A;  1LVK A;  3IHP A;  4O5V A;  5AIQ A;  1TQP A;  4ZDO A;  1QVR A;  2K9N A;  5GP9 A;  3IP4 B;  1Z21 A;  1ZLJ A;  2DWZ B;  2OOB A;  2FX0 A;  2LP0 A;  3H4M A;  2CG4 A;  1FC3 A;  1JR3 A;  1SXJ B;  2DBB A;  4ZTJ A;  1BI2 A;  2GQQ A;  2R6F A;  2P8T A;  1UFM A;  1XXH B;  1XMA A;  1CUK A;  3FMS A;  3GRV A;  2HQR A;  3CGW A;  1FJG M;  4IRI A;  2DA3 A;  3LCV B;  3FTD A;  5ILU A;  3IKT A;  2XF7 A;  1D1A A;  1E3P A;  2CSO A;  2HL7 A;  4XKB A;  2MR9 A;  4FCY A;  3J80 K;  1AKH A;  4RB0 A;  2EO2 A;  2LBF A;  2V9V A;  4ENM A;  3RPU D;  2NS8 A;  1FOW A;  4Y33 A;  3KEO A;  5LEK A;  1S3J A;  2EIJ H;  2IT0 A;  4JI6 M;  3GPY A;  3CC2 I;  1ZH5 A;  2ZM6 M;  5FLX K;  1KZH A;  4FTH A;  3W67 A;  5BPD A;  1BR1 A;  3FYC A;  3M0E A;  3F72 A;  1P4A A;  2LFB A;  3EPZ A;  1E2X A;  2W48 A;  5CVV A;  3CDH A;  4RGR A;  2Y69 H;  1TWG J;  1KU9 A;  2EA0 A;  1NG7 A;  2HYF A;  4LIT A;  3HOW J;  1XGN A;  3GLI A;  4U0V A;  3LQR A;  2QSG X;  3W2V A;  2L2D A;  2Z3X A;  4UV8 A;  3LCU A;  2VJ5 A;  1E94 E;  4AYB N;  5M3M J;  2R5Z A;  2FFJ A;  3AFH A;  2KP6 A;  3CCE I;  4KO8 A;  1ZQ9 A;  4G8X A;  4Q48 A;  2MFZ A;  4N0B A;  5DUK A;  4HAM A;  3ZMZ A;  3OMY A;  9ANT A;  5K7H A;  1R5H A;  1X2M A;  3HPG A;  3VB2 A;  2MSY A;  1CQT A;  1TF0 B;  2QUF A;  4LFU A;  2H8R A;  3DFZ A;  5FD5 A;  2FE8 A;  2HOS A;  2O8X A;  1TT5 B;  1HKQ A;  5GAH J;  3J7Y J;  1FOK A;  2FJ1 A;  2L9V A;  3TL4 X;  1VEJ A;  1R00 A;  3I53 A;  4NC7 A;  3KOZ E;  2XKP A;  1HCR A;  4I2O A;  4JI1 M;  3BR2 A;  3E1S A;  2KIU A;  4L15 A;  3F0C A;  2QKM B;  5M5W J;  3EIE A;  2BNK A;  3LSG A;  2XGN A;  1SAU A;  4XKW A;  4XKC A;  1DGH B;  3LL7 A;  2L4A A;  3CUQ C;  5LHG A;  1U9N A;  3H36 A;  1A6Q A;  4R79 A;  4JYA M;  2GA2 A;  2NRA C;  3U61 A;  2DA4 A;  2JSC A;  2DU9 A;  4MGY E;  1WJF A;  1QAM A;  5B3S H; 
#chains in the Genus database with same CATH homology
 2KHH A;  1V92 A;  1G41 A;  1WGL A;  1Y8G A;  2EKK A;  1OAI A;  2CP8 A;  3K9O A;  1HT1 E;  4F2L A;  4F1I A;  1WHC A;  4R71 A;  1TP4 A;  5JI2 E;  2JY7 A;  2HWJ A;  1NV8 A;  1PGY A;  2JZ0 A;  2QSF X;  3T6P A;  2F4M B;  1Q02 A;  1GO5 A;  2DAM A;  2LVA A;  1WGN A;  2ZTD A;  4GEW A;  1VEG A;  3FE3 A;  3IHP A;  5DFL A;  2KNV A;  2K9D A;  3E21 A;  2OOB A;  1TR8 A;  1XXH E;  2LTU A;  1WJ7 A;  1HJP A;  1IXS A;  2CWB A;  3ESW B;  1IM2 A;  2EJS A;  1CUK A;  1OTR A;  2R0I A;  2B3T A;  3GLG E;  1NV9 A;  1QZE A;  3LCV B;  1BVS A;  3MMP A;  4WP2 A;  1VQ1 A;  2JY8 A;  2MR9 A;  1A5T A;  2JZ1 A;  2QHO B;  3B89 A;  2LVQ D;  1ZMU A;  2LBC A;  1IFY A;  1P3Q Q;  2DI0 A;  1EFU B;  1DV0 A;  2KNZ A;  1OKS A;  4DBG B;  1X3Z B;  2LVO C;  2MJ5 B;  1UFZ A;  3E46 A;  1T43 A;  1PVE A;  4UN2 B;  2DKL A;  2JP7 A;  2RRU A;  1SG9 A;  2EKF A;  4Q7J A;  2MGW A;  2QSG X;  1XB2 B;  2L2D A;  1YLA A;  3LCU A;  1E94 E;  2LVN C;  2WZJ A;  2DAK A;  3BBZ A;  1OQY A;  2ZTC A;  2DAI A;  1WIV A;  1C7Y A;  3FRH A;  4HEO A;  1DO0 A;  2G3Q A;  1TTE A;  2L4E A;  4YIR X;  2OOA A;  2DNA A;  1HQY E;  2H5X A;  3GLI E;  2BWB A;  1T6O A;  2JY6 B;  1VEJ A;  2JY5 A;  1G4A E;  2L4F A;  2DHY A;  4G3O A;  1HT2 E;  2JUJ A;  3FRI A;  1AIP C;  1F4I A;  2KNA A;  1WR1 B;  1MN3 A;  2LVP C;  2JNH A;  1DO2 A;  1ZV1 A;  2DAE A;  2DEN A;  2O25 A;  1VEK A;  3F92 A;  2F4O B;  1G3I A;  2QNJ A;  2DZL A;  2HAK A;  2OO9 A;  1R4G A;  3K9P A;  3H4J A;  1KYI A;  1ZMV A;  3IEC A;  3GLF E;  3GLH E;  1ZMW A;  1VDL A;  1X3W B;  1VG5 A;  2MRO B;  1JR3 E;  2QSH X;  2K0B X;  2BWE A;  2DAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...