2QSFX

Crystal structure of the rad4-rad23 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
104
Chain Sequence
IGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAVGSFQVDYTPEDDQAISRLCELGFERDLVIQVYFACDKNEEAAANILFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein RAD4
publication title Recognition of DNA damage by the Rad4 nucleotide excision repair protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 33
structure length 104
sequence length 141
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00627 UBA UBA/TS-N domain
X PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2qsfX02
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2qsfX01
3GLFE 3B89A 2JY6B 1WHCA 3ESWB 2JZ1A 2OOBA 2G3QA 2L4EA 3FRHA 2DKLA 2LBCA 2KHHA 1JR3E 2O25A 2DENA 1KYIA 2DI0A 1PVEA 1OAIA 1ZMVA 3K9OA 4Q7JA 1WR1B 2BWEA 2K9DA 1P3QQ 1HJPA 3LCVB 5JI2E 1ZMWA 1NV9A 2MR9A 1HQYE 1DV0A 1HT1E 2R0IA 1Y8GA 1F4IA 1T43A 2F4OB 1WJ7A 3K9PA 1IXSA 1V92A 1HT2E 2MROB 1SG9A 4UN2B 3FRIA 2MJ5B 1TP4A 2DAKA 3F92A 1MN3A 3GLIE 1VG5A 2JZ0A 2DAIA 1YLAA 3BBZA 2OOAA 2RRUA 4WP2A 2QSGX 4R71A 1T6OA 2K0BX 2LVPC 1R4GA 1EFUB 1VQ1A 1OTRA 2JY7A 1TTEA 2JNHA 2LVQD 1G41A 1XXHE 1CUKA 1QZEA 2LVOC 2LTUA 4HEOA 2DAMA 4F2LA 1VEGA 2L4FA 3IHPA 1BVSA 2EKKA 3LCUA 1X3ZB 2F4MB 1X3WB 2HWJA 5DFLA 2CP8A 2KNAA 2JY5A 2KNZA 2QSHX 1G3IA 1AIPC 1ZV1A 2DZLA 2DHYA 3FE3A 2HAKA 1IFYA 1NV8A 2B3TA 4GEWA 1PGYA 1VDLA 2EKFA 3IECA 3T6PA 1ZMUA 1G4AE 2ZTDA 1E94E 2JUJA 1WGLA 1Q02A 2L2DA 3GLGE 1OKSA 4DBGB 2LVNC 1DO2A 1DO0A 1VEJA 2WZJA 2DNAA 2QNJA 1C7YA 1TR8A 2DAGA 2KNVA 2LVAA 2EJSA 1XB2B 1IM2A 2QHOB 1GO5A 2MGWA 2BWBA 3E46A 4G3OA 3E21A 3MMPA 1VEKA 2DAEA 2H5XA 4F1IA 2ZTCA 4YIRX 1WGNA 2JY8A 1A5TA 3H4JA 2OO9A 1UFZA 2CWBA 1OQYA 2QSFX 1WIVA 3GLHE 2JP7A
chains in the Genus database with same CATH superfamily
2EIKH 2HVQA 2JY6B 4EMSA 4H4KC 3LSPA 4YIIA 2HI3A 5JHUA 2OAZA 2VASA 1HW5A 4BDYA 1R6BX 4I02A 2HOSA 3L2CA 2BXZA 3TPZA 5FFZA 3VOEA 1B72A 3FXOA 3RYPA 4CO8A 2GM4A 1GV5A 2AXTC 2F4IA 4UVAA 2LKPA 4XLAA 2C9OA 2C5RA 1VZ0A 3VFZA 1HJPA 1XSXA 4LIVA 1QRYA 1J5YA 4B3XA 3U1DA 2VODA 1E9RA 1R7JA 1SMTA 2IA1A 2LMDA 4AIHA 3GQ5A 1S72I 1K7AA 4FX0A 3JR9A 4JI3M 5FTJA 3H92A 2OU2A 3HHXA 1AOYA 1G6NA 4B7GA 2L9SA 4DJAA 5E20A 2KQRA 5J4YA 3CC7I 3ZN1A 4E7HA 4LB6B 2DA1A 5IPAA 4A3IJ 3PIOF 2KISA 1EF4A 2IA2A 3MCZA 4Y15A 5EEAA 1IXSA 1HSJA 1UHMA 3G1LA 3O2PE 2UV1A 2VUMJ 3B9PA 1ETXA 1O7FA 4HX7A 2VPLA 3HHYA 5H2FC 2DPUA 5M3MJ 4E7LA 3BT9A 3DV8A 4ASNA 4Z6YA 3M8JA 2CV0A 1NG7A 4NC8A 3S3OA 3CDHA 2DAIA 1QQWA 2I5UA 5CYVA 4IRHA 3ZQFA 1ZN2A 1MMNA 2CS3A 1QAMA 3RIRA 3CDIA 3KP0E 1HCRA 4IBGA 1X2NA 1Y0UA 1CUKA 1DGBA 3HX3A 1MD0A 2YSRA 1W1WE 2K9NA 2IT0A 3KOZE 1VEGA 1PJIA 3MD2A 2PMZA 2ME0A 3IWFA 4OIPF 2NRAC 2F5CA 2OD5A 1WXQA 3LCUA 4P1WA 1R5LA 3A2KA 3ABMH 4G4NA 2H1RA 4RAFA 1YITI 2OTJI 2VJ5A 1HOMA 1N34M 1U9OA 2DYRH 2R7OA 1G71A 4IO9F 2BHZA 2LFBA 2X1CA 5C4XJ 1NV8A 4FE7A 2M7BA 4L5JA 1O3QA 5F1RA 1DQUA 4C9YA 3RQ4A 1W5TA 1EE8A 2V7FA 1XDSA 2LP0A 3MFKA 4JK1X 4UUSB 2KRUA 1OISA 2YNMD 2L6OA 1PYVA 3EUKL 2GNOA 2UXCM 2VQLA 4AIDA 4A12A 4U87A 3KVWA 2HU9A 4FISA 3KX2A 1D0MA 2HHHM 5AIPA 3TOBA 4LCBA 2V79A 2KDOA 1LQ1A 4ITVA 4EJOA 3M1EA 4XQFA 1L2BA 4LLNA 4W1UA 3OYKA 3A45A 2LF7A 4PGGA 2VJIA 1YTYA 3HJSA 5EJCA 2V1UA 3OWTA 1R2ZA 3RGPA 3KE2A 2H5XA 2XB5A 3ZQGA 1E0EA 4OIRF 1YG2A 4X1EA 5D6FA 1PJSA 3BCBA 2M45A 1UFZA 1KONA 4ZZLA 4RGXA 2Z7JA 1PM5A 2H1KA 4GIPA 3K4NA 2L7KA 3KSXA 1WI3A 3C3WA 3ESWB 2OOBA 5FTLA 3C3EA 1VQ6I 4MO7A 3JAMZ 2MD5A 2K4BA 3DTKA 2HTJA 2FS1A 1TBXA 2EFNA 4W5WA 1QVTA 4HQMA 1KYWA 3DF8A 2R93J 2CJJA 2E35A 2YR2A 3KZYA 3NWLA 4JI8M 3TP3A 1OAIA 1WR1B 3GVAA 4HW0A 5AIQA 1PRBA 1EH6A 1SD5A 4NXNM 1RKWA 1T3TA 1LUJB 3CDLA 5D8LB 1YI2I 4M0DA 4PD2A 2LC2A 1N25A 3C2HA 1FOKA 5EZGA 1TQMA 1WCMJ 2MR9A 1ORKA 2DTRA 3G2BA 4S12A 2ZMEB 1OYYA 4DOZA 3F72A 2LY9A 4NRWA 3CZ6A 2KHMA 2JK3A 2Z4RA 2R44A 2XPVA 3U2RA 1Z3XA 4LJ4A 1JTYA 5FSWA 2WC2A 3PL8A 4ON0A 3QRFF 2M8EA 4BUPA 5E3NA 4HQEA 3LSGA 4LF4M 1KU2A 1R1TA 2D1HA 2XHKA 4OINF 2A5WA 3CUQC 3C7JA 3E4RA 5DM7F 1E9SA 1SG9A 1DGHB 3KSJA 1R71A 4LRSA 2DODA 4KO8A 1LEBA 1FOWA 2ZMEA 2LREA 1H6UA 1X1PA 3FM5A 4CH7A 3SATA 1IJWC 2P5KA 4A3EJ 1FIAA 2BGCA 2WB1A 2NNNA 3Q9SA 3CCRI 2WA0A 3GTLJ 4YG2F 2DN0A 3DBHB 2ICWG 4B3AA 4UHTA 4XSZF 1FOYA 2FD5A 2VQGA 3HUGB 4R1HA 3LVWA 1RPWA 2QPAA 1DGHA 5EP3A 3L25A 2E1OA 2K85A 2QCUA 4HV6A 2D45A 1HKTA 1DUXC 3S1NJ 4RS8A 3KOWE 5DFLA 3PO2J 3E9SA 4UV8A 2KNAA 1R4MB 2X1DA 5LGNA 1IV6A 3SYTA 1FOXA 3ZQLA 2QZ4A 1OFHA 3KLOA 3KZZA 2L9NA 3BZKA 2PFBA 2IGKA 1MJGM 2HZDA 3HUGA 4MNUA 3WG9A 3DPTA 4HEA2 2J5PA 4XOPA 3AG4H 1U5TA 2P5TA 3THGA 4L4UA 2K6BA 5F0HA 1MGTA 2VXDA 3HOZJ 3S2DJ 2R5YB 4KT5C 4A3JJ 2R7XA 3TWMA 1LTMA 4GITA 2P81A 4HG2A 2UZKA 3V7SA 1BC8C 1TC3C 1OLTA 5E3OA 3PNYA 1OCZH 2FU4A 2OF7A 4RAYA 4I0BA 2DA4A 4IRGA 3GLXA 1VEJA 2GZWA 5FFXA 1OFCX 2EIMH 5J4VA 3KOXE 1ZQ9A 3IG8A 3SHGB 5HVQC 1K3XA 4LGMA 3K7AJ 2R18A 3HRUA 3V7RA 5L3FA 3C58A 1PP7U 5K7HA 2VQCA 4B7FA 4BBSJ 5HDNA 3TEDA 3FDYA 1VQ5I 3EQLF 4BGDA 5D5VB 1B4AA 3VODA 3GQ3A 2Y75A 1TH2A 3ERMA 1T6SA 3HGYA 4CICA 2GQQA 5FLXS 2IXSA 5CJ9A 2R5YA 1Z1DA 4RA2A 1WGNA 5CVRA 4CGYB 3GRVA 4MH0E 2K7LA 1O4XA 1TT5B 1ETWA 2CWBA 3H9JA 3K2LA 3CCLI 4IJFA 3OIQA 1AKHB 2KPMA 2JA8J 1MMSA 3D5SC 1JUMA 4HNVA 5ICGA 2ZBKB 2M3AA 4LG0B 1IN7A 3SARA 3I55I 3Q0VA 1FZPB 1KYIA 2DI0A 3JSOA 4IPAA 3I0TA 1QDRA 3RKXA 1SVOA 3GTPJ 1GHCA 1QQIA 2FNAA 2NQ8C 3J80K 1AKHA 5IT9S 1J9IA 5LGUA 1WJCA 2ZBKA 2ZFUA 1I1SA 1Z67A 4LG0A 2KP6A 4XICA 2R5ZA 2CW8A 1YO5C 2HKOA 3PO3J 2R0IA 1ETQA 5E1ZB 4GC5A 1J5EM 5DEQA 1OCRH 2Y69H 3G1OA 5F27A 4A5NA 4MGKE 4DV0M 1DP3A 1LB2A 2DOFA 3CGWA 3DWLE 2EZIA 1Z5BA 1V92A 1TNSA 2FMLA 5F0FA 3FKJA 4AVPA 2N35A 4KT6A 4MTEA 2RDPA 1VQOI 3W2AA 4WF2A 2ESHA 1MN3A 2E19A 1UELB 3I01M 2DK8A 1NO1A 2VKEA 1MIJA 3H9GA 3UNGC 3BBZA 4B8XA 1EH7A 4JN6A 3B74A 4LF8M 3IV5A 1A04A 2JPBA 4AQYM 4ABZA 3QP5A 3CCQI 1LPQA 3U21A 1F4KA 2WAQN 3TQNA 2DAMA 3L27A 2Z5UA 3L00A 1KQ8A 3GLFA 2ECBA 3WHKA 5E8IA 3E6MA 2LSOA 1OAOC 3Q8GA 2R7DA 3JRDA 2G5GX 3DXJF 2M8GX 2TCTA 2ZB9A 5ED4A 2VQFM 2VDBB 1I27A 2H8WA 3GXOA 4A69C 2VJ4A 1ZV1A 3WTYC 4KMFA 2WV1A 3HU1A 4LY6A 1IV8A 2LOOA 1IFYA 3G3ZA 2C98A 4IQ4A 5DUKA 3DA1A 3RTRA 2GA1A 2Z2SB 3PVSA 2ZXJA 3ZP5A 4GEWA 3SEQA 1G8XA 2QZ8A 3DLAA 4Q48A 5F08A 2D7GA 1OFIA 4WK8F 4I98B 1DU6A 1ZARA 3RE8A 2ID3A 4IHYA 3GZ6A 2GIZA 1YRNB 4IF4A 1AU7A 1F9NA 4AKIA 4D5CA 4XR6A 3L2VA 4NNJA 3A1YA 2CQQA 2V6ZM 2Q0OA 2NOGA 3DU6A 3V4GA 3K8ZA 4G6QA 2PN6A 3SC3A 5HNHA 2FSWA 4ANRA 4NB5A 2IA0A 1ETYA 4RLFA 4BJ5C 3PUBA 4QWQA 2JN6A 2RKHA 4UB6C 3G73A 3FUUA 2L01A 3FHZA 1LEAA 3DTIA 3I4PA 3L2WA 1YRNA 1R5GA 1EV7A 5EEGA 3MZYA 1K78A 3RDIA 3E97A 2OO9A 5FTNA 3HB9A 2XROA 2E2JJ 4KISA 3G71I 2YPRA 3ONQA 4LLGF 3NARA 2RGVA 3FK6A 4LFCM 3FRHA 1T95A 3IAS2 3RJPA 4BNCA 1LFBA 4OWRB 3HG9A 1T08B 2KDLA 2DMQA 2DK5A 3MKZA 3OYHA 2WSCF 2NYXA 4EIWA 2JZYA 4B09A 1ON1A 3WE3A 3LSTA 4H0EA 1H88C 1R58A 1Z5AA 4RKUF 2DQLA 4RM2A 3N97A 3V7CA 2LTPA 1LE8A 4M0WA 1TF0B 1MBJA 2COMA 3AOEA 2BHYA 2DMNA 2FBIA 1ZELA 3QPSA 4UNOA 1FEXA 5J8CA 2Z8YM 3CUOA 5FKOA 2VBYA 5ILUA 4N9IA 1N36M 4KITB 1QHGA 3RSNA 4OOIA 2J5YA 5FROA 3G6EI 1XMQM 2R7QA 3GTOJ 1FT9A 3R9XB 5IT3A 1ZGWA 1T2KA 3AL0B 3LOCA 3SFIA 1X4PA 1MBGA 3F9KA 4YFNF 5ITXE 2A07F 4M71A 4G9YA 4S0HB 3HOYJ 3F92A 1DGGA 2XRNA 3A02A 2W57A 4DR6M 4M3FA 4OU0A 1U2WA 2JZ0A 4DYCA 3S3MA 2STTA 3HY5A 1Z5CA 4OU7A 1YLAA 1H0MA 2LHGA 3FUWA 1IY1A 1LVKA 2RRUA 1USSA 4QIWN 3D5RC 3LQRA 2WSEF 1JR3D 1ZKGA 3MVPA 1EFUB 4XIDA 3IC7A 3CJRB 2QQ8A 4TUWA 5FLVA 1X37A 2G7UA 2M4KA 3L9FA 1G41A 1X19A 2PJPA 2IAIA 2W1OA 3QU6A 3PSFA 1IN6A 1RNLA 1H9TA 4LK1F 5F0CA 2I7NA 1HBXG 1CQTA 1X3ZB 4XM3A 1OMIA 3C2BA 3FBIB 1KQ9A 1ZGJA 2HNHA 4ZDLA 2X6YA 3JCUC 1I5ZA 4UUVA 1AWCA 3F8BA 4LGWA 3L26A 2P6SA 3H9QA 4HPQA 3SASA 3OYBA 1H89C 4NSOB 4AWXB 4IZZA 3E5QA 3CMEI 5B1BH 3HXLA 1VDLA 1A5JA 3IECA 1XSVA 1E2XA 3A4CA 3LVVA 2X4AA 4X64M 4FCTA 4KHPM 3IH3A 4ZJZA 3HOUJ 1D0YA 1D0LA 1N33M 2KZVA 1XSDA 3W2WA 1BW5A 2FEZA 4ENKA 1Z6TA 2MG4A 2OUMA 5L3GA 2VOPA 2M7AA 3FKEA 2A05A 3FK7A 1DO0A 2QNJA 4DYRA 1A36A 2WAEA 2H09A 5FTKA 4REZA 1Z91A 3OYJA 3A01B 2RNJA 5C44J 1XMAA 2G9WA 3AG3H 3GLIA 3HIFA 5HLTA 1WJEA 2D1VA 1MSEC 2MC4A 5BQTA 3ERED 2CRUA 2Q8KA 4R3DA 5E3MA 3LL7A 4BB9A 3BLYA 4K0KM 3R6SA 1A5TA 2FXAA 3H4JA 4C3IJ 3CF5F 3JR4A 2ZAMA 4M73A 2CGPA 2JP7A 1TWHJ 4IHVA 4GGGA 2ISYA 2JZ1A 1S6LA 1S7AA 2F5VA 2WBMA 3V42A 3A01A 1O3RA 4CXFA 1IRXA 2EZHA 2KL4A 1GL6A 4QHTA 1Q3BA 1BI3A 3U61A 4RB1A 2O25A 4JI0M 3C18A 3BOQA 3OYNA 3P9KA 4ITQA 2ZC2A 5AONA 1A6IA 2BY2A 1ZMVA 3H1CA 1R49A 4LGYA 3F8NA 3BPVA 4RF0A 1G8PA 4F91B 2KXEA 4ESBA 3TE6A 4BXUA 4CCOA 1HLVA 3ASNH 2KLOA 4LZZA 1XB4A 1HNWM 2Z33A 3E3VA 2VB6A 3DTEA 3O6BB 4CCMA 1VQ4I 5K7ZA 1F5TA 2XPUA 3LSJA 3NBXX 2F5OA 1Z7LA 2PQ8A 2XAQA 1Y0NA 2Z16A 2XSJC 2M0MA 4M9XA 5CPRB 2LG4A 3HU2A 1XTAA 2F4OB 4LF5M 4Y3OA 4YHHM 4MLOA 4IJEA 1B9NA 2F5FA 3ZQHA 4ANJA 2MA3A 2PBIA 2O03A 4JI5M 3MKWB 1ULYA 2VE9A 3CCJI 5M5WJ 2OZUA 2R7SA 2DA3A 2R7VA 3F23A 1SFOJ 3ABUA 3BC8A 4UUTA 2MLGA 3F8FA 3I04M 4LJ9A 4CIZA 4C30A 2G8LA 4HF2A 1XPXA 3LAJA 5K5QA 3EIEA 1XNRM 2QENA 3GTMJ 3G4SI 2ZXHA 3LSIA 1FX7A 2JQ7A 3K4KA 4LG2A 2HWJA 2JRMA 1LV7A 4G4QA 2IEKA 3MKLA 4B48A 2O9LA 4NRVA 1FPQA 1VQ7I 5ERIA 4U88A 1ETVA 1QVRA 2UUZA 2HAKA 5K7FA 4HNTA 4Q4ZF 3BPXA 5C4JJ 3I59A 1BBYA 3HOVJ 1E3HA 4FE4A 4BACA 5HNFA 1ZQ3P 3L7WA 1RRJA 2MH2A 3HKZN 2DFEA 3CLOA 4ZH4F 4RB3C 1SXJD 4GKKM 2V9VA 3KDSE 4LFBM 3GW2A 1MKMA 3H36A 4BJ6C 5BMZA 2AS5F 2MW8A 4CA0A 3W67A 3RGSA 1XMKA 4DR7M 4PSWA 3RYRA 1SXJC 1RKTA 3M4OJ 2L09A 1BN5A 1C7YA 4M3BA 3REOA 5EXXA 3FX3A 4B3RM 5F1JA 4M72A 1JKPC 4HX8A 1R6RA 1TWCJ 2B9SA 3OSFA 1IY2A 3PJRA 2E7XA 4L78A 4IBFA 2YR0A 2KT0A 2DMPA 1MNEA 3TQSA 4NUBA 4F1IA 4AM3A 1BR2A 2VT3A 3B6CA 3P5JA 1PUFA 4IRIA 1Z59A 3B7ZA 1QZYA 1WPKA 3NAUA 1E17A 1UCRA 2F5PA 4MFEA 2GXAA 4LF6M 4RAZA 5LHHA 3J7ZI 1K61A 3AJIB 1WGXA 2RV8A 2FBHA 2KIMA 3IHUA 1NY6A 3K69A 3QYFA 3E7LA 1R7RA 1XMXA 4JI7M 1LDJA 2L4MA 2P8TA 2Y48A 4Y52J 2LBCA 3VKHA 1W5CC 1WH5A 3J81S 2VF7A 3M7GA 4MM3B 1WHUA 4D7MA 2DFFA 2JUCA 2X6WA 1TH4A 1FYMA 2DYSH 2BWEA 3SBJA 4ZYHA 2DHRA 1EKEA 5LFAA 5H20A 4CCLA 3BJ6A 3FMRA 5HDGA 5EEHA 1B72B 3UR3C 4II3A 2F5QA 4M74A 4B3TM 2LVSA 5E26A 4XLCA 4LIUA 3U5ZB 2I8DA 5FLXZ 1FSEA 1LFUP 3LAPA 4LJ7A 4YELA 3SAVA 5BR8M 2I7PA 4WX9A 2OJED 1U78A 3ZMZA 3BG9A 3HJEA 4ZYDA 2BXYA 2E2IJ 5LRRA 2UXXA 5GADJ 1BIBA 3F6VA 4A0XA 1LDDA 5TRDA 1B59A 4BLCA 4PT5A 1SVLA 1I50J 1IXSB 4X65M 2XZUA 3U5ZA 5F04A 1Z77A 5CVVA 3DEWA 1DDNA 2LVPC 3V8JA 5GTHC 1MBHA 4MGZE 3ZCOA 3HTUA 4ENMA 3ZMUA 4HEOA 1XN7A 3CTAA 5IT9Z 2O0YA 1WZ2A 2J5OA 3W2VA 2LH9A 1NK2P 4XK4A 3FWEA 5M5XJ 2ZFWA 2AQEA 2DA7A 1WJDA 3ULQB 1IN4A 5J1RA 3OS0A 2F2EA 2EA0A 2LY1A 2O7OA 2PG4A 5IZ7D 4JQFA 1WKMA 2EFPA 3F6OA 4M3EA 1B9MA 3CUQA 3DZDA 2GBYA 1BJZA 4FW9A 2E5ZA 4FQGA 5J3LA 3BTJA 3GUDA 3HRSA 1X1CA 3FIWA 1JKQC 2A6EF 5E1WA 2E60A 2KIQA 4CYDA 1CF7B 4AKHA 3CCVI 2JUJA 1SAXA 1JT0A 4BE1A 1DGWY 3HJQA 4LZJA 4XLEA 4EV0A 5KPZA 4L6V6 2RN7A 5C3EJ 4J00A 2OBPA 4F92B 1F43A 2FBKA 4NC7A 1XB2B 2BEOA 2BE5F 1NY5A 1R2YA 4JV5M 3SEZA 2MGWA 1P4WA 3I4YA 5IYCJ 3CQZJ 1ZLKA 3WHBA 1CF7A 3RPUA 1XGOA 3NQOA 3GYHX 2QBYA 1O7LA 2Z9OA 3TW7A 3OIPA 1FC3A 3K2AA 1U0JA 1OCCH 5HLHA 5FLXK 3RZOJ 4ZPXA 3O3KA 3I4VA 2TRTA 3OV8A 1BW6A 2WTEA 4PK4A 5HS7A 5E18F 3Q5FA 2QQAA 4O6JA 3TDZC 1H9GA 3MZ8A 2FA5A 1FMWA 1FTTA 1ACIA 2N8GA 1HDDC 2DKLA 1MZBA 3H0GJ 2BV6A 2DI3A 1UHWA 3S16J 2DA6A 1D8JA 4Q7JA 2XUBA 4M3DA 1MH4A 1SFUA 5IYDJ 3GPXA 5A2QS 4AKGA 1J2XA 4M9ZA 4HLYA 1YUBA 2HOAA 3PFYA 2KIUA 2EBIA 2MFZA 3QQAA 5IT9K 1HQYE 4DGWB 3CMAI 1GXQA 2JRTA 4HF1A 1OIPA 2JA7J 4IBCA 1SANA 1Q39A 3EUHC 2KIFA 1NNUC 3TDUC 1QPIA 3MMYB 2MROB 3W6VA 2XGCA 5DDGA 1W5SA 2DWZB 3VK8A 1W0UA 3A46A 1YQAA 3ZPLA 1PJQA 1IDZA 1MMAA 1FBUA 3S8PA 4N4NB 2HDDA 1Q1HA 2L2OA 3S1QJ 3DQVC 1P92A 3CMYA 2D2WA 1S8NA 1VQ1A 2BJWA 3BR2A 2K9SA 2XIGA 1BI1A 2VLAA 5ITUA 2LVOC 2CQXA 2MGQA 3K4BA 4U0WA 5M3FJ 2FX0A 1FYLA 3HOTA 1YYVA 1L1TA 5FB2A 3SFZA 1BVSA 1NHWC 4QPQA 2EKKA 2VQHA 3L2QA 4CHUA 1YHQI 2L9RA 4IHXA 2ETHA 3NRVA 3LNQA 4Q5SF 4AIKA 3EYYA 4V19K 2E5NA 3OYDA 2ZKZA 1R5ID 1TNTA 2HOEA 2X6XA 1E32A 5IWAM 5E3LA 4BY7J 5BS6A 4LJZF 2B3TA 1I94M 2O6GE 2STWA 2R92J 3ZRGA 1YS6A 1D3YA 2CQ7A 4RDUA 3VB2A 4AU7A 3WTUC 2DPDA 3S2HJ 2M34A 5DYIA 2HL7A 1ETKA 2EA2A 3UKGA 4I09A 4AYBN 2E1CA 4X6AJ 1Z0XA 2GIVA 3RPUD 1MJAA 1NH3A 2K3PA 5EZHA 2EIJH 3I64A 1LDKB 1U5TB 2D7EA 5J40A 4NQWB 1V5EA 3I4MJ 3ASOH 4DBRA 3FYCA 3I4NJ 1OIZA 2ZXIA 3CCSI 3MWMA 3CC2I 4HDVA 4A0YA 4BL0B 2WY8Q 2E1MC 4QOSA 2CW7A 4C2UA 4LB5A 2HVSA 1SAUA 1P4AA 1YW7A 3IKTA 2WV0A 1PDNC 2A6HF 4YIRX 2DO7A 4B1RA 4KLNA 3FXUA 3HRTA 4F93B 2CU7A 3GTJJ 1SVMA 2CV1A 2W7NA 1S3SA 1WJFA 2RGHA 4NQWA 3QAUA 2H6BA 1SMYF 1GVNA 4L9JA 4OMZA 2K27A 5D4RA 2MBFA 1D2NA 3I9V2 2MLKA 1QUTA 4G8XA 2WAQA 4IKFA 4I81A 3GO8A 3ZXSA 2E1NA 1IRFA 2NVXJ 3F8CA 2M5WA 3QODA 4MGRA 3O8GA 4AC0A 2C9CA 3U6SA 2HKXA 3VYSB 3WTXC 2YUSA 1AUAA 2JA2A 2OZ6A 2IBDA 4GXOA 1IQPA 4I6ZA 2EH3A 2F5DA 2CEAA 3GMEA 3PXGA 1JKRC 5L8RF 1QGPA 1ZMWA 2O5RA 2P6TA 5BNGA 4U7DA 2OQRA 3EDPA 1G4DA 4I01A 4QPOA 1JHFA 5F3WA 4Z2YA 4C3HJ 2KZGA 2M1BA 2B63J 5KQ8A 1O3SA 1FBQA 1NJFA 2R5ZB 3HWSA 1SFEA 2GXGA 3MHVC 1TP4A 1BJAA 3JR5A 2XSDC 1D0XA 4AD9A 2DFIA 4I7HA 2ESNA 4BBRJ 5B1AH 4A3LJ 1STZA 4ZC3A 2K40A 2HQ5A 1YOVB 3V76A 2IPQX 3JRBA 1ZRDA 4WP2A 3DPUA 2JNHA 1TH3A 2AHMA 3HGGA 1ZHFA 2NNYA 3E5XA 1A6QA 2QWWA 3KP4A 2GQFA 3Q8XA 2IGMA 3GP1A 4F2LA 4BQQA 3HTSB 3WTZA 1S29A 1XGSA 2ME6A 3PUFA 4Y17A 2RNGA 1V55H 1X3WB 3M8FA 2CP8A 1VQKI 2K9MA 2ZSIB 3FM3A 1BOAA 4KMUX 3WGGA 2P5LC 5DNYA 2W24A 3F22A 2R0QC 1Z9CA 3GLFB 4XNFA 1GJSA 2CFXA 2JWSA 1MMGA 3HPHA 4EGYA 1SEUA 1FYKA 2EJRA 2WB1N 4RBOA 4PCZA 3BTIA 1LJ9A 1OYIA 5KCMA 4DYQA 5FJ8J 1ZR2A 2F4VM 2VL8A 3DPLC 1VFCA 5KPRA 5HLGA 2EKFA 3E6CC 4J19A 4PJJA 2KA6B 2XSZA 1KGSA 1MH3A 3WU2C 1YIOA 3SZTA 1B8IA 2R3SA 4XGIA 5J1UA 4E7KA 2IS2A 4DBGB 1YIJI 2EFQA 2JTVA 3DKWA 3VYRB 2DAGA 1I6XA 4FWHA 2JPCA 1JR3A 1O57A 2VIIA 3KP1E 3GPUA 1S7EA 2OV7A 3GWZA 2QHOB 1GO5A 3I5UA 3KLNA 3NWSA 3W6JB 4G94A 3BTCA 4D7NA 2DQRA 4DZPA 5ITQA 3OYIA 1PUEE 3D5LA 2L02A 3IG5A 1SFKA 3J2PB 1R9TJ 2EV0A 2FOKA 2DAEA 3N4MA 4I99C 2ZO4A 4F3QA 3CCEI 1BI0A 5K1YA 1U8BA 1IY0A 2JY8A 3BR3A 2XF6A 3P9IA 1YW8A 1IZ1A 2KRHA 3U6MA 1J0RA 3ROUA 1G2HA 1QA6A 4HSTA 3M1CA 3GLFE 3B02A 2P7CB 5JVTA 4BY1J 4DV7M 4IBEA 3OYCA 1K78B 5EQTA 1BC7C 1JR3E 3LSRA 2W84A 1RC9A 1G3TA 3BY6A 2KRKA 3W0LB 3HKPA 1XC8A 3M9AA 3K9OA 2Y0SN 4OW0A 2K9DA 3CF0A 5GAGJ 2OPTA 1U3EM 3DKYA 1R22A 3GEZA 2QQBA 4E7ZA 4HZFA 3AG2H 3R0AA 4P17A 4AI6A 1HQCA 4RGSA 2FOIC 4RF1A 4PJNA 4OIOF 1Y1WJ 3ABTA 2DT7B 2Y30A 1TWAJ 2RQQA 2JT1A 5ICFA 2L5QA 4KODA 4NSRA 3BCAA 2BY0A 1LE8B 4ZDOA 2MD0A 4QTRA 1TT0A 3TP0A 3ZQJA 1YSYA 1Q1VA 2HZTA 5CLSA 2CQKA 3V8KA 4XN3A 3LQQA 4I0AA 3GO5A 3FTDA 5DYGA 4NDLA 4ENNA 4UN2B 5ILVA 1WI9A 1K79A 1VG5A 1L0OC 1FIPA 4B4CA 4BQOA 1JGSA 3MKYB 2UXDM 2VJJA 2V1CA 4MIMA 4BAYA 3J81Z 1IGNA 4RNAA 5KK1A 5EXPA 4A2UA 1OTRA 2EFOA 4DIQA 1HA8A 3H5NA 3JRHA 1YJNI 5JI3E 4MEXF 4YIFA 2HYGD 1C0WA 1E3OC 3EYIA 5B5EC 4IBJA 1QANA 4DR3M 5JHFA 5KQDA 3HYIA 3RPQA 4JYKA 3T8TA 3W6KB 3KYCB 1K82A 2UXNA 2V6EA 1W36D 5B66C 2IS6A 1I3QJ 2QKLB 2VQEM 3J7BA 4XLHA 2XSZD 5FKKA 5HDKA 2HWVA 3WG7H 3FE3A 2A6TA 2AHQA 3FUTA 2VXZA 2RREA 2DOAA 2VPRA 3CJNA 3ZQQA 1YE9A 1W36C 1Z05A 2PEXA 2A68F 1TL8A 1ZG5A 1J75A 3GLLA 3C1DA 5IREB 3PNVA 2XC7A 2DDBA 2XGXA 4II2A 1R36A 2AQFA 2XPWA 3ZQIA 1NK3P 4L18B 3U6QA 5E1XA 1K3WA 3L2UA 3GPPA 2CO5A 1ZMUA 3IWZA 2VKHA 2R4EA 1ONVA 4RGRA 1WFXA 5GAEJ 3ECHA 4ZDPA 5FD6A 2XZFA 1WVRA 2LKXA 2QP9X 2HOTA 2QF7A 3DKXA 3GZ5A 1XX5A 4XONA 2LH0A 2LVNC 5D6EA 3OL4A 4Y4RA 2C6YA 1JXSA 1OJLA 2LWXA 1T8IA 1XCBA 4LOCA 2HPMA 2C96A 3PQJA 1HXDA 3LWFA 2L7HA 2Z3XA 4A3DJ 2QKMB 3KYDB 3BQYA 4EJUA 5JLXA 4D81A 1USTA 5DCMA 1O3TA 3J80S 3TGNA 1D0ZA 4N4OB 3SAUA 3ZN0A 3E46A 2W4SA 1D1CA 3ILKA 3VDPA 3JW4A 4XLNF 2DW4A 4X62M 3LFKA 4HOBA 1EH8A 5DD4A 4MGIE 4AVZA 2J7NA 3QYBA 1RI7A 2HKJA 4XSXF 2LBFB 4CCKA 1SXJB 2O8XA 1D5YA 2VF8A 2OQ4A 2VKVA 3IH2A 5K5OA 1YS7A 3GLIB 1N78A 3GFLA 4FTHA 3DU5A 3KP7A 4PUSA 2QSFX 1X58A 5F6FA 1X1AA 3L09A 3B89A 5EGOB 1YX3A 5IOYA 4KYWA 2L4AA 4MQ9F 4B44A 2ZJPF 1YW9A 3I54A 2ZM6M 4KIBA 1BM9A 4FCWA 2DENA 2LBFA 3J81K 2JA6J 1SXJA 3L28A 4DR2M 2VIXA 4IOAF 3JTHA 4HLXA 4LMYA 2LHCA 2X8AA 4M6XA 3IRQA 1XC5A 3CCYA 3U61B 3DCFA 3I53A 4C2MJ 5EGOA 2MH9A 4HRIA 1UFMA 4F7ZA 4L9VA 4BKXA 1NSFA 1IUYA 3HKZA 2L7MP 4A3GJ 2QQ9A 1YFHA 2K9LA 3GTGJ 3S14J 5CVUA 1Q3CA 5FKLA 4ZTFA 3OR1C 3CF6E 1Y8GA 3QPHA 4PDIA 4QOZC 4PJ0C 2A69F 5CQEA 4EGZA 1QBJA 4BHCA 1KSFX 3A03A 3KEQA 3HRMA 4DNCA 1L3LA 4OVZB 1FY7A 2CG4A 3VSKA 1SXJE 7CATA 1FP2A 3FRIA 2ADUA 4BHBA 2R7FA 3GLIE 2XF7A 2R62A 1G3WA 3KXEC 2B0LA 4K2EA 1UB9A 2KJBA 2RAEA 2HQNA 3K9TA 4XKWA 4XOTA 5HLIA 4BJTA 3CTWB 1T6OA 1JUSA 1AHDP 3K70C 1TTEA 3I58A 2LVQD 2LF8A 4CZZA 8CATA 1R1VA 2XGEA 4UXNA 5KVRA 3SJMA 1ZLJA 5A2QZ 4OVZA 2X51A 3JRFA 3L29A 1KQ0A 4U0YA 1ZR4A 4LK0F 3JRAA 3IHPA 1S5LC 4MFDA 4YFKF 2AO9A 4TV7A 4E7JA 3OL3A 2XAGA 5DCFA 3SZPA 3GRRA 3U9GA 1BR4A 3FTEA 1W4MA 3HM5A 5LMUM 4P96A 1QYRA 2JWTA 5LGTA 1OKRA 3FF5A 1JJ8C 3J27B 3BROA 1HKSA 2NS8A 1RR7A 1ZAOA 2APLA 1SD4A 1P4XA 2Z99A 4JOMA 3GTQJ 4E4HA 3U6DA 3OR2C 3T6PA 2X48A 3GX4X 2M5ZA 3O8HA 1K83J 3I59B 5FKNA 1E94E 4RMNA 1PJRA 1Q02A 5GAHJ 2Q2EB 1FJLA 2UXBM 5L3EA 2OTLI 5GPCA 3MQ0A 2EPFA 4U0VA 3P9CA 4A5MA 5FGMA 3KYLA 4D9JA 3P7NA 4XRMA 4D5FA 3HJ8A 2JUGA 3ZH9B 4KA4A 1QZZA 3KW6A 2FRHA 1JQJC 4II7A 2BNKA 4MB7A 5EXSA 3KIOA 4HA8A 4L15A 5ITTA 1IRGA 3IP4B 1VEKA 2ZNZA 3EIHA 3ML6A 4QSHA 2Q2EA 3QPLA 2X0LA 4A3MJ 3KPHA 4PGHA 4Y28F 3OMYA 2RVCA 3OIOA 1GKIA 4PFPA 1XXHA 1XGMA 2HEOA 4DV6M 4B3MM 4BYYA 3M8EA 4BH9A 3ZOBA 2A5YB 1P7JA 4C2TA 4L8RC 3S1MJ 1PUFB 3NWTA 2MSYA 1I3AA 4UB8C 1K6YA 1TWGJ 1PJJA 1BI2A 2M0CA 2ZCWA 4CISA 3CJQB 5D4SA 5J8FA 3LSMA 5EG0A 3ISPA 1ZREA 1QDTA 2LK2A 3K1PA 3GRYA 3DBRB 2Y21A 1PVEA 2XDVA 2R45A 3T0YA 1XD7A 4A0ZA 1R5HA 3X2QH 3UGJA 4NOOB 4NHJA 4DR4M 5A2QK 3L2RA 3JRGA 1Z6RA 2IJLA 3OS2A 3AG1H 2MH8A 3W3CA 4FASD 4IHTA 4QNMA 4FHTA 5E6JA 3GPYA 2QVOA 3HDDA 3FZVA 4B7HA 3NEUA 3VDUA 1A31A 2H27A 3IH4A 3QPTA 3TO6A 5KAFC 4XMYA 1WJ7A 2CH0A 1ZAEA 3ZQCA 1N77A 1WJ5A 1GL7A 2ZJQF 2CSOA 3FMQA 1HT2E 3FXJA 4U7BA 5FRMA 5IP6A 3U6OA 1FWZA 2DTZA 1V3FA 4CZCA 2X6OA 3KOYE 3OYMA 3L1PA 3K1NA 1TGUA 2R65A 3FXMA 4I5SA 3TWLA 3LA3A 5F64A 3D1NI 5KO3A 2R7UA 2IS1A 2XV4S 2ZJ2A 2VOOA 1ENHA 2H1LA 4JBAA 2WADA 3C3DA 5E8GA 2OPFA 3RQIA 3VDXA 1ZRCA 4XORA 2DVWB 4D82A 3SQNA 2H94A 2L3DA 4AUXA 1S7OA 5HS9A 3TL4X 2M60A 2R4GA 2HS5A 2BY1A 5DM6F 3U6EA 1I1GA 3I51A 1APLC 2RGOA 4WXDA 2VBWA 1K4SA 3FXRA 2QSHX 2KEBA 2FF4A 2XAFA 3E1SA 3FUVA 3GLHB 3HL2A 5B3SH 3CF2A 3EUHA 1XMOM 5IY5H 3BWGA 2ZXWH 2KRFA 4BXXJ 2UUCM 2RC4A 2QLZA 3VYTB 4PDGA 3DFGA 4ETSA 3J7AS 1RESA 1QZMA 2XEPA 3G1MA 4HAMA 4M6YA 1FBSA 2A3SA 3F0CA 4GDFA 2XKPA 2ZTDA 3CUQB 3GLHA 4EJVA 2XFTA 1FNNA 4YRVA 4XBFA 1RU3A 3HOSA 1DGRM 2VI6A 1TR8A 3ZQ7A 2HDCA 3ELKA 1Y56A 5HODA 1IM2A 4XBOA 1ZG3A 1HDPA 5L3DA 2DT5A 5ICEA 4DUYM 1V54H 2DDAA 3CO6C 4IJAA 2COBA 3FMSA 2UU9M 3SZGA 1DU0A 2DZOB 2ZTCA 1JHHA 2W25A 5IYBJ 3WU0A 1EA3A 1MMDA 3S2WA 1KA8A 3GLHE 3W68A 2FH0A 1B6AA 2O01F 1NNJA 2UUBM 2JVHA 5LEKA 4DV4M 1WHCA 3H35A 1TW2A 2QBYB 4FD2A 4GYGA 2BZTA 2E1MB 5DD8A 1W7PB 2ZNYA 3S17J 3SMSA 9ANTA 1VQLI 2XRLA 4KN7X 2LRDA 2CFOA 1BR1A 3Q3SA 3SDGA 2AXLA 4EVIA 2P5VA 2EZKA 1IF1A 5EP1A 4BU2A 2JA5J 3TOAA 5IOZA 3D0SA 2L7FP 2NS7A 3NBIA 2LR8A 2V6CA 4JX6A 3LMMA 4L0ZB 3WE2A 4AW4A 1TLHB 3ZC7B 1DV0A 1W7PA 4FWDA 2F6CA 4DV1M 4IOCF 3PFIA 3J7AO 3FBNB 1ODDA 1T0FC 2M2EA 3RKYA 3HHWA 4AYBA 2TDXA 5TGTA 1SD6A 5KNLA 2IS4A 1T43A 1YLFA 2HQRA 1IO2A 4L5EA 2ELKA 3J7AY 1VNDA 3WTVC 3CP8A 3MK6A 1IBKM 2LNHC 2FMYA 1TWFJ 4IIWA 1H8AC 3K92A 2OCCH 3WGIA 2M30A 1OR7C 2JXNA 4IQJA 3FUXA 2BVLA 2K0BX 1GUUA 1I6HJ 3OY9A 2JY7A 3DOAA 4AG5A 2NAZA 2FQ3A 4KUMA 4GH9A 5LEJA 2QA4I 3OSGA 1RIOH 2Y20A 4EM1A 4A3CJ 2D7HA 4WW0A 2F48A 4FETA 4WXCA 2ISZA 4XLPF 1MJ9A 2R7ZJ 2F4MB 3CCUI 1QAOA 3ZCBB 4DV3M 2GOXB 4HX4A 2BVMA 4QHSA 2I10A 3Q0UA 2KNZA 2UWMA 1AIPC 3HSRA 2XF3A 4IL6C 4UUSA 3FXKA 3SHFA 4V2FA 3HC7A 5FO5A 3CP2A 3B7NA 1G3YA 1AA7A 1Y6IA 2W00A 1U8RA 1QVUA 2Y0MA 4RAGA 3JRCA 3RKQA 2RQPA 1PGYA 1XGNA 4FT8A 1VTNC 1HC8A 2HCBA 1X4OA 2Z3YA 1K6OA 4MGYE 2DWMA 1SFXA 4N9HA 2FJ1A 1D5VA 4HLQA 4GRIA 2L54A 3RFWA 5J6XA 1T98A 3Q9VA 3SAWA 2EINH 2CWEA 1QPMA 3LA7A 4R79A 1OKSA 2R4JA 2O3FA 1VQ9I 5EP4A 1XDUA 3VEPA 1Z7UA 1MW7A 4G6ZA 2WZJA 2DNAA 4LFUA 1Y8RB 2KNVA 2LVAA 1ERDA 3K1JA 3HZJA 2JJ7A 1POGA 1NHAA 2BWBA 1KFVA 4DQ2A 3WGHA 1DPUA 4NL4H 3MMPA 4CYCB 4KN4X 3I56I 1VI0A 3PIPF 4ESFA 2D5VA 3S3NA 1J59A 5BPDA 3QWLA 2DFHA 2ZANA 1L2DA 1UJ8A 2KZUA 4MGHA 1HKQA 2V1DA 2PMZN 3K4CA 2M9HA 2NS0A 4B43A 1IUFA 2KKOA 3KEOA 4P16A 3HHHA 4RGUA 1XG1A 2FE8A 3BDDA 1GVDA 3CLQA 4LF9M 4O3MA 3QOEA 1F36A 2WY7Q 3CCMI 1W7PD 1KU7A 2F5NA 2P7VB 3OYFA 5KPTA 4CYCA 5DS9A 5TISC 3SMPA 2Y31A 2Y0TA 4GO1A 2XFSA 5LBQA 1QUSA 2V1NA 3HU3A 1V5FA 2BYVE 1P3QQ 4P55A 1JB0F 3B73A 4KFCA 3OTOM 3I3LA 4CDGA 1MBEA 3R8FA 2YX7A 2ZJRF 2E36A 1PJTA 2KRCA 2L0KA 4CCJA 3J80Z 1FJGM 2H8RA 4IBKA 4C3JJ 2VT2A 1JTXA 1UHSA 2ID6A 4EQQA 4XLFA 5EF6A 1XNQM 1ZYRF 3ZMVA 2Y0QA 1KU3A 4JX4A 5ITYA 4KJZA 5CKTA 5LRSA 2CV2A 5JVGF 5FLMJ 3HOWJ 4LRTA 1R23A 4MTDA 4CHTB 2OA4A 2GOMA 4XRFA 2MYSA 4IBDA 3GZNB 1XHBA 1NG6A 2Y2ZA 3E6DA 4PJMA 4EJTA 2F5EA 5C18A 3SXYA 2KFDA 5DUIA 1NJGA 2LDUA 3GBGA 4JYAM 2NXNB 4FCYA 4L5IA 5L3CA 4R71A 3BZCA 3B6AA 4BHPA 1V4RA 1V5GA 1ZGAA 2E71A 2VONA 5H6RA 3TMOA 5BPIA 3F8MA 3LSHA 3MAJA 3TO7A 5ICCA 4ESJA 4GKJM 2L4FA 3GFIA 2PI0A 3GTKJ 2K4JA 1HR0M 4FWGA 5CQGA 4JP0A 4S04A 2DWNA 3VWBA 1G3IA 5EP2A 4IEJA 2GWRA 1JI8A 5EDNA 2NVYJ 4WURA 4DUZM 4DR1M 1L2CA 2CUFA 2LYCA 5LD2C 4BQAA 4G4RA 4QNRA 3DEEA 4P9UA 2R7TA 4HF0A 4P5OA 2Y0SA 4PFOA 3DP7A 5FRNA 4HSRA 2CHGA 4UY8I 1YX5A 1DPRA 2DAOA 4QLCU 4O5VA 5JFRA 1VF9A 3HSEA 2FFJA 4EJWA 1L1ZA 4F55A 1UAAA 4E7SA 1I4WA 2E7WA 3OOUA 4M9SA 2CMPA 2L7ZA 3PSIA 4N0BA 1JUPA 2DLLA 5FTMA 2M4GA 1DO2A 1QO0D 2VBZA 2H6CA 3E6BA 5LHIA 5C1BA 2OC6A 1IBLM 1T56A 3GFMA 4I4LA 2WSFF 2DA2A 2XB0X 3C2GA 1B8IB 1GABA 3I71A 5E79C 3LFUA 1RZ4A 3VYUB 1GLNA 2EV5A 3OYEA 1X2MA 1IXRC 3E21A 5DTDA 2HDWA 2F5SA 1LFPA 2DA5A 2CUEA 2YU3A 4DBQA 2HXOA 3VSLA 3T5XA 1GVJA 3PQKA 2EZLA 3IRRA 3R0JA 2CHVA 4FCVA 1WIVA 2BBYA 3M07A 4JXJA 4A3FJ 3EETA 3K1MA 4XKVA 1LKXA 2L4EA 1QHHD 4FX4A 3KFWX 2ZMEC 1Z3YA 2LD5A 4B3SM 1ZRFA 2G7HA 5BOXA 3GFJA 4I2OA 1A35A 3WHCA 1MSFC 2FE3A 3K4LA 2XGDA 3MN2A 5GKNA 2B7EA 3BQZA 4IHWA 2YX4A 3TW6A 2E2HJ 2DXIA 5JI2E 3AKZA 4XRSA 5EXTA 3BOSA 4KIGA 1N32M 4IHSA 5BPVA 3ZMTA 5D8KB 3A0BC 3CO7C 3KCCA 1OPCA 1LVAA 4MQVA 2W85A 4YY3M 2Q1ZB 4LJAA 1OCOH 2DMTA 2MABA 3BR0A 4XKBA 3AOGA 3VFDA 3E5UA 4R8HA 5L3BA 2DOEA 3PM1A 4RLQA 2PMHA 1TTYA 1S3JA 2Z1DA 3CC4I 4F52A 3U6PA 5LMNM 4MHGA 1S9HA 3BJAA 4G12A 4BEHB 1Y8QB 5GTIC 4XK8F 3AAFA 2VE8A 4RB2C 2DMUA 2R7RA 2EQRA 4GMQA 3AFHA 2HYFA 2IGNA 1MNMC 4DR5M 3E0JB 3HBLA 1U5TC 1X3UA 3K4MA 2V9PA 3V8LA 4UVBA 5JLWA 3KZIC 1FLIA 3MJ5A 1IBMM 1HF0A 5FKMA 2QSGX 3JREA 2IGOA 5ITRA 2NVTJ 1ZK8A 3GQ4A 3BTLA 2Y9YA 2MC3A 4IX7A 4BEHA 4OAYA 1QZEA 1TDZA 3WTWC 2LTUA 2DBBA 4BQNA 2R6FA 2GAUA 4A6EA 4YEJA 2JVGA 1QU3A 2LLKA 1J7KA 4Z8XA 4G7ZF 1LNWA 1TQPA 1DGFA 2YU9J 2NVQJ 4DV5M 1BOBA 3OOPA 2QEXI 1YJWI 1HW1A 1U6GA 1I39A 2NVUB 1QAQA 1G3SA 4OIQF 3CESA 2YQZA 4G6DA 2UUAM 3FXLA 4G6TB 1FP1D 4EM2A 1MU5A 1MBKA 2OCEA 2K9QA 3QU3A 1GJTA 3K0LA 4UVCA 1MX0A 2K47A 1SC7A 4GYIA 2PJRB 3JAMS 3VLFB 2IW5A 2XAUA 3K10A 3F21A 1G4AE 1ITYA 1SD7A 2HXIA 2KZSA 4PCQA 4A93J 1IRZA 3HGIA 1K4TA 2DWLA 3H3ZA 3GRUA 2GA2A 1EIJA 1T33A 1TW3A 5LHGA 1BL0A 1DP7P 3M6AA 3DBLB 4ZYEA 4ZTJA 2YFQA 2W48A 2ECCA 2VC0A 4Y13A 1RUNA 4WXHA 1X1BA 2Z4SA 3FTFA 5FD5A 2BJVA 1RETA 4BXFA 4OMYA 5CVIA 2PX9A 3FYDA 3AV0A 1IW7F 2EJSA 5ITXA 2K3FA 3MEXA 4GHLA 4GCVA 4D0PA 2IRFG 2PJRA 2CRGA 1MDMB 2CHQA 4KT0F 4LJ8A 1L8QA 1WRJA 2BY3A 3CMMA 4A3KJ 1U9NA 3H4MA 3SYLA 1FTZA 3DEUA 2X85A 4JI2M 2EB7A 4G4OA 4RM3A 5DCMB 2IVMA 4JI4M 4AZFA 2MJ5B 3B7QA 1NTCA 5IP7J 1GDTA 3T15A 2JSCA 4DZJA 2G3QA 4L0YB 3ECOA 3FKIJ 5GP9A 4DV2M 1ZTRA 1Y39A 2HYJA 2CUZA 2KHHA 2ELJA 2V9KA 3KEYA 4L16A 1MDMA 2DJIA 3S32A 3BZ6A 2EV6A 5J47A 1RR8C 4UV9A 3M3YJ 2A61A 3UZUA 2HGCA 1IXZA 4NC6A 2KMUA 2LNBA 2P4WA 1QNTA 3LCVB 3UK6A 2CE7A 2LKSA 3BG6A 1Y1VJ 3JAMK 4P9FA 5TJJA 1NV9A 1NHGC 1KU9A 1WQ2A 1T38A 3A98B 3D8LA 2CUJA 3QAHA 3TO9A 3WHLA 3BR1A 1R4NB 2EUCA 4IVNA 1XWIA 3FTCA 2EWNA 4I76A 4PSXA 1VDDA 3KP6A 4Y7NJ 4E70A 4B08A 4LFAM 1X1DA 4ENJA 2PLYA 3U6LA 3HPGA 1TQIA 3CJTB 2EK5A 3W0FA 3VK7A 4LD5A 3IKVA 2FOWA 4WWCA 5KHDA 2LY2A 4RB0A 2DAKA 2XAJA 3K2ZA 3BG7A 2M87A 2GLOA 3GLGB 4HL4A 4EEFG 5CVJA 1IAWA 3WTSC 5E17F 2K86A 1JT6A 1D0KA 2DU9A 1R1UA 1UMQA 5JI6A 4WCGA 4A3BJ 2XGNA 3BG3A 2EFWA 3L2AA 3ZR8X 2DCEA 2WAFA 3A0HC 1YJ9I 1JGGA 1P2FA 3LW5F 4ZYAA 2DT6A 4S05A 3UMMA 3DLLF 1BA5A 2QUFA 1XS9A 1KYZA 3HHZA 5EYRA 3GLGA 2DJNA 2KJCA 3H3UA 3HEFA 3U60B 3BJOA 3GF2A 3JSPA 3SYKA 2JY5A 4IBIA 4CGZA 4BDZA 1JE8A 4HV5A 2DHYA 3K6GA 1V34A 4V2GA 1GT0C 3K70D 4JX5A 5HS8A 3JRIA 1E3PA 3A42A 3IUOA 5HOOA 1D1AA 4ZYGA 4IBBA 5D5XB 3DFZA 4E6KG 4XKCA 2EO2A 1HSTA 3R4KA 3QYEA 2VBXA 5GPAA 3ZMDA 4GC9A 3U60A 4KNYA 4KDPA 3HOXJ 1UZCA 1XCVA 3EUAA 3OYGA 2K02A 3IAM2 2L2DA 3GLGE 4M6VA 1UG0A 1UG2A 2HR3A 3R61A 4D1QA 4KICA 2CQNA 2V4JC 1NVMA 3WTTC 3KS8A 2FUG2 1MNDA 3ABLH 2JSPA 3S1RJ 3AOEC 2R46A 3J7YJ 2P0WA 1TZLA 3BG5A 3OYAA 4G3OA 2G0EA 2YS9A 4ZZDA 3IL2A 1J09A 3KP3A 1OCTC 1VQ8I 2DZNB 2NOJB 1VQNI 3S93A 4J01A 3BP8A 4I8OA 3GCMA 1D1BA 3RZDJ 4HBLA 4R7GA 5D5WB 3OYLA 3JTGA 3TKYA 3UJNA 2HQAA 2VC1A 4CUGA 1OQYA 5ILSA 1GXPA 5H37D 5H6QA 1B1BA 3WU1B 3T8RA 3VPRA 4HNUA 4LG3A 1WJAA 2ELHA 4XRSG 3KP5A 4BE0A 2ACJA 1P7IA 5DV5A 1EJ9A 2XKOA 2O8KA 2V1XA 1XXHB 4BS9A 3KS4A 1VQMI 2GXBA 2FNPA 4EM0B 1IC8A 1HNZM 3H5AA 4L9TA 4Q47A 2QGUA 4D80A 2ZSHB 1N75A 3AL0C 5JR3A 4KIFA 3CD6I 4LLLA 3T1HM 3KETA 1WWXA 5EG0B 2QM3A 1JJ6C 2E34A 2BOLA 2O61A 2L7IA 3KFUG 1WJBA 4HYEA 1HT1E 4BBAA 1F1ZA 3HHGA 2VKDA 1WSUA 1ZH5A 1G59A 1Z21A 5DYMA 1REPC 3LA2A 4Y33A 1F4IA 4PJLA 3Q0WA 2KDZA 3PNTA 2HPIA 3RCOA 3FD9A 3K9PA 1MBFA 4AIJA 2XASA 4EATA 3LSKA 3C9PA 3ABKH 2C99A 1OYWA 2IP2A 5M5YJ 2R7WA 4OX9M 1C1KA 3FHNA 1VQPI 2J7OA 5IP9J 3BR5A 3QP6A 3TWKA 2FQ4A 1V33A 3T1YM 2PMUA 4NBQA 2Y9ZA 4GFBA 2JMWA 3K4JA 2OOAA 3QOPA 1CGPA 2QCOA 1TDHA 2ERCA 1R4GA 4BE2A 1UM8A 2HFHA 5D5UB 4CCNA 2LXEA 4E7IA 3RKWA 1JKOC 2ZAOA 1XXHE 2BW3B 4LITA 1MJBA 1W0TA 4JI1M 5K5RA 2X49A 2K5CA 1KZHA 1IN8A 6PAXA 4AG6A 1IG7A 3BXWA 4NXMM 1ON2A 2X9DA 4B47A 4G7HF 4LJ6A 3D8BA 2CW0F 1PP8F 4PDKA 1T0FA 2CYYA 2RKOA 3ZGKA 3SDBA 4YFXF 1D8KA 1GV2A 1T39A 3FXQA 3H5RA 4W97A 2HVRA 2DZLA 1OCPA 3M0EA 3COAC 4G7OF 1P9QC 1WH7A 3N05A 4IXAA 3BR6A 1P6RA 4DW6A 2BW3A 1IXCA 4A6DA 1M1EB 5LLQA 3U6CA 3U1KA 3T1BA 2E5LM 1ETOA 1FSHA 3VKGA 1HW2A 1R00A 2EA4A 3EPZA 4M3GA 4OAZA 2OQGA 4X0GA 1OR7A 3S15J 3RI4A 2XF5A 1IDYA 3MZHA 2KW0A 1ZG1A 2XH9A 1WGLA 3FISA 2X1EA 3TBIA 4CSWA 1ORYB 5KAIC 1IN5A 1RUOA 4L9NA 3F3XA 2XAHA 4X66M 2L9VA 3KP2A 4XN0A 2WWYA 3OS1A 4XL9A 4FVMA 4PZJA 2X4HA 4LJ5A 4JI6M 4A3VB 3T38A 3ZMSA 3R60A 2EILH 2XVCA 4HDUA 1BIAA 3H3VK 1HNXM 3H0DA 2HTSA 2QYOA 4MEYF 3WODF 4LF7M 1FMVA 2W82A 4GHAA 2V26A 2VN2A 5J1YA 3HSFA 4CJ6A 2XLJA
chains in the Genus database with same CATH topology
3GLFE 3B89A 2JY6B 1WHCA 3ESWB 2JZ1A 2OOBA 2G3QA 2L4EA 3FRHA 2DKLA 2LBCA 2KHHA 1JR3E 2O25A 2DENA 1KYIA 2DI0A 1PVEA 1OAIA 1ZMVA 3K9OA 4Q7JA 1WR1B 2BWEA 2K9DA 1P3QQ 1HJPA 3LCVB 5JI2E 1ZMWA 1NV9A 2MR9A 1HQYE 1DV0A 1HT1E 2R0IA 1Y8GA 1F4IA 1T43A 2F4OB 1WJ7A 3K9PA 1IXSA 1V92A 1HT2E 2MROB 1SG9A 4UN2B 3FRIA 2MJ5B 1TP4A 2DAKA 3F92A 1MN3A 3GLIE 1VG5A 2JZ0A 2DAIA 1YLAA 3BBZA 2OOAA 2RRUA 4WP2A 2QSGX 4R71A 1T6OA 2K0BX 2LVPC 1R4GA 1EFUB 1VQ1A 1OTRA 2JY7A 1TTEA 2JNHA 2LVQD 1G41A 1XXHE 1CUKA 1QZEA 2LVOC 2LTUA 4HEOA 2DAMA 4F2LA 1VEGA 2L4FA 3IHPA 1BVSA 2EKKA 3LCUA 1X3ZB 2F4MB 1X3WB 2HWJA 5DFLA 2CP8A 2KNAA 2JY5A 2KNZA 2QSHX 1G3IA 1AIPC 1ZV1A 2DZLA 2DHYA 3FE3A 2HAKA 1IFYA 1NV8A 2B3TA 4GEWA 1PGYA 1VDLA 2EKFA 3IECA 3T6PA 1ZMUA 1G4AE 2ZTDA 1E94E 2JUJA 1WGLA 1Q02A 2L2DA 3GLGE 1OKSA 4DBGB 2LVNC 1DO2A 1DO0A 1VEJA 2WZJA 2DNAA 2QNJA 1C7YA 1TR8A 2DAGA 2KNVA 2LVAA 2EJSA 1XB2B 1IM2A 2QHOB 1GO5A 2MGWA 2BWBA 3E46A 4G3OA 3E21A 3MMPA 1VEKA 2DAEA 2H5XA 4F1IA 2ZTCA 4YIRX 1WGNA 2JY8A 1A5TA 3H4JA 2OO9A 1UFZA 2CWBA 1OQYA 2QSFX 1WIVA 3GLHE 2JP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLF E;  3B89 A;  2JY6 B;  1WHC A;  3ESW B;  2JZ1 A;  2OOB A;  2G3Q A;  2L4E A;  3FRH A;  2DKL A;  2LBC A;  2KHH A;  1JR3 E;  2O25 A;  2DEN A;  1KYI A;  2DI0 A;  1PVE A;  1OAI A;  1ZMV A;  3K9O A;  4Q7J A;  1WR1 B;  2BWE A;  2K9D A;  1P3Q Q;  1HJP A;  3LCV B;  5JI2 E;  1ZMW A;  1NV9 A;  2MR9 A;  1HQY E;  1DV0 A;  1HT1 E;  2R0I A;  1Y8G A;  1F4I A;  1T43 A;  2F4O B;  1WJ7 A;  3K9P A;  1IXS A;  1V92 A;  1HT2 E;  2MRO B;  1SG9 A;  4UN2 B;  3FRI A;  2MJ5 B;  1TP4 A;  2DAK A;  3F92 A;  1MN3 A;  3GLI E;  1VG5 A;  2JZ0 A;  2DAI A;  1YLA A;  3BBZ A;  2OOA A;  2RRU A;  4WP2 A;  2QSG X;  4R71 A;  1T6O A;  2K0B X;  2LVP C;  1R4G A;  1EFU B;  1VQ1 A;  1OTR A;  2JY7 A;  1TTE A;  2JNH A;  2LVQ D;  1G41 A;  1XXH E;  1CUK A;  1QZE A;  2LVO C;  2LTU A;  4HEO A;  2DAM A;  4F2L A;  1VEG A;  2L4F A;  3IHP A;  1BVS A;  2EKK A;  3LCU A;  1X3Z B;  2F4M B;  1X3W B;  2HWJ A;  5DFL A;  2CP8 A;  2KNA A;  2JY5 A;  2KNZ A;  2QSH X;  1G3I A;  1AIP C;  1ZV1 A;  2DZL A;  2DHY A;  3FE3 A;  2HAK A;  1IFY A;  1NV8 A;  2B3T A;  4GEW A;  1PGY A;  1VDL A;  2EKF A;  3IEC A;  3T6P A;  1ZMU A;  1G4A E;  2ZTD A;  1E94 E;  2JUJ A;  1WGL A;  1Q02 A;  2L2D A;  3GLG E;  1OKS A;  4DBG B;  2LVN C;  1DO2 A;  1DO0 A;  1VEJ A;  2WZJ A;  2DNA A;  2QNJ A;  1C7Y A;  1TR8 A;  2DAG A;  2KNV A;  2LVA A;  2EJS A;  1XB2 B;  1IM2 A;  2QHO B;  1GO5 A;  2MGW A;  2BWB A;  3E46 A;  4G3O A;  3E21 A;  3MMP A;  1VEK A;  2DAE A;  2H5X A;  4F1I A;  2ZTC A;  4YIR X;  1WGN A;  2JY8 A;  1A5T A;  3H4J A;  2OO9 A;  1UFZ A;  2CWB A;  1OQY A;  2QSF X;  1WIV A;  3GLH E;  2JP7 A; 
#chains in the Genus database with same CATH topology
 2EIK H;  2HVQ A;  2JY6 B;  4EMS A;  4H4K C;  3LSP A;  4YII A;  2HI3 A;  5JHU A;  2OAZ A;  2VAS A;  1HW5 A;  4BDY A;  1R6B X;  4I02 A;  2HOS A;  3L2C A;  2BXZ A;  3TPZ A;  5FFZ A;  3VOE A;  1B72 A;  3FXO A;  3RYP A;  4CO8 A;  2GM4 A;  1GV5 A;  2AXT C;  2F4I A;  4UVA A;  2LKP A;  4XLA A;  2C9O A;  2C5R A;  1VZ0 A;  3VFZ A;  1HJP A;  1XSX A;  4LIV A;  1QRY A;  1J5Y A;  4B3X A;  3U1D A;  2VOD A;  1E9R A;  1R7J A;  1SMT A;  2IA1 A;  2LMD A;  4AIH A;  3GQ5 A;  1S72 I;  1K7A A;  4FX0 A;  3JR9 A;  4JI3 M;  5FTJ A;  3H92 A;  2OU2 A;  3HHX A;  1AOY A;  1G6N A;  4B7G A;  2L9S A;  4DJA A;  5E20 A;  2KQR A;  5J4Y A;  3CC7 I;  3ZN1 A;  4E7H A;  4LB6 B;  2DA1 A;  5IPA A;  4A3I J;  3PIO F;  2KIS A;  1EF4 A;  2IA2 A;  3MCZ A;  4Y15 A;  5EEA A;  1IXS A;  1HSJ A;  1UHM A;  3G1L A;  3O2P E;  2UV1 A;  2VUM J;  3B9P A;  1ETX A;  1O7F A;  4HX7 A;  2VPL A;  3HHY A;  5H2F C;  2DPU A;  5M3M J;  4E7L A;  3BT9 A;  3DV8 A;  4ASN A;  4Z6Y A;  3M8J A;  2CV0 A;  1NG7 A;  4NC8 A;  3S3O A;  3CDH A;  2DAI A;  1QQW A;  2I5U A;  5CYV A;  4IRH A;  3ZQF A;  1ZN2 A;  1MMN A;  2CS3 A;  1QAM A;  3RIR A;  3CDI A;  3KP0 E;  1HCR A;  4IBG A;  1X2N A;  1Y0U A;  1CUK A;  1DGB A;  3HX3 A;  1MD0 A;  2YSR A;  1W1W E;  2K9N A;  2IT0 A;  3KOZ E;  1VEG A;  1PJI A;  3MD2 A;  2PMZ A;  2ME0 A;  3IWF A;  4OIP F;  2NRA C;  2F5C A;  2OD5 A;  1WXQ A;  3LCU A;  4P1W A;  1R5L A;  3A2K A;  3ABM H;  4G4N A;  2H1R A;  4RAF A;  1YIT I;  2OTJ I;  2VJ5 A;  1HOM A;  1N34 M;  1U9O A;  2DYR H;  2R7O A;  1G71 A;  4IO9 F;  2BHZ A;  2LFB A;  2X1C A;  5C4X J;  1NV8 A;  4FE7 A;  2M7B A;  4L5J A;  1O3Q A;  5F1R A;  1DQU A;  4C9Y A;  3RQ4 A;  1W5T A;  1EE8 A;  2V7F A;  1XDS A;  2LP0 A;  3MFK A;  4JK1 X;  4UUS B;  2KRU A;  1OIS A;  2YNM D;  2L6O A;  1PYV A;  3EUK L;  2GNO A;  2UXC M;  2VQL A;  4AID A;  4A12 A;  4U87 A;  3KVW A;  2HU9 A;  4FIS A;  3KX2 A;  1D0M A;  2HHH M;  5AIP A;  3TOB A;  4LCB A;  2V79 A;  2KDO A;  1LQ1 A;  4ITV A;  4EJO A;  3M1E A;  4XQF A;  1L2B A;  4LLN A;  4W1U A;  3OYK A;  3A45 A;  2LF7 A;  4PGG A;  2VJI A;  1YTY A;  3HJS A;  5EJC A;  2V1U A;  3OWT A;  1R2Z A;  3RGP A;  3KE2 A;  2H5X A;  2XB5 A;  3ZQG A;  1E0E A;  4OIR F;  1YG2 A;  4X1E A;  5D6F A;  1PJS A;  3BCB A;  2M45 A;  1UFZ A;  1KON A;  4ZZL A;  4RGX A;  2Z7J A;  1PM5 A;  2H1K A;  4GIP A;  3K4N A;  2L7K A;  3KSX A;  1WI3 A;  3C3W A;  3ESW B;  2OOB A;  5FTL A;  3C3E A;  1VQ6 I;  4MO7 A;  3JAM Z;  2MD5 A;  2K4B A;  3DTK A;  2HTJ A;  2FS1 A;  1TBX A;  2EFN A;  4W5W A;  1QVT A;  4HQM A;  1KYW A;  3DF8 A;  2R93 J;  2CJJ A;  2E35 A;  2YR2 A;  3KZY A;  3NWL A;  4JI8 M;  3TP3 A;  1OAI A;  1WR1 B;  3GVA A;  4HW0 A;  5AIQ A;  1PRB A;  1EH6 A;  1SD5 A;  4NXN M;  1RKW A;  1T3T A;  1LUJ B;  3CDL A;  5D8L B;  1YI2 I;  4M0D A;  4PD2 A;  2LC2 A;  1N25 A;  3C2H A;  1FOK A;  5EZG A;  1TQM A;  1WCM J;  2MR9 A;  1ORK A;  2DTR A;  3G2B A;  4S12 A;  2ZME B;  1OYY A;  4DOZ A;  3F72 A;  2LY9 A;  4NRW A;  3CZ6 A;  2KHM A;  2JK3 A;  2Z4R A;  2R44 A;  2XPV A;  3U2R A;  1Z3X A;  4LJ4 A;  1JTY A;  5FSW A;  2WC2 A;  3PL8 A;  4ON0 A;  3QRF F;  2M8E A;  4BUP A;  5E3N A;  4HQE A;  3LSG A;  4LF4 M;  1KU2 A;  1R1T A;  2D1H A;  2XHK A;  4OIN F;  2A5W A;  3CUQ C;  3C7J A;  3E4R A;  5DM7 F;  1E9S A;  1SG9 A;  1DGH B;  3KSJ A;  1R71 A;  4LRS A;  2DOD A;  4KO8 A;  1LEB A;  1FOW A;  2ZME A;  2LRE A;  1H6U A;  1X1P A;  3FM5 A;  4CH7 A;  3SAT A;  1IJW C;  2P5K A;  4A3E J;  1FIA A;  2BGC A;  2WB1 A;  2NNN A;  3Q9S A;  3CCR I;  2WA0 A;  3GTL J;  4YG2 F;  2DN0 A;  3DBH B;  2ICW G;  4B3A A;  4UHT A;  4XSZ F;  1FOY A;  2FD5 A;  2VQG A;  3HUG B;  4R1H A;  3LVW A;  1RPW A;  2QPA A;  1DGH A;  5EP3 A;  3L25 A;  2E1O A;  2K85 A;  2QCU A;  4HV6 A;  2D45 A;  1HKT A;  1DUX C;  3S1N J;  4RS8 A;  3KOW E;  5DFL A;  3PO2 J;  3E9S A;  4UV8 A;  2KNA A;  1R4M B;  2X1D A;  5LGN A;  1IV6 A;  3SYT A;  1FOX A;  3ZQL A;  2QZ4 A;  1OFH A;  3KLO A;  3KZZ A;  2L9N A;  3BZK A;  2PFB A;  2IGK A;  1MJG M;  2HZD A;  3HUG A;  4MNU A;  3WG9 A;  3DPT A;  4HEA 2;  2J5P A;  4XOP A;  3AG4 H;  1U5T A;  2P5T A;  3THG A;  4L4U A;  2K6B A;  5F0H A;  1MGT A;  2VXD A;  3HOZ J;  3S2D J;  2R5Y B;  4KT5 C;  4A3J J;  2R7X A;  3TWM A;  1LTM A;  4GIT A;  2P81 A;  4HG2 A;  2UZK A;  3V7S A;  1BC8 C;  1TC3 C;  1OLT A;  5E3O A;  3PNY A;  1OCZ H;  2FU4 A;  2OF7 A;  4RAY A;  4I0B A;  2DA4 A;  4IRG A;  3GLX A;  1VEJ A;  2GZW A;  5FFX A;  1OFC X;  2EIM H;  5J4V A;  3KOX E;  1ZQ9 A;  3IG8 A;  3SHG B;  5HVQ C;  1K3X A;  4LGM A;  3K7A J;  2R18 A;  3HRU A;  3V7R A;  5L3F A;  3C58 A;  1PP7 U;  5K7H A;  2VQC A;  4B7F A;  4BBS J;  5HDN A;  3TED A;  3FDY A;  1VQ5 I;  3EQL F;  4BGD A;  5D5V B;  1B4A A;  3VOD A;  3GQ3 A;  2Y75 A;  1TH2 A;  3ERM A;  1T6S A;  3HGY A;  4CIC A;  2GQQ A;  5FLX S;  2IXS A;  5CJ9 A;  2R5Y A;  1Z1D A;  4RA2 A;  1WGN A;  5CVR A;  4CGY B;  3GRV A;  4MH0 E;  2K7L A;  1O4X A;  1TT5 B;  1ETW A;  2CWB A;  3H9J A;  3K2L A;  3CCL I;  4IJF A;  3OIQ A;  1AKH B;  2KPM A;  2JA8 J;  1MMS A;  3D5S C;  1JUM A;  4HNV A;  5ICG A;  2ZBK B;  2M3A A;  4LG0 B;  1IN7 A;  3SAR A;  3I55 I;  3Q0V A;  1FZP B;  1KYI A;  2DI0 A;  3JSO A;  4IPA A;  3I0T A;  1QDR A;  3RKX A;  1SVO A;  3GTP J;  1GHC A;  1QQI A;  2FNA A;  2NQ8 C;  3J80 K;  1AKH A;  5IT9 S;  1J9I A;  5LGU A;  1WJC A;  2ZBK A;  2ZFU A;  1I1S A;  1Z67 A;  4LG0 A;  2KP6 A;  4XIC A;  2R5Z A;  2CW8 A;  1YO5 C;  2HKO A;  3PO3 J;  2R0I A;  1ETQ A;  5E1Z B;  4GC5 A;  1J5E M;  5DEQ A;  1OCR H;  2Y69 H;  3G1O A;  5F27 A;  4A5N A;  4MGK E;  4DV0 M;  1DP3 A;  1LB2 A;  2DOF A;  3CGW A;  3DWL E;  2EZI A;  1Z5B A;  1V92 A;  1TNS A;  2FML A;  5F0F A;  3FKJ A;  4AVP A;  2N35 A;  4KT6 A;  4MTE A;  2RDP A;  1VQO I;  3W2A A;  4WF2 A;  2ESH A;  1MN3 A;  2E19 A;  1UEL B;  3I01 M;  2DK8 A;  1NO1 A;  2VKE A;  1MIJ A;  3H9G A;  3UNG C;  3BBZ A;  4B8X A;  1EH7 A;  4JN6 A;  3B74 A;  4LF8 M;  3IV5 A;  1A04 A;  2JPB A;  4AQY M;  4ABZ A;  3QP5 A;  3CCQ I;  1LPQ A;  3U21 A;  1F4K A;  2WAQ N;  3TQN A;  2DAM A;  3L27 A;  2Z5U A;  3L00 A;  1KQ8 A;  3GLF A;  2ECB A;  3WHK A;  5E8I A;  3E6M A;  2LSO A;  1OAO C;  3Q8G A;  2R7D A;  3JRD A;  2G5G X;  3DXJ F;  2M8G X;  2TCT A;  2ZB9 A;  5ED4 A;  2VQF M;  2VDB B;  1I27 A;  2H8W A;  3GXO A;  4A69 C;  2VJ4 A;  1ZV1 A;  3WTY C;  4KMF A;  2WV1 A;  3HU1 A;  4LY6 A;  1IV8 A;  2LOO A;  1IFY A;  3G3Z A;  2C98 A;  4IQ4 A;  5DUK A;  3DA1 A;  3RTR A;  2GA1 A;  2Z2S B;  3PVS A;  2ZXJ A;  3ZP5 A;  4GEW A;  3SEQ A;  1G8X A;  2QZ8 A;  3DLA A;  4Q48 A;  5F08 A;  2D7G A;  1OFI A;  4WK8 F;  4I98 B;  1DU6 A;  1ZAR A;  3RE8 A;  2ID3 A;  4IHY A;  3GZ6 A;  2GIZ A;  1YRN B;  4IF4 A;  1AU7 A;  1F9N A;  4AKI A;  4D5C A;  4XR6 A;  3L2V A;  4NNJ A;  3A1Y A;  2CQQ A;  2V6Z M;  2Q0O A;  2NOG A;  3DU6 A;  3V4G A;  3K8Z A;  4G6Q A;  2PN6 A;  3SC3 A;  5HNH A;  2FSW A;  4ANR A;  4NB5 A;  2IA0 A;  1ETY A;  4RLF A;  4BJ5 C;  3PUB A;  4QWQ A;  2JN6 A;  2RKH A;  4UB6 C;  3G73 A;  3FUU A;  2L01 A;  3FHZ A;  1LEA A;  3DTI A;  3I4P A;  3L2W A;  1YRN A;  1R5G A;  1EV7 A;  5EEG A;  3MZY A;  1K78 A;  3RDI A;  3E97 A;  2OO9 A;  5FTN A;  3HB9 A;  2XRO A;  2E2J J;  4KIS A;  3G71 I;  2YPR A;  3ONQ A;  4LLG F;  3NAR A;  2RGV A;  3FK6 A;  4LFC M;  3FRH A;  1T95 A;  3IAS 2;  3RJP A;  4BNC A;  1LFB A;  4OWR B;  3HG9 A;  1T08 B;  2KDL A;  2DMQ A;  2DK5 A;  3MKZ A;  3OYH A;  2WSC F;  2NYX A;  4EIW A;  2JZY A;  4B09 A;  1ON1 A;  3WE3 A;  3LST A;  4H0E A;  1H88 C;  1R58 A;  1Z5A A;  4RKU F;  2DQL A;  4RM2 A;  3N97 A;  3V7C A;  2LTP A;  1LE8 A;  4M0W A;  1TF0 B;  1MBJ A;  2COM A;  3AOE A;  2BHY A;  2DMN A;  2FBI A;  1ZEL A;  3QPS A;  4UNO A;  1FEX A;  5J8C A;  2Z8Y M;  3CUO A;  5FKO A;  2VBY A;  5ILU A;  4N9I A;  1N36 M;  4KIT B;  1QHG A;  3RSN A;  4OOI A;  2J5Y A;  5FRO A;  3G6E I;  1XMQ M;  2R7Q A;  3GTO J;  1FT9 A;  3R9X B;  5IT3 A;  1ZGW A;  1T2K A;  3AL0 B;  3LOC A;  3SFI A;  1X4P A;  1MBG A;  3F9K A;  4YFN F;  5ITX E;  2A07 F;  4M71 A;  4G9Y A;  4S0H B;  3HOY J;  3F92 A;  1DGG A;  2XRN A;  3A02 A;  2W57 A;  4DR6 M;  4M3F A;  4OU0 A;  1U2W A;  2JZ0 A;  4DYC A;  3S3M A;  2STT A;  3HY5 A;  1Z5C A;  4OU7 A;  1YLA A;  1H0M A;  2LHG A;  3FUW A;  1IY1 A;  1LVK A;  2RRU A;  1USS A;  4QIW N;  3D5R C;  3LQR A;  2WSE F;  1JR3 D;  1ZKG A;  3MVP A;  1EFU B;  4XID A;  3IC7 A;  3CJR B;  2QQ8 A;  4TUW A;  5FLV A;  1X37 A;  2G7U A;  2M4K A;  3L9F A;  1G41 A;  1X19 A;  2PJP A;  2IAI A;  2W1O A;  3QU6 A;  3PSF A;  1IN6 A;  1RNL A;  1H9T A;  4LK1 F;  5F0C A;  2I7N A;  1HBX G;  1CQT A;  1X3Z B;  4XM3 A;  1OMI A;  3C2B A;  3FBI B;  1KQ9 A;  1ZGJ A;  2HNH A;  4ZDL A;  2X6Y A;  3JCU C;  1I5Z A;  4UUV A;  1AWC A;  3F8B A;  4LGW A;  3L26 A;  2P6S A;  3H9Q A;  4HPQ A;  3SAS A;  3OYB A;  1H89 C;  4NSO B;  4AWX B;  4IZZ A;  3E5Q A;  3CME I;  5B1B H;  3HXL A;  1VDL A;  1A5J A;  3IEC A;  1XSV A;  1E2X A;  3A4C A;  3LVV A;  2X4A A;  4X64 M;  4FCT A;  4KHP M;  3IH3 A;  4ZJZ A;  3HOU J;  1D0Y A;  1D0L A;  1N33 M;  2KZV A;  1XSD A;  3W2W A;  1BW5 A;  2FEZ A;  4ENK A;  1Z6T A;  2MG4 A;  2OUM A;  5L3G A;  2VOP A;  2M7A A;  3FKE A;  2A05 A;  3FK7 A;  1DO0 A;  2QNJ A;  4DYR A;  1A36 A;  2WAE A;  2H09 A;  5FTK A;  4REZ A;  1Z91 A;  3OYJ A;  3A01 B;  2RNJ A;  5C44 J;  1XMA A;  2G9W A;  3AG3 H;  3GLI A;  3HIF A;  5HLT A;  1WJE A;  2D1V A;  1MSE C;  2MC4 A;  5BQT A;  3ERE D;  2CRU A;  2Q8K A;  4R3D A;  5E3M A;  3LL7 A;  4BB9 A;  3BLY A;  4K0K M;  3R6S A;  1A5T A;  2FXA A;  3H4J A;  4C3I J;  3CF5 F;  3JR4 A;  2ZAM A;  4M73 A;  2CGP A;  2JP7 A;  1TWH J;  4IHV A;  4GGG A;  2ISY A;  2JZ1 A;  1S6L A;  1S7A A;  2F5V A;  2WBM A;  3V42 A;  3A01 A;  1O3R A;  4CXF A;  1IRX A;  2EZH A;  2KL4 A;  1GL6 A;  4QHT A;  1Q3B A;  1BI3 A;  3U61 A;  4RB1 A;  2O25 A;  4JI0 M;  3C18 A;  3BOQ A;  3OYN A;  3P9K A;  4ITQ A;  2ZC2 A;  5AON A;  1A6I A;  2BY2 A;  1ZMV A;  3H1C A;  1R49 A;  4LGY A;  3F8N A;  3BPV A;  4RF0 A;  1G8P A;  4F91 B;  2KXE A;  4ESB A;  3TE6 A;  4BXU A;  4CCO A;  1HLV A;  3ASN H;  2KLO A;  4LZZ A;  1XB4 A;  1HNW M;  2Z33 A;  3E3V A;  2VB6 A;  3DTE A;  3O6B B;  4CCM A;  1VQ4 I;  5K7Z A;  1F5T A;  2XPU A;  3LSJ A;  3NBX X;  2F5O A;  1Z7L A;  2PQ8 A;  2XAQ A;  1Y0N A;  2Z16 A;  2XSJ C;  2M0M A;  4M9X A;  5CPR B;  2LG4 A;  3HU2 A;  1XTA A;  2F4O B;  4LF5 M;  4Y3O A;  4YHH M;  4MLO A;  4IJE A;  1B9N A;  2F5F A;  3ZQH A;  4ANJ A;  2MA3 A;  2PBI A;  2O03 A;  4JI5 M;  3MKW B;  1ULY A;  2VE9 A;  3CCJ I;  5M5W J;  2OZU A;  2R7S A;  2DA3 A;  2R7V A;  3F23 A;  1SFO J;  3ABU A;  3BC8 A;  4UUT A;  2MLG A;  3F8F A;  3I04 M;  4LJ9 A;  4CIZ A;  4C30 A;  2G8L A;  4HF2 A;  1XPX A;  3LAJ A;  5K5Q A;  3EIE A;  1XNR M;  2QEN A;  3GTM J;  3G4S I;  2ZXH A;  3LSI A;  1FX7 A;  2JQ7 A;  3K4K A;  4LG2 A;  2HWJ A;  2JRM A;  1LV7 A;  4G4Q A;  2IEK A;  3MKL A;  4B48 A;  2O9L A;  4NRV A;  1FPQ A;  1VQ7 I;  5ERI A;  4U88 A;  1ETV A;  1QVR A;  2UUZ A;  2HAK A;  5K7F A;  4HNT A;  4Q4Z F;  3BPX A;  5C4J J;  3I59 A;  1BBY A;  3HOV J;  1E3H A;  4FE4 A;  4BAC A;  5HNF A;  1ZQ3 P;  3L7W A;  1RRJ A;  2MH2 A;  3HKZ N;  2DFE A;  3CLO A;  4ZH4 F;  4RB3 C;  1SXJ D;  4GKK M;  2V9V A;  3KDS E;  4LFB M;  3GW2 A;  1MKM A;  3H36 A;  4BJ6 C;  5BMZ A;  2AS5 F;  2MW8 A;  4CA0 A;  3W67 A;  3RGS A;  1XMK A;  4DR7 M;  4PSW A;  3RYR A;  1SXJ C;  1RKT A;  3M4O J;  2L09 A;  1BN5 A;  1C7Y A;  4M3B A;  3REO A;  5EXX A;  3FX3 A;  4B3R M;  5F1J A;  4M72 A;  1JKP C;  4HX8 A;  1R6R A;  1TWC J;  2B9S A;  3OSF A;  1IY2 A;  3PJR A;  2E7X A;  4L78 A;  4IBF A;  2YR0 A;  2KT0 A;  2DMP A;  1MNE A;  3TQS A;  4NUB A;  4F1I A;  4AM3 A;  1BR2 A;  2VT3 A;  3B6C A;  3P5J A;  1PUF A;  4IRI A;  1Z59 A;  3B7Z A;  1QZY A;  1WPK A;  3NAU A;  1E17 A;  1UCR A;  2F5P A;  4MFE A;  2GXA A;  4LF6 M;  4RAZ A;  5LHH A;  3J7Z I;  1K61 A;  3AJI B;  1WGX A;  2RV8 A;  2FBH A;  2KIM A;  3IHU A;  1NY6 A;  3K69 A;  3QYF A;  3E7L A;  1R7R A;  1XMX A;  4JI7 M;  1LDJ A;  2L4M A;  2P8T A;  2Y48 A;  4Y52 J;  2LBC A;  3VKH A;  1W5C C;  1WH5 A;  3J81 S;  2VF7 A;  3M7G A;  4MM3 B;  1WHU A;  4D7M A;  2DFF A;  2JUC A;  2X6W A;  1TH4 A;  1FYM A;  2DYS H;  2BWE A;  3SBJ A;  4ZYH A;  2DHR A;  1EKE A;  5LFA A;  5H20 A;  4CCL A;  3BJ6 A;  3FMR A;  5HDG A;  5EEH A;  1B72 B;  3UR3 C;  4II3 A;  2F5Q A;  4M74 A;  4B3T M;  2LVS A;  5E26 A;  4XLC A;  4LIU A;  3U5Z B;  2I8D A;  5FLX Z;  1FSE A;  1LFU P;  3LAP A;  4LJ7 A;  4YEL A;  3SAV A;  5BR8 M;  2I7P A;  4WX9 A;  2OJE D;  1U78 A;  3ZMZ A;  3BG9 A;  3HJE A;  4ZYD A;  2BXY A;  2E2I J;  5LRR A;  2UXX A;  5GAD J;  1BIB A;  3F6V A;  4A0X A;  1LDD A;  5TRD A;  1B59 A;  4BLC A;  4PT5 A;  1SVL A;  1I50 J;  1IXS B;  4X65 M;  2XZU A;  3U5Z A;  5F04 A;  1Z77 A;  5CVV A;  3DEW A;  1DDN A;  2LVP C;  3V8J A;  5GTH C;  1MBH A;  4MGZ E;  3ZCO A;  3HTU A;  4ENM A;  3ZMU A;  4HEO A;  1XN7 A;  3CTA A;  5IT9 Z;  2O0Y A;  1WZ2 A;  2J5O A;  3W2V A;  2LH9 A;  1NK2 P;  4XK4 A;  3FWE A;  5M5X J;  2ZFW A;  2AQE A;  2DA7 A;  1WJD A;  3ULQ B;  1IN4 A;  5J1R A;  3OS0 A;  2F2E A;  2EA0 A;  2LY1 A;  2O7O A;  2PG4 A;  5IZ7 D;  4JQF A;  1WKM A;  2EFP A;  3F6O A;  4M3E A;  1B9M A;  3CUQ A;  3DZD A;  2GBY A;  1BJZ A;  4FW9 A;  2E5Z A;  4FQG A;  5J3L A;  3BTJ A;  3GUD A;  3HRS A;  1X1C A;  3FIW A;  1JKQ C;  2A6E F;  5E1W A;  2E60 A;  2KIQ A;  4CYD A;  1CF7 B;  4AKH A;  3CCV I;  2JUJ A;  1SAX A;  1JT0 A;  4BE1 A;  1DGW Y;  3HJQ A;  4LZJ A;  4XLE A;  4EV0 A;  5KPZ A;  4L6V 6;  2RN7 A;  5C3E J;  4J00 A;  2OBP A;  4F92 B;  1F43 A;  2FBK A;  4NC7 A;  1XB2 B;  2BEO A;  2BE5 F;  1NY5 A;  1R2Y A;  4JV5 M;  3SEZ A;  2MGW A;  1P4W A;  3I4Y A;  5IYC J;  3CQZ J;  1ZLK A;  3WHB A;  1CF7 A;  3RPU A;  1XGO A;  3NQO A;  3GYH X;  2QBY A;  1O7L A;  2Z9O A;  3TW7 A;  3OIP A;  1FC3 A;  3K2A A;  1U0J A;  1OCC H;  5HLH A;  5FLX K;  3RZO J;  4ZPX A;  3O3K A;  3I4V A;  2TRT A;  3OV8 A;  1BW6 A;  2WTE A;  4PK4 A;  5HS7 A;  5E18 F;  3Q5F A;  2QQA A;  4O6J A;  3TDZ C;  1H9G A;  3MZ8 A;  2FA5 A;  1FMW A;  1FTT A;  1ACI A;  2N8G A;  1HDD C;  2DKL A;  1MZB A;  3H0G J;  2BV6 A;  2DI3 A;  1UHW A;  3S16 J;  2DA6 A;  1D8J A;  4Q7J A;  2XUB A;  4M3D A;  1MH4 A;  1SFU A;  5IYD J;  3GPX A;  5A2Q S;  4AKG A;  1J2X A;  4M9Z A;  4HLY A;  1YUB A;  2HOA A;  3PFY A;  2KIU A;  2EBI A;  2MFZ A;  3QQA A;  5IT9 K;  1HQY E;  4DGW B;  3CMA I;  1GXQ A;  2JRT A;  4HF1 A;  1OIP A;  2JA7 J;  4IBC A;  1SAN A;  1Q39 A;  3EUH C;  2KIF A;  1NNU C;  3TDU C;  1QPI A;  3MMY B;  2MRO B;  3W6V A;  2XGC A;  5DDG A;  1W5S A;  2DWZ B;  3VK8 A;  1W0U A;  3A46 A;  1YQA A;  3ZPL A;  1PJQ A;  1IDZ A;  1MMA A;  1FBU A;  3S8P A;  4N4N B;  2HDD A;  1Q1H A;  2L2O A;  3S1Q J;  3DQV C;  1P92 A;  3CMY A;  2D2W A;  1S8N A;  1VQ1 A;  2BJW A;  3BR2 A;  2K9S A;  2XIG A;  1BI1 A;  2VLA A;  5ITU A;  2LVO C;  2CQX A;  2MGQ A;  3K4B A;  4U0W A;  5M3F J;  2FX0 A;  1FYL A;  3HOT A;  1YYV A;  1L1T A;  5FB2 A;  3SFZ A;  1BVS A;  1NHW C;  4QPQ A;  2EKK A;  2VQH A;  3L2Q A;  4CHU A;  1YHQ I;  2L9R A;  4IHX A;  2ETH A;  3NRV A;  3LNQ A;  4Q5S F;  4AIK A;  3EYY A;  4V19 K;  2E5N A;  3OYD A;  2ZKZ A;  1R5I D;  1TNT A;  2HOE A;  2X6X A;  1E32 A;  5IWA M;  5E3L A;  4BY7 J;  5BS6 A;  4LJZ F;  2B3T A;  1I94 M;  2O6G E;  2STW A;  2R92 J;  3ZRG A;  1YS6 A;  1D3Y A;  2CQ7 A;  4RDU A;  3VB2 A;  4AU7 A;  3WTU C;  2DPD A;  3S2H J;  2M34 A;  5DYI A;  2HL7 A;  1ETK A;  2EA2 A;  3UKG A;  4I09 A;  4AYB N;  2E1C A;  4X6A J;  1Z0X A;  2GIV A;  3RPU D;  1MJA A;  1NH3 A;  2K3P A;  5EZH A;  2EIJ H;  3I64 A;  1LDK B;  1U5T B;  2D7E A;  5J40 A;  4NQW B;  1V5E A;  3I4M J;  3ASO H;  4DBR A;  3FYC A;  3I4N J;  1OIZ A;  2ZXI A;  3CCS I;  3MWM A;  3CC2 I;  4HDV A;  4A0Y A;  4BL0 B;  2WY8 Q;  2E1M C;  4QOS A;  2CW7 A;  4C2U A;  4LB5 A;  2HVS A;  1SAU A;  1P4A A;  1YW7 A;  3IKT A;  2WV0 A;  1PDN C;  2A6H F;  4YIR X;  2DO7 A;  4B1R A;  4KLN A;  3FXU A;  3HRT A;  4F93 B;  2CU7 A;  3GTJ J;  1SVM A;  2CV1 A;  2W7N A;  1S3S A;  1WJF A;  2RGH A;  4NQW A;  3QAU A;  2H6B A;  1SMY F;  1GVN A;  4L9J A;  4OMZ A;  2K27 A;  5D4R A;  2MBF A;  1D2N A;  3I9V 2;  2MLK A;  1QUT A;  4G8X A;  2WAQ A;  4IKF A;  4I81 A;  3GO8 A;  3ZXS A;  2E1N A;  1IRF A;  2NVX J;  3F8C A;  2M5W A;  3QOD A;  4MGR A;  3O8G A;  4AC0 A;  2C9C A;  3U6S A;  2HKX A;  3VYS B;  3WTX C;  2YUS A;  1AUA A;  2JA2 A;  2OZ6 A;  2IBD A;  4GXO A;  1IQP A;  4I6Z A;  2EH3 A;  2F5D A;  2CEA A;  3GME A;  3PXG A;  1JKR C;  5L8R F;  1QGP A;  1ZMW A;  2O5R A;  2P6T A;  5BNG A;  4U7D A;  2OQR A;  3EDP A;  1G4D A;  4I01 A;  4QPO A;  1JHF A;  5F3W A;  4Z2Y A;  4C3H J;  2KZG A;  2M1B A;  2B63 J;  5KQ8 A;  1O3S A;  1FBQ A;  1NJF A;  2R5Z B;  3HWS A;  1SFE A;  2GXG A;  3MHV C;  1TP4 A;  1BJA A;  3JR5 A;  2XSD C;  1D0X A;  4AD9 A;  2DFI A;  4I7H A;  2ESN A;  4BBR J;  5B1A H;  4A3L J;  1STZ A;  4ZC3 A;  2K40 A;  2HQ5 A;  1YOV B;  3V76 A;  2IPQ X;  3JRB A;  1ZRD A;  4WP2 A;  3DPU A;  2JNH A;  1TH3 A;  2AHM A;  3HGG A;  1ZHF A;  2NNY A;  3E5X A;  1A6Q A;  2QWW A;  3KP4 A;  2GQF A;  3Q8X A;  2IGM A;  3GP1 A;  4F2L A;  4BQQ A;  3HTS B;  3WTZ A;  1S29 A;  1XGS A;  2ME6 A;  3PUF A;  4Y17 A;  2RNG A;  1V55 H;  1X3W B;  3M8F A;  2CP8 A;  1VQK I;  2K9M A;  2ZSI B;  3FM3 A;  1BOA A;  4KMU X;  3WGG A;  2P5L C;  5DNY A;  2W24 A;  3F22 A;  2R0Q C;  1Z9C A;  3GLF B;  4XNF A;  1GJS A;  2CFX A;  2JWS A;  1MMG A;  3HPH A;  4EGY A;  1SEU A;  1FYK A;  2EJR A;  2WB1 N;  4RBO A;  4PCZ A;  3BTI A;  1LJ9 A;  1OYI A;  5KCM A;  4DYQ A;  5FJ8 J;  1ZR2 A;  2F4V M;  2VL8 A;  3DPL C;  1VFC A;  5KPR A;  5HLG A;  2EKF A;  3E6C C;  4J19 A;  4PJJ A;  2KA6 B;  2XSZ A;  1KGS A;  1MH3 A;  3WU2 C;  1YIO A;  3SZT A;  1B8I A;  2R3S A;  4XGI A;  5J1U A;  4E7K A;  2IS2 A;  4DBG B;  1YIJ I;  2EFQ A;  2JTV A;  3DKW A;  3VYR B;  2DAG A;  1I6X A;  4FWH A;  2JPC A;  1JR3 A;  1O57 A;  2VII A;  3KP1 E;  3GPU A;  1S7E A;  2OV7 A;  3GWZ A;  2QHO B;  1GO5 A;  3I5U A;  3KLN A;  3NWS A;  3W6J B;  4G94 A;  3BTC A;  4D7N A;  2DQR A;  4DZP A;  5ITQ A;  3OYI A;  1PUE E;  3D5L A;  2L02 A;  3IG5 A;  1SFK A;  3J2P B;  1R9T J;  2EV0 A;  2FOK A;  2DAE A;  3N4M A;  4I99 C;  2ZO4 A;  4F3Q A;  3CCE I;  1BI0 A;  5K1Y A;  1U8B A;  1IY0 A;  2JY8 A;  3BR3 A;  2XF6 A;  3P9I A;  1YW8 A;  1IZ1 A;  2KRH A;  3U6M A;  1J0R A;  3ROU A;  1G2H A;  1QA6 A;  4HST A;  3M1C A;  3GLF E;  3B02 A;  2P7C B;  5JVT A;  4BY1 J;  4DV7 M;  4IBE A;  3OYC A;  1K78 B;  5EQT A;  1BC7 C;  1JR3 E;  3LSR A;  2W84 A;  1RC9 A;  1G3T A;  3BY6 A;  2KRK A;  3W0L B;  3HKP A;  1XC8 A;  3M9A A;  3K9O A;  2Y0S N;  4OW0 A;  2K9D A;  3CF0 A;  5GAG J;  2OPT A;  1U3E M;  3DKY A;  1R22 A;  3GEZ A;  2QQB A;  4E7Z A;  4HZF A;  3AG2 H;  3R0A A;  4P17 A;  4AI6 A;  1HQC A;  4RGS A;  2FOI C;  4RF1 A;  4PJN A;  4OIO F;  1Y1W J;  3ABT A;  2DT7 B;  2Y30 A;  1TWA J;  2RQQ A;  2JT1 A;  5ICF A;  2L5Q A;  4KOD A;  4NSR A;  3BCA A;  2BY0 A;  1LE8 B;  4ZDO A;  2MD0 A;  4QTR A;  1TT0 A;  3TP0 A;  3ZQJ A;  1YSY A;  1Q1V A;  2HZT A;  5CLS A;  2CQK A;  3V8K A;  4XN3 A;  3LQQ A;  4I0A A;  3GO5 A;  3FTD A;  5DYG A;  4NDL A;  4ENN A;  4UN2 B;  5ILV A;  1WI9 A;  1K79 A;  1VG5 A;  1L0O C;  1FIP A;  4B4C A;  4BQO A;  1JGS A;  3MKY B;  2UXD M;  2VJJ A;  2V1C A;  4MIM A;  4BAY A;  3J81 Z;  1IGN A;  4RNA A;  5KK1 A;  5EXP A;  4A2U A;  1OTR A;  2EFO A;  4DIQ A;  1HA8 A;  3H5N A;  3JRH A;  1YJN I;  5JI3 E;  4MEX F;  4YIF A;  2HYG D;  1C0W A;  1E3O C;  3EYI A;  5B5E C;  4IBJ A;  1QAN A;  4DR3 M;  5JHF A;  5KQD A;  3HYI A;  3RPQ A;  4JYK A;  3T8T A;  3W6K B;  3KYC B;  1K82 A;  2UXN A;  2V6E A;  1W36 D;  5B66 C;  2IS6 A;  1I3Q J;  2QKL B;  2VQE M;  3J7B A;  4XLH A;  2XSZ D;  5FKK A;  5HDK A;  2HWV A;  3WG7 H;  3FE3 A;  2A6T A;  2AHQ A;  3FUT A;  2VXZ A;  2RRE A;  2DOA A;  2VPR A;  3CJN A;  3ZQQ A;  1YE9 A;  1W36 C;  1Z05 A;  2PEX A;  2A68 F;  1TL8 A;  1ZG5 A;  1J75 A;  3GLL A;  3C1D A;  5IRE B;  3PNV A;  2XC7 A;  2DDB A;  2XGX A;  4II2 A;  1R36 A;  2AQF A;  2XPW A;  3ZQI A;  1NK3 P;  4L18 B;  3U6Q A;  5E1X A;  1K3W A;  3L2U A;  3GPP A;  2CO5 A;  1ZMU A;  3IWZ A;  2VKH A;  2R4E A;  1ONV A;  4RGR A;  1WFX A;  5GAE J;  3ECH A;  4ZDP A;  5FD6 A;  2XZF A;  1WVR A;  2LKX A;  2QP9 X;  2HOT A;  2QF7 A;  3DKX A;  3GZ5 A;  1XX5 A;  4XON A;  2LH0 A;  2LVN C;  5D6E A;  3OL4 A;  4Y4R A;  2C6Y A;  1JXS A;  1OJL A;  2LWX A;  1T8I A;  1XCB A;  4LOC A;  2HPM A;  2C96 A;  3PQJ A;  1HXD A;  3LWF A;  2L7H A;  2Z3X A;  4A3D J;  2QKM B;  3KYD B;  3BQY A;  4EJU A;  5JLX A;  4D81 A;  1UST A;  5DCM A;  1O3T A;  3J80 S;  3TGN A;  1D0Z A;  4N4O B;  3SAU A;  3ZN0 A;  3E46 A;  2W4S A;  1D1C A;  3ILK A;  3VDP A;  3JW4 A;  4XLN F;  2DW4 A;  4X62 M;  3LFK A;  4HOB A;  1EH8 A;  5DD4 A;  4MGI E;  4AVZ A;  2J7N A;  3QYB A;  1RI7 A;  2HKJ A;  4XSX F;  2LBF B;  4CCK A;  1SXJ B;  2O8X A;  1D5Y A;  2VF8 A;  2OQ4 A;  2VKV A;  3IH2 A;  5K5O A;  1YS7 A;  3GLI B;  1N78 A;  3GFL A;  4FTH A;  3DU5 A;  3KP7 A;  4PUS A;  2QSF X;  1X58 A;  5F6F A;  1X1A A;  3L09 A;  3B89 A;  5EGO B;  1YX3 A;  5IOY A;  4KYW A;  2L4A A;  4MQ9 F;  4B44 A;  2ZJP F;  1YW9 A;  3I54 A;  2ZM6 M;  4KIB A;  1BM9 A;  4FCW A;  2DEN A;  2LBF A;  3J81 K;  2JA6 J;  1SXJ A;  3L28 A;  4DR2 M;  2VIX A;  4IOA F;  3JTH A;  4HLX A;  4LMY A;  2LHC A;  2X8A A;  4M6X A;  3IRQ A;  1XC5 A;  3CCY A;  3U61 B;  3DCF A;  3I53 A;  4C2M J;  5EGO A;  2MH9 A;  4HRI A;  1UFM A;  4F7Z A;  4L9V A;  4BKX A;  1NSF A;  1IUY A;  3HKZ A;  2L7M P;  4A3G J;  2QQ9 A;  1YFH A;  2K9L A;  3GTG J;  3S14 J;  5CVU A;  1Q3C A;  5FKL A;  4ZTF A;  3OR1 C;  3CF6 E;  1Y8G A;  3QPH A;  4PDI A;  4QOZ C;  4PJ0 C;  2A69 F;  5CQE A;  4EGZ A;  1QBJ A;  4BHC A;  1KSF X;  3A03 A;  3KEQ A;  3HRM A;  4DNC A;  1L3L A;  4OVZ B;  1FY7 A;  2CG4 A;  3VSK A;  1SXJ E;  7CAT A;  1FP2 A;  3FRI A;  2ADU A;  4BHB A;  2R7F A;  3GLI E;  2XF7 A;  2R62 A;  1G3W A;  3KXE C;  2B0L A;  4K2E A;  1UB9 A;  2KJB A;  2RAE A;  2HQN A;  3K9T A;  4XKW A;  4XOT A;  5HLI A;  4BJT A;  3CTW B;  1T6O A;  1JUS A;  1AHD P;  3K70 C;  1TTE A;  3I58 A;  2LVQ D;  2LF8 A;  4CZZ A;  8CAT A;  1R1V A;  2XGE A;  4UXN A;  5KVR A;  3SJM A;  1ZLJ A;  5A2Q Z;  4OVZ A;  2X51 A;  3JRF A;  3L29 A;  1KQ0 A;  4U0Y A;  1ZR4 A;  4LK0 F;  3JRA A;  3IHP A;  1S5L C;  4MFD A;  4YFK F;  2AO9 A;  4TV7 A;  4E7J A;  3OL3 A;  2XAG A;  5DCF A;  3SZP A;  3GRR A;  3U9G A;  1BR4 A;  3FTE A;  1W4M A;  3HM5 A;  5LMU M;  4P96 A;  1QYR A;  2JWT A;  5LGT A;  1OKR A;  3FF5 A;  1JJ8 C;  3J27 B;  3BRO A;  1HKS A;  2NS8 A;  1RR7 A;  1ZAO A;  2APL A;  1SD4 A;  1P4X A;  2Z99 A;  4JOM A;  3GTQ J;  4E4H A;  3U6D A;  3OR2 C;  3T6P A;  2X48 A;  3GX4 X;  2M5Z A;  3O8H A;  1K83 J;  3I59 B;  5FKN A;  1E94 E;  4RMN A;  1PJR A;  1Q02 A;  5GAH J;  2Q2E B;  1FJL A;  2UXB M;  5L3E A;  2OTL I;  5GPC A;  3MQ0 A;  2EPF A;  4U0V A;  3P9C A;  4A5M A;  5FGM A;  3KYL A;  4D9J A;  3P7N A;  4XRM A;  4D5F A;  3HJ8 A;  2JUG A;  3ZH9 B;  4KA4 A;  1QZZ A;  3KW6 A;  2FRH A;  1JQJ C;  4II7 A;  2BNK A;  4MB7 A;  5EXS A;  3KIO A;  4HA8 A;  4L15 A;  5ITT A;  1IRG A;  3IP4 B;  1VEK A;  2ZNZ A;  3EIH A;  3ML6 A;  4QSH A;  2Q2E A;  3QPL A;  2X0L A;  4A3M J;  3KPH A;  4PGH A;  4Y28 F;  3OMY A;  2RVC A;  3OIO A;  1GKI A;  4PFP A;  1XXH A;  1XGM A;  2HEO A;  4DV6 M;  4B3M M;  4BYY A;  3M8E A;  4BH9 A;  3ZOB A;  2A5Y B;  1P7J A;  4C2T A;  4L8R C;  3S1M J;  1PUF B;  3NWT A;  2MSY A;  1I3A A;  4UB8 C;  1K6Y A;  1TWG J;  1PJJ A;  1BI2 A;  2M0C A;  2ZCW A;  4CIS A;  3CJQ B;  5D4S A;  5J8F A;  3LSM A;  5EG0 A;  3ISP A;  1ZRE A;  1QDT A;  2LK2 A;  3K1P A;  3GRY A;  3DBR B;  2Y21 A;  1PVE A;  2XDV A;  2R45 A;  3T0Y A;  1XD7 A;  4A0Z A;  1R5H A;  3X2Q H;  3UGJ A;  4NOO B;  4NHJ A;  4DR4 M;  5A2Q K;  3L2R A;  3JRG A;  1Z6R A;  2IJL A;  3OS2 A;  3AG1 H;  2MH8 A;  3W3C A;  4FAS D;  4IHT A;  4QNM A;  4FHT A;  5E6J A;  3GPY A;  2QVO A;  3HDD A;  3FZV A;  4B7H A;  3NEU A;  3VDU A;  1A31 A;  2H27 A;  3IH4 A;  3QPT A;  3TO6 A;  5KAF C;  4XMY A;  1WJ7 A;  2CH0 A;  1ZAE A;  3ZQC A;  1N77 A;  1WJ5 A;  1GL7 A;  2ZJQ F;  2CSO A;  3FMQ A;  1HT2 E;  3FXJ A;  4U7B A;  5FRM A;  5IP6 A;  3U6O A;  1FWZ A;  2DTZ A;  1V3F A;  4CZC A;  2X6O A;  3KOY E;  3OYM A;  3L1P A;  3K1N A;  1TGU A;  2R65 A;  3FXM A;  4I5S A;  3TWL A;  3LA3 A;  5F64 A;  3D1N I;  5KO3 A;  2R7U A;  2IS1 A;  2XV4 S;  2ZJ2 A;  2VOO A;  1ENH A;  2H1L A;  4JBA A;  2WAD A;  3C3D A;  5E8G A;  2OPF A;  3RQI A;  3VDX A;  1ZRC A;  4XOR A;  2DVW B;  4D82 A;  3SQN A;  2H94 A;  2L3D A;  4AUX A;  1S7O A;  5HS9 A;  3TL4 X;  2M60 A;  2R4G A;  2HS5 A;  2BY1 A;  5DM6 F;  3U6E A;  1I1G A;  3I51 A;  1APL C;  2RGO A;  4WXD A;  2VBW A;  1K4S A;  3FXR A;  2QSH X;  2KEB A;  2FF4 A;  2XAF A;  3E1S A;  3FUV A;  3GLH B;  3HL2 A;  5B3S H;  3CF2 A;  3EUH A;  1XMO M;  5IY5 H;  3BWG A;  2ZXW H;  2KRF A;  4BXX J;  2UUC M;  2RC4 A;  2QLZ A;  3VYT B;  4PDG A;  3DFG A;  4ETS A;  3J7A S;  1RES A;  1QZM A;  2XEP A;  3G1M A;  4HAM A;  4M6Y A;  1FBS A;  2A3S A;  3F0C A;  4GDF A;  2XKP A;  2ZTD A;  3CUQ B;  3GLH A;  4EJV A;  2XFT A;  1FNN A;  4YRV A;  4XBF A;  1RU3 A;  3HOS A;  1DGR M;  2VI6 A;  1TR8 A;  3ZQ7 A;  2HDC A;  3ELK A;  1Y56 A;  5HOD A;  1IM2 A;  4XBO A;  1ZG3 A;  1HDP A;  5L3D A;  2DT5 A;  5ICE A;  4DUY M;  1V54 H;  2DDA A;  3CO6 C;  4IJA A;  2COB A;  3FMS A;  2UU9 M;  3SZG A;  1DU0 A;  2DZO B;  2ZTC A;  1JHH A;  2W25 A;  5IYB J;  3WU0 A;  1EA3 A;  1MMD A;  3S2W A;  1KA8 A;  3GLH E;  3W68 A;  2FH0 A;  1B6A A;  2O01 F;  1NNJ A;  2UUB M;  2JVH A;  5LEK A;  4DV4 M;  1WHC A;  3H35 A;  1TW2 A;  2QBY B;  4FD2 A;  4GYG A;  2BZT A;  2E1M B;  5DD8 A;  1W7P B;  2ZNY A;  3S17 J;  3SMS A;  9ANT A;  1VQL I;  2XRL A;  4KN7 X;  2LRD A;  2CFO A;  1BR1 A;  3Q3S A;  3SDG A;  2AXL A;  4EVI A;  2P5V A;  2EZK A;  1IF1 A;  5EP1 A;  4BU2 A;  2JA5 J;  3TOA A;  5IOZ A;  3D0S A;  2L7F P;  2NS7 A;  3NBI A;  2LR8 A;  2V6C A;  4JX6 A;  3LMM A;  4L0Z B;  3WE2 A;  4AW4 A;  1TLH B;  3ZC7 B;  1DV0 A;  1W7P A;  4FWD A;  2F6C A;  4DV1 M;  4IOC F;  3PFI A;  3J7A O;  3FBN B;  1ODD A;  1T0F C;  2M2E A;  3RKY A;  3HHW A;  4AYB A;  2TDX A;  5TGT A;  1SD6 A;  5KNL A;  2IS4 A;  1T43 A;  1YLF A;  2HQR A;  1IO2 A;  4L5E A;  2ELK A;  3J7A Y;  1VND A;  3WTV C;  3CP8 A;  3MK6 A;  1IBK M;  2LNH C;  2FMY A;  1TWF J;  4IIW A;  1H8A C;  3K92 A;  2OCC H;  3WGI A;  2M30 A;  1OR7 C;  2JXN A;  4IQJ A;  3FUX A;  2BVL A;  2K0B X;  1GUU A;  1I6H J;  3OY9 A;  2JY7 A;  3DOA A;  4AG5 A;  2NAZ A;  2FQ3 A;  4KUM A;  4GH9 A;  5LEJ A;  2QA4 I;  3OSG A;  1RIO H;  2Y20 A;  4EM1 A;  4A3C J;  2D7H A;  4WW0 A;  2F48 A;  4FET A;  4WXC A;  2ISZ A;  4XLP F;  1MJ9 A;  2R7Z J;  2F4M B;  3CCU I;  1QAO A;  3ZCB B;  4DV3 M;  2GOX B;  4HX4 A;  2BVM A;  4QHS A;  2I10 A;  3Q0U A;  2KNZ A;  2UWM A;  1AIP C;  3HSR A;  2XF3 A;  4IL6 C;  4UUS A;  3FXK A;  3SHF A;  4V2F A;  3HC7 A;  5FO5 A;  3CP2 A;  3B7N A;  1G3Y A;  1AA7 A;  1Y6I A;  2W00 A;  1U8R A;  1QVU A;  2Y0M A;  4RAG A;  3JRC A;  3RKQ A;  2RQP A;  1PGY A;  1XGN A;  4FT8 A;  1VTN C;  1HC8 A;  2HCB A;  1X4O A;  2Z3Y A;  1K6O A;  4MGY E;  2DWM A;  1SFX A;  4N9H A;  2FJ1 A;  1D5V A;  4HLQ A;  4GRI A;  2L54 A;  3RFW A;  5J6X A;  1T98 A;  3Q9V A;  3SAW A;  2EIN H;  2CWE A;  1QPM A;  3LA7 A;  4R79 A;  1OKS A;  2R4J A;  2O3F A;  1VQ9 I;  5EP4 A;  1XDU A;  3VEP A;  1Z7U A;  1MW7 A;  4G6Z A;  2WZJ A;  2DNA A;  4LFU A;  1Y8R B;  2KNV A;  2LVA A;  1ERD A;  3K1J A;  3HZJ A;  2JJ7 A;  1POG A;  1NHA A;  2BWB A;  1KFV A;  4DQ2 A;  3WGH A;  1DPU A;  4NL4 H;  3MMP A;  4CYC B;  4KN4 X;  3I56 I;  1VI0 A;  3PIP F;  4ESF A;  2D5V A;  3S3N A;  1J59 A;  5BPD A;  3QWL A;  2DFH A;  2ZAN A;  1L2D A;  1UJ8 A;  2KZU A;  4MGH A;  1HKQ A;  2V1D A;  2PMZ N;  3K4C A;  2M9H A;  2NS0 A;  4B43 A;  1IUF A;  2KKO A;  3KEO A;  4P16 A;  3HHH A;  4RGU A;  1XG1 A;  2FE8 A;  3BDD A;  1GVD A;  3CLQ A;  4LF9 M;  4O3M A;  3QOE A;  1F36 A;  2WY7 Q;  3CCM I;  1W7P D;  1KU7 A;  2F5N A;  2P7V B;  3OYF A;  5KPT A;  4CYC A;  5DS9 A;  5TIS C;  3SMP A;  2Y31 A;  2Y0T A;  4GO1 A;  2XFS A;  5LBQ A;  1QUS A;  2V1N A;  3HU3 A;  1V5F A;  2BYV E;  1P3Q Q;  4P55 A;  1JB0 F;  3B73 A;  4KFC A;  3OTO M;  3I3L A;  4CDG A;  1MBE A;  3R8F A;  2YX7 A;  2ZJR F;  2E36 A;  1PJT A;  2KRC A;  2L0K A;  4CCJ A;  3J80 Z;  1FJG M;  2H8R A;  4IBK A;  4C3J J;  2VT2 A;  1JTX A;  1UHS A;  2ID6 A;  4EQQ A;  4XLF A;  5EF6 A;  1XNQ M;  1ZYR F;  3ZMV A;  2Y0Q A;  1KU3 A;  4JX4 A;  5ITY A;  4KJZ A;  5CKT A;  5LRS A;  2CV2 A;  5JVG F;  5FLM J;  3HOW J;  4LRT A;  1R23 A;  4MTD A;  4CHT B;  2OA4 A;  2GOM A;  4XRF A;  2MYS A;  4IBD A;  3GZN B;  1XHB A;  1NG6 A;  2Y2Z A;  3E6D A;  4PJM A;  4EJT A;  2F5E A;  5C18 A;  3SXY A;  2KFD A;  5DUI A;  1NJG A;  2LDU A;  3GBG A;  4JYA M;  2NXN B;  4FCY A;  4L5I A;  5L3C A;  4R71 A;  3BZC A;  3B6A A;  4BHP A;  1V4R A;  1V5G A;  1ZGA A;  2E71 A;  2VON A;  5H6R A;  3TMO A;  5BPI A;  3F8M A;  3LSH A;  3MAJ A;  3TO7 A;  5ICC A;  4ESJ A;  4GKJ M;  2L4F A;  3GFI A;  2PI0 A;  3GTK J;  2K4J A;  1HR0 M;  4FWG A;  5CQG A;  4JP0 A;  4S04 A;  2DWN A;  3VWB A;  1G3I A;  5EP2 A;  4IEJ A;  2GWR A;  1JI8 A;  5EDN A;  2NVY J;  4WUR A;  4DUZ M;  4DR1 M;  1L2C A;  2CUF A;  2LYC A;  5LD2 C;  4BQA A;  4G4R A;  4QNR A;  3DEE A;  4P9U A;  2R7T A;  4HF0 A;  4P5O A;  2Y0S A;  4PFO A;  3DP7 A;  5FRN A;  4HSR A;  2CHG A;  4UY8 I;  1YX5 A;  1DPR A;  2DAO A;  4QLC U;  4O5V A;  5JFR A;  1VF9 A;  3HSE A;  2FFJ A;  4EJW A;  1L1Z A;  4F55 A;  1UAA A;  4E7S A;  1I4W A;  2E7W A;  3OOU A;  4M9S A;  2CMP A;  2L7Z A;  3PSI A;  4N0B A;  1JUP A;  2DLL A;  5FTM A;  2M4G A;  1DO2 A;  1QO0 D;  2VBZ A;  2H6C A;  3E6B A;  5LHI A;  5C1B A;  2OC6 A;  1IBL M;  1T56 A;  3GFM A;  4I4L A;  2WSF F;  2DA2 A;  2XB0 X;  3C2G A;  1B8I B;  1GAB A;  3I71 A;  5E79 C;  3LFU A;  1RZ4 A;  3VYU B;  1GLN A;  2EV5 A;  3OYE A;  1X2M A;  1IXR C;  3E21 A;  5DTD A;  2HDW A;  2F5S A;  1LFP A;  2DA5 A;  2CUE A;  2YU3 A;  4DBQ A;  2HXO A;  3VSL A;  3T5X A;  1GVJ A;  3PQK A;  2EZL A;  3IRR A;  3R0J A;  2CHV A;  4FCV A;  1WIV A;  2BBY A;  3M07 A;  4JXJ A;  4A3F J;  3EET A;  3K1M A;  4XKV A;  1LKX A;  2L4E A;  1QHH D;  4FX4 A;  3KFW X;  2ZME C;  1Z3Y A;  2LD5 A;  4B3S M;  1ZRF A;  2G7H A;  5BOX A;  3GFJ A;  4I2O A;  1A35 A;  3WHC A;  1MSF C;  2FE3 A;  3K4L A;  2XGD A;  3MN2 A;  5GKN A;  2B7E A;  3BQZ A;  4IHW A;  2YX4 A;  3TW6 A;  2E2H J;  2DXI A;  5JI2 E;  3AKZ A;  4XRS A;  5EXT A;  3BOS A;  4KIG A;  1N32 M;  4IHS A;  5BPV A;  3ZMT A;  5D8K B;  3A0B C;  3CO7 C;  3KCC A;  1OPC A;  1LVA A;  4MQV A;  2W85 A;  4YY3 M;  2Q1Z B;  4LJA A;  1OCO H;  2DMT A;  2MAB A;  3BR0 A;  4XKB A;  3AOG A;  3VFD A;  3E5U A;  4R8H A;  5L3B A;  2DOE A;  3PM1 A;  4RLQ A;  2PMH A;  1TTY A;  1S3J A;  2Z1D A;  3CC4 I;  4F52 A;  3U6P A;  5LMN M;  4MHG A;  1S9H A;  3BJA A;  4G12 A;  4BEH B;  1Y8Q B;  5GTI C;  4XK8 F;  3AAF A;  2VE8 A;  4RB2 C;  2DMU A;  2R7R A;  2EQR A;  4GMQ A;  3AFH A;  2HYF A;  2IGN A;  1MNM C;  4DR5 M;  3E0J B;  3HBL A;  1U5T C;  1X3U A;  3K4M A;  2V9P A;  3V8L A;  4UVB A;  5JLW A;  3KZI C;  1FLI A;  3MJ5 A;  1IBM M;  1HF0 A;  5FKM A;  2QSG X;  3JRE A;  2IGO A;  5ITR A;  2NVT J;  1ZK8 A;  3GQ4 A;  3BTL A;  2Y9Y A;  2MC3 A;  4IX7 A;  4BEH A;  4OAY A;  1QZE A;  1TDZ A;  3WTW C;  2LTU A;  2DBB A;  4BQN A;  2R6F A;  2GAU A;  4A6E A;  4YEJ A;  2JVG A;  1QU3 A;  2LLK A;  1J7K A;  4Z8X A;  4G7Z F;  1LNW A;  1TQP A;  1DGF A;  2YU9 J;  2NVQ J;  4DV5 M;  1BOB A;  3OOP A;  2QEX I;  1YJW I;  1HW1 A;  1U6G A;  1I39 A;  2NVU B;  1QAQ A;  1G3S A;  4OIQ F;  3CES A;  2YQZ A;  4G6D A;  2UUA M;  3FXL A;  4G6T B;  1FP1 D;  4EM2 A;  1MU5 A;  1MBK A;  2OCE A;  2K9Q A;  3QU3 A;  1GJT A;  3K0L A;  4UVC A;  1MX0 A;  2K47 A;  1SC7 A;  4GYI A;  2PJR B;  3JAM S;  3VLF B;  2IW5 A;  2XAU A;  3K10 A;  3F21 A;  1G4A E;  1ITY A;  1SD7 A;  2HXI A;  2KZS A;  4PCQ A;  4A93 J;  1IRZ A;  3HGI A;  1K4T A;  2DWL A;  3H3Z A;  3GRU A;  2GA2 A;  1EIJ A;  1T33 A;  1TW3 A;  5LHG A;  1BL0 A;  1DP7 P;  3M6A A;  3DBL B;  4ZYE A;  4ZTJ A;  2YFQ A;  2W48 A;  2ECC A;  2VC0 A;  4Y13 A;  1RUN A;  4WXH A;  1X1B A;  2Z4S A;  3FTF A;  5FD5 A;  2BJV A;  1RET A;  4BXF A;  4OMY A;  5CVI A;  2PX9 A;  3FYD A;  3AV0 A;  1IW7 F;  2EJS A;  5ITX A;  2K3F A;  3MEX A;  4GHL A;  4GCV A;  4D0P A;  2IRF G;  2PJR A;  2CRG A;  1MDM B;  2CHQ A;  4KT0 F;  4LJ8 A;  1L8Q A;  1WRJ A;  2BY3 A;  3CMM A;  4A3K J;  1U9N A;  3H4M A;  3SYL A;  1FTZ A;  3DEU A;  2X85 A;  4JI2 M;  2EB7 A;  4G4O A;  4RM3 A;  5DCM B;  2IVM A;  4JI4 M;  4AZF A;  2MJ5 B;  3B7Q A;  1NTC A;  5IP7 J;  1GDT A;  3T15 A;  2JSC A;  4DZJ A;  2G3Q A;  4L0Y B;  3ECO A;  3FKI J;  5GP9 A;  4DV2 M;  1ZTR A;  1Y39 A;  2HYJ A;  2CUZ A;  2KHH A;  2ELJ A;  2V9K A;  3KEY A;  4L16 A;  1MDM A;  2DJI A;  3S32 A;  3BZ6 A;  2EV6 A;  5J47 A;  1RR8 C;  4UV9 A;  3M3Y J;  2A61 A;  3UZU A;  2HGC A;  1IXZ A;  4NC6 A;  2KMU A;  2LNB A;  2P4W A;  1QNT A;  3LCV B;  3UK6 A;  2CE7 A;  2LKS A;  3BG6 A;  1Y1V J;  3JAM K;  4P9F A;  5TJJ A;  1NV9 A;  1NHG C;  1KU9 A;  1WQ2 A;  1T38 A;  3A98 B;  3D8L A;  2CUJ A;  3QAH A;  3TO9 A;  3WHL A;  3BR1 A;  1R4N B;  2EUC A;  4IVN A;  1XWI A;  3FTC A;  2EWN A;  4I76 A;  4PSX A;  1VDD A;  3KP6 A;  4Y7N J;  4E70 A;  4B08 A;  4LFA M;  1X1D A;  4ENJ A;  2PLY A;  3U6L A;  3HPG A;  1TQI A;  3CJT B;  2EK5 A;  3W0F A;  3VK7 A;  4LD5 A;  3IKV A;  2FOW A;  4WWC A;  5KHD A;  2LY2 A;  4RB0 A;  2DAK A;  2XAJ A;  3K2Z A;  3BG7 A;  2M87 A;  2GLO A;  3GLG B;  4HL4 A;  4EEF G;  5CVJ A;  1IAW A;  3WTS C;  5E17 F;  2K86 A;  1JT6 A;  1D0K A;  2DU9 A;  1R1U A;  1UMQ A;  5JI6 A;  4WCG A;  4A3B J;  2XGN A;  3BG3 A;  2EFW A;  3L2A A;  3ZR8 X;  2DCE A;  2WAF A;  3A0H C;  1YJ9 I;  1JGG A;  1P2F A;  3LW5 F;  4ZYA A;  2DT6 A;  4S05 A;  3UMM A;  3DLL F;  1BA5 A;  2QUF A;  1XS9 A;  1KYZ A;  3HHZ A;  5EYR A;  3GLG A;  2DJN A;  2KJC A;  3H3U A;  3HEF A;  3U60 B;  3BJO A;  3GF2 A;  3JSP A;  3SYK A;  2JY5 A;  4IBI A;  4CGZ A;  4BDZ A;  1JE8 A;  4HV5 A;  2DHY A;  3K6G A;  1V34 A;  4V2G A;  1GT0 C;  3K70 D;  4JX5 A;  5HS8 A;  3JRI A;  1E3P A;  3A42 A;  3IUO A;  5HOO A;  1D1A A;  4ZYG A;  4IBB A;  5D5X B;  3DFZ A;  4E6K G;  4XKC A;  2EO2 A;  1HST A;  3R4K A;  3QYE A;  2VBX A;  5GPA A;  3ZMD A;  4GC9 A;  3U60 A;  4KNY A;  4KDP A;  3HOX J;  1UZC A;  1XCV A;  3EUA A;  3OYG A;  2K02 A;  3IAM 2;  2L2D A;  3GLG E;  4M6V A;  1UG0 A;  1UG2 A;  2HR3 A;  3R61 A;  4D1Q A;  4KIC A;  2CQN A;  2V4J C;  1NVM A;  3WTT C;  3KS8 A;  2FUG 2;  1MND A;  3ABL H;  2JSP A;  3S1R J;  3AOE C;  2R46 A;  3J7Y J;  2P0W A;  1TZL A;  3BG5 A;  3OYA A;  4G3O A;  2G0E A;  2YS9 A;  4ZZD A;  3IL2 A;  1J09 A;  3KP3 A;  1OCT C;  1VQ8 I;  2DZN B;  2NOJ B;  1VQN I;  3S93 A;  4J01 A;  3BP8 A;  4I8O A;  3GCM A;  1D1B A;  3RZD J;  4HBL A;  4R7G A;  5D5W B;  3OYL A;  3JTG A;  3TKY A;  3UJN A;  2HQA A;  2VC1 A;  4CUG A;  1OQY A;  5ILS A;  1GXP A;  5H37 D;  5H6Q A;  1B1B A;  3WU1 B;  3T8R A;  3VPR A;  4HNU A;  4LG3 A;  1WJA A;  2ELH A;  4XRS G;  3KP5 A;  4BE0 A;  2ACJ A;  1P7I A;  5DV5 A;  1EJ9 A;  2XKO A;  2O8K A;  2V1X A;  1XXH B;  4BS9 A;  3KS4 A;  1VQM I;  2GXB A;  2FNP A;  4EM0 B;  1IC8 A;  1HNZ M;  3H5A A;  4L9T A;  4Q47 A;  2QGU A;  4D80 A;  2ZSH B;  1N75 A;  3AL0 C;  5JR3 A;  4KIF A;  3CD6 I;  4LLL A;  3T1H M;  3KET A;  1WWX A;  5EG0 B;  2QM3 A;  1JJ6 C;  2E34 A;  2BOL A;  2O61 A;  2L7I A;  3KFU G;  1WJB A;  4HYE A;  1HT1 E;  4BBA A;  1F1Z A;  3HHG A;  2VKD A;  1WSU A;  1ZH5 A;  1G59 A;  1Z21 A;  5DYM A;  1REP C;  3LA2 A;  4Y33 A;  1F4I A;  4PJL A;  3Q0W A;  2KDZ A;  3PNT A;  2HPI A;  3RCO A;  3FD9 A;  3K9P A;  1MBF A;  4AIJ A;  2XAS A;  4EAT A;  3LSK A;  3C9P A;  3ABK H;  2C99 A;  1OYW A;  2IP2 A;  5M5Y J;  2R7W A;  4OX9 M;  1C1K A;  3FHN A;  1VQP I;  2J7O A;  5IP9 J;  3BR5 A;  3QP6 A;  3TWK A;  2FQ4 A;  1V33 A;  3T1Y M;  2PMU A;  4NBQ A;  2Y9Z A;  4GFB A;  2JMW A;  3K4J A;  2OOA A;  3QOP A;  1CGP A;  2QCO A;  1TDH A;  2ERC A;  1R4G A;  4BE2 A;  1UM8 A;  2HFH A;  5D5U B;  4CCN A;  2LXE A;  4E7I A;  3RKW A;  1JKO C;  2ZAO A;  1XXH E;  2BW3 B;  4LIT A;  1MJB A;  1W0T A;  4JI1 M;  5K5R A;  2X49 A;  2K5C A;  1KZH A;  1IN8 A;  6PAX A;  4AG6 A;  1IG7 A;  3BXW A;  4NXM M;  1ON2 A;  2X9D A;  4B47 A;  4G7H F;  4LJ6 A;  3D8B A;  2CW0 F;  1PP8 F;  4PDK A;  1T0F A;  2CYY A;  2RKO A;  3ZGK A;  3SDB A;  4YFX F;  1D8K A;  1GV2 A;  1T39 A;  3FXQ A;  3H5R A;  4W97 A;  2HVR A;  2DZL A;  1OCP A;  3M0E A;  3COA C;  4G7O F;  1P9Q C;  1WH7 A;  3N05 A;  4IXA A;  3BR6 A;  1P6R A;  4DW6 A;  2BW3 A;  1IXC A;  4A6D A;  1M1E B;  5LLQ A;  3U6C A;  3U1K A;  3T1B A;  2E5L M;  1ETO A;  1FSH A;  3VKG A;  1HW2 A;  1R00 A;  2EA4 A;  3EPZ A;  4M3G A;  4OAZ A;  2OQG A;  4X0G A;  1OR7 A;  3S15 J;  3RI4 A;  2XF5 A;  1IDY A;  3MZH A;  2KW0 A;  1ZG1 A;  2XH9 A;  1WGL A;  3FIS A;  2X1E A;  3TBI A;  4CSW A;  1ORY B;  5KAI C;  1IN5 A;  1RUO A;  4L9N A;  3F3X A;  2XAH A;  4X66 M;  2L9V A;  3KP2 A;  4XN0 A;  2WWY A;  3OS1 A;  4XL9 A;  4FVM A;  4PZJ A;  2X4H A;  4LJ5 A;  4JI6 M;  4A3V B;  3T38 A;  3ZMS A;  3R60 A;  2EIL H;  2XVC A;  4HDU A;  1BIA A;  3H3V K;  1HNX M;  3H0D A;  2HTS A;  2QYO A;  4MEY F;  3WOD F;  4LF7 M;  1FMV A;  2W82 A;  4GHA A;  2V26 A;  2VN2 A;  5J1Y A;  3HSF A;  4CJ6 A;  2XLJ A; 
#chains in the Genus database with same CATH homology
 3GLF E;  3B89 A;  2JY6 B;  1WHC A;  3ESW B;  2JZ1 A;  2OOB A;  2G3Q A;  2L4E A;  3FRH A;  2DKL A;  2LBC A;  2KHH A;  1JR3 E;  2O25 A;  2DEN A;  1KYI A;  2DI0 A;  1PVE A;  1OAI A;  1ZMV A;  3K9O A;  4Q7J A;  1WR1 B;  2BWE A;  2K9D A;  1P3Q Q;  1HJP A;  3LCV B;  5JI2 E;  1ZMW A;  1NV9 A;  2MR9 A;  1HQY E;  1DV0 A;  1HT1 E;  2R0I A;  1Y8G A;  1F4I A;  1T43 A;  2F4O B;  1WJ7 A;  3K9P A;  1IXS A;  1V92 A;  1HT2 E;  2MRO B;  1SG9 A;  4UN2 B;  3FRI A;  2MJ5 B;  1TP4 A;  2DAK A;  3F92 A;  1MN3 A;  3GLI E;  1VG5 A;  2JZ0 A;  2DAI A;  1YLA A;  3BBZ A;  2OOA A;  2RRU A;  4WP2 A;  2QSG X;  4R71 A;  1T6O A;  2K0B X;  2LVP C;  1R4G A;  1EFU B;  1VQ1 A;  1OTR A;  2JY7 A;  1TTE A;  2JNH A;  2LVQ D;  1G41 A;  1XXH E;  1CUK A;  1QZE A;  2LVO C;  2LTU A;  4HEO A;  2DAM A;  4F2L A;  1VEG A;  2L4F A;  3IHP A;  1BVS A;  2EKK A;  3LCU A;  1X3Z B;  2F4M B;  1X3W B;  2HWJ A;  5DFL A;  2CP8 A;  2KNA A;  2JY5 A;  2KNZ A;  2QSH X;  1G3I A;  1AIP C;  1ZV1 A;  2DZL A;  2DHY A;  3FE3 A;  2HAK A;  1IFY A;  1NV8 A;  2B3T A;  4GEW A;  1PGY A;  1VDL A;  2EKF A;  3IEC A;  3T6P A;  1ZMU A;  1G4A E;  2ZTD A;  1E94 E;  2JUJ A;  1WGL A;  1Q02 A;  2L2D A;  3GLG E;  1OKS A;  4DBG B;  2LVN C;  1DO2 A;  1DO0 A;  1VEJ A;  2WZJ A;  2DNA A;  2QNJ A;  1C7Y A;  1TR8 A;  2DAG A;  2KNV A;  2LVA A;  2EJS A;  1XB2 B;  1IM2 A;  2QHO B;  1GO5 A;  2MGW A;  2BWB A;  3E46 A;  4G3O A;  3E21 A;  3MMP A;  1VEK A;  2DAE A;  2H5X A;  4F1I A;  2ZTC A;  4YIR X;  1WGN A;  2JY8 A;  1A5T A;  3H4J A;  2OO9 A;  1UFZ A;  2CWB A;  1OQY A;  2QSF X;  1WIV A;  3GLH E;  2JP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...