2QSFX

Crystal structure of the rad4-rad23 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
104
Chain Sequence
b'IGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAVGSFQVDYTPEDDQAISRLCELGFERDLVIQVYFACDKNEEAAANILFSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein RAD4
publication title Recognition of DNA damage by the Rad4 nucleotide excision repair protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 33
structure length 104
sequence length 141
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00627 UBA UBA/TS-N domain
X PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2qsfX02
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2qsfX01
3IECA 3K9PA 2KNAA 2KNVA 2LBCA 1WGNA 3ESWB 2DAMA 2HWJA 2JY5A 3LCVB 3B89A 1HQYE 3IHPA 4DBGB 2QSGX 1JR3E 2LVQD 2EKFA 2KHHA 2LVOC 3FRIA 1VDLA 1ZV1A 2DNAA 2BWBA 2B3TA 4F2LA 1XB2B 4YIRX 3GLFE 2MJ5B 1TR8A 3E21A 1E94E 1DV0A 3T6PA 5JI2E 1TP4A 1AIPC 3MMPA 2L4FA 4HEOA 2EJSA 2QSFX 1EFUB 1ZMVA 4WP2A 1T43A 2DAGA 1ZMWA 2DKLA 2DZLA 1XXHE 1G41A 2DAIA 2R0IA 1WJ7A 1P3QQ 4UN2B 2DAEA 2CWBA 2F4MB 1BVSA 1NV8A 1QZEA 1WGLA 2JY6B 2JY8A 2LTUA 2HAKA 1KYIA 2JY7A 1X3ZB 3FRHA 2QSHX 4F1IA 1HT2E 1VEGA 1F4IA 1VQ1A 3GLGE 2F4OB 2JNHA 1DO0A 2DENA 1OTRA 2DAKA 2QNJA 1WR1B 1WIVA 1A5TA 2OOAA 1DO2A 1Y8GA 2RRUA 1Q02A 1IXSA 2K0BX 1VEKA 2JP7A 1NV9A 1OKSA 2G3QA 1HJPA 3H4JA 3K9OA 2L2DA 2OO9A 1PVEA 2MR9A 2O25A 3GLHE 3GLIE 2OOBA 1R4GA 1X3WB 1HT1E 1PGYA 4G3OA 1VG5A 2L4EA 1G4AE 1SG9A 1OQYA 2ZTCA 2CP8A 1IM2A 1G3IA 1OAIA 1V92A 3F92A 4R71A 3LCUA 2K9DA 1IFYA 1YLAA 2DI0A 2QHOB 2JZ0A 1UFZA 5DFLA 2MGWA 1GO5A 2JZ1A 1WHCA 2MROB 2LVPC 1VEJA 1T6OA 3BBZA 2H5XA 3FE3A 1CUKA 1ZMUA 2KNZA 2DHYA 1TTEA 1MN3A 1C7YA 4Q7JA 2ZTDA 2EKKA 2JUJA 2WZJA 4GEWA 2LVAA 2LVNC 2BWEA 3E46A
chains in the Genus database with same CATH superfamily
5ILSA 2V1UA 3N4MA 4LZZA 2KNVA 5CVRA 2JY5A 3D8LA 3PFYA 2BXYA 3FUWA 3IHPA 4DYCA 2OZUA 4PDKA 4RA2A 3Q8GA 1C1KA 3GW2A 4YY3M 5ILVA 2QQ8A 4XLCA 3C58A 3J7BA 3T1BA 1TH3A 4GKJM 1ZN2A 2R4GA 4R8HA 4BGDA 3SASA 4FISA 3IL2A 3AKZA 1ZQ3P 1W36D 4FQGA 4EM2A 1K78A 4DR1M 4B4CA 3W6JB 4AIDA 3LAJA 2NNNA 2UZKA 3CC7I 4RM3A 2HFHA 3FTDA 2DLLA 2W57A 3GZ5A 5KVRA 2R7RA 1XXHB 4ZPXA 3CTAA 1S3SA 4Z6YA 2EZHA 1J5EM 3T1YM 4LB6B 5GP9A 2V4JC 1FBUA 3EQLF 1WJEA 4M3EA 1HOMA 1R71A 3HHXA 4UVAA 3BG3A 5D5XB 4E7HA 4RAYA 4G8XA 1QBJA 2B9SA 2HYGD 4KISA 1J09A 1LB2A 2X51A 1GL7A 1LJ9A 2X6WA 1FY7A 1DO0A 2XVCA 4GYGA 4BJTA 4IIWA 3MD2A 3KP2A 2WB1A 5ILUA 2DWZB 1RKTA 1YJNI 2Z9OA 1TT5B 4AIKA 2CUJA 2O5RA 1Q02A 2PEXA 3RKQA 2K9LA 2HQAA 3J7AS 4BH9A 3JAMK 5IREB 2BJWA 2K4BA 4TV7A 3H4JA 2H8RA 2L2DA 1BI2A 3GLHE 2K7LA 3OYBA 3K4LA 1XCBA 2M1BA 4LITA 3IRQA 4S12A 4HDVA 3OS0A 5IT3A 3HUGB 2NVXJ 2JPCA 1E3PA 2DWLA 2K85A 3U6LA 3I9V2 1ZG3A 1MMAA 4MH0E 2MH2A 2VOOA 2K6BA 5HOOA 3BTJA 1LEBA 2VJ4A 3JR9A 1Z05A 2V6EA 1TW3A 4LCBA 1XSVA 2FQ4A 2DFFA 4G9YA 1FOKA 2AHMA 4MGRA 3VLFB 2GLOA 3K4CA 3M6AA 2Y9YA 1DGFA 1BOBA 1Y8RB 1R1UA 2MFZA 3MKWB 3WGIA 1CGPA 5LRSA 1R36A 4GIPA 1YX3A 1GXPA 1GJSA 4ZC3A 4G6TB 4M0DA 1JR3A 2EZIA 3ULQB 1Y0NA 3I58A 3L25A 2JVHA 2DA2A 3L2CA 3CO7C 2A5WA 2BW3B 2K5CA 5L3DA 1U9NA 5EGOA 2L7HA 1W7PA 4MIMA 4AYBN 1J75A 4KHPM 3FXJA 3DV8A 4D80A 2Z4RA 5H6RA 1POGA 4NSRA 2CUZA 3CTWB 1V5EA 1UAAA 2LBCA 1KYWA 2W84A 3IH2A 3A2KA 4NQWB 3HSRA 3CCEI 2HXOA 2DFEA 3BG7A 1A36A 1TNTA 4A6DA 3V7RA 3OYFA 3WTYC 3VYTB 4WCGA 4U7BA 2R44A 2LBFB 3WU0A 2R18A 2EWNA 3ABTA 3BG5A 4C30A 3X2QH 2F5NA 2DI3A 2L4AA 5ICFA 3QAHA 1DUXC 3E4RA 3E21A 1FOXA 2MG4A 2W85A 1BBYA 4AC0A 3A01B 1FJLA 1V5GA 3RSNA 2R5ZA 5DD8A 2O7OA 1K61A 2WSCF 2GQFA 3NARA 3L28A 2O03A 3MEXA 4YEJA 4Y13A 5JVTA 3W0LB 3IRRA 1S7OA 1YS7A 4ENJA 4ESFA 1BW5A 5FTNA 2A6HF 2VBZA 4BEHB 2P6SA 2CGPA 3WHKA 3JCUC 2ZJ2A 2LHGA 3OR2C 4EJTA 2PN6A 2KA6B 3FK7A 3QPTA 2DDAA 3VEPA 5LLQA 3OS2A 2DAEA 4KDPA 5F0FA 3TQNA 3WG9A 3OYAA 1A35A 3V42A 3PO3J 4RB2C 2QQBA 4XLAA 2Z3YA 2O0YA 3PM1A 4L9NA 2VJJA 3RKWA 3DBLB 1PUEE 1JGGA 1XN7A 4OMZA 3K70D 1LVAA 2YX7A 3QAUA 3HYIA 3JAMZ 2IT0A 5CQEA 3U6DA 3F6VA 2QPAA 1AA7A 4XKCA 4QOSA 2PJRA 4XBOA 4KODA 1XGSA 1Z91A 2KP6A 3FTFA 2XPWA 4LJ4A 3P9IA 4I09A 4KT5C 4MM3B 1KQ9A 4L9JA 2OV7A 3DWLE 2OZ6A 2O25A 2H1RA 2P8TA 4XN3A 1HCRA 1KYZA 1IUFA 5LRRA 1PGYA 3CQZJ 2XPVA 2B63J 1IXCA 3H3VK 2WSEF 1X1PA 1QNTA 1H9GA 5AIQA 1IRZA 2PBIA 2CV1A 2Y0SA 3RCOA 1GV5A 4HLQA 3F92A 4R71A 5ITXE 2MSYA 2W25A 4F91B 2M34A 5J1YA 4ANRA 3ZQ7A 3JSOA 4E6KG 1ZREA 1VQPI 1P92A 1G71A 3BR0A 3I59B 4M73A 1YOVB 3F6OA 3U21A 5GTHC 1ODDA 2DT5A 4WXHA 3ZRGA 1GABA 1MNMC 3S14J 5CVIA 1ZKGA 2HYFA 2QYOA 1T3TA 9ANTA 3RFWA 2QP9X 1GKIA 3BBZA 1G3SA 4N9HA 3ZQLA 3GWZA 2VQFM 2F5FA 3RKYA 2ZJQF 5KAIC 3GLLA 4DV5M 4XKBA 2DK5A 1MMGA 1Z9CA 4AUXA 1VQ9I 1UHSA 3T8RA 3HZJA 1Z59A 1WKMA 2CFOA 3CD6I 2VIIA 2KZSA 4BY1J 2MH9A 3QOEA 4LMYA 3COAC 5KO3A 2MD0A 2HKXA 2VXDA 4LG0A 5D4SA 3K92A 1JB0F 3HG9A 4NC6A 4LF6M 1T98A 2L5QA 3WE2A 4AQYM 5DEQA 3RQ4A 4UV8A 2JA6J 4CGZA 1IO2A 1FP1D 3ZQCA 3K9PA 2BBYA 1DPUA 1V34A 2IBDA 4RS8A 2DAMA 2QF7A 1P7JA 5DM7F 2ECCA 4GYIA 2W4SA 4L4UA 4N4NB 4B7FA 4UUSB 1MJ9A 1H6UA 2L2OA 2JPBA 2BHYA 2NS7A 2FOIC 3PNTA 3S3MA 3BT9A 1TBXA 2KIUA 3GLFE 3F0CA 1K78B 1X2MA 2H6CA 4GRIA 1VF9A 2E1OA 1I3QJ 4DR4M 1Z7LA 1SMYF 3LQQA 2ADUA 3CDIA 4LLNA 4RDUA 4QIWN 3NWTA 5FTLA 4EVIA 3FWEA 2HOSA 1PYVA 1PUFA 4J00A 1HW2A 2ZMEC 3ECOA 1ZGWA 5FKOA 3DZDA 2JT1A 2I7NA 1OISA 1Z0XA 3I54A 3IP4B 1N36M 3C3EA 1JI8A 1U5TB 1FOYA 4B7HA 1TTYA 4JX4A 3ZMVA 1X19A 2NNYA 1K3XA 1RR7A 4U88A 4A3EJ 5EXPA 3GLFB 4M6YA 3S1QJ 2Y0QA 4A69C 4CXFA 1MBGA 3ZOBA 3J2PB 3M7GA 3W3CA 3U61A 2M45A 4FD2A 3JRFA 2JA7J 2HGCA 2LY2A 1HKTA 3DPUA 3OR1C 3CJNA 2W48A 2JP7A 4MTDA 4EMSA 3M8FA 2JA8J 4A3GJ 2CEAA 2Z3XA 1SANA 3KEYA 3OIOA 3CLQA 4KA4A 4PT5A 1T2KA 5F27A 2L7KA 4GC5A 2P6TA 3HOYJ 1X3WB 1RETA 1T0FA 4A0ZA 2L4EA 1MSEC 3CUQC 4I98B 4PGGA 1D3YA 2X0LA 2A6EF 3IHUA 2VKHA 3BOQA 4NBQA 1Y39A 3LCUA 1ONVA 3UR3C 3DP7A 2CJJA 4V19K 2VXZA 4DV0M 3Q8XA 1FP2A 1MNDA 4LG3A 3LVVA 2CUEA 3FXUA 1TQIA 1BR1A 3SDGA 3PIPF 1U3EM 2LC2A 4MGYE 1SD5A 5FKMA 2E1MC 3PFIA 1S6LA 4BB9A 4LG2A 3GQ3A 2KKOA 5BPVA 2ZXJA 3C2BA 3W6VA 3WTSC 2R7DA 2CE7A 2XGEA 2STTA 2UXDM 4IHSA 4KNYA 3H92A 5HDNA 1R5ID 1KSFX 4B44A 3BDDA 4ENKA 1WJDA 1WJAA 1L8QA 3QU6A 3NQOA 4UVCA 1Q3BA 4DV1M 1UFMA 3S32A 1D5VA 3R0JA 1B72A 3I04M 4AVPA 1MDMB 3CF6E 1XMOM 2EFQA 3I4PA 4JI3M 1IUYA 3HU2A 5FSWA 1SFUA 3FKIJ 1IRGA 2KRCA 1E0EA 1MH4A 1TZLA 4PCZA 4R1HA 5TGTA 4DR7M 2HOEA 3E46A 5B1AH 1IW7F 2X6YA 3MZYA 4B3SM 4GMQA 2ZC2A 3E3VA 3MHVC 3FXOA 1S7EA 1B8IA 5IPAA 4HF1A 2Y0TA 3FXRA 5KQ8A 1K4TA 4G7HF 1DQUA 2MC4A 4M72A 1XDUA 2VPLA 1CQTA 3FRIA 2KJBA 2COBA 2FS1A 1XMKA 2E35A 2MC3A 4QSHA 1P9QC 2JWSA 5GPCA 1FIPA 3K4JA 2MJ5B 3KOXE 2DTZA 3KYCB 5J40A 4WWCA 5EXSA 2PJPA 2VIXA 3S15J 4BQOA 3ABKH 3KE2A 3MZ8A 3HB9A 1OYYA 4DV2M 2H8WA 2MBFA 3K69A 4CYCA 4CISA 1FWZA 3CO6C 1DP3A 1OLTA 3AOGA 2L7ZA 3VWBA 3ECHA 1MMNA 1R6BX 2DZOB 2BY3A 3V8KA 2E5ZA 1PJTA 4PSXA 1Q3CA 2DOAA 2IGMA 3KP5A 3J81K 1QPMA 2FJ1A 3BC8A 3KSXA 2FNPA 2C98A 5F64A 3DLLF 1MZBA 1OCCH 2DWMA 2F4MB 3HGGA 3LSGA 4B47A 2B7EA 3SHFA 4XLNF 1ZRDA 4L5IA 2HAKA 2HU9A 4HNUA 3SYLA 1GVDA 4B3RM 4HEA2 4PSWA 2R7VA 2V1XA 3IKVA 1MJAA 3CJQB 2Y30A 1OAOC 2X8AA 2L9SA 3G73A 2WA0A 3GLGE 3BR1A 3B7ZA 1XS9A 2HCBA 2PJRB 4IBCA 4BNCA 4NXNM 1A5TA 3WHLA 4DV4M 1R6RA 2YPRA 3KLNA 1REPC 4GITA 1AUAA 2K3PA 4P17A 3IH3A 5LEJA 1NY6A 2HS5A 3VYUB 1IN6A 1MNEA 3RZOJ 2PQ8A 1X1BA 2HYJA 2G7UA 3ABUA 1OFHA 1UG0A 2X1DA 5B66C 2EH3A 4XRSG 4RB1A 3E6MA 4NC8A 3L2WA 4REZA 3HHGA 5J6XA 1WCMJ 4BACA 1IY2A 3BPVA 1LTMA 4FHTA 3TP0A 1PP7U 1STZA 2VQLA 4PJJA 4UXNA 2K9DA 2MH8A 3UK6A 3L00A 1ZK8A 4PD2A 3BR6A 1TWCJ 3IV5A 4LB5A 1S3JA 3LA3A 1WJFA 4LFUA 2E2IJ 1X1DA 1QANA 2JVGA 2C96A 4NUBA 1ZG1A 2VOPA 3CMEI 4DR2M 1AHDP 3OYJA 1GO5A 1U9OA 2IAIA 1OCZH 4J19A 1MBKA 2JMWA 5E1XA 2MROB 1L2BA 4A6EA 3NAUA 3PUBA 4E7ZA 1VEJA 3KETA 1D0KA 2VONA 3GTGJ 4I7HA 5B5EC 1NH3A 1F4KA 1SVMA 3D8BA 1Z6RA 2LKPA 3DKXA 4A12A 3S93A 3HHYA 3F21A 3ZCBB 2R7QA 3AL0C 4LG0B 5HVQC 3C1DA 2EKKA 4MFDA 1YSYA 2DFIA 4BKXA 4IBEA 5E17F 2FBKA 3PQKA 4UB8C 2A68F 4RBOA 2HKJA 1X1AA 3SZPA 3FD9A 3P5JA 4D5FA 2RGVA 1XG1A 4P9UA 2LVNC 3A42A 1W5TA 1IN4A 1MJGM 2LNBA 3D5RC 3IWFA 1LNWA 3FIWA 3LOCA 4MLOA 4DIQA 2HDCA 4LFBM 4ITVA 4M6VA 1LFBA 3IAM2 3I56I 2QA4I 1R58A 3EIHA 1SC7A 1XX5A 3U60A 5F04A 2QCOA 4S05A 4KFCA 1QGPA 3LA7A 3W68A 2CSOA 1YO5C 3TDUC 1ORYB 3A4CA 2H27A 2MGQA 3BROA 3BTIA 4II2A 3WGGA 2JSPA 2VBYA 2XAHA 3GRRA 4B48A 3F8FA 4F2LA 1BI3A 1XB2B 3W2WA 4A3JJ 2UXXA 4QPQA 4X0GA 1HKSA 4ESJA 3TDZC 1ZARA 3J81Z 5DM6F 4LJ5A 4M0WA 4A3DJ 3SDBA 2DTRA 4FETA 2OCCH 3KFUG 3DBHB 2D5VA 3S16J 3VDUA 3B6CA 3GUDA 2XAUA 4IBKA 4ZH4F 1LFUP 3TPZA 3VKHA 2XFSA 1YS6A 1HR0M 3S1MJ 2CWBA 2X1CA 4XR6A 4A3VB 2LG4A 4B1RA 1RC9A 2Q8KA 1XD7A 1NTCA 4CO8A 4BDYA 1WSUA 4GXOA 1HT2E 1JKOC 3J7AO 2L0KA 3LAPA 4LJAA 1YQAA 3IH4A 1EJ9A 2I5UA 1PRBA 3E1SA 3N05A 4OU0A 4L8RC 1EF4A 1U78A 3NWLA 2HWVA 4HNTA 1ZTRA 4P9FA 4UY8I 1Z67A 3ZQFA 3QPLA 4AI6A 3H9GA 1Z5CA 5E8IA 4EJOA 3TO7A 1R2ZA 2XAFA 4C3JJ 3GLIE 3M1CA 1JR3D 1I94M 4M74A 1IBLM 4RLFA 2R6FA 4OWRB 4DYQA 2ZTCA 2D1HA 4C2MJ 1IM2A 1OAIA 5BR8M 2DQLA 1VQ6I 2FU4A 5AIPA 2IW5A 1QUTA 1XWIA 1W7PD 2AO9A 3WTWC 4C2UA 2STWA 1F5TA 3DU6A 5IZ7D 4K0KM 3IWZA 1VQOI 1ZQ9A 4L16A 2WY7Q 3TE6A 2QZ8A 4LF8M 3KOYE 1D1AA 1ZR4A 1U8RA 4A3BJ 1F1ZA 3FUUA 1D0XA 3KZZA 3G4SI 2NS0A 2HR3A 4IBGA 1XDSA 3AOEA 2DW4A 2L9RA 3T0YA 5FJ8J 2Z2SB 3F8NA 1MGTA 3U1KA 1ITYA 4EJUA 1B72B 3ZH9B 5CKTA 2C9OA 1XMAA 2UU9M 3BLYA 4FX0A 4I4LA 1JKQC 1W36C 3ZP5A 1TC3C 4FWGA 5EZHA 2WZJA 1O7FA 4XK4A 4GEWA 4Y17A 3S1RJ 2XSZA 5KPZA 3OL4A 3CCQI 4BE2A 2E19A 2DWNA 2BZTA 2HTJA 2VQEM 2QWWA 2VQCA 1SMTA 3ISPA 5ED4A 3K1PA 1HNWM 3JTHA 1NSFA 1Q39A 3KP0E 1HQYE 1VQNI 4X66M 1G3WA 2VC1A 3W67A 4YG2F 3GRUA 4DR6M 1TQPA 2P7CB 4F52A 3TQSA 2YS9A 4JI4M 5EYRA 2K27A 5FKLA 4ASNA 1R9TJ 3HXLA 1YW8A 1XSDA 3DEWA 4M9ZA 2V1DA 2HOAA 1BI1A 4IKFA 2RGHA 1JE8A 5E79C 3BTCA 2BJVA 2F5QA 5E3OA 3LSRA 3MK6A 4XRSA 1XHBA 2F5EA 1MKMA 1O3SA 1OCTC 2L4FA 4BU2A 2BHZA 2A6TA 3MAJA 3FXKA 3CJTB 2K9QA 2IS4A 4F93B 2O3FA 3KX2A 1D0LA 3RIRA 4M3GA 1BL0A 1XXHE 1PP8F 4ANJA 1VDDA 2BVLA 3C9PA 2V26A 2JWTA 2RREA 3E7LA 3L2VA 4Z8XA 1F9NA 3JRHA 3PNYA 3P7NA 3GFIA 1EH7A 2R7ZJ 1D8KA 1NV8A 5BPIA 2XSJC 2IJLA 3JW4A 2O8XA 2P4WA 3DU5A 4LK1F 2DQRA 3DTEA 4IJEA 1VEGA 2ZJRF 4JI7M 1EV7A 2OQGA 2Z33A 3WU2C 2F4OB 4IF4A 2NVTJ 5ITXA 2QBYB 1J5YA 2J5PA 5IWAM 2DJIA 3KXEC 4RNAA 4F7ZA 2YNMD 3OYLA 3S17J 3HHHA 1N78A 2GWRA 4A3LJ 2MLGA 2QKLB 3E9SA 1IN5A 3GRVA 3L2QA 3F22A 3IG5A 4IHYA 2WV1A 1I1GA 1LVKA 2LYCA 2MR9A 3H3ZA 2BNKA 3G1MA 4RMNA 2ETHA 2KMUA 1VQLI 4OIPF 1QAOA 4IRHA 2LLKA 1ON1A 2D2WA 2E5NA 3P9KA 4AIHA 2A07F 2FUG2 1XB4A 1HF0A 3CDLA 1DGHA 5EF6A 1UHMA 1PDNC 3CCUI 1ZRFA 4EGYA 3ZMTA 4FE7A 4JBAA 1K3WA 4KIBA 1Z5BA 4P55A 4ZDPA 1SXJA 2XDVA 3BXWA 2LWXA 3PSFA 3RI4A 1PJSA 5K5QA 3BQYA 3TOBA 4O3MA 5ERIA 3EDPA 4BUPA 4FASD 2WB1N 1T0FC 3Q9SA 2E1NA 5GAGJ 5TRDA 2Z4SA 2ISZA 5M5YJ 1YI2I 4DUYM 1X1CA 1YE9A 3OYIA 2HVSA 5IT9S 2CRGA 2VKDA 2CW0F 3OWTA 1GVNA 3Q0UA 1U8BA 3AG2H 3CCVI 5D5WB 1YFHA 4LJ6A 2NS8A 3E6BA 3VFDA 1K6YA 4UHTA 2RV8A 2HL7A 1ETVA 2KIFA 4W1UA 3F72A 2FSWA 4NRWA 2OD5A 3K6GA 3KZIC 4XLEA 2KRKA 3F8MA 2IA0A 1P4AA 2QGUA 5FKKA 1QA6A 3IUOA 1TQMA 3SEZA 3KP3A 4BL0B 4NRVA 3NWSA 5DCMA 1WGNA 2E5LM 2BXZA 3KW6A 3R60A 3ERMA 2CW7A 5D8KB 4KT0F 4B3XA 3EYIA 4I8OA 2E2HJ 1HA8A 1J7KA 2CMPA 2L7FP 5DCFA 4I0AA 2RVCA 1LE8A 1IG7A 4LF5M 2EIJH 3OYKA 4D5CA 3TO9A 1O57A 1USTA 3K70C 3GPUA 1P2FA 4RKUF 1NG7A 1Z21A 3BG6A 3HJ8A 3FBIB 2IA1A 4I76A 4D81A 3CZ6A 3GO5A 4IX7A 4O6JA 4HW0A 4X62M 2XRLA 4XBFA 2XF5A 2CS3A 4LF7M 1P4XA 1T43A 4G4QA 2YUSA 2DK8A 3MMYB 3H4MA 2DO7A 2GA1A 5K5OA 4HL4A 4BBSJ 4DV6M 3R0AA 3M07A 5C3EJ 2WADA 4JI8M 1L2DA 3R8FA 4X1EA 2LSOA 2XSDC 3RZDJ 1ZAEA 3HJSA 4CCLA 1V4RA 2V6ZM 2P81A 2JRTA 2ZMEB 5BQTA 4PFPA 4L9TA 4GH9A 1IZ1A 2JY6B 3I4MJ 2JY7A 2OQ4A 3EPZA 4ZYHA 3ZQJA 3SATA 2DMNA 4AYBA 2QSHX 2UXBM 2M0MA 3HU3A 1T8IA 3CDHA 3LMMA 2NVQJ 5M3FJ 1QZMA 1DGGA 3HSFA 3DBRB 2HXIA 2NQ8C 4HV5A 5HDKA 2OOAA 1N32M 1ZELA 1OJLA 2OUMA 1I5ZA 4FE4A 2HZTA 3GYHX 4QOZC 1LFPA 5FLXS 3L2AA 3DCFA 3GBGA 4RGSA 3J7AY 4XK8F 5LD2C 2ZM6M 3U6PA 2Y9ZA 5JI3E 1JT0A 2RC4A 1SFKA 1HJPA 3CJRB 4BXFA 4JI0M 1X4OA 1R4MB 3ZQQA 4CCKA 3QPHA 1Z6TA 3IAS2 4A93J 1TWHJ 3JSPA 2DOEA 2L3DA 2CP8A 2XV4S 4LLLA 3QRFF 1BW6A 3CUQB 2XGDA 4U7DA 2BEOA 2DI0A 3KDSE 2LTPA 4YIFA 3HKZN 2GQQA 3S2WA 5GTIC 2JZ0A 2Z16A 1S8NA 3E5UA 2K86A 2UV1A 2GOXB 4OOIA 4F55A 3SC3A 1G8PA 2F5VA 3CCYA 3GXOA 4Q4ZF 2NYXA 1WPKA 3FKJA 2G5GX 3F8CA 2E1MB 2QZ4A 4C9YA 4ZDLA 1NK3P 1QVUA 2QQ9A 4IPAA 4RLQA 1JUMA 3H9JA 2E2JJ 5FFZA 1QVTA 5FO5A 3JRDA 3GFJA 4XL9A 2DHYA 4MQ9F 3DEEA 3K7AJ 5EEGA 2ZNYA 3CLOA 1TF0B 3RGPA 3LSHA 3VKGA 1I1SA 4ZDOA 1EH8A 1KA8A 4DUZM 2F5CA 3Q0VA 4Y3OA 2VT2A 3S2DJ 1DU6A 5M5XJ 1JT6A 3MCZA 4I01A 2JQ7A 5J3LA 4MGKE 3OS1A 4F92B 3JR5A 2FOWA 3HOXJ 3ZGKA 3AG1H 3MQ0A 2V1NA 1NHWC 3QYFA 3S3NA 4IBDA 5F1JA 5JI6A 2GXBA 4A3MJ 2YR0A 1B6AA 5FD6A 1Y1WJ 5K1YA 1FYKA 2LVQD 1ZLJA 3KIOA 3U5ZB 2LFBA 4LJZF 1E17A 2GNOA 5JFRA 2BVMA 4K2EA 3ZMSA 4Y4RA 1G2HA 5EXTA 1TH4A 4ZJZA 4BLCA 3THGA 2FBHA 2XB5A 2B3TA 3H9QA 2GM4A 4PFOA 2EA4A 5HNHA 4GC9A 2R45A 1DV0A 2NVYJ 2PLYA 1CF7A 1JKPC 4ZZDA 3K1MA 3GLGA 3WHCA 3HSEA 1E2XA 4HEOA 3U6OA 3TEDA 4D1QA 5IOZA 3SJMA 3LA2A 2DHRA 1ZMWA 5LBQA 5HLIA 4KO8A 1B1BA 1MMDA 2Q2EA 2K4JA 2JRMA 3CMMA 4BDZA 4LRSA 1MBEA 4MNUA 4XLPF 5M3MJ 4WX9A 1V33A 1JTXA 2EPFA 2M5ZA 4JI6M 2C5RA 1MBFA 1MD0A 1WJ7A 2MA3A 3SXYA 3WTUC 1R1TA 3GLXA 2KDZA 2EFNA 3GCMA 4GHLA 1EE8A 3CF0A 2XF7A 4GHAA 5AONA 2A05A 3UZUA 4XKVA 1FBSA 1SD7A 3CMYA 5GKNA 1BR4A 1WQ2A 2VJ5A 4JK1X 3JRGA 2UUBM 1L0OC 2ME0A 2NXNB 1T95A 3FYCA 1WR1B 2EQRA 2YX4A 4MGHA 3B7QA 5GAHJ 1ETOA 4LJ9A 3ASOH 2AQEA 5CLSA 2K0BX 3U6MA 3SBJA 1XPXA 3BR5A 3E5XA 2XB0X 3VYRB 3PXGA 1W4MA 3K4NA 3CMAI 5LGUA 1E3OC 3B73A 5BMZA 1DGHB 1WRJA 2IPQX 4JN6A 3PUFA 1JHFA 1Y6IA 1T56A 2KRHA 2L9VA 4BY7J 2Z8YM 4E7SA 1H88C 3BZ6A 1V92A 2GAUA 1FSHA 3KEOA 3LNQA 3PJRA 1ETQA 2ELJA 1YLAA 2MABA 3BR2A 1R49A 7CATA 2FX0A 3OYCA 3C18A 1ZG5A 3CP2A 1QPIA 2E1CA 3QWLA 4AKGA 3KEQA 1WH5A 2VI6A 2VF7A 1R2YA 3RYRA 2DYRH 2JZ1A 5ITRA 2XF3A 1FJGM 1R00A 3EUHA 3HGYA 4IEJA 5HS9A 3CCLI 3BQZA 3E0JB 1WHUA 1J59A 3FXLA 1L1ZA 3I3LA 1DGBA 1P7IA 4DZJA 5LGNA 2J7NA 1WZ2A 1MMSA 2OF7A 1Y56A 5J8CA 2KEBA 1USSA 3B02A 5FTMA 2ZSHB 2JZYA 3BPXA 1IBMM 1U6GA 5LGTA 5E3MA 5EQTA 2W7NA 2I7PA 1QZYA 5H20A 4AVZA 3AL0B 4A2UA 2A69F 3GTLJ 4U0WA 4KLNA 4AD9A 3GTOJ 2CQ7A 4G6ZA 4QHSA 3SMPA 3KP4A 1XGOA 5FROA 1APLC 3GZ6A 3ABMH 3KCCA 3IECA 4KIGA 2KNAA 4EEFG 4WK8F 1BC7C 2EB7A 3LSMA 1WFXA 3ZQHA 2OA4A 2PMUA 4BQQA 5D8LB 2NRAC 2ERCA 3GQ5A 4XGIA 1XSXA 3Q9VA 3VYSB 4G7OF 3GRYA 1O3TA 2OC6A 2VBXA 2QVOA 2DA5A 3CP8A 1G6NA 1ZRCA 4ZTJA 5EGOB 1W7PB 2WAFA 1RKWA 1QHGA 1XNQM 2ESNA 1OCPA 2V6CA 4IVNA 1ACIA 4G4RA 1V5FA 1MJBA 3WTVC 3V8LA 1NVMA 4NC7A 4L9VA 4A3FJ 5KCMA 2M7BA 3K1JA 2WWYA 2CW8A 2IA2A 1UM8A 2O6GE 4M3FA 2VQGA 4V2GA 2UUAM 1IC8A 1G41A 2CV2A 1G3YA 4M9SA 3BCAA 1YITI 2XPUA 1X4PA 1GLNA 1IXRC 3TP3A 3HOTA 2HVRA 4CYDA 3JR4A 5BOXA 1ERDA 4AM3A 1BR2A 3H36A 5FD5A 1O7LA 4F1IA 4NSOB 1F4IA 1LV7A 3C3WA 4CCJA 2R5ZB 3W6KB 1KU2A 2DENA 3BWGA 1EA3A 4J01A 1ZGAA 1BI0A 2CFXA 1BA5A 1R5LA 5C4XJ 1OFCX 1Y8GA 2L9NA 3VSLA 4OU7A 2OPFA 3A02A 3K4KA 1KFVA 1PJIA 5LFAA 4KT6A 2N35A 2F5DA 1QVRA 3HJEA 2QM3A 4FCYA 3AJIB 1AWCA 1AU7A 5KK1A 4GDFA 1FIAA 2M8GX 1A6QA 3BR3A 3AFHA 4CIZA 2YFQA 3LQRA 3H5RA 4LIUA 1G8XA 4HF2A 2UXCM 2LDUA 3QQAA 2DMTA 4OIOF 4QPOA 1B4AA 3SFIA 1AKHA 2DPUA 2R46A 1IFYA 4XLHA 2XRNA 3I01M 4HNVA 3AG4H 3T38A 2XSZD 2NOGA 3RQIA 3U6QA 2CYYA 2W24A 2VLAA 1ZGJA 1JHHA 2VPRA 3J27B 4RF0A 2FE3A 4E7JA 2JXNA 4WXCA 2H1KA 2Y2ZA 4AIJA 4MEXF 4IHTA 4P5OA 1IRXA 3WTXC 4UVBA 3O6BB 2KJCA 3LSIA 3C2GA 2NVUB 3HC7A 3K8ZA 1HC8A 2R7FA 1WJCA 1T6OA 2DFHA 2ZCWA 3DF8A 1E32A 5FTJA 2FA5A 2HHHM 4A0XA 5KQDA 5D4RA 4QNRA 1A31A 6PAXA 2LR8A 3C3DA 5A2QS 1BIBA 4NXMM 2K9SA 1SXJC 3U6EA 3GEZA 5CQGA 1K83J 1C7YA 1XMXA 5DUIA 2OBPA 2RQPA 3AG3H 4FCTA 3BP8A 4XSXF 1MBHA 3OIQA 2DU9A 4XICA 2QKMB 5C18A 2P0WA 2ZAOA 4GKKM 1HBXG 3FHNA 1Z5AA 1QZZA 1UB9A 1R7JA 2P5KA 4XKWA 3L26A 2HKOA 1MH3A 1I6XA 3B89A 1XXHA 2RKOA 4NNJA 3TKYA 2HI3A 3FXQA 1R1VA 2DT6A 4XORA 1VZ0A 2MLKA 2LHCA 1IY0A 1XC5A 4HG2A 4MGZE 3I5UA 1E94E 2EILH 4L0ZB 4YIIA 3S1NJ 3WU1B 5HODA 3EYYA 3T6PA 4EGZA 2NAZA 2R7OA 1O3RA 2ZO4A 2EJSA 4HQEA 4E7LA 2QSFX 4UV9A 1E9RA 2PMZN 1GJTA 1FC3A 5CVJA 4F3QA 1IXZA 2EA2A 1H8AC 1DU0A 1KQ8A 3MVPA 4IQJA 1HQCA 1OR7A 4PJLA 1NY5A 5ICEA 3HPHA 2M30A 1SD6A 4JP0A 4PUSA 1R5GA 3NBIA 2E36A 2DAIA 1PJQA 4IHWA 5EP3A 1TGUA 1P3QQ 2GZWA 4UN2B 1YYVA 4BJ5C 1HDDC 2FEZA 2HOTA 1BVSA 4Q48A 2CG4A 1WGLA 3TW6A 3FUXA 1X3ZB 1L1TA 3ZQGA 4M3DA 1D8JA 1HLVA 1TNSA 3ROUA 3JRCA 2ZBKA 1X58A 1SXJD 2F4VM 2OCEA 3MKZA 3VK7A 2IGOA 1IAWA 3KPHA 1OTRA 3W2AA 3SZGA 1PUFB 3K2AA 4YELA 2R7UA 1LUJB 2XGCA 5J4VA 3GPYA 5KHDA 2I8DA 2ELHA 3ASNH 3JTGA 4DBQA 3VDPA 1QAMA 4L78A 2AXLA 4CICA 5F0HA 2GBYA 1ON2A 5ICGA 5KAFC 3PIOF 1U0JA 4XRMA 3J80S 1N34M 2ZSIB 5IP6A 1C0WA 2W00A 1ENHA 1HT1E 1F36A 1S9HA 1YJ9I 2O9LA 1BOAA 3GLHA 1HSJA 2N8GA 2VKVA 3ZPLA 1ETXA 1OQYA 2KPMA 1W0UA 3O8GA 2HPMA 3WGHA 3AV0A 4AKHA 2M4GA 4IRGA 3ZMUA 4B3TM 4JV5M 1RNLA 2NOJB 4PK4A 4RAZA 4D9JA 3MKYB 3U61B 5DTDA 1TDZA 2QHOB 1MU5A 1JUPA 3L9FA 2WAQA 4NDLA 3A46A 2FQ3A 2CO5A 2Q1ZB 3K4MA 2Z1DA 4Q47A 3I71A 4NL4H 2VQHA 1V54H 4D82A 1S5LC 5D5UB 4U87A 3GTKJ 3GP1A 1HDPA 4A5MA 4YHHM 5IP7J 3ZC7B 1W0TA 1QYRA 3KYDB 1IY1A 4P16A 1N33M 3OSGA 2WY8Q 5K7HA 2CQXA 3CCMI 1TTEA 2ZXWH 4U0YA 2GIZA 2RAEA 2ZNZA 4FT8A 5H6QA 3V4GA 3ERED 1LKXA 3REOA 3TW7A 3A0HC 3KP7A 1WVRA 4HYEA 2ME6A 3A03A 5E3LA 3A01A 2DA6A 2KDLA 2WTEA 3KSJA 4H0EA 3BZCA 2CH0A 1I4WA 2A3SA 1RUOA 4DOZA 2F2EA 4GO1A 3WE3A 4V2FA 3OOPA 4A5NA 2VJIA 1A04A 4HAMA 3SFZA 4LGWA 4L5EA 2HWJA 3VODA 1OFIA 5IYBJ 4LGMA 2ELKA 2Q0OA 3WTTC 2ACJA 4BXXJ 4DBGB 2VKEA 1UZCA 4MHGA 5J8FA 4FX4A 1ETWA 4UUTA 2IVMA 2XASA 2DVWB 5IT9K 2Z99A 1NJFA 4LK0F 4I99C 5ICCA 3CCRI 1B9MA 1R22A 1QDTA 3TWKA 2Y69H 2XAQA 4Q5SF 3HOUJ 3VPRA 5J47A 4ENNA 2WSFF 2XUBA 4OAYA 3ZMZA 4G94A 1I39A 1KGSA 5E1ZB 2UWMA 3FMRA 2E7XA 5L3EA 2R93J 5L3BA 1RPWA 1FPQA 3M8JA 4EATA 1B8IB 4G6QA 4B08A 4OAZA 2EZKA 4O5VA 2ZJPF 1VQ5I 2PI0A 4OVZA 4JI2M 5EP4A 3R4KA 4WURA 4TUWA 1M1EB 2FXAA 5BPDA 5F08A 2XC7A 4HOBA 4JOMA 2CHVA 4PZJA 3RDIA 1QZEA 1PJJA 2LTUA 5E26A 2M60A 1UMQA 3VSKA 4B8XA 1LQ1A 4E70A 8CATA 5HNFA 5JLXA 3GTQJ 2COMA 4MFEA 3SAVA 1VNDA 2I10A 2IEKA 4LD5A 4CYCB 1Z3YA 2A61A 1L3LA 5HS7A 2X4HA 4IOCF 2LP0A 2QNJA 4JXJA 1TWFJ 3PVSA 4MEYF 5EEAA 4I2OA 1ETYA 1Y8QB 3K9TA 2RRUA 1NK2P 1HW1A 3DFZA 4FTHA 3H5AA 2CRUA 1OPCA 2R92J 2E34A 1VEKA 5CVUA 1VTNC 2BYVE 4RGRA 3HRUA 2VB6A 2RQQA 2HQ5A 2WAEA 3E6DA 3F8BA 3G2BA 1QAQA 1PVEA 2IXSA 3FZVA 1KQ0A 3FXMA 1T6SA 1R4GA 4FCWA 4FW9A 1TW2A 2KFDA 3LFKA 5C4JJ 1H9TA 1AKHB 1SG9A 1RR8C 2LK2A 4ZYAA 5EG0A 1LPQA 3HOSA 4XN0A 3TMOA 4X65M 4HRIA 3O3KA 4RAFA 4DYRA 3I55I 1TWAJ 3DTKA 3PNVA 4Y7NJ 1YRNA 3Q3SA 2OPTA 2ZB9A 2LD5A 2Y48A 1FZPB 4S0HB 2HEOA 2J5YA 3H5NA 2MGWA 4PJMA 3A0BC 2VL8A 5FLXK 4HBLA 2R5YA 3LFUA 4ZYDA 4IZZA 1QQWA 5E3NA 1N75A 3JREA 3HWSA 2CHGA 3KOWE 4LJ8A 3BJOA 5HLTA 4II7A 1BC8C 2KRFA 4OINF 4BHPA 4OX9M 3G3ZA 3HTSB 1D1CA 3OOUA 4XLFA 2XGNA 1D0ZA 1ZMUA 2GIVA 4W97A 3Q0WA 5DD4A 4UUSA 2ID6A 3GF2A 3H3UA 3HL2A 3R6SA 2ZTDA 3LVWA 2F48A 2X1EA 1MSFC 3OL3A 3HPGA 3U6CA 2VT3A 1VQKI 3EUHC 2EK5A 2M3AA 3MN2A 2L54A 1KU9A 1BM9A 2OTJI 3L1PA 3BY6A 3TWMA 2RN7A 3DKYA 1HNZM 5IT9Z 2M9HA 2X4AA 1TWGJ 2ZAMA 3MFKA 3TGNA 3FK6A 3F23A 4DBRA 4BAYA 2DXIA 1WWXA 5DS9A 1RRJA 1QHHD 1GDTA 3I4YA 2AQFA 3H0DA 2KHHA 4ON0A 1YG2A 1ZV1A 4HZFA 2G7HA 1U5TA 3GTJJ 5K5RA 4QNMA 3DTIA 1GHCA 2ESHA 3FF5A 1H0MA 3M4OJ 2KZUA 3GLFA 4I5SA 5DYIA 4CCOA 3H0GJ 2ISYA 2IGKA 2KL4A 3D0SA 3LWFA 2FF4A 1DDNA 4ITQA 3FBNB 2QEXI 2CWEA 2JSCA 1QRYA 4YFKF 4EJVA 5DDGA 2J7OA 3U60B 1HSTA 4N4OB 1O4XA 2H09A 3K2LA 3RPUA 3G6EI 1QU3A 3OYNA 4GFBA 3DFGA 3ZR8X 4IJAA 3J7YJ 3FHZA 1NJGA 3QP6A 4PJ0C 4E7KA 2JY8A 3JRBA 1A6IA 1IV8A 4R7GA 2ZBKB 2EJRA 4HA8A 3L27A 1NNJA 4B3AA 1ZLKA 2F5SA 4P1WA 3FDYA 2XAJA 1SVLA 2ID3A 5LMNM 2IP2A 2DAKA 2VE8A 2L01A 4KIFA 2CQNA 4B3MM 5GAEJ 2DOFA 4IXAA 2RNJA 2HQRA 4XSZF 1NV9A 1DP7P 1I6HJ 2EINH 2F4IA 1W1WE 3GLHB 3DEUA 4MTEA 4CZZA 2ECBA 2EUCA 1Q1VA 4DQ2A 5LMUM 2VDBB 1RZ4A 3DPLC 5LHGA 4R3DA 3A98B 2LF7A 3FKEA 3I51A 4H4KC 2GOMA 3VB2A 2IS2A 4KMUX 5FGMA 4YFXF 5FLXZ 3GX4X 1MDMA 2LMDA 1BJZA 2KZGA 2UXNA 2FMYA 4HF0A 2PMHA 4L5JA 3W2VA 4AG6A 3CF2A 4RAGA 4EIWA 5F3WA 3FTEA 1IRFA 3JRIA 4XMYA 4Z2YA 4BQAA 1YW7A 5BS6A 2J5OA 4YFNF 5E20A 5JHUA 1S29A 3PO2J 5IYDJ 5F6FA 2DA4A 4DZPA 4QHTA 1EIJA 1IQPA 4L0YB 1B9NA 4KUMA 1DPRA 2L6OA 3GO8A 4KJZA 5CYVA 1CUKA 2M87A 2QUFA 5FLVA 3OYGA 3U9GA 3HGIA 1MN3A 1KZHA 1VFCA 2OAZA 3BOSA 1FOWA 4DR5M 5FLMJ 3E6CC 2Z5UA 2LVAA 3HKPA 3CCSI 3SHGB 4WXDA 3F9KA 4A0YA 5H37D 2OU2A 3WHBA 3S3OA 1TDHA 1V3FA 2DPDA 4HX4A 2R65A 3VFZA 5HDGA 3DQVC 4BS9A 1UG2A 4LF9M 2FD5A 5DV5A 3ZN0A 2LH9A 4G12A 4ZYEA 4RB3C 3CCJI 2QSGX 3KOZE 2L4MA 4BHCA 4JX5A 1GT0C 4CCNA 2BY0A 2PG4A 1P4WA 2E71A 3K4BA 4JX6A 3OSFA 2X6OA 2D7HA 2EFWA 2QENA 2EIMH 2BV6A 3HKZA 1IBKM 2GXGA 4IBFA 2XHKA 3IG8A 2XROA 1OIPA 3I53A 4WW0A 4PJNA 4JI5M 3M3YJ 1FMWA 1J9IA 4B09A 5JI2E 2Y0SN 4M3BA 4ZYGA 2LOOA 1IGNA 1AIPC 3MMPA 3GPPA 2LKXA 4XONA 5GADJ 4E7IA 1P6RA 1Q1HA 1ZMVA 4OVZB 4IHXA 3BJ6A 3JAMS 1JUSA 4A3CJ 4G6DA 3F3XA 3SYTA 1G4DA 4EM0B 1I3AA 1QDRA 1SVOA 5CJ9A 2O01F 3HRSA 4S04A 3FM3A 2FBIA 3N97A 2KQRA 4BBAA 1KYIA 4I02A 4D7MA 3UKGA 3U6SA 3RE8A 2R7WA 2YU9J 3RTRA 1RU3A 2AS5F 5DYGA 2XZFA 1MIJA 1SFEA 1X3UA 3HRTA 1K82A 3E5QA 2JNHA 1IF1A 3TBIA 1OR7C 2JJ7A 2TRTA 1WIVA 5EP1A 1AOYA 3JRAA 1SEUA 5B1BH 2APLA 1IXSA 3ZMDA 1EH6A 3TO6A 2CQKA 2V79A 5FKNA 3ILKA 2C6YA 2G3QA 3SAUA 2FH0A 3CGWA 2V1CA 3T1HM 4DJAA 1LDKB 2JA2A 4L6V6 2HQNA 5D6EA 5BNGA 4UUVA 1B59A 3CESA 1ZAOA 1DGWY 5EG0B 1JTYA 1ORKA 3MJ5A 3EUAA 2HTSA 3B9PA 3ZN1A 4XNFA 1NHAA 2VE9A 5E1WA 4II3A 2P7VB 1YRNB 2HDDA 2P5LC 1SXJE 2KIQA 2P5VA 5TJJA 1QO0D 2K40A 2VASA 1ZH5A 1BN5A 1X2NA 1GV2A 4W5WA 4EM1A 4RF1A 1WJ5A 1XC8A 3G71I 2R5YB 2KIMA 2Y0MA 2O8KA 1D0YA 1S72I 2XFTA 4LLGF 1WHCA 2DBBA 2XF6A 1Z1DA 2YSRA 1T08B 4NHJA 2QCUA 3FM5A 4PDGA 2H5XA 4HSTA 1F43A 3ABLH 3ML6A 1MBJA 2B0LA 3FTCA 2TCTA 2BGCA 2W1OA 3ELKA 4XM3A 2Y20A 3HHWA 3U2RA 4BHBA 2H94A 2EFPA 3A1YA 1GUUA 2M5WA 5K7ZA 2XEPA 4OIRF 1SXJB 3HEFA 4P96A 2YQZA 4CCMA 4HSRA 1TT0A 2XZUA 3FMQA 4KICA 5H2FC 1OIZA 2LF8A 1KU3A 2DDBA 1ULYA 4XRFA 4AZFA 2IGNA 2VUMJ 4Y33A 2HVQA 2ZANA 2EA0A 5JVGF 4I0BA 2D1VA 3VDXA 1JQJC 3HU1A 1FT9A 1LDJA 4GGGA 3C7JA 4UB6C 3Q5FA 1VQ8I 1JR3E 1BJAA 3OYDA 3D1NI 5EZGA 3TWLA 1K6OA 3QYBA 1VDLA 2DNAA 1OCOH 4BYYA 1ZR2A 5A2QK 5CPRB 4LY6A 2V9VA 4C2TA 1TR8A 2R7TA 3HBLA 1WXQA 1Y1VJ 4YRVA 4WF2A 5E8GA 3T15A 2VF8A 3HM5A 4DR3M 1YJWI 1VQMI 4LRTA 1EFUB 1RUNA 5DCMB 2LH0A 2DKLA 2CV0A 3LSPA 4XIDA 2RNGA 1WGXA 2C99A 3AOEC 4IHVA 2R7SA 4KN7X 2DZLA 4KMFA 4JYAM 2XLJA 1KU7A 4QTRA 3V7SA 1OMIA 2DYSH 2GA2A 2JK3A 2YR2A 3G1LA 5KPRA 3GVAA 4I6ZA 4LOCA 2QLZA 5DUKA 3OV8A 1O3QA 4CSWA 2MD5A 1LE8B 2ZKZA 1G59A 1UCRA 2KHMA 5TISC 1UHWA 1T38A 3FRHA 2DMQA 2LKSA 2JTVA 4KN4X 1T39A 2CHQA 1PM5A 1ETKA 5F1RA 4HDUA 4ABZA 1VQ1A 3ZXSA 2KISA 5CVVA 1XNRM 4JYKA 1FSEA 1WI3A 2EZLA 3EETA 5L3FA 3GTPJ 1OKRA 4PDIA 2R4JA 2DAOA 1TLHB 2EBIA 2Z7JA 4CJ6A 3TL4X 3PSIA 1IN8A 2YU3A 3CF5F 3KS4A 3NBXX 1K7AA 2HDWA 1SFOJ 2AHQA 3RKXA 3HX3A 3V7CA 3S2HJ 4HLXA 1TL8A 3NEUA 3R9XB 4IBJA 4L15A 2R62A 1Z3XA 3GLIA 2WC2A 2K47A 2D7EA 4CH7A 1G3IA 4FWDA 4BE0A 4FWHA 4FCVA 1E9SA 2FOKA 2F5PA 1R5HA 2LY1A 5IP9J 2R0QC 2XKOA 3KZYA 4LFAM 3P9CA 3GFMA 4M9XA 3DLAA 3OIPA 2V7FA 2FRHA 1UFZA 2M0CA 1JJ6C 4AG5A 2FFJA 5KNLA 1R7RA 1EKEA 1HKQA 4DV3M 4EV0A 1SAUA 4IJFA 2V9PA 2DZNB 3HIFA 4GCVA 5LHIA 3UMMA 3QPSA 1NG6A 4D0PA 1FTTA 3KFWX 2JUCA 2Y21A 2LVPC 3GFLA 4PGHA 4R79A 3PL8A 2XIGA 3BCBA 3OTOM 2H6BA 3FE3A 3J80K 3SYKA 1YIOA 5J4YA 1D1BA 2G0EA 4AU7A 2KNZA 3VK8A 2OJED 4HX7A 4PCQA 2OTLI 3S8PA 3LW5F 1UJ8A 3FUTA 4BE1A 3L2UA 2EO2A 2HPIA 1YX5A 1WJBA 2JUGA 4Q7JA 4HQMA 3RGSA 2JUJA 1YLFA 2QQAA 3QP5A 3WODF 4E4HA 2DODA 5LEKA 4RM2A 4XQFA 2DA3A 1NO1A 4OW0A 2VC0A 3MZHA 3KVWA 1Y0UA 4B7GA 3DA1A 1GVJA 1MW7A 2F6CA 1U2WA 1OYIA 1XTAA 2MW8A 2HNHA 3LCVB 4M71A 3T8TA 4AKIA 3U1DA 5A2QZ 5L8RF 2V9KA 1VI0A 2EV6A 2EV5A 1J2XA 3DPTA 3BTLA 1FYMA 4RB0A 2AXTC 1XGNA 4I81A 2IS1A 2DCEA 3PQJA 3D5LA 4LZJA 4HLYA 4YIRX 4EQQA 3B6AA 5ITTA 3AAFA 2FE8A 3K2ZA 3RJPA 1SD4A 4KITB 4DNCA 3SZTA 1TP4A 4B43A 3SMSA 1N77A 4CDGA 2QBYA 2RKHA 3UNGC 2M7AA 3ONQA 5EXXA 2DAGA 5E18F 4N9IA 3WTZA 1R4NB 4NB5A 3HOZJ 3H35A 4A3KJ 5F0CA 5IY5H 5J1RA 1YUBA 2R0IA 1U5TC 2XH9A 1XCVA 3FX3A 5HS8A 5DYMA 4LGYA 1XMQM 2LNHC 3SAWA 3ZQIA 1YW9A 4D7NA 3IC7A 1FLIA 1FNNA 4ENMA 4JQFA 4LF4M 1IDYA 3KLOA 3QYEA 1FX7A 1IDZA 5D6FA 1CF7B 3RYPA 2W82A 2K3FA 3GLGB 2R3SA 3GZNB 1IXSB 2L02A 2RDPA 3I64A 2Q2EB 1DO2A 3LSJA 3QOPA 2XKPA 3CC2I 2CQQA 3FMSA 2X48A 3T5XA 4OIQF 3GPXA 4MO7A 1OKSA 3DOAA 5EDNA 2KXEA 2L7MP 3K9OA 1ZYRF 4CZCA 4IBIA 3V76A 4ZZLA 2OOBA 2KRUA 2KLOA 2BY1A 1VG5A 2L7IA 4X64M 2KT0A 5IOYA 2A5YB 5ITQA 2RGOA 4CHUA 5FFXA 1S7AA 2M4KA 1NNUC 5C44J 4MB7A 3HUGA 3LL7A 4ETSA 2CU7A 2L09A 2UUZA 5EJCA 4U0VA 2DJNA 2PMZA 4LJ7A 1LDDA 4XOPA 3HOWJ 1OYWA 2FNAA 4FVMA 5DFLA 4AW4A 4DV7M 1BIAA 1HXDA 3DKWA 3D5SC 2HZDA 4XOTA 3J80Z 1UELB 4AWXB 1NHGC 2PX9A 4IL6C 2BE5F 2IRFG 1LEAA 5ITUA 3OY9A 3HDDA 4G4NA 5HLGA 3WG7H 1Z77A 4BBRJ 1K4SA 5FRMA 3IKTA 3LSTA 1HW5A 1R23A 2EV0A 1YHQI 2K9MA 1FYLA 5B3SH 4IBBA 5EP2A 2DMPA 5L3GA 3W0FA 4JI1M 1XGMA 2O61A 2D7GA 1I27A 4BQNA 4Y28F 3NRVA 2DA7A 3R61A 5C1BA 3KYLA 2BW3A 2XGXA 4OMYA 2BY2A 2DT7B 2Y75A 2WAQN 2BWEA 1SFXA 3H1CA 1FBQA 3MKLA 3RPUD 3J81S 1E3HA 5LHHA 1QQIA 2DMUA 3ESWB 3V8JA 3GQ4A 1ZHFA 2EIKH 2LREA 1D0MA 3FISA 3GMEA 3KP1E 3VOEA 2ZXIA 3I0TA 5JLWA 1GL6A 1K79A 3A45A 4NQWA 3UGJA 4LFCM 4C3IJ 5FB2A 2VBWA 3I4VA 3BG9A 3HRMA 2EKFA 2ZMEA 2LVOC 3O8HA 1JJ8C 2DA1A 3L09A 4IOAF 4DGWB 2BWBA 3ZCOA 1JXSA 5L3CA 4KYWA 1IN7A 3KP6A 2LVSA 2LBFA 1RIOH 2PFBA 3CUOA 4L18B 3B7NA 4M6XA 4BXUA 5HLHA 2GXAA 1IJWC 5DNYA 4WP2A 2WV0A 4LIVA 4IO9F 2MYSA 4IQ4A 3HY5A 2FMLA 2ZFUA 4CUGA 2TDXA 2K9NA 1L2CA 2LY9A 4IRIA 2G9WA 3K10A 3MWMA 1V55H 5IYCJ 4QWQA 1N25A 3E97A 1TH2A 3L2RA 4ZTFA 1KONA 1JGSA 3DXJF 4BEHA 4NOOB 4MGIE 2X49A 3HOVJ 3FUVA 2C9CA 2P5TA 3G1OA 3OYEA 4CGYB 3O2PE 1J0RA 2WBMA 1PJRA 2X9DA 2ICWG 2ZXHA 2LXEA 3TOAA 4A3IJ 4ESBA 1VQ7I 2IS6A 1Z7UA 5KPTA 3HHZA 4QLCU 3LSKA 1FEXA 1YTYA 4UNOA 3CUQA 1A5JA 2JA5J 5JHFA 2Y31A 3RPQA 1JKRC 3SQNA 3L29A 5E6JA 4Y15A 2K02A 5ITYA 1WI9A 1W5SA 3M0EA 2R4EA 1FMVA 3C2HA 3HTUA 3BJAA 3GTMJ 5D5VB 2OO9A 3GLIB 2VN2A 4RGUA 1G3TA 2BOLA 2E7WA 1YIJI 1D5YA 4G3OA 2X6XA 4Y52J 1QUSA 1SAXA 1G4AE 1MX0A 5EEHA 3QODA 5FRNA 3B74A 4RGXA 2R7XA 3K0LA 3KS8A 3SEQA 5M5WJ 3CC4I 3EIEA 3EUKL 4C3HJ 1WH7A 2KZVA 3HJQA 4MQVA 1HNXM 4G7ZF 2CUFA 5JR3A 1X37A 3SARA 4N0BA 1VQ4I 2E60A 2H1LA 1D2NA 5GPAA 1T33A 3I59A 1OCRH 1RESA 3J7ZI 4DW6A 1GXQA 2D45A 2XAGA 3OMYA 3OYMA 5K7FA 3QU3A 2VODA 3L7WA 3BZKA 3UJNA 2KDOA 1IV6A 3M1EA 1FTZA 4HV6A 1DGRM 4CHTB 4HPQA 2DN0A 2KW0A 3U5ZA 3FYDA 2LRDA 3OYHA 3K1NA 2JN6A 1RI7A 2EFOA 4CA0A 2M2EA 4HX8A 5J1UA 3I4NJ 1H89C 2ZFWA 2UUCM 4G4OA 1I50J 3M9AA 4EJWA 2M8EA 2OQRA 2F5OA 2X85A 5FTKA 4BJ6C 4X6AJ 3M8EA 1W5CC 2G8LA
chains in the Genus database with same CATH topology
3IECA 3K9PA 2KNAA 2KNVA 2LBCA 1WGNA 3ESWB 2DAMA 2HWJA 2JY5A 3LCVB 3B89A 1HQYE 3IHPA 4DBGB 2QSGX 1JR3E 2LVQD 2EKFA 2KHHA 2LVOC 3FRIA 1VDLA 1ZV1A 2DNAA 2BWBA 2B3TA 4F2LA 1XB2B 4YIRX 3GLFE 2MJ5B 1TR8A 3E21A 1E94E 1DV0A 3T6PA 5JI2E 1TP4A 1AIPC 3MMPA 2L4FA 4HEOA 2EJSA 2QSFX 1EFUB 1ZMVA 4WP2A 1T43A 2DAGA 1ZMWA 2DKLA 2DZLA 1XXHE 1G41A 2DAIA 2R0IA 1WJ7A 1P3QQ 4UN2B 2DAEA 2CWBA 2F4MB 1BVSA 1NV8A 1QZEA 1WGLA 2JY6B 2JY8A 2LTUA 2HAKA 1KYIA 2JY7A 1X3ZB 3FRHA 2QSHX 4F1IA 1HT2E 1VEGA 1F4IA 1VQ1A 3GLGE 2F4OB 2JNHA 1DO0A 2DENA 1OTRA 2DAKA 2QNJA 1WR1B 1WIVA 1A5TA 2OOAA 1DO2A 1Y8GA 2RRUA 1Q02A 1IXSA 2K0BX 1VEKA 2JP7A 1NV9A 1OKSA 2G3QA 1HJPA 3H4JA 3K9OA 2L2DA 2OO9A 1PVEA 2MR9A 2O25A 3GLHE 3GLIE 2OOBA 1R4GA 1X3WB 1HT1E 1PGYA 4G3OA 1VG5A 2L4EA 1G4AE 1SG9A 1OQYA 2ZTCA 2CP8A 1IM2A 1G3IA 1OAIA 1V92A 3F92A 4R71A 3LCUA 2K9DA 1IFYA 1YLAA 2DI0A 2QHOB 2JZ0A 1UFZA 5DFLA 2MGWA 1GO5A 2JZ1A 1WHCA 2MROB 2LVPC 1VEJA 1T6OA 3BBZA 2H5XA 3FE3A 1CUKA 1ZMUA 2KNZA 2DHYA 1TTEA 1MN3A 1C7YA 4Q7JA 2ZTDA 2EKKA 2JUJA 2WZJA 4GEWA 2LVAA 2LVNC 2BWEA 3E46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEC A;  3K9P A;  2KNA A;  2KNV A;  2LBC A;  1WGN A;  3ESW B;  2DAM A;  2HWJ A;  2JY5 A;  3LCV B;  3B89 A;  1HQY E;  3IHP A;  4DBG B;  2QSG X;  1JR3 E;  2LVQ D;  2EKF A;  2KHH A;  2LVO C;  3FRI A;  1VDL A;  1ZV1 A;  2DNA A;  2BWB A;  2B3T A;  4F2L A;  1XB2 B;  4YIR X;  3GLF E;  2MJ5 B;  1TR8 A;  3E21 A;  1E94 E;  1DV0 A;  3T6P A;  5JI2 E;  1TP4 A;  1AIP C;  3MMP A;  2L4F A;  4HEO A;  2EJS A;  2QSF X;  1EFU B;  1ZMV A;  4WP2 A;  1T43 A;  2DAG A;  1ZMW A;  2DKL A;  2DZL A;  1XXH E;  1G41 A;  2DAI A;  2R0I A;  1WJ7 A;  1P3Q Q;  4UN2 B;  2DAE A;  2CWB A;  2F4M B;  1BVS A;  1NV8 A;  1QZE A;  1WGL A;  2JY6 B;  2JY8 A;  2LTU A;  2HAK A;  1KYI A;  2JY7 A;  1X3Z B;  3FRH A;  2QSH X;  4F1I A;  1HT2 E;  1VEG A;  1F4I A;  1VQ1 A;  3GLG E;  2F4O B;  2JNH A;  1DO0 A;  2DEN A;  1OTR A;  2DAK A;  2QNJ A;  1WR1 B;  1WIV A;  1A5T A;  2OOA A;  1DO2 A;  1Y8G A;  2RRU A;  1Q02 A;  1IXS A;  2K0B X;  1VEK A;  2JP7 A;  1NV9 A;  1OKS A;  2G3Q A;  1HJP A;  3H4J A;  3K9O A;  2L2D A;  2OO9 A;  1PVE A;  2MR9 A;  2O25 A;  3GLH E;  3GLI E;  2OOB A;  1R4G A;  1X3W B;  1HT1 E;  1PGY A;  4G3O A;  1VG5 A;  2L4E A;  1G4A E;  1SG9 A;  1OQY A;  2ZTC A;  2CP8 A;  1IM2 A;  1G3I A;  1OAI A;  1V92 A;  3F92 A;  4R71 A;  3LCU A;  2K9D A;  1IFY A;  1YLA A;  2DI0 A;  2QHO B;  2JZ0 A;  1UFZ A;  5DFL A;  2MGW A;  1GO5 A;  2JZ1 A;  1WHC A;  2MRO B;  2LVP C;  1VEJ A;  1T6O A;  3BBZ A;  2H5X A;  3FE3 A;  1CUK A;  1ZMU A;  2KNZ A;  2DHY A;  1TTE A;  1MN3 A;  1C7Y A;  4Q7J A;  2ZTD A;  2EKK A;  2JUJ A;  2WZJ A;  4GEW A;  2LVA A;  2LVN C;  2BWE A;  3E46 A; 
#chains in the Genus database with same CATH topology
 5ILS A;  2V1U A;  3N4M A;  4LZZ A;  2KNV A;  5CVR A;  2JY5 A;  3D8L A;  3PFY A;  2BXY A;  3FUW A;  3IHP A;  4DYC A;  2OZU A;  4PDK A;  4RA2 A;  3Q8G A;  1C1K A;  3GW2 A;  4YY3 M;  5ILV A;  2QQ8 A;  4XLC A;  3C58 A;  3J7B A;  3T1B A;  1TH3 A;  4GKJ M;  1ZN2 A;  2R4G A;  4R8H A;  4BGD A;  3SAS A;  4FIS A;  3IL2 A;  3AKZ A;  1ZQ3 P;  1W36 D;  4FQG A;  4EM2 A;  1K78 A;  4DR1 M;  4B4C A;  3W6J B;  4AID A;  3LAJ A;  2NNN A;  2UZK A;  3CC7 I;  4RM3 A;  2HFH A;  3FTD A;  2DLL A;  2W57 A;  3GZ5 A;  5KVR A;  2R7R A;  1XXH B;  4ZPX A;  3CTA A;  1S3S A;  4Z6Y A;  2EZH A;  1J5E M;  3T1Y M;  4LB6 B;  5GP9 A;  2V4J C;  1FBU A;  3EQL F;  1WJE A;  4M3E A;  1HOM A;  1R71 A;  3HHX A;  4UVA A;  3BG3 A;  5D5X B;  4E7H A;  4RAY A;  4G8X A;  1QBJ A;  2B9S A;  2HYG D;  4KIS A;  1J09 A;  1LB2 A;  2X51 A;  1GL7 A;  1LJ9 A;  2X6W A;  1FY7 A;  1DO0 A;  2XVC A;  4GYG A;  4BJT A;  4IIW A;  3MD2 A;  3KP2 A;  2WB1 A;  5ILU A;  2DWZ B;  1RKT A;  1YJN I;  2Z9O A;  1TT5 B;  4AIK A;  2CUJ A;  2O5R A;  1Q02 A;  2PEX A;  3RKQ A;  2K9L A;  2HQA A;  3J7A S;  4BH9 A;  3JAM K;  5IRE B;  2BJW A;  2K4B A;  4TV7 A;  3H4J A;  2H8R A;  2L2D A;  1BI2 A;  3GLH E;  2K7L A;  3OYB A;  3K4L A;  1XCB A;  2M1B A;  4LIT A;  3IRQ A;  4S12 A;  4HDV A;  3OS0 A;  5IT3 A;  3HUG B;  2NVX J;  2JPC A;  1E3P A;  2DWL A;  2K85 A;  3U6L A;  3I9V 2;  1ZG3 A;  1MMA A;  4MH0 E;  2MH2 A;  2VOO A;  2K6B A;  5HOO A;  3BTJ A;  1LEB A;  2VJ4 A;  3JR9 A;  1Z05 A;  2V6E A;  1TW3 A;  4LCB A;  1XSV A;  2FQ4 A;  2DFF A;  4G9Y A;  1FOK A;  2AHM A;  4MGR A;  3VLF B;  2GLO A;  3K4C A;  3M6A A;  2Y9Y A;  1DGF A;  1BOB A;  1Y8R B;  1R1U A;  2MFZ A;  3MKW B;  3WGI A;  1CGP A;  5LRS A;  1R36 A;  4GIP A;  1YX3 A;  1GXP A;  1GJS A;  4ZC3 A;  4G6T B;  4M0D A;  1JR3 A;  2EZI A;  3ULQ B;  1Y0N A;  3I58 A;  3L25 A;  2JVH A;  2DA2 A;  3L2C A;  3CO7 C;  2A5W A;  2BW3 B;  2K5C A;  5L3D A;  1U9N A;  5EGO A;  2L7H A;  1W7P A;  4MIM A;  4AYB N;  1J75 A;  4KHP M;  3FXJ A;  3DV8 A;  4D80 A;  2Z4R A;  5H6R A;  1POG A;  4NSR A;  2CUZ A;  3CTW B;  1V5E A;  1UAA A;  2LBC A;  1KYW A;  2W84 A;  3IH2 A;  3A2K A;  4NQW B;  3HSR A;  3CCE I;  2HXO A;  2DFE A;  3BG7 A;  1A36 A;  1TNT A;  4A6D A;  3V7R A;  3OYF A;  3WTY C;  3VYT B;  4WCG A;  4U7B A;  2R44 A;  2LBF B;  3WU0 A;  2R18 A;  2EWN A;  3ABT A;  3BG5 A;  4C30 A;  3X2Q H;  2F5N A;  2DI3 A;  2L4A A;  5ICF A;  3QAH A;  1DUX C;  3E4R A;  3E21 A;  1FOX A;  2MG4 A;  2W85 A;  1BBY A;  4AC0 A;  3A01 B;  1FJL A;  1V5G A;  3RSN A;  2R5Z A;  5DD8 A;  2O7O A;  1K61 A;  2WSC F;  2GQF A;  3NAR A;  3L28 A;  2O03 A;  3MEX A;  4YEJ A;  4Y13 A;  5JVT A;  3W0L B;  3IRR A;  1S7O A;  1YS7 A;  4ENJ A;  4ESF A;  1BW5 A;  5FTN A;  2A6H F;  2VBZ A;  4BEH B;  2P6S A;  2CGP A;  3WHK A;  3JCU C;  2ZJ2 A;  2LHG A;  3OR2 C;  4EJT A;  2PN6 A;  2KA6 B;  3FK7 A;  3QPT A;  2DDA A;  3VEP A;  5LLQ A;  3OS2 A;  2DAE A;  4KDP A;  5F0F A;  3TQN A;  3WG9 A;  3OYA A;  1A35 A;  3V42 A;  3PO3 J;  4RB2 C;  2QQB A;  4XLA A;  2Z3Y A;  2O0Y A;  3PM1 A;  4L9N A;  2VJJ A;  3RKW A;  3DBL B;  1PUE E;  1JGG A;  1XN7 A;  4OMZ A;  3K70 D;  1LVA A;  2YX7 A;  3QAU A;  3HYI A;  3JAM Z;  2IT0 A;  5CQE A;  3U6D A;  3F6V A;  2QPA A;  1AA7 A;  4XKC A;  4QOS A;  2PJR A;  4XBO A;  4KOD A;  1XGS A;  1Z91 A;  2KP6 A;  3FTF A;  2XPW A;  4LJ4 A;  3P9I A;  4I09 A;  4KT5 C;  4MM3 B;  1KQ9 A;  4L9J A;  2OV7 A;  3DWL E;  2OZ6 A;  2O25 A;  2H1R A;  2P8T A;  4XN3 A;  1HCR A;  1KYZ A;  1IUF A;  5LRR A;  1PGY A;  3CQZ J;  2XPV A;  2B63 J;  1IXC A;  3H3V K;  2WSE F;  1X1P A;  1QNT A;  1H9G A;  5AIQ A;  1IRZ A;  2PBI A;  2CV1 A;  2Y0S A;  3RCO A;  1GV5 A;  4HLQ A;  3F92 A;  4R71 A;  5ITX E;  2MSY A;  2W25 A;  4F91 B;  2M34 A;  5J1Y A;  4ANR A;  3ZQ7 A;  3JSO A;  4E6K G;  1ZRE A;  1VQP I;  1P92 A;  1G71 A;  3BR0 A;  3I59 B;  4M73 A;  1YOV B;  3F6O A;  3U21 A;  5GTH C;  1ODD A;  2DT5 A;  4WXH A;  3ZRG A;  1GAB A;  1MNM C;  3S14 J;  5CVI A;  1ZKG A;  2HYF A;  2QYO A;  1T3T A;  9ANT A;  3RFW A;  2QP9 X;  1GKI A;  3BBZ A;  1G3S A;  4N9H A;  3ZQL A;  3GWZ A;  2VQF M;  2F5F A;  3RKY A;  2ZJQ F;  5KAI C;  3GLL A;  4DV5 M;  4XKB A;  2DK5 A;  1MMG A;  1Z9C A;  4AUX A;  1VQ9 I;  1UHS A;  3T8R A;  3HZJ A;  1Z59 A;  1WKM A;  2CFO A;  3CD6 I;  2VII A;  2KZS A;  4BY1 J;  2MH9 A;  3QOE A;  4LMY A;  3COA C;  5KO3 A;  2MD0 A;  2HKX A;  2VXD A;  4LG0 A;  5D4S A;  3K92 A;  1JB0 F;  3HG9 A;  4NC6 A;  4LF6 M;  1T98 A;  2L5Q A;  3WE2 A;  4AQY M;  5DEQ A;  3RQ4 A;  4UV8 A;  2JA6 J;  4CGZ A;  1IO2 A;  1FP1 D;  3ZQC A;  3K9P A;  2BBY A;  1DPU A;  1V34 A;  2IBD A;  4RS8 A;  2DAM A;  2QF7 A;  1P7J A;  5DM7 F;  2ECC A;  4GYI A;  2W4S A;  4L4U A;  4N4N B;  4B7F A;  4UUS B;  1MJ9 A;  1H6U A;  2L2O A;  2JPB A;  2BHY A;  2NS7 A;  2FOI C;  3PNT A;  3S3M A;  3BT9 A;  1TBX A;  2KIU A;  3GLF E;  3F0C A;  1K78 B;  1X2M A;  2H6C A;  4GRI A;  1VF9 A;  2E1O A;  1I3Q J;  4DR4 M;  1Z7L A;  1SMY F;  3LQQ A;  2ADU A;  3CDI A;  4LLN A;  4RDU A;  4QIW N;  3NWT A;  5FTL A;  4EVI A;  3FWE A;  2HOS A;  1PYV A;  1PUF A;  4J00 A;  1HW2 A;  2ZME C;  3ECO A;  1ZGW A;  5FKO A;  3DZD A;  2JT1 A;  2I7N A;  1OIS A;  1Z0X A;  3I54 A;  3IP4 B;  1N36 M;  3C3E A;  1JI8 A;  1U5T B;  1FOY A;  4B7H A;  1TTY A;  4JX4 A;  3ZMV A;  1X19 A;  2NNY A;  1K3X A;  1RR7 A;  4U88 A;  4A3E J;  5EXP A;  3GLF B;  4M6Y A;  3S1Q J;  2Y0Q A;  4A69 C;  4CXF A;  1MBG A;  3ZOB A;  3J2P B;  3M7G A;  3W3C A;  3U61 A;  2M45 A;  4FD2 A;  3JRF A;  2JA7 J;  2HGC A;  2LY2 A;  1HKT A;  3DPU A;  3OR1 C;  3CJN A;  2W48 A;  2JP7 A;  4MTD A;  4EMS A;  3M8F A;  2JA8 J;  4A3G J;  2CEA A;  2Z3X A;  1SAN A;  3KEY A;  3OIO A;  3CLQ A;  4KA4 A;  4PT5 A;  1T2K A;  5F27 A;  2L7K A;  4GC5 A;  2P6T A;  3HOY J;  1X3W B;  1RET A;  1T0F A;  4A0Z A;  2L4E A;  1MSE C;  3CUQ C;  4I98 B;  4PGG A;  1D3Y A;  2X0L A;  2A6E F;  3IHU A;  2VKH A;  3BOQ A;  4NBQ A;  1Y39 A;  3LCU A;  1ONV A;  3UR3 C;  3DP7 A;  2CJJ A;  4V19 K;  2VXZ A;  4DV0 M;  3Q8X A;  1FP2 A;  1MND A;  4LG3 A;  3LVV A;  2CUE A;  3FXU A;  1TQI A;  1BR1 A;  3SDG A;  3PIP F;  1U3E M;  2LC2 A;  4MGY E;  1SD5 A;  5FKM A;  2E1M C;  3PFI A;  1S6L A;  4BB9 A;  4LG2 A;  3GQ3 A;  2KKO A;  5BPV A;  2ZXJ A;  3C2B A;  3W6V A;  3WTS C;  2R7D A;  2CE7 A;  2XGE A;  2STT A;  2UXD M;  4IHS A;  4KNY A;  3H92 A;  5HDN A;  1R5I D;  1KSF X;  4B44 A;  3BDD A;  4ENK A;  1WJD A;  1WJA A;  1L8Q A;  3QU6 A;  3NQO A;  4UVC A;  1Q3B A;  4DV1 M;  1UFM A;  3S32 A;  1D5V A;  3R0J A;  1B72 A;  3I04 M;  4AVP A;  1MDM B;  3CF6 E;  1XMO M;  2EFQ A;  3I4P A;  4JI3 M;  1IUY A;  3HU2 A;  5FSW A;  1SFU A;  3FKI J;  1IRG A;  2KRC A;  1E0E A;  1MH4 A;  1TZL A;  4PCZ A;  4R1H A;  5TGT A;  4DR7 M;  2HOE A;  3E46 A;  5B1A H;  1IW7 F;  2X6Y A;  3MZY A;  4B3S M;  4GMQ A;  2ZC2 A;  3E3V A;  3MHV C;  3FXO A;  1S7E A;  1B8I A;  5IPA A;  4HF1 A;  2Y0T A;  3FXR A;  5KQ8 A;  1K4T A;  4G7H F;  1DQU A;  2MC4 A;  4M72 A;  1XDU A;  2VPL A;  1CQT A;  3FRI A;  2KJB A;  2COB A;  2FS1 A;  1XMK A;  2E35 A;  2MC3 A;  4QSH A;  1P9Q C;  2JWS A;  5GPC A;  1FIP A;  3K4J A;  2MJ5 B;  3KOX E;  2DTZ A;  3KYC B;  5J40 A;  4WWC A;  5EXS A;  2PJP A;  2VIX A;  3S15 J;  4BQO A;  3ABK H;  3KE2 A;  3MZ8 A;  3HB9 A;  1OYY A;  4DV2 M;  2H8W A;  2MBF A;  3K69 A;  4CYC A;  4CIS A;  1FWZ A;  3CO6 C;  1DP3 A;  1OLT A;  3AOG A;  2L7Z A;  3VWB A;  3ECH A;  1MMN A;  1R6B X;  2DZO B;  2BY3 A;  3V8K A;  2E5Z A;  1PJT A;  4PSX A;  1Q3C A;  2DOA A;  2IGM A;  3KP5 A;  3J81 K;  1QPM A;  2FJ1 A;  3BC8 A;  3KSX A;  2FNP A;  2C98 A;  5F64 A;  3DLL F;  1MZB A;  1OCC H;  2DWM A;  2F4M B;  3HGG A;  3LSG A;  4B47 A;  2B7E A;  3SHF A;  4XLN F;  1ZRD A;  4L5I A;  2HAK A;  2HU9 A;  4HNU A;  3SYL A;  1GVD A;  4B3R M;  4HEA 2;  4PSW A;  2R7V A;  2V1X A;  3IKV A;  1MJA A;  3CJQ B;  2Y30 A;  1OAO C;  2X8A A;  2L9S A;  3G73 A;  2WA0 A;  3GLG E;  3BR1 A;  3B7Z A;  1XS9 A;  2HCB A;  2PJR B;  4IBC A;  4BNC A;  4NXN M;  1A5T A;  3WHL A;  4DV4 M;  1R6R A;  2YPR A;  3KLN A;  1REP C;  4GIT A;  1AUA A;  2K3P A;  4P17 A;  3IH3 A;  5LEJ A;  1NY6 A;  2HS5 A;  3VYU B;  1IN6 A;  1MNE A;  3RZO J;  2PQ8 A;  1X1B A;  2HYJ A;  2G7U A;  3ABU A;  1OFH A;  1UG0 A;  2X1D A;  5B66 C;  2EH3 A;  4XRS G;  4RB1 A;  3E6M A;  4NC8 A;  3L2W A;  4REZ A;  3HHG A;  5J6X A;  1WCM J;  4BAC A;  1IY2 A;  3BPV A;  1LTM A;  4FHT A;  3TP0 A;  1PP7 U;  1STZ A;  2VQL A;  4PJJ A;  4UXN A;  2K9D A;  2MH8 A;  3UK6 A;  3L00 A;  1ZK8 A;  4PD2 A;  3BR6 A;  1TWC J;  3IV5 A;  4LB5 A;  1S3J A;  3LA3 A;  1WJF A;  4LFU A;  2E2I J;  1X1D A;  1QAN A;  2JVG A;  2C96 A;  4NUB A;  1ZG1 A;  2VOP A;  3CME I;  4DR2 M;  1AHD P;  3OYJ A;  1GO5 A;  1U9O A;  2IAI A;  1OCZ H;  4J19 A;  1MBK A;  2JMW A;  5E1X A;  2MRO B;  1L2B A;  4A6E A;  3NAU A;  3PUB A;  4E7Z A;  1VEJ A;  3KET A;  1D0K A;  2VON A;  3GTG J;  4I7H A;  5B5E C;  1NH3 A;  1F4K A;  1SVM A;  3D8B A;  1Z6R A;  2LKP A;  3DKX A;  4A12 A;  3S93 A;  3HHY A;  3F21 A;  3ZCB B;  2R7Q A;  3AL0 C;  4LG0 B;  5HVQ C;  3C1D A;  2EKK A;  4MFD A;  1YSY A;  2DFI A;  4BKX A;  4IBE A;  5E17 F;  2FBK A;  3PQK A;  4UB8 C;  2A68 F;  4RBO A;  2HKJ A;  1X1A A;  3SZP A;  3FD9 A;  3P5J A;  4D5F A;  2RGV A;  1XG1 A;  4P9U A;  2LVN C;  3A42 A;  1W5T A;  1IN4 A;  1MJG M;  2LNB A;  3D5R C;  3IWF A;  1LNW A;  3FIW A;  3LOC A;  4MLO A;  4DIQ A;  2HDC A;  4LFB M;  4ITV A;  4M6V A;  1LFB A;  3IAM 2;  3I56 I;  2QA4 I;  1R58 A;  3EIH A;  1SC7 A;  1XX5 A;  3U60 A;  5F04 A;  2QCO A;  4S05 A;  4KFC A;  1QGP A;  3LA7 A;  3W68 A;  2CSO A;  1YO5 C;  3TDU C;  1ORY B;  3A4C A;  2H27 A;  2MGQ A;  3BRO A;  3BTI A;  4II2 A;  3WGG A;  2JSP A;  2VBY A;  2XAH A;  3GRR A;  4B48 A;  3F8F A;  4F2L A;  1BI3 A;  1XB2 B;  3W2W A;  4A3J J;  2UXX A;  4QPQ A;  4X0G A;  1HKS A;  4ESJ A;  3TDZ C;  1ZAR A;  3J81 Z;  5DM6 F;  4LJ5 A;  4M0W A;  4A3D J;  3SDB A;  2DTR A;  4FET A;  2OCC H;  3KFU G;  3DBH B;  2D5V A;  3S16 J;  3VDU A;  3B6C A;  3GUD A;  2XAU A;  4IBK A;  4ZH4 F;  1LFU P;  3TPZ A;  3VKH A;  2XFS A;  1YS6 A;  1HR0 M;  3S1M J;  2CWB A;  2X1C A;  4XR6 A;  4A3V B;  2LG4 A;  4B1R A;  1RC9 A;  2Q8K A;  1XD7 A;  1NTC A;  4CO8 A;  4BDY A;  1WSU A;  4GXO A;  1HT2 E;  1JKO C;  3J7A O;  2L0K A;  3LAP A;  4LJA A;  1YQA A;  3IH4 A;  1EJ9 A;  2I5U A;  1PRB A;  3E1S A;  3N05 A;  4OU0 A;  4L8R C;  1EF4 A;  1U78 A;  3NWL A;  2HWV A;  4HNT A;  1ZTR A;  4P9F A;  4UY8 I;  1Z67 A;  3ZQF A;  3QPL A;  4AI6 A;  3H9G A;  1Z5C A;  5E8I A;  4EJO A;  3TO7 A;  1R2Z A;  2XAF A;  4C3J J;  3GLI E;  3M1C A;  1JR3 D;  1I94 M;  4M74 A;  1IBL M;  4RLF A;  2R6F A;  4OWR B;  4DYQ A;  2ZTC A;  2D1H A;  4C2M J;  1IM2 A;  1OAI A;  5BR8 M;  2DQL A;  1VQ6 I;  2FU4 A;  5AIP A;  2IW5 A;  1QUT A;  1XWI A;  1W7P D;  2AO9 A;  3WTW C;  4C2U A;  2STW A;  1F5T A;  3DU6 A;  5IZ7 D;  4K0K M;  3IWZ A;  1VQO I;  1ZQ9 A;  4L16 A;  2WY7 Q;  3TE6 A;  2QZ8 A;  4LF8 M;  3KOY E;  1D1A A;  1ZR4 A;  1U8R A;  4A3B J;  1F1Z A;  3FUU A;  1D0X A;  3KZZ A;  3G4S I;  2NS0 A;  2HR3 A;  4IBG A;  1XDS A;  3AOE A;  2DW4 A;  2L9R A;  3T0Y A;  5FJ8 J;  2Z2S B;  3F8N A;  1MGT A;  3U1K A;  1ITY A;  4EJU A;  1B72 B;  3ZH9 B;  5CKT A;  2C9O A;  1XMA A;  2UU9 M;  3BLY A;  4FX0 A;  4I4L A;  1JKQ C;  1W36 C;  3ZP5 A;  1TC3 C;  4FWG A;  5EZH A;  2WZJ A;  1O7F A;  4XK4 A;  4GEW A;  4Y17 A;  3S1R J;  2XSZ A;  5KPZ A;  3OL4 A;  3CCQ I;  4BE2 A;  2E19 A;  2DWN A;  2BZT A;  2HTJ A;  2VQE M;  2QWW A;  2VQC A;  1SMT A;  3ISP A;  5ED4 A;  3K1P A;  1HNW M;  3JTH A;  1NSF A;  1Q39 A;  3KP0 E;  1HQY E;  1VQN I;  4X66 M;  1G3W A;  2VC1 A;  3W67 A;  4YG2 F;  3GRU A;  4DR6 M;  1TQP A;  2P7C B;  4F52 A;  3TQS A;  2YS9 A;  4JI4 M;  5EYR A;  2K27 A;  5FKL A;  4ASN A;  1R9T J;  3HXL A;  1YW8 A;  1XSD A;  3DEW A;  4M9Z A;  2V1D A;  2HOA A;  1BI1 A;  4IKF A;  2RGH A;  1JE8 A;  5E79 C;  3BTC A;  2BJV A;  2F5Q A;  5E3O A;  3LSR A;  3MK6 A;  4XRS A;  1XHB A;  2F5E A;  1MKM A;  1O3S A;  1OCT C;  2L4F A;  4BU2 A;  2BHZ A;  2A6T A;  3MAJ A;  3FXK A;  3CJT B;  2K9Q A;  2IS4 A;  4F93 B;  2O3F A;  3KX2 A;  1D0L A;  3RIR A;  4M3G A;  1BL0 A;  1XXH E;  1PP8 F;  4ANJ A;  1VDD A;  2BVL A;  3C9P A;  2V26 A;  2JWT A;  2RRE A;  3E7L A;  3L2V A;  4Z8X A;  1F9N A;  3JRH A;  3PNY A;  3P7N A;  3GFI A;  1EH7 A;  2R7Z J;  1D8K A;  1NV8 A;  5BPI A;  2XSJ C;  2IJL A;  3JW4 A;  2O8X A;  2P4W A;  3DU5 A;  4LK1 F;  2DQR A;  3DTE A;  4IJE A;  1VEG A;  2ZJR F;  4JI7 M;  1EV7 A;  2OQG A;  2Z33 A;  3WU2 C;  2F4O B;  4IF4 A;  2NVT J;  5ITX A;  2QBY B;  1J5Y A;  2J5P A;  5IWA M;  2DJI A;  3KXE C;  4RNA A;  4F7Z A;  2YNM D;  3OYL A;  3S17 J;  3HHH A;  1N78 A;  2GWR A;  4A3L J;  2MLG A;  2QKL B;  3E9S A;  1IN5 A;  3GRV A;  3L2Q A;  3F22 A;  3IG5 A;  4IHY A;  2WV1 A;  1I1G A;  1LVK A;  2LYC A;  2MR9 A;  3H3Z A;  2BNK A;  3G1M A;  4RMN A;  2ETH A;  2KMU A;  1VQL I;  4OIP F;  1QAO A;  4IRH A;  2LLK A;  1ON1 A;  2D2W A;  2E5N A;  3P9K A;  4AIH A;  2A07 F;  2FUG 2;  1XB4 A;  1HF0 A;  3CDL A;  1DGH A;  5EF6 A;  1UHM A;  1PDN C;  3CCU I;  1ZRF A;  4EGY A;  3ZMT A;  4FE7 A;  4JBA A;  1K3W A;  4KIB A;  1Z5B A;  4P55 A;  4ZDP A;  1SXJ A;  2XDV A;  3BXW A;  2LWX A;  3PSF A;  3RI4 A;  1PJS A;  5K5Q A;  3BQY A;  3TOB A;  4O3M A;  5ERI A;  3EDP A;  4BUP A;  4FAS D;  2WB1 N;  1T0F C;  3Q9S A;  2E1N A;  5GAG J;  5TRD A;  2Z4S A;  2ISZ A;  5M5Y J;  1YI2 I;  4DUY M;  1X1C A;  1YE9 A;  3OYI A;  2HVS A;  5IT9 S;  2CRG A;  2VKD A;  2CW0 F;  3OWT A;  1GVN A;  3Q0U A;  1U8B A;  3AG2 H;  3CCV I;  5D5W B;  1YFH A;  4LJ6 A;  2NS8 A;  3E6B A;  3VFD A;  1K6Y A;  4UHT A;  2RV8 A;  2HL7 A;  1ETV A;  2KIF A;  4W1U A;  3F72 A;  2FSW A;  4NRW A;  2OD5 A;  3K6G A;  3KZI C;  4XLE A;  2KRK A;  3F8M A;  2IA0 A;  1P4A A;  2QGU A;  5FKK A;  1QA6 A;  3IUO A;  1TQM A;  3SEZ A;  3KP3 A;  4BL0 B;  4NRV A;  3NWS A;  5DCM A;  1WGN A;  2E5L M;  2BXZ A;  3KW6 A;  3R60 A;  3ERM A;  2CW7 A;  5D8K B;  4KT0 F;  4B3X A;  3EYI A;  4I8O A;  2E2H J;  1HA8 A;  1J7K A;  2CMP A;  2L7F P;  5DCF A;  4I0A A;  2RVC A;  1LE8 A;  1IG7 A;  4LF5 M;  2EIJ H;  3OYK A;  4D5C A;  3TO9 A;  1O57 A;  1UST A;  3K70 C;  3GPU A;  1P2F A;  4RKU F;  1NG7 A;  1Z21 A;  3BG6 A;  3HJ8 A;  3FBI B;  2IA1 A;  4I76 A;  4D81 A;  3CZ6 A;  3GO5 A;  4IX7 A;  4O6J A;  4HW0 A;  4X62 M;  2XRL A;  4XBF A;  2XF5 A;  2CS3 A;  4LF7 M;  1P4X A;  1T43 A;  4G4Q A;  2YUS A;  2DK8 A;  3MMY B;  3H4M A;  2DO7 A;  2GA1 A;  5K5O A;  4HL4 A;  4BBS J;  4DV6 M;  3R0A A;  3M07 A;  5C3E J;  2WAD A;  4JI8 M;  1L2D A;  3R8F A;  4X1E A;  2LSO A;  2XSD C;  3RZD J;  1ZAE A;  3HJS A;  4CCL A;  1V4R A;  2V6Z M;  2P81 A;  2JRT A;  2ZME B;  5BQT A;  4PFP A;  4L9T A;  4GH9 A;  1IZ1 A;  2JY6 B;  3I4M J;  2JY7 A;  2OQ4 A;  3EPZ A;  4ZYH A;  3ZQJ A;  3SAT A;  2DMN A;  4AYB A;  2QSH X;  2UXB M;  2M0M A;  3HU3 A;  1T8I A;  3CDH A;  3LMM A;  2NVQ J;  5M3F J;  1QZM A;  1DGG A;  3HSF A;  3DBR B;  2HXI A;  2NQ8 C;  4HV5 A;  5HDK A;  2OOA A;  1N32 M;  1ZEL A;  1OJL A;  2OUM A;  1I5Z A;  4FE4 A;  2HZT A;  3GYH X;  4QOZ C;  1LFP A;  5FLX S;  3L2A A;  3DCF A;  3GBG A;  4RGS A;  3J7A Y;  4XK8 F;  5LD2 C;  2ZM6 M;  3U6P A;  2Y9Z A;  5JI3 E;  1JT0 A;  2RC4 A;  1SFK A;  1HJP A;  3CJR B;  4BXF A;  4JI0 M;  1X4O A;  1R4M B;  3ZQQ A;  4CCK A;  3QPH A;  1Z6T A;  3IAS 2;  4A93 J;  1TWH J;  3JSP A;  2DOE A;  2L3D A;  2CP8 A;  2XV4 S;  4LLL A;  3QRF F;  1BW6 A;  3CUQ B;  2XGD A;  4U7D A;  2BEO A;  2DI0 A;  3KDS E;  2LTP A;  4YIF A;  3HKZ N;  2GQQ A;  3S2W A;  5GTI C;  2JZ0 A;  2Z16 A;  1S8N A;  3E5U A;  2K86 A;  2UV1 A;  2GOX B;  4OOI A;  4F55 A;  3SC3 A;  1G8P A;  2F5V A;  3CCY A;  3GXO A;  4Q4Z F;  2NYX A;  1WPK A;  3FKJ A;  2G5G X;  3F8C A;  2E1M B;  2QZ4 A;  4C9Y A;  4ZDL A;  1NK3 P;  1QVU A;  2QQ9 A;  4IPA A;  4RLQ A;  1JUM A;  3H9J A;  2E2J J;  5FFZ A;  1QVT A;  5FO5 A;  3JRD A;  3GFJ A;  4XL9 A;  2DHY A;  4MQ9 F;  3DEE A;  3K7A J;  5EEG A;  2ZNY A;  3CLO A;  1TF0 B;  3RGP A;  3LSH A;  3VKG A;  1I1S A;  4ZDO A;  1EH8 A;  1KA8 A;  4DUZ M;  2F5C A;  3Q0V A;  4Y3O A;  2VT2 A;  3S2D J;  1DU6 A;  5M5X J;  1JT6 A;  3MCZ A;  4I01 A;  2JQ7 A;  5J3L A;  4MGK E;  3OS1 A;  4F92 B;  3JR5 A;  2FOW A;  3HOX J;  3ZGK A;  3AG1 H;  3MQ0 A;  2V1N A;  1NHW C;  3QYF A;  3S3N A;  4IBD A;  5F1J A;  5JI6 A;  2GXB A;  4A3M J;  2YR0 A;  1B6A A;  5FD6 A;  1Y1W J;  5K1Y A;  1FYK A;  2LVQ D;  1ZLJ A;  3KIO A;  3U5Z B;  2LFB A;  4LJZ F;  1E17 A;  2GNO A;  5JFR A;  2BVM A;  4K2E A;  3ZMS A;  4Y4R A;  1G2H A;  5EXT A;  1TH4 A;  4ZJZ A;  4BLC A;  3THG A;  2FBH A;  2XB5 A;  2B3T A;  3H9Q A;  2GM4 A;  4PFO A;  2EA4 A;  5HNH A;  4GC9 A;  2R45 A;  1DV0 A;  2NVY J;  2PLY A;  1CF7 A;  1JKP C;  4ZZD A;  3K1M A;  3GLG A;  3WHC A;  3HSE A;  1E2X A;  4HEO A;  3U6O A;  3TED A;  4D1Q A;  5IOZ A;  3SJM A;  3LA2 A;  2DHR A;  1ZMW A;  5LBQ A;  5HLI A;  4KO8 A;  1B1B A;  1MMD A;  2Q2E A;  2K4J A;  2JRM A;  3CMM A;  4BDZ A;  4LRS A;  1MBE A;  4MNU A;  4XLP F;  5M3M J;  4WX9 A;  1V33 A;  1JTX A;  2EPF A;  2M5Z A;  4JI6 M;  2C5R A;  1MBF A;  1MD0 A;  1WJ7 A;  2MA3 A;  3SXY A;  3WTU C;  1R1T A;  3GLX A;  2KDZ A;  2EFN A;  3GCM A;  4GHL A;  1EE8 A;  3CF0 A;  2XF7 A;  4GHA A;  5AON A;  2A05 A;  3UZU A;  4XKV A;  1FBS A;  1SD7 A;  3CMY A;  5GKN A;  1BR4 A;  1WQ2 A;  2VJ5 A;  4JK1 X;  3JRG A;  2UUB M;  1L0O C;  2ME0 A;  2NXN B;  1T95 A;  3FYC A;  1WR1 B;  2EQR A;  2YX4 A;  4MGH A;  3B7Q A;  5GAH J;  1ETO A;  4LJ9 A;  3ASO H;  2AQE A;  5CLS A;  2K0B X;  3U6M A;  3SBJ A;  1XPX A;  3BR5 A;  3E5X A;  2XB0 X;  3VYR B;  3PXG A;  1W4M A;  3K4N A;  3CMA I;  5LGU A;  1E3O C;  3B73 A;  5BMZ A;  1DGH B;  1WRJ A;  2IPQ X;  4JN6 A;  3PUF A;  1JHF A;  1Y6I A;  1T56 A;  2KRH A;  2L9V A;  4BY7 J;  2Z8Y M;  4E7S A;  1H88 C;  3BZ6 A;  1V92 A;  2GAU A;  1FSH A;  3KEO A;  3LNQ A;  3PJR A;  1ETQ A;  2ELJ A;  1YLA A;  2MAB A;  3BR2 A;  1R49 A;  7CAT A;  2FX0 A;  3OYC A;  3C18 A;  1ZG5 A;  3CP2 A;  1QPI A;  2E1C A;  3QWL A;  4AKG A;  3KEQ A;  1WH5 A;  2VI6 A;  2VF7 A;  1R2Y A;  3RYR A;  2DYR H;  2JZ1 A;  5ITR A;  2XF3 A;  1FJG M;  1R00 A;  3EUH A;  3HGY A;  4IEJ A;  5HS9 A;  3CCL I;  3BQZ A;  3E0J B;  1WHU A;  1J59 A;  3FXL A;  1L1Z A;  3I3L A;  1DGB A;  1P7I A;  4DZJ A;  5LGN A;  2J7N A;  1WZ2 A;  1MMS A;  2OF7 A;  1Y56 A;  5J8C A;  2KEB A;  1USS A;  3B02 A;  5FTM A;  2ZSH B;  2JZY A;  3BPX A;  1IBM M;  1U6G A;  5LGT A;  5E3M A;  5EQT A;  2W7N A;  2I7P A;  1QZY A;  5H20 A;  4AVZ A;  3AL0 B;  4A2U A;  2A69 F;  3GTL J;  4U0W A;  4KLN A;  4AD9 A;  3GTO J;  2CQ7 A;  4G6Z A;  4QHS A;  3SMP A;  3KP4 A;  1XGO A;  5FRO A;  1APL C;  3GZ6 A;  3ABM H;  3KCC A;  3IEC A;  4KIG A;  2KNA A;  4EEF G;  4WK8 F;  1BC7 C;  2EB7 A;  3LSM A;  1WFX A;  3ZQH A;  2OA4 A;  2PMU A;  4BQQ A;  5D8L B;  2NRA C;  2ERC A;  3GQ5 A;  4XGI A;  1XSX A;  3Q9V A;  3VYS B;  4G7O F;  3GRY A;  1O3T A;  2OC6 A;  2VBX A;  2QVO A;  2DA5 A;  3CP8 A;  1G6N A;  1ZRC A;  4ZTJ A;  5EGO B;  1W7P B;  2WAF A;  1RKW A;  1QHG A;  1XNQ M;  2ESN A;  1OCP A;  2V6C A;  4IVN A;  1ACI A;  4G4R A;  1V5F A;  1MJB A;  3WTV C;  3V8L A;  1NVM A;  4NC7 A;  4L9V A;  4A3F J;  5KCM A;  2M7B A;  3K1J A;  2WWY A;  2CW8 A;  2IA2 A;  1UM8 A;  2O6G E;  4M3F A;  2VQG A;  4V2G A;  2UUA M;  1IC8 A;  1G41 A;  2CV2 A;  1G3Y A;  4M9S A;  3BCA A;  1YIT I;  2XPU A;  1X4P A;  1GLN A;  1IXR C;  3TP3 A;  3HOT A;  2HVR A;  4CYD A;  3JR4 A;  5BOX A;  1ERD A;  4AM3 A;  1BR2 A;  3H36 A;  5FD5 A;  1O7L A;  4F1I A;  4NSO B;  1F4I A;  1LV7 A;  3C3W A;  4CCJ A;  2R5Z B;  3W6K B;  1KU2 A;  2DEN A;  3BWG A;  1EA3 A;  4J01 A;  1ZGA A;  1BI0 A;  2CFX A;  1BA5 A;  1R5L A;  5C4X J;  1OFC X;  1Y8G A;  2L9N A;  3VSL A;  4OU7 A;  2OPF A;  3A02 A;  3K4K A;  1KFV A;  1PJI A;  5LFA A;  4KT6 A;  2N35 A;  2F5D A;  1QVR A;  3HJE A;  2QM3 A;  4FCY A;  3AJI B;  1AWC A;  1AU7 A;  5KK1 A;  4GDF A;  1FIA A;  2M8G X;  1A6Q A;  3BR3 A;  3AFH A;  4CIZ A;  2YFQ A;  3LQR A;  3H5R A;  4LIU A;  1G8X A;  4HF2 A;  2UXC M;  2LDU A;  3QQA A;  2DMT A;  4OIO F;  4QPO A;  1B4A A;  3SFI A;  1AKH A;  2DPU A;  2R46 A;  1IFY A;  4XLH A;  2XRN A;  3I01 M;  4HNV A;  3AG4 H;  3T38 A;  2XSZ D;  2NOG A;  3RQI A;  3U6Q A;  2CYY A;  2W24 A;  2VLA A;  1ZGJ A;  1JHH A;  2VPR A;  3J27 B;  4RF0 A;  2FE3 A;  4E7J A;  2JXN A;  4WXC A;  2H1K A;  2Y2Z A;  4AIJ A;  4MEX F;  4IHT A;  4P5O A;  1IRX A;  3WTX C;  4UVB A;  3O6B B;  2KJC A;  3LSI A;  3C2G A;  2NVU B;  3HC7 A;  3K8Z A;  1HC8 A;  2R7F A;  1WJC A;  1T6O A;  2DFH A;  2ZCW A;  3DF8 A;  1E32 A;  5FTJ A;  2FA5 A;  2HHH M;  4A0X A;  5KQD A;  5D4R A;  4QNR A;  1A31 A;  6PAX A;  2LR8 A;  3C3D A;  5A2Q S;  1BIB A;  4NXM M;  2K9S A;  1SXJ C;  3U6E A;  3GEZ A;  5CQG A;  1K83 J;  1C7Y A;  1XMX A;  5DUI A;  2OBP A;  2RQP A;  3AG3 H;  4FCT A;  3BP8 A;  4XSX F;  1MBH A;  3OIQ A;  2DU9 A;  4XIC A;  2QKM B;  5C18 A;  2P0W A;  2ZAO A;  4GKK M;  1HBX G;  3FHN A;  1Z5A A;  1QZZ A;  1UB9 A;  1R7J A;  2P5K A;  4XKW A;  3L26 A;  2HKO A;  1MH3 A;  1I6X A;  3B89 A;  1XXH A;  2RKO A;  4NNJ A;  3TKY A;  2HI3 A;  3FXQ A;  1R1V A;  2DT6 A;  4XOR A;  1VZ0 A;  2MLK A;  2LHC A;  1IY0 A;  1XC5 A;  4HG2 A;  4MGZ E;  3I5U A;  1E94 E;  2EIL H;  4L0Z B;  4YII A;  3S1N J;  3WU1 B;  5HOD A;  3EYY A;  3T6P A;  4EGZ A;  2NAZ A;  2R7O A;  1O3R A;  2ZO4 A;  2EJS A;  4HQE A;  4E7L A;  2QSF X;  4UV9 A;  1E9R A;  2PMZ N;  1GJT A;  1FC3 A;  5CVJ A;  4F3Q A;  1IXZ A;  2EA2 A;  1H8A C;  1DU0 A;  1KQ8 A;  3MVP A;  4IQJ A;  1HQC A;  1OR7 A;  4PJL A;  1NY5 A;  5ICE A;  3HPH A;  2M30 A;  1SD6 A;  4JP0 A;  4PUS A;  1R5G A;  3NBI A;  2E36 A;  2DAI A;  1PJQ A;  4IHW A;  5EP3 A;  1TGU A;  1P3Q Q;  2GZW A;  4UN2 B;  1YYV A;  4BJ5 C;  1HDD C;  2FEZ A;  2HOT A;  1BVS A;  4Q48 A;  2CG4 A;  1WGL A;  3TW6 A;  3FUX A;  1X3Z B;  1L1T A;  3ZQG A;  4M3D A;  1D8J A;  1HLV A;  1TNS A;  3ROU A;  3JRC A;  2ZBK A;  1X58 A;  1SXJ D;  2F4V M;  2OCE A;  3MKZ A;  3VK7 A;  2IGO A;  1IAW A;  3KPH A;  1OTR A;  3W2A A;  3SZG A;  1PUF B;  3K2A A;  4YEL A;  2R7U A;  1LUJ B;  2XGC A;  5J4V A;  3GPY A;  5KHD A;  2I8D A;  2ELH A;  3ASN H;  3JTG A;  4DBQ A;  3VDP A;  1QAM A;  4L78 A;  2AXL A;  4CIC A;  5F0H A;  2GBY A;  1ON2 A;  5ICG A;  5KAF C;  3PIO F;  1U0J A;  4XRM A;  3J80 S;  1N34 M;  2ZSI B;  5IP6 A;  1C0W A;  2W00 A;  1ENH A;  1HT1 E;  1F36 A;  1S9H A;  1YJ9 I;  2O9L A;  1BOA A;  3GLH A;  1HSJ A;  2N8G A;  2VKV A;  3ZPL A;  1ETX A;  1OQY A;  2KPM A;  1W0U A;  3O8G A;  2HPM A;  3WGH A;  3AV0 A;  4AKH A;  2M4G A;  4IRG A;  3ZMU A;  4B3T M;  4JV5 M;  1RNL A;  2NOJ B;  4PK4 A;  4RAZ A;  4D9J A;  3MKY B;  3U61 B;  5DTD A;  1TDZ A;  2QHO B;  1MU5 A;  1JUP A;  3L9F A;  2WAQ A;  4NDL A;  3A46 A;  2FQ3 A;  2CO5 A;  2Q1Z B;  3K4M A;  2Z1D A;  4Q47 A;  3I71 A;  4NL4 H;  2VQH A;  1V54 H;  4D82 A;  1S5L C;  5D5U B;  4U87 A;  3GTK J;  3GP1 A;  1HDP A;  4A5M A;  4YHH M;  5IP7 J;  3ZC7 B;  1W0T A;  1QYR A;  3KYD B;  1IY1 A;  4P16 A;  1N33 M;  3OSG A;  2WY8 Q;  5K7H A;  2CQX A;  3CCM I;  1TTE A;  2ZXW H;  4U0Y A;  2GIZ A;  2RAE A;  2ZNZ A;  4FT8 A;  5H6Q A;  3V4G A;  3ERE D;  1LKX A;  3REO A;  3TW7 A;  3A0H C;  3KP7 A;  1WVR A;  4HYE A;  2ME6 A;  3A03 A;  5E3L A;  3A01 A;  2DA6 A;  2KDL A;  2WTE A;  3KSJ A;  4H0E A;  3BZC A;  2CH0 A;  1I4W A;  2A3S A;  1RUO A;  4DOZ A;  2F2E A;  4GO1 A;  3WE3 A;  4V2F A;  3OOP A;  4A5N A;  2VJI A;  1A04 A;  4HAM A;  3SFZ A;  4LGW A;  4L5E A;  2HWJ A;  3VOD A;  1OFI A;  5IYB J;  4LGM A;  2ELK A;  2Q0O A;  3WTT C;  2ACJ A;  4BXX J;  4DBG B;  2VKE A;  1UZC A;  4MHG A;  5J8F A;  4FX4 A;  1ETW A;  4UUT A;  2IVM A;  2XAS A;  2DVW B;  5IT9 K;  2Z99 A;  1NJF A;  4LK0 F;  4I99 C;  5ICC A;  3CCR I;  1B9M A;  1R22 A;  1QDT A;  3TWK A;  2Y69 H;  2XAQ A;  4Q5S F;  3HOU J;  3VPR A;  5J47 A;  4ENN A;  2WSF F;  2XUB A;  4OAY A;  3ZMZ A;  4G94 A;  1I39 A;  1KGS A;  5E1Z B;  2UWM A;  3FMR A;  2E7X A;  5L3E A;  2R93 J;  5L3B A;  1RPW A;  1FPQ A;  3M8J A;  4EAT A;  1B8I B;  4G6Q A;  4B08 A;  4OAZ A;  2EZK A;  4O5V A;  2ZJP F;  1VQ5 I;  2PI0 A;  4OVZ A;  4JI2 M;  5EP4 A;  3R4K A;  4WUR A;  4TUW A;  1M1E B;  2FXA A;  5BPD A;  5F08 A;  2XC7 A;  4HOB A;  4JOM A;  2CHV A;  4PZJ A;  3RDI A;  1QZE A;  1PJJ A;  2LTU A;  5E26 A;  2M60 A;  1UMQ A;  3VSK A;  4B8X A;  1LQ1 A;  4E70 A;  8CAT A;  5HNF A;  5JLX A;  3GTQ J;  2COM A;  4MFE A;  3SAV A;  1VND A;  2I10 A;  2IEK A;  4LD5 A;  4CYC B;  1Z3Y A;  2A61 A;  1L3L A;  5HS7 A;  2X4H A;  4IOC F;  2LP0 A;  2QNJ A;  4JXJ A;  1TWF J;  3PVS A;  4MEY F;  5EEA A;  4I2O A;  1ETY A;  1Y8Q B;  3K9T A;  2RRU A;  1NK2 P;  1HW1 A;  3DFZ A;  4FTH A;  3H5A A;  2CRU A;  1OPC A;  2R92 J;  2E34 A;  1VEK A;  5CVU A;  1VTN C;  2BYV E;  4RGR A;  3HRU A;  2VB6 A;  2RQQ A;  2HQ5 A;  2WAE A;  3E6D A;  3F8B A;  3G2B A;  1QAQ A;  1PVE A;  2IXS A;  3FZV A;  1KQ0 A;  3FXM A;  1T6S A;  1R4G A;  4FCW A;  4FW9 A;  1TW2 A;  2KFD A;  3LFK A;  5C4J J;  1H9T A;  1AKH B;  1SG9 A;  1RR8 C;  2LK2 A;  4ZYA A;  5EG0 A;  1LPQ A;  3HOS A;  4XN0 A;  3TMO A;  4X65 M;  4HRI A;  3O3K A;  4RAF A;  4DYR A;  3I55 I;  1TWA J;  3DTK A;  3PNV A;  4Y7N J;  1YRN A;  3Q3S A;  2OPT A;  2ZB9 A;  2LD5 A;  2Y48 A;  1FZP B;  4S0H B;  2HEO A;  2J5Y A;  3H5N A;  2MGW A;  4PJM A;  3A0B C;  2VL8 A;  5FLX K;  4HBL A;  2R5Y A;  3LFU A;  4ZYD A;  4IZZ A;  1QQW A;  5E3N A;  1N75 A;  3JRE A;  3HWS A;  2CHG A;  3KOW E;  4LJ8 A;  3BJO A;  5HLT A;  4II7 A;  1BC8 C;  2KRF A;  4OIN F;  4BHP A;  4OX9 M;  3G3Z A;  3HTS B;  1D1C A;  3OOU A;  4XLF A;  2XGN A;  1D0Z A;  1ZMU A;  2GIV A;  4W97 A;  3Q0W A;  5DD4 A;  4UUS A;  2ID6 A;  3GF2 A;  3H3U A;  3HL2 A;  3R6S A;  2ZTD A;  3LVW A;  2F48 A;  2X1E A;  1MSF C;  3OL3 A;  3HPG A;  3U6C A;  2VT3 A;  1VQK I;  3EUH C;  2EK5 A;  2M3A A;  3MN2 A;  2L54 A;  1KU9 A;  1BM9 A;  2OTJ I;  3L1P A;  3BY6 A;  3TWM A;  2RN7 A;  3DKY A;  1HNZ M;  5IT9 Z;  2M9H A;  2X4A A;  1TWG J;  2ZAM A;  3MFK A;  3TGN A;  3FK6 A;  3F23 A;  4DBR A;  4BAY A;  2DXI A;  1WWX A;  5DS9 A;  1RRJ A;  1QHH D;  1GDT A;  3I4Y A;  2AQF A;  3H0D A;  2KHH A;  4ON0 A;  1YG2 A;  1ZV1 A;  4HZF A;  2G7H A;  1U5T A;  3GTJ J;  5K5R A;  4QNM A;  3DTI A;  1GHC A;  2ESH A;  3FF5 A;  1H0M A;  3M4O J;  2KZU A;  3GLF A;  4I5S A;  5DYI A;  4CCO A;  3H0G J;  2ISY A;  2IGK A;  2KL4 A;  3D0S A;  3LWF A;  2FF4 A;  1DDN A;  4ITQ A;  3FBN B;  2QEX I;  2CWE A;  2JSC A;  1QRY A;  4YFK F;  4EJV A;  5DDG A;  2J7O A;  3U60 B;  1HST A;  4N4O B;  1O4X A;  2H09 A;  3K2L A;  3RPU A;  3G6E I;  1QU3 A;  3OYN A;  4GFB A;  3DFG A;  3ZR8 X;  4IJA A;  3J7Y J;  3FHZ A;  1NJG A;  3QP6 A;  4PJ0 C;  4E7K A;  2JY8 A;  3JRB A;  1A6I A;  1IV8 A;  4R7G A;  2ZBK B;  2EJR A;  4HA8 A;  3L27 A;  1NNJ A;  4B3A A;  1ZLK A;  2F5S A;  4P1W A;  3FDY A;  2XAJ A;  1SVL A;  2ID3 A;  5LMN M;  2IP2 A;  2DAK A;  2VE8 A;  2L01 A;  4KIF A;  2CQN A;  4B3M M;  5GAE J;  2DOF A;  4IXA A;  2RNJ A;  2HQR A;  4XSZ F;  1NV9 A;  1DP7 P;  1I6H J;  2EIN H;  2F4I A;  1W1W E;  3GLH B;  3DEU A;  4MTE A;  4CZZ A;  2ECB A;  2EUC A;  1Q1V A;  4DQ2 A;  5LMU M;  2VDB B;  1RZ4 A;  3DPL C;  5LHG A;  4R3D A;  3A98 B;  2LF7 A;  3FKE A;  3I51 A;  4H4K C;  2GOM A;  3VB2 A;  2IS2 A;  4KMU X;  5FGM A;  4YFX F;  5FLX Z;  3GX4 X;  1MDM A;  2LMD A;  1BJZ A;  2KZG A;  2UXN A;  2FMY A;  4HF0 A;  2PMH A;  4L5J A;  3W2V A;  4AG6 A;  3CF2 A;  4RAG A;  4EIW A;  5F3W A;  3FTE A;  1IRF A;  3JRI A;  4XMY A;  4Z2Y A;  4BQA A;  1YW7 A;  5BS6 A;  2J5O A;  4YFN F;  5E20 A;  5JHU A;  1S29 A;  3PO2 J;  5IYD J;  5F6F A;  2DA4 A;  4DZP A;  4QHT A;  1EIJ A;  1IQP A;  4L0Y B;  1B9N A;  4KUM A;  1DPR A;  2L6O A;  3GO8 A;  4KJZ A;  5CYV A;  1CUK A;  2M87 A;  2QUF A;  5FLV A;  3OYG A;  3U9G A;  3HGI A;  1MN3 A;  1KZH A;  1VFC A;  2OAZ A;  3BOS A;  1FOW A;  4DR5 M;  5FLM J;  3E6C C;  2Z5U A;  2LVA A;  3HKP A;  3CCS I;  3SHG B;  4WXD A;  3F9K A;  4A0Y A;  5H37 D;  2OU2 A;  3WHB A;  3S3O A;  1TDH A;  1V3F A;  2DPD A;  4HX4 A;  2R65 A;  3VFZ A;  5HDG A;  3DQV C;  4BS9 A;  1UG2 A;  4LF9 M;  2FD5 A;  5DV5 A;  3ZN0 A;  2LH9 A;  4G12 A;  4ZYE A;  4RB3 C;  3CCJ I;  2QSG X;  3KOZ E;  2L4M A;  4BHC A;  4JX5 A;  1GT0 C;  4CCN A;  2BY0 A;  2PG4 A;  1P4W A;  2E71 A;  3K4B A;  4JX6 A;  3OSF A;  2X6O A;  2D7H A;  2EFW A;  2QEN A;  2EIM H;  2BV6 A;  3HKZ A;  1IBK M;  2GXG A;  4IBF A;  2XHK A;  3IG8 A;  2XRO A;  1OIP A;  3I53 A;  4WW0 A;  4PJN A;  4JI5 M;  3M3Y J;  1FMW A;  1J9I A;  4B09 A;  5JI2 E;  2Y0S N;  4M3B A;  4ZYG A;  2LOO A;  1IGN A;  1AIP C;  3MMP A;  3GPP A;  2LKX A;  4XON A;  5GAD J;  4E7I A;  1P6R A;  1Q1H A;  1ZMV A;  4OVZ B;  4IHX A;  3BJ6 A;  3JAM S;  1JUS A;  4A3C J;  4G6D A;  3F3X A;  3SYT A;  1G4D A;  4EM0 B;  1I3A A;  1QDR A;  1SVO A;  5CJ9 A;  2O01 F;  3HRS A;  4S04 A;  3FM3 A;  2FBI A;  3N97 A;  2KQR A;  4BBA A;  1KYI A;  4I02 A;  4D7M A;  3UKG A;  3U6S A;  3RE8 A;  2R7W A;  2YU9 J;  3RTR A;  1RU3 A;  2AS5 F;  5DYG A;  2XZF A;  1MIJ A;  1SFE A;  1X3U A;  3HRT A;  1K82 A;  3E5Q A;  2JNH A;  1IF1 A;  3TBI A;  1OR7 C;  2JJ7 A;  2TRT A;  1WIV A;  5EP1 A;  1AOY A;  3JRA A;  1SEU A;  5B1B H;  2APL A;  1IXS A;  3ZMD A;  1EH6 A;  3TO6 A;  2CQK A;  2V79 A;  5FKN A;  3ILK A;  2C6Y A;  2G3Q A;  3SAU A;  2FH0 A;  3CGW A;  2V1C A;  3T1H M;  4DJA A;  1LDK B;  2JA2 A;  4L6V 6;  2HQN A;  5D6E A;  5BNG A;  4UUV A;  1B59 A;  3CES A;  1ZAO A;  1DGW Y;  5EG0 B;  1JTY A;  1ORK A;  3MJ5 A;  3EUA A;  2HTS A;  3B9P A;  3ZN1 A;  4XNF A;  1NHA A;  2VE9 A;  5E1W A;  4II3 A;  2P7V B;  1YRN B;  2HDD A;  2P5L C;  1SXJ E;  2KIQ A;  2P5V A;  5TJJ A;  1QO0 D;  2K40 A;  2VAS A;  1ZH5 A;  1BN5 A;  1X2N A;  1GV2 A;  4W5W A;  4EM1 A;  4RF1 A;  1WJ5 A;  1XC8 A;  3G71 I;  2R5Y B;  2KIM A;  2Y0M A;  2O8K A;  1D0Y A;  1S72 I;  2XFT A;  4LLG F;  1WHC A;  2DBB A;  2XF6 A;  1Z1D A;  2YSR A;  1T08 B;  4NHJ A;  2QCU A;  3FM5 A;  4PDG A;  2H5X A;  4HST A;  1F43 A;  3ABL H;  3ML6 A;  1MBJ A;  2B0L A;  3FTC A;  2TCT A;  2BGC A;  2W1O A;  3ELK A;  4XM3 A;  2Y20 A;  3HHW A;  3U2R A;  4BHB A;  2H94 A;  2EFP A;  3A1Y A;  1GUU A;  2M5W A;  5K7Z A;  2XEP A;  4OIR F;  1SXJ B;  3HEF A;  4P96 A;  2YQZ A;  4CCM A;  4HSR A;  1TT0 A;  2XZU A;  3FMQ A;  4KIC A;  5H2F C;  1OIZ A;  2LF8 A;  1KU3 A;  2DDB A;  1ULY A;  4XRF A;  4AZF A;  2IGN A;  2VUM J;  4Y33 A;  2HVQ A;  2ZAN A;  2EA0 A;  5JVG F;  4I0B A;  2D1V A;  3VDX A;  1JQJ C;  3HU1 A;  1FT9 A;  1LDJ A;  4GGG A;  3C7J A;  4UB6 C;  3Q5F A;  1VQ8 I;  1JR3 E;  1BJA A;  3OYD A;  3D1N I;  5EZG A;  3TWL A;  1K6O A;  3QYB A;  1VDL A;  2DNA A;  1OCO H;  4BYY A;  1ZR2 A;  5A2Q K;  5CPR B;  4LY6 A;  2V9V A;  4C2T A;  1TR8 A;  2R7T A;  3HBL A;  1WXQ A;  1Y1V J;  4YRV A;  4WF2 A;  5E8G A;  3T15 A;  2VF8 A;  3HM5 A;  4DR3 M;  1YJW I;  1VQM I;  4LRT A;  1EFU B;  1RUN A;  5DCM B;  2LH0 A;  2DKL A;  2CV0 A;  3LSP A;  4XID A;  2RNG A;  1WGX A;  2C99 A;  3AOE C;  4IHV A;  2R7S A;  4KN7 X;  2DZL A;  4KMF A;  4JYA M;  2XLJ A;  1KU7 A;  4QTR A;  3V7S A;  1OMI A;  2DYS H;  2GA2 A;  2JK3 A;  2YR2 A;  3G1L A;  5KPR A;  3GVA A;  4I6Z A;  4LOC A;  2QLZ A;  5DUK A;  3OV8 A;  1O3Q A;  4CSW A;  2MD5 A;  1LE8 B;  2ZKZ A;  1G59 A;  1UCR A;  2KHM A;  5TIS C;  1UHW A;  1T38 A;  3FRH A;  2DMQ A;  2LKS A;  2JTV A;  4KN4 X;  1T39 A;  2CHQ A;  1PM5 A;  1ETK A;  5F1R A;  4HDU A;  4ABZ A;  1VQ1 A;  3ZXS A;  2KIS A;  5CVV A;  1XNR M;  4JYK A;  1FSE A;  1WI3 A;  2EZL A;  3EET A;  5L3F A;  3GTP J;  1OKR A;  4PDI A;  2R4J A;  2DAO A;  1TLH B;  2EBI A;  2Z7J A;  4CJ6 A;  3TL4 X;  3PSI A;  1IN8 A;  2YU3 A;  3CF5 F;  3KS4 A;  3NBX X;  1K7A A;  2HDW A;  1SFO J;  2AHQ A;  3RKX A;  3HX3 A;  3V7C A;  3S2H J;  4HLX A;  1TL8 A;  3NEU A;  3R9X B;  4IBJ A;  4L15 A;  2R62 A;  1Z3X A;  3GLI A;  2WC2 A;  2K47 A;  2D7E A;  4CH7 A;  1G3I A;  4FWD A;  4BE0 A;  4FWH A;  4FCV A;  1E9S A;  2FOK A;  2F5P A;  1R5H A;  2LY1 A;  5IP9 J;  2R0Q C;  2XKO A;  3KZY A;  4LFA M;  3P9C A;  3GFM A;  4M9X A;  3DLA A;  3OIP A;  2V7F A;  2FRH A;  1UFZ A;  2M0C A;  1JJ6 C;  4AG5 A;  2FFJ A;  5KNL A;  1R7R A;  1EKE A;  1HKQ A;  4DV3 M;  4EV0 A;  1SAU A;  4IJF A;  2V9P A;  2DZN B;  3HIF A;  4GCV A;  5LHI A;  3UMM A;  3QPS A;  1NG6 A;  4D0P A;  1FTT A;  3KFW X;  2JUC A;  2Y21 A;  2LVP C;  3GFL A;  4PGH A;  4R79 A;  3PL8 A;  2XIG A;  3BCB A;  3OTO M;  2H6B A;  3FE3 A;  3J80 K;  3SYK A;  1YIO A;  5J4Y A;  1D1B A;  2G0E A;  4AU7 A;  2KNZ A;  3VK8 A;  2OJE D;  4HX7 A;  4PCQ A;  2OTL I;  3S8P A;  3LW5 F;  1UJ8 A;  3FUT A;  4BE1 A;  3L2U A;  2EO2 A;  2HPI A;  1YX5 A;  1WJB A;  2JUG A;  4Q7J A;  4HQM A;  3RGS A;  2JUJ A;  1YLF A;  2QQA A;  3QP5 A;  3WOD F;  4E4H A;  2DOD A;  5LEK A;  4RM2 A;  4XQF A;  2DA3 A;  1NO1 A;  4OW0 A;  2VC0 A;  3MZH A;  3KVW A;  1Y0U A;  4B7G A;  3DA1 A;  1GVJ A;  1MW7 A;  2F6C A;  1U2W A;  1OYI A;  1XTA A;  2MW8 A;  2HNH A;  3LCV B;  4M71 A;  3T8T A;  4AKI A;  3U1D A;  5A2Q Z;  5L8R F;  2V9K A;  1VI0 A;  2EV6 A;  2EV5 A;  1J2X A;  3DPT A;  3BTL A;  1FYM A;  4RB0 A;  2AXT C;  1XGN A;  4I81 A;  2IS1 A;  2DCE A;  3PQJ A;  3D5L A;  4LZJ A;  4HLY A;  4YIR X;  4EQQ A;  3B6A A;  5ITT A;  3AAF A;  2FE8 A;  3K2Z A;  3RJP A;  1SD4 A;  4KIT B;  4DNC A;  3SZT A;  1TP4 A;  4B43 A;  3SMS A;  1N77 A;  4CDG A;  2QBY A;  2RKH A;  3UNG C;  2M7A A;  3ONQ A;  5EXX A;  2DAG A;  5E18 F;  4N9I A;  3WTZ A;  1R4N B;  4NB5 A;  3HOZ J;  3H35 A;  4A3K J;  5F0C A;  5IY5 H;  5J1R A;  1YUB A;  2R0I A;  1U5T C;  2XH9 A;  1XCV A;  3FX3 A;  5HS8 A;  5DYM A;  4LGY A;  1XMQ M;  2LNH C;  3SAW A;  3ZQI A;  1YW9 A;  4D7N A;  3IC7 A;  1FLI A;  1FNN A;  4ENM A;  4JQF A;  4LF4 M;  1IDY A;  3KLO A;  3QYE A;  1FX7 A;  1IDZ A;  5D6F A;  1CF7 B;  3RYP A;  2W82 A;  2K3F A;  3GLG B;  2R3S A;  3GZN B;  1IXS B;  2L02 A;  2RDP A;  3I64 A;  2Q2E B;  1DO2 A;  3LSJ A;  3QOP A;  2XKP A;  3CC2 I;  2CQQ A;  3FMS A;  2X48 A;  3T5X A;  4OIQ F;  3GPX A;  4MO7 A;  1OKS A;  3DOA A;  5EDN A;  2KXE A;  2L7M P;  3K9O A;  1ZYR F;  4CZC A;  4IBI A;  3V76 A;  4ZZL A;  2OOB A;  2KRU A;  2KLO A;  2BY1 A;  1VG5 A;  2L7I A;  4X64 M;  2KT0 A;  5IOY A;  2A5Y B;  5ITQ A;  2RGO A;  4CHU A;  5FFX A;  1S7A A;  2M4K A;  1NNU C;  5C44 J;  4MB7 A;  3HUG A;  3LL7 A;  4ETS A;  2CU7 A;  2L09 A;  2UUZ A;  5EJC A;  4U0V A;  2DJN A;  2PMZ A;  4LJ7 A;  1LDD A;  4XOP A;  3HOW J;  1OYW A;  2FNA A;  4FVM A;  5DFL A;  4AW4 A;  4DV7 M;  1BIA A;  1HXD A;  3DKW A;  3D5S C;  2HZD A;  4XOT A;  3J80 Z;  1UEL B;  4AWX B;  1NHG C;  2PX9 A;  4IL6 C;  2BE5 F;  2IRF G;  1LEA A;  5ITU A;  3OY9 A;  3HDD A;  4G4N A;  5HLG A;  3WG7 H;  1Z77 A;  4BBR J;  1K4S A;  5FRM A;  3IKT A;  3LST A;  1HW5 A;  1R23 A;  2EV0 A;  1YHQ I;  2K9M A;  1FYL A;  5B3S H;  4IBB A;  5EP2 A;  2DMP A;  5L3G A;  3W0F A;  4JI1 M;  1XGM A;  2O61 A;  2D7G A;  1I27 A;  4BQN A;  4Y28 F;  3NRV A;  2DA7 A;  3R61 A;  5C1B A;  3KYL A;  2BW3 A;  2XGX A;  4OMY A;  2BY2 A;  2DT7 B;  2Y75 A;  2WAQ N;  2BWE A;  1SFX A;  3H1C A;  1FBQ A;  3MKL A;  3RPU D;  3J81 S;  1E3H A;  5LHH A;  1QQI A;  2DMU A;  3ESW B;  3V8J A;  3GQ4 A;  1ZHF A;  2EIK H;  2LRE A;  1D0M A;  3FIS A;  3GME A;  3KP1 E;  3VOE A;  2ZXI A;  3I0T A;  5JLW A;  1GL6 A;  1K79 A;  3A45 A;  4NQW A;  3UGJ A;  4LFC M;  4C3I J;  5FB2 A;  2VBW A;  3I4V A;  3BG9 A;  3HRM A;  2EKF A;  2ZME A;  2LVO C;  3O8H A;  1JJ8 C;  2DA1 A;  3L09 A;  4IOA F;  4DGW B;  2BWB A;  3ZCO A;  1JXS A;  5L3C A;  4KYW A;  1IN7 A;  3KP6 A;  2LVS A;  2LBF A;  1RIO H;  2PFB A;  3CUO A;  4L18 B;  3B7N A;  4M6X A;  4BXU A;  5HLH A;  2GXA A;  1IJW C;  5DNY A;  4WP2 A;  2WV0 A;  4LIV A;  4IO9 F;  2MYS A;  4IQ4 A;  3HY5 A;  2FML A;  2ZFU A;  4CUG A;  2TDX A;  2K9N A;  1L2C A;  2LY9 A;  4IRI A;  2G9W A;  3K10 A;  3MWM A;  1V55 H;  5IYC J;  4QWQ A;  1N25 A;  3E97 A;  1TH2 A;  3L2R A;  4ZTF A;  1KON A;  1JGS A;  3DXJ F;  4BEH A;  4NOO B;  4MGI E;  2X49 A;  3HOV J;  3FUV A;  2C9C A;  2P5T A;  3G1O A;  3OYE A;  4CGY B;  3O2P E;  1J0R A;  2WBM A;  1PJR A;  2X9D A;  2ICW G;  2ZXH A;  2LXE A;  3TOA A;  4A3I J;  4ESB A;  1VQ7 I;  2IS6 A;  1Z7U A;  5KPT A;  3HHZ A;  4QLC U;  3LSK A;  1FEX A;  1YTY A;  4UNO A;  3CUQ A;  1A5J A;  2JA5 J;  5JHF A;  2Y31 A;  3RPQ A;  1JKR C;  3SQN A;  3L29 A;  5E6J A;  4Y15 A;  2K02 A;  5ITY A;  1WI9 A;  1W5S A;  3M0E A;  2R4E A;  1FMV A;  3C2H A;  3HTU A;  3BJA A;  3GTM J;  5D5V B;  2OO9 A;  3GLI B;  2VN2 A;  4RGU A;  1G3T A;  2BOL A;  2E7W A;  1YIJ I;  1D5Y A;  4G3O A;  2X6X A;  4Y52 J;  1QUS A;  1SAX A;  1G4A E;  1MX0 A;  5EEH A;  3QOD A;  5FRN A;  3B74 A;  4RGX A;  2R7X A;  3K0L A;  3KS8 A;  3SEQ A;  5M5W J;  3CC4 I;  3EIE A;  3EUK L;  4C3H J;  1WH7 A;  2KZV A;  3HJQ A;  4MQV A;  1HNX M;  4G7Z F;  2CUF A;  5JR3 A;  1X37 A;  3SAR A;  4N0B A;  1VQ4 I;  2E60 A;  2H1L A;  1D2N A;  5GPA A;  1T33 A;  3I59 A;  1OCR H;  1RES A;  3J7Z I;  4DW6 A;  1GXQ A;  2D45 A;  2XAG A;  3OMY A;  3OYM A;  5K7F A;  3QU3 A;  2VOD A;  3L7W A;  3BZK A;  3UJN A;  2KDO A;  1IV6 A;  3M1E A;  1FTZ A;  4HV6 A;  1DGR M;  4CHT B;  4HPQ A;  2DN0 A;  2KW0 A;  3U5Z A;  3FYD A;  2LRD A;  3OYH A;  3K1N A;  2JN6 A;  1RI7 A;  2EFO A;  4CA0 A;  2M2E A;  4HX8 A;  5J1U A;  3I4N J;  1H89 C;  2ZFW A;  2UUC M;  4G4O A;  1I50 J;  3M9A A;  4EJW A;  2M8E A;  2OQR A;  2F5O A;  2X85 A;  5FTK A;  4BJ6 C;  4X6A J;  3M8E A;  1W5C C;  2G8L A; 
#chains in the Genus database with same CATH homology
 3IEC A;  3K9P A;  2KNA A;  2KNV A;  2LBC A;  1WGN A;  3ESW B;  2DAM A;  2HWJ A;  2JY5 A;  3LCV B;  3B89 A;  1HQY E;  3IHP A;  4DBG B;  2QSG X;  1JR3 E;  2LVQ D;  2EKF A;  2KHH A;  2LVO C;  3FRI A;  1VDL A;  1ZV1 A;  2DNA A;  2BWB A;  2B3T A;  4F2L A;  1XB2 B;  4YIR X;  3GLF E;  2MJ5 B;  1TR8 A;  3E21 A;  1E94 E;  1DV0 A;  3T6P A;  5JI2 E;  1TP4 A;  1AIP C;  3MMP A;  2L4F A;  4HEO A;  2EJS A;  2QSF X;  1EFU B;  1ZMV A;  4WP2 A;  1T43 A;  2DAG A;  1ZMW A;  2DKL A;  2DZL A;  1XXH E;  1G41 A;  2DAI A;  2R0I A;  1WJ7 A;  1P3Q Q;  4UN2 B;  2DAE A;  2CWB A;  2F4M B;  1BVS A;  1NV8 A;  1QZE A;  1WGL A;  2JY6 B;  2JY8 A;  2LTU A;  2HAK A;  1KYI A;  2JY7 A;  1X3Z B;  3FRH A;  2QSH X;  4F1I A;  1HT2 E;  1VEG A;  1F4I A;  1VQ1 A;  3GLG E;  2F4O B;  2JNH A;  1DO0 A;  2DEN A;  1OTR A;  2DAK A;  2QNJ A;  1WR1 B;  1WIV A;  1A5T A;  2OOA A;  1DO2 A;  1Y8G A;  2RRU A;  1Q02 A;  1IXS A;  2K0B X;  1VEK A;  2JP7 A;  1NV9 A;  1OKS A;  2G3Q A;  1HJP A;  3H4J A;  3K9O A;  2L2D A;  2OO9 A;  1PVE A;  2MR9 A;  2O25 A;  3GLH E;  3GLI E;  2OOB A;  1R4G A;  1X3W B;  1HT1 E;  1PGY A;  4G3O A;  1VG5 A;  2L4E A;  1G4A E;  1SG9 A;  1OQY A;  2ZTC A;  2CP8 A;  1IM2 A;  1G3I A;  1OAI A;  1V92 A;  3F92 A;  4R71 A;  3LCU A;  2K9D A;  1IFY A;  1YLA A;  2DI0 A;  2QHO B;  2JZ0 A;  1UFZ A;  5DFL A;  2MGW A;  1GO5 A;  2JZ1 A;  1WHC A;  2MRO B;  2LVP C;  1VEJ A;  1T6O A;  3BBZ A;  2H5X A;  3FE3 A;  1CUK A;  1ZMU A;  2KNZ A;  2DHY A;  1TTE A;  1MN3 A;  1C7Y A;  4Q7J A;  2ZTD A;  2EKK A;  2JUJ A;  2WZJ A;  4GEW A;  2LVA A;  2LVN C;  2BWE A;  3E46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...