2QSVA

Crystal structure of protein of unknown function from porphyromonas gingivalis w83
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
220
structure length
220
Chain Sequence
b'GPLQVSNARLLFPISMPEDEGVVRLVVNNTDESDLQVAVVSLPSFVSLDDRAFRLQAREPRELNLSLAVPRNMPPGMKDEPLVLEVTSPETGKKAVDSVMVSLPLVDNFPALTAAQTGVMELSTYLDMGQLDGETTKAAIEIRNVGAGPLRLHSVTTRNPALTAVPDRTEIKPGGSTLLRIAVDPQVMKAEGWQSIAADISIICNDPQAPLRRIKVKAEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Protein of unknown function from Porphyromonas gingivalis W83.
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
total genus 37
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2007-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qsvA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qsvA01
4KJWD 3DO3A 4YFLF 5CSGA 5BRZE 3T2PA 1JPTH 5HI5D 5BVJA 3UTTA 2Z31A 4R96A 3MROA 3KG5A 3DMMB 1U91A 5TDPB 3WFZA 5DC9B 5E99L 3PIQA 4HGWA 35C8L 5A2KH 1KFAL 5C0CD 2ATPA 2YPVL 4YK4C 2ITDB 3HE6B 4Z7NE 1KTRL 4X6EB 4JRYB 4W4NA 5E5RB 2MHAB 4JFDA 4ZTOH 1KEGL 1NANH 3I02A 5E1AB 5EFIB 5GISH 2X4UA 4OZGE 1OGTA 3L1OL 2B5IC 4U1JB 2ZOKB 3QUMA 4JVUA 3D39B 3LIZH 2V17H 4DVBB 4E41D 4P9HC 1MCWW 1FVDB 1SJXA 5LGHH 2VDKL 4R4BB 1AKJA 2XZCL 5CBAB 5D1XC 5TDPA 4AENB 3RVWD 3MUY1 2A2QT 4UBDC 2A73B 1AGFA 1T89A 3L7EA 1DBMH 1JPSH 4WEBL 4BZ2L 2AJXH 2HTLD 2EH7L 2ITDA 2BVYA 3HE6A 3SO5A 2GW5A 4X6EA 4JRYA 4TOYH 1Z0MA 5DJAB 1FO0H 1U8LB 1KCSH 3C9NA 5FAAA 2MHAA 3DHMA 2YD3A 5IB4A 2D7MA 5E1AA 4RGMB 5TF1H 4GO6B 4RBPK 5D96B 5ALBH 3T77B 4NZRH 4LIQH 3ZLQC 3P11H 2IFGA 4XPGH 3EOBA 1ZA6B 3EBAA 4ELMF 3DOSA 4Y19B 2ZOKA 3D39A 3PV6B 1AE6L 4DVBA 4Z6AT 1RUML 3S37L 1LE5B 4LSTH 1IZKA 1J1PL 2OI9C 3BT2L 5CBAA 4HIEB 5I17B 3HZVA 3VFPB 4HS8L 1XMWA 4N5ED 2LTQC 4P9HL 2N4IA 5E9DE 3VGDA 3LHPL 2DM2A 1RMFH 3C8KB 4JY5L 3WDIA 4KGLA 1U8LA 2EO1A 3KAAA 4BELD 1KJ3H 2XWJB 4JFQB 2EDEA 4V1DB 2Y9RT 2GITB 3T77A 4EUPB 3BGFC 2V9TA 3KYKH 5H94B 1VFAB 3QUKB 3QUZC 5HHMD 1U8KB 1ZA6A 3C2AH 3J8F7 3LVEA 3GJFB 5C07B 5GZNC 1OSPH 4Y19A 3CLFL 4F15B 3PV6A 3KPQB 5H2BB 1LE5A 1KUMA 4ZQKB 2OTUB 4L4TD 3O0RH 4HIEA 1OGAE 3GJEB 4JM2D 1N7MH 5I17A 5IWLC 1P9MC 4YHMH 3BHBB 3CK0H 4YDKH 5B3JF 1XH3B 1X6NA 2V5SA 1YEDA 5D72H 5J56B 1NLDH 1CG9B 2GKIA 3IFNL 4JO2L 1HKLH 1FC1A 4JFOB 3MRGB 4WVRA 3P2TA 4CVXB 4EVNA 1FLRL 3DX9A 3C8KA 1FE8H 3P4MB 5DMGD 1WIOA 2NY0C 4M3JA 2W91A 3P9WB 2XWJA 4NHCH 5CJQL 1W0WA 5C0DB 1MCQA 2GITA 4IRSC 4YZFF 4YBLC 4EUPA 1VFAA 3NMEA 1GGCH 4YHYC 1U8KA 5I15L 3GJFA 1A3RL 1U6AL 2WLZA 5D7LD 3KPQA 5H2BA 4ZQKA 5C0AE 2OTUA 1JGVL 3GJEA 4JN2A 3B5HA 5ANME 2J4WL 3BHBA 1XH3A 2AEQL 4K3GA 5DD1L 4QY8B 1I85C 2ADIB 5E95B 3QDJE 1TJIL 4X7EC 5LWYL 5FM4A 1CFVL 4PJXE 4JFOA 3MRGA 3ROLB 4K94C 1JI1A 1QFHA 3P4MA 1WK0A 1CBVL 3RVUD 5I66B 1X4XA 4CN1A 3GMRB 4ONOA 4P2RB 5D1QB 5C0DA 2VLJB 3MGAA 3UYOD 2HH0H 1RJZA 3HFML 4HCRA 4MNQB 4NPYB 1FZKB 3WV0A 5BZDB 4Y89A 2R0ZL 2YMXH 2ZPKL 4K7FB 4U2YA 5MHSE 5I6XB 3O6FB 3U83A 4HKBB 5E6ID 4I5BB 4RMRA 3VXSB 4PB0L 3LMJL 3FTGB 4DKEH 1B6DA 3JWDH 3AXLB 4APQC 4I0PC 2ZCKH 4LVHB 3GMPB 2D0HA 5JPMB 3W5NA 2MFNA 2W0FA 4YFEA 4BK4A 15C8H 4GRLD 1ZAGA 1Y6MR 3HNTL 1BZ7B 4K7PY 5KVDL 4BQCA 5I66A 3B2UD 1NFDA 5K93A 1UFUA 3MZGB 3RZCC 4P2RA 4U6XA 5D1QA 3GKZA 1BD2B 1U8MB 2VLJA 2J8HA 4ZS7H 1N8ZA 5ERWB 4ZDHB 4NPYA 5BZDA 4K7FA 3CSYA 3HC3L 3TBSB 2OZ4L 3D85D 3Q6FA 4HKBA 5SV4A 3S36H 3VD9A 4JAMB 1IM3B 3VXOB 3VXSA 1ZXQA 3FTGA 1RZIB 2H1PH 1U8IB 5CILH 2P8LB 3AXLA 1X4YA 5FYLL 1NH6A 5EBMB 4HD9A 2RR3A 1F6FB 5JPMA 1R3JB 3V6OA 4HPOH 3UMTA 3WCYA 3OAYH 2B2XH 4FTVD 12E8L 1BZ7A 1YJDL 3DXAD 1UZ6E 2F8XC 2Q20A 5D1ZB 3VD3A 3UTSB 3OKNB 1F4WL 5HYSB 4GSDL 3S98A 4AIZB 2YUVA 1KXQE 1QPPA 5FCUH 4CNIB 5BJTA 2YXFA 2IPTH 4Y4HA 3QEGH 4QGTA 4ZXBB 4JLRB 4U0RC 1PX4A 1MCHA 3IGAB 1HCVA 2IQ9L 1DSFH 5FO8B 5D7IE 2R39A 3TBSA 5C9JB 1U2HA 3CH1A 3NTCL 3CFBB 1IM3A 4MYWB 2Z91A 3PABB 4NP4L 3VXOA 1GIGL 1C12B 4MZ3A 1YY8A 2OYPA 3PDGA 1YMME 1A1MB 3HI5L 1U8IA 1A64A 2P8LA 5TE6H 3NIDE 1EPFA 5EBMA 4LLDA 3SO3C 1ZANL 2YS4A 3TN0B 3K81A 1OHQA 3ZZ1A 4IM8A 1RAMA 1I7TB 3MV9D 5D1ZA 3QFJB 3UTSA 3OKNA 5HYSA 4Z7VB 1WCBB 4PB9L 3FO2B 3T0EC 5GGTH 4CNIA 4YE4H 3RA7L 4JO1H 1UWEL 3ARGD 4JGJA 2J8UE 3KPSE 4PJGA 2R4SL 2CDEB 3RX7A 2BZDA 2DTSA 4NDMA 1QFWH 4O02H 3QEUA 4UU9A 4GBXB 1DFBH 4JZJC 2X05A 3CFBA 1PLGH 3RDTC 3PABA 1C12A 4HWZB 1TIUA 5D93C 5IVXA 4IDLA 3FL7A 1G0XA 2FD6H 1Z9LA 4GH7B 1OSZB 4WO4C 3RWFB 4NOFA 1A5FH 2LE9A 2AXJA 1NKRA 1NGWB 1RQ5A 1I7TA 3QFJA 4PJ7B 3SKMB 1XR9B 3MV8E 2RFXB 2PXYD 1WCBA 2PTVA 3T09A 2CLRB 4D9QD 4G6ML 4FQQB 5GQBA 1WZ1L 3FO2A 4QHMA 4J4PC 4H5SB 5ESAB 3BRGC 2DQCH 5C7XL 5L6YL 2A77H 2CDEA 3QZWB 4ODWB 5C08B 2Y1VA 4MJ2A 3U9UB 4GBXA 2BY1A 5FGBC 1JHKH 4HWZA 4GS7B 3BN9D 2FECL 4Q2ZA 2R9HD 1DVFB 3OSKA 2YA1A 1NEZG 4HDIB 1T1XB 2WNGA 3HZYB 3N85L 3UZQA 1BX2B 1NUNB 1MJ7L 1OSZA 4NM4H 4YHZL 1J0IA 3RWFA 5I0ZA 3QHTC 5J7CC 3G9AB 4M7LH 3QG7H 2YPLA 5KANG 3AB0C 1NGWA 4FNLH 5IHZB 4G80B 4PJ7A 4QXUH 3SKMA 2A9NL 1XR9A 2RFXA 4JHZA 2R0LH 2CLRA 3ZT5A 5T3ZE 3GBLA 1MQKH 1S5IL 4H5SA 1Q72L 5ESAA 1CLYH 1RVFH 4UT6L 5KSVA 3RJQB 4XNXL 5DQJB 1GGBH 3RKPA 1SM3L 3BOVA 1F3RB 1KC5H 4UIMB 3KJ4B 3QZWA 4QEGA 3TZVB 1CL7I 1GGIH 2X4PA 2XXMB 3A6BL 4HJJL 3FO0H 5IQ7H 4JPKH 5JQ6H 4M6OH 1BAFL 1DVFA 3QHZH 5DUPH 5KS9B 1FFPB 2NXYD 1HIMH 4HDIA 4NYLA 1OD9A 1T1XA 2A6JB 2P5WB 4KKBD 4N9GB 1BX2A 3FOLB 4I2XE 3UTPD 3IF1B 5CD3A 3K4ZA 2HRPH 4NKIH 4PJCF 2V2WB 5IHZA 1KXTB 4ZFFA 4R7DB 2XOTA 5GGVL 3IKKA 4N1HB 1JMZA 2JJTC 3IKCB 3CMOL 4RFNC 3FFCE 4XP5L 3H3PH 5CIPA 3T1FB 4MA3B 2CRMA 3TO4C 2JJVA 5DQJA 3CZFB 4M5YL 5GIRB 1AD0B 2P8MB 4JQVA 3BD5A 4NQTA 4UIMA 3ZE0E 2XQYK 3QUMH 2HTKD 2CD0A 3STLB 3CCHA 1CFBA 2AEPL 3DETC 4K8RH 1CXIA 1R0AL 2X6MA 5B39G 2DQGH 4NCDA 2Z35B 3VJ6B 1FZOB 5K9QI 5KS9A 1A6TA 3HPLB 3BAEL 4K07A 1I4FB 4P59L 3WBDA 3QNZB 3K4AA 4N9GA 4IHOB 3FOLA 4ZOBA 4RAUB 5F3BB 5CJXA 1L7IL 5M94B 4P2OD 1CDUA 2B1HH 2YUZA 2V2WA 5E99H 3DX6B 3RVXD 2EH8L 4B5EA 4JY6A 4R7DA 2YPVH 4D8PB 4KMTH 1NCCH 1R3IH 3T1FA 5BV7B 4JO4L 1ZHNB 1N0XL 3TNMA 4NNXB 4BQ8A 4KRPC 3K3QA 5GIRA 4M02A 4G8IB 4XCNB 5DJ8B 4CKVX 1AD0A 4NQCB 5F1IB 1AQKH 4YAQB 3BZEA 2ESVB 5DFVD 4PP2A 3EYSH 4O00A 5E5MB 1NJ9B 1PAMA 3VJ6A 1FZOA 1AO7E 3NAAL 1U3HC 1RJLA 3HPLA 4OZGF 1A7NL 3QNZA 1F8TL 3VI4F 3LZFL 4IHOA 4PTTB 2BVQB 2VDKH 1TJHL 4HUMB 5HYJD 4OCRL 5F3BA 4OCNC 2RHEA 3V6FB 1AH1A 2B4CH 3MGOB 3IFOA 1YN6A 3VU2A 2UZIH 2GAZB 4GRWE 4KY1H 1DQQA 1HH6B 2UYLB 4CJ0A 1MREL 1MFEL 1WZKA 4D8PA 1F13A 3MRMB 2EH7H 4WV1B 2I5YL 2VDRH 2FIRT 2NY4C 1WFNA 4HGMA 4JVWA 4WUKL 4JRWA 3EYQC 2OMBA 2JF1A 2Z31D 1BFOB 2W9DH 3HTLX 2IMMA 4XCNA 4G8IA 5DJ8A 2GJ6E 1EHLL 4NQCA 3TCLB 5F1IA 1DEDA 3V6BR 2HN7B 3IDYC 4YAQA 3O2DL 2ESVA 3W81A 4OGZA 3TBYB 1BMGA 1UH4A 2RIKA 4ETQA 1V05A 4F7PB 1GCFA 2JJSC 5E5MA 1CE1L 5IQ9A 1NJ9A 2ZUQC 5DEFA 1J12A 3O3AB 4F33A 1AE6H 2A6DB 4LMQI 1LP9F 4PTTA 2BVQA 3G6JB 1QOKA 2ZSWB 4OI7A 1J1PH 3D5OF 4U6VH 4TUOB 5CGTA 3MGOA 4HS8H 3BPCB 3C09C 2Y07H 2GAZA 5DHVB 3GSRB 1ZEAL 1WVZA 1IGIL 3DBXB 2IADA 5HHXL 2FHCA 1QR1B 2CKBL 3MRMA 4WTZA 1FSKB 3B9EA 3LHPH 2OXGA 4Z7WE 4OCLC 3DMMD 1BFOA 3RL1B 2HJFB 4EUPH 3QCTH 1MIML 2MQ0A 4NUGH 2HKHL 2YZ1A 4NN6B 3ZHLA 3TBYA 4PIRF 2DQIL 4UILL 4YHNB 4G3YL 3HE6D 4FA8A 1FAIH 3FQXB 3V52L 4JRYD 3C5JA 4K3JH 1MHEB 1Q9LB 5J89A 5T5NG 3O3AA 3Q5OA 4TPRL 2NZIA 3G6AB 2ZSWA 3B9DA 4TUOA 2D4FA 3BZDA 3BPCA 5DHVA 2RBLA 1P7QB 3GSRA 2YUXA 1VDGA 1AI1L 1SMOA 3DBXA 3D39D 1QR1A 3MLZL 4PY8I 4GQPH 2QQLL 4QRPB 5DC4B 3TFKD 1BF2A 1DLHB 3WUZA 1CK0H 2DLFH 5LAXB 4XZUB 2W0KA 1S8DB 2HJFA 4HCRH 3RL1A 1CU4H 1TZGH 4IRJB 4RRPG 5CJQH 5DJCA 4H1LA 4LQFL 3FQXA 3DURB 4YHKL 3MLUH 5BOPA 4WI6A 1MHEA 1Q9LA 3KLDA 1A3RH 1LEGB 2BSED 3QRGL 5HSFA 2F5BH 3G6AA 4F58L 4P3DB 3IFPB 2LAAA 1WWBX 1BEYH 4U31A 3MBEA 5DJ0B 3T0WA 5C6TH 1T83C 5IK3B 1P7QA 2AEQH 1E4XL 3VRJA 4Y19D 2X5PA 1KN4L 5K9JL 1TJIH 1FNHA 1T0NA 2BVEA 3FFDA 5M95B 3CNKA 3UO1L 3V6ZB 5T1LB 4HV8B 1I1RA 1I9JL 2ZG3A 2ADFH 1S8DA 1QSEB 6FABL 3VFRB 4C54A 4YEFA 1XIWB 4V2BA 1K6QH 4IRJA 5H35B 4RDQG 1JZ5A 2H2PC 1T5WB 1A6AB 2R0WL 3ARXA 4UB0H 2YD4A 1S7RA 4F3FB 4P57A 5JHLL 3ARDB 2EDBA 1R3KA 4LHQB 3MJ8A 4M1CD 5E2JA 4P3DA 3ULUD 3IFPA 4PP1D 4X6CE 4V1DD 1XFPA 2X89A 2DBJA 2VH5L 2A74A 5DJ0A 4NN5B 5IK3A 2IBZY 5C07D 4AJ0A 4PG9B 3ZYJA 2YBRA 3QIUB 5DUML 4C56E 3GBNL 5SX4I 4K55A 4RGOH 5T1LA 3BSZL 3MRNB 1S7VB 4X4ZA 5KVDH 3CAFA 2C1PA 2IG2H 3VFRA 2X9WA 4HFUH 5C71A 4J12A 5H35A 1NGQH 1N5AB 4R90L 4HH9B 4C4KT 1A6AA 1INQB 2UWEB 1FG2B 4F3FA 1QLRB 1AGDB 3ARDA 4QRSB 1A3QA 3GHEL 1K4CB 3PGDB 4D0BA 1BP3B 4ACPA 5D70L 5I74C 2WBJB 2A0LC 4HEME 2OZ4H 4G9FA 3FQUB 4Y2DC 1XR8A 4Y16C 4I18C 1OTUC 4JE4B 4NO0B 3SDAD 4KUCD 3IDMB 3E0GA 5I73C 1NCBH 4OKVA 4XC1H 3WUWG 5FYLH 4KI1A 3QIUA 5JDSA 3LD8C 2AXHA 2I9TA 5DRWB 1NDMB 3ZYZA 4LLVA 2CQVA 12E8H 2HLAB 1YJDH 1N2RB 3L5WA 1S7VA 3MRNA 1W0VB 2ZUSA 5IHLB 4DZBA 5C0NC 5I2IB 1F4WH 5F7LB 4WFHD 5I1JH 3IXTA 3HRZA 4OZHA 1UZ6F 1B4JL 1P4BL 3HZKA 1INQA 4BSVB 2UWEA 3VE0B 4P3CH 1FG2A 1EJOL 1QLRA 3RUGF 4XXCA 1AGDA 4QRSA 1BFSA 1K4CA 3GGWB 3O4OC 2WBJA 3SN6N 5IFJB 1WEJH 3FQUA 5IW1B 1MI5B 2M8XA 3PXJA 2JJWA 3VMNA 2AGJL 4QHUB 1UM6H 3OBAA 3T4AB 4MNQD 1X5GA 1JIBA 3D1MC 3E2HC 4X5LA 1I1YB 2G9HB 2YRPA 2IAMC 3GJFK 2VDMH 1WSST 1ZANH 4UTBL 4RZCB 3O6FD 3EFFA 5DRWA 3QG6B 2EDWA 1V3LA 1KIPA 1YDPB 3VXSD 3K2UL 4IMLB 5DRZB 3WFCH 2QHRL 5MP6L 4NGHL 1CYGA 4PB9H 4POUB 5BW7A 1B2WH 2V7NB 3AS1A 3PJSB 1A1OB 3VE0A 3RKDD 4JR9L 4YDVB 3VFSB 3BW9B 2OTWB 1BLNB 3GGWA 4RWYL 2QQQA 1IM9B 4OI9A 1BD2D 1WC7B 4M93C 4TTDD 1CF8L 2NY7L 4MXVE 3O6ML 4EI5C 1KTDB 3BD4A 4Z9KB 3T4AA 2G9HA 4LVEA 3DX7B 1OWRM 4RMQA 3BP4B 3QG6A 2XACC 3MRHA 3PL6B 3P9LB 3VRLE 2VXSL 4CAGA 5C86A 1YDPA 4ZAKA 3SKOB 4IMLA 4PRIE 5DRZA 3BKML 4G6MH 1WZ1H 1KLGB 3PJSA 4F37K 3C5ZB 5DMIH 4YBQC 1HN1A 1C7SA 4KAQH 4YDVA 3BW9A 4HUUB 1DJSA 3FRPA 4QRRB 1BLNA 5I1GL 1EAPA 4QXGH 3UTSD 1UYWL 2E7HA 5C0CE 3K4DA 3OG4B 1TTFA 4JKWA 1T7WA 5F96L 1KOAA 1WC7A 3OJDA 1OAKL 1VCAA 3DUUB 1KTDA 4ZXBD 3QWRA 4ZFGH 3LPWA 3PWPB 4LSPL 2V5RA 1XT5A 4LPUA 4X98A 2GUOB 4NQEB 3BP4A 1MJ7H 2DLTA 1YEJH 3VGEA 5JTWA 3DV6B 3PL6A 3P9LA 5CIPH 5GS0D 2ICWB 3BP7B 4LMQE 4BQBA 4UT9H 1U8HB 3SKOA 4EBQH 2A9NH 2PYED 5J9PA 4B0MM 1A8JH 4OI8A 5K33A 3QCUL 4WENB 4KJWC 1JF6A 1FL3B 4UDUA 1S5IH 3T0AA 3C5ZA 3TN0D 4XNXH 2HT2D 5EZOL 4ZSOB 4PD4K 1LK3H 3NIGE 4XVTL 4ZG1A 3QFJD 4XVUC 5DO2C 1D5MA 4RCAA 3TNNA 1H3TA 3D69A 1U93B 2VL5A 3CDCA 1TZHB 1ZK9A 4D0CB 4AK1A 3DUUA 3OR7A 1NMAL 4JB9L 1BAFH 5EC2B 3PWPA 4YXKH 4CADB 4S1RH 1V3KA 3GSVB 2GUOA 4NQEA 4YHOL 3T3PE 4KHTH 4GBXD 1A0QL 3DV6A 3KHOA 4OT1H 2ICWA 3BP7A 4FP8H 4K2UL 1G7JA 5BVPH 1C8PA 5ICXA 3V8OA 3B2VL 4X5XB 2I60H 2ZUYA 4YDJB 1SBSL 3BH9B 3B9KA 1JGLL 1FL3A 4XP5H 4PJDB 3H7BB 5IVZA 3H9SB 5KSUB 4HKZB 4ORGB 3VWJC 1R5VB 2BDNL 4AEHH 5C1MB 3HC4H 3K7UA 2Q6WB 3UJJL 1P7HL 1CD8A 3U4AA 1TZHA 1XZ0A 4KI5D 4WFEE 4QRQB 3ZE0F 3U7WH 3O6LH 4KH2A 3MYJA 4CADA 2ARWA 3V8CA 3GSVA 5C08D 3QH3A 4ORZC 2AJYL 3O9WD 1NPUA 2CO7B 4S1QL 1F58H 1X4ZA 5DJ2B 3EOYG 1DVFD 5HHME 2WIMA 4U6TA 3ISWA 2K7QA 3C87A 3BH9A 4WI8A 2Y7QA 2OR9H 4JO4H 3MSPA 1N0XH 4PJDA 3H7BA 4NKQB 5KSUA 3RWHB 4ORGA 5CZVL 2ZSVA 1R5VA 4AT6B 4LKXB 3VWKB 4Y0GA 3GB7A 4EN3B 4Z78B 3BIAX 4XAWL 5AG9A 2FX7H 4QRQA 1CXEA 3L3IB 1Y6KR 3NAAH 3K1KC 4R4NC 5J0BA 2N56A 1ORQB 4TULL 3LZFH 3TZVD 4ODBD 2J3SA 1MFNA 4HZLB 5SX5H 4L8BB 3FZUD 4XP4L 1ZLVK 2VAJA 1MREH 1MFEH 1QSVA 2F9BT 2Y36H 2P5WD 5B4MC 1S7QA 3X3FL 1I9IH 5KSBE 4LASL 4WUKH 2APVA 1EA9C 1GOGA 4HUKB 3RWHA 4R0LB 1A4KB 1KIQB 4UUJB 4PJEE 4AT6A 4LKXA 4TQEH 4WTXA 2M26A 3VWKA 1D6VH 1R3HB 4KDTA 4EN3A 4Z78A 1DBBH 2IFFH 5CGMA 4UNTA 3KLHD 2NX5E 3S34L 2E27L 3L3IA 1UCBH 3WIFB 1LO4L 5DHVH 4X8JB 4RFOH 5C09E 4LCWD 2CUIA 2X40A 2G5BA 1MAML 4FN0A 4I77L 1ES0B 4L8BA 3DIFB 4TUJB 5IIEB 1IGIH 4EJ1C 5D7KD 5HHXH 1BJMA 1CGTA 2YXMA 4GG8B 5SWSB 4ODVL 3RGHA 3RAJH 2Y6SC 1NC2B 1HI6A 4H1LH 3MUJA 2WINB 5TGBB 1BQHB 3Q2CA 4LDLB 4Z7WF 2HT4D 2DQIH 3EJZC 4PJCB 4WFFD 4G3YH 3JV0A 1S9VB 4ODSL 2NW2B 2D7OA 3MLVL 4JFFA 3KPMB 5CMAB 4YK4B 3WIFA 2DAVA 3LQAH 4X8JA 1OP5K 1CFTA 1A7RL 2ESVD 3VXNB 4X4MA 4YH6A 1YNTB 3QJFB 1BBJB 1HOCB 4CMMA 5IBLD 1Q38A 2Z92A 1ES0A 3OB8A 5C8JA 5IEHA 4TUJA 4K3HA 5E2WH 5IIEA 4NOBA 2X09A 2EKSA 1YEEH 3ULVD 3PP3H 3SE4A 2B5IB 1T1YB 4GG8A 3WLBB 5EU6A 4DZ8B 3WJJC 1HCFX 1NC2A 3TV3H 2LABA 5CUSH 5F8QC 1JI2A 1BQHA 4OJFL 1LNUB 4DOHE 5I19L 1J18A 2HVKA 4XNZC 2R29H 5BRZB 2AK1L 5D1XB 5J1AA 3OKMB 5ETUB 3CVHL 1RFDL 1S9VA 3KPRD 1BJ1H 3VCLB 5DI8A 1G9EA 4MMZC 3KPMA 4JPIB 1UADC 5ICYB 3DXAE 1H3WM 3S4SB 1RULL 3WXVL 4RRPA 3TJHC 1YNTA 3QJFA 4BK5A 1BBJA 5DVLA 4QXWA 1HOCA 4MA7L 2CDGB 1BIIB 1TVHB 4RNRA 4WWKC 4YQXH 4N8PA 4FQLH 3RI5F 4PTUB 3PWJA 3GSOB 2MKLC 3RQ3A 4Y88A 3UC0L 4ZUSB 1YQ2A 3MRQB 3L6FA 3BKCH 3SE9H 1MRDL 1T1YA 3WLBA 2R69L 5T3XD 4DZ8A 4X4XB 1I9JH 4OZGB 5EZIH 2FZ3B 2E7BA 4MHHI 5TE4L 1ZT7A 5DVKA 1LNUA 5T1DL 5L9DH 3B3IA 2OI9B 3AM8C 4EEEA 4M48H 2VDPL 3SE3C 1FORL 3MLXL 3VXTB 4LHJB 5EU5B 4NKDB 5I1HL 2LTQB 5DT1L 2CDFB 4XB7A 5ICYA 2YRZA 3MV9E 25C8H 1G9MH 1RZ7H 3LEYL 4Z7UA 1RZKC 3IFLL 2R8SL 1CFSB 5BMFL 2CDGA 1TVHA 3MX0A 1KCVL 4M6AA 4AQ1B 3N1FC 5KW9H 5LJYH 1NCDL 3GSOA 5IW6B 3V4UL 1MFBH 2AQ1A 2WWMD 3MRQA 3BGFB 1PG7H 4QKXB 3QUZB 2EE9A 3WKNA 4OZGA 1GAFL 2FZ3A 4PRPE 4E5XB 5DQDL 3RL2A 2H45A 3NZ8B 3TT1H 4GXUM 1P7QD 5JW5B 4GLRI 3ZT7A 2Z8RA 4J23A 1NSNL 1KPRB 4QRPD 3TPKA 5F9OH 5KTEL 3W9EA 3VXTA 5EU5A 4NKDA 4UTAH 2AEIT 1BVZA 2CDFA 5FHBH 5KJRH 3GHEH 3D2UB 3INUL 5B8CC 2DIBA 1OL0A 2MTPA 5E9DB 3O3EB 3CU1A 4H8WC 3MA9H 5HVFB 1QBMH 5DJXB 2X2YA 2NY0B 3QDGA 1CFSA 1LO5B 1FBIH 2VDLL 2C4XA 4YIQB 5IW6A 4BFGA 3RFZC 4Q0XL 4IRSB 5L88H 4LF3B 4YBLB 1J0ZA 5IHUL 3GSUB 3QUZA 3ARGC 4YHYB 4M1DL 3GKWL 5CGYC 3TO2B 2YD9A 5K9OA 3QXWA 1IMHC 1MCFA 3NZ8A 2EIBA 4M8VA 3WUWA 5GJTH 3EYOA 4MJIA 1P6FA 2BNRA 1YC8A 5T1LD 1AFVL 1OGAB 3O2VH 1QSED 2OQJB 1XIWD 4I3RL 1Q0YL 2VUOA 5JOFB 5H8DA 5F6HI 5EBWB 5E9DA 5EO0A 2DQDH 5A2JH 5DJXA 2VLLB 4ZUWA 5B21A 1PJ9A 1S7TB 1LO5A 4WRLA 4QLRA 1I3VA 1YNLL 1OF2B 2E7CA 4YIQA 1MOEA 1IAMA 4LARL 3F7YA 3WJLA 4HH8A 1WBXB 4LF3A 4LSDA 1MFAL 2H32B 1QFPA 5CWSB 4KZDH 3P4LA 3SDXF 4I9WD 1J10A 4NGHH 3TT3L 5HGBB 1GC1H 4DAGH 4QGYA 5LCVL 3QIUD 5HDLA 3BN9C 2QADC 2WIIB 1RD6A 5C0AB 4JR9H 4IOIA 3RY6C 1OGAA 2C7UB 1F2QA 4APQB 1DBKL 1PZ5B 4I0PB 1FFRA 1NL0H 4XP6L 2OQJA 1DUYB 5ANMB 3RNKA 4LLUB 4EOWL 4G7YH 1FYTE 5DURB 4KJQC 4HKXB 3QDJB 1HDMB 2WWKO 3DROB 2VLLA 4PJXB 1CF8H 2NY7H 1S7TA 4M61B 2VYRE 5EUOF 3RZCB 1OF2A 1RIUH 1WBXA 2NCMA 1X5LA 2JB6B 3UPRA 2H32A 1UWGH 1G6RL 4NO0D 1J88A 1IARB 5CEYB 4BFIB 5HYEA 2HKFL 2XG5A 4KKLD 4HUWB 1FVCB 3A6CH 3VRLF 2V2TB 5FKAB 1CGSH 4J6RH 2WBKA 5C0AA 1NAMB 3C6SB 3MRIB 3ZKQD 1MHPL 1LEKA 4Q6IC 3KJ6L 1PZ5A 4APQA 4I0PA 5ANMA 4K3DL 3SGJA 1DUYA 4LLUA 2GJZB 4QHNA 1FGNL 2JTDA 3NGBC 3QDJA 5F96H 3T08A 1E4JA 1CICD 1HDMA 4PJXA 5DYOB 4NCC1 1ZMYA 5JW3H 3HMXA 4M61A 2HT3D 3QISA 3SKNB 2QEJA 4G6KH 3IRZA 3IU3B 4LSPH 3BQUC 2N7BA 2WQRA 2YA0A 4FFYL 1G7HA 2JB6A 2ZUXA 1MI5D 1IZJA 3MFFB 4U0RB 2F58L 5IB1B 5CEYA 4ALAH 4BFIA 4ZUUA 4XP9L 2EDTA 2PR4H 1FVCA 2V2TA 2XFXA 3OTTA 3QCUH 5DFWH 2FR4B 4JY4B 4P4KD 2JLLA 3C60A 1CFNA 1MWAL 1NAMA 3C6SA 4UV4L 5GGQL 3FN9A 1HNGA 1G9NL 2IBBA 3SO3B 1ND0A 3WNPA 2BERA 5DWUH 5ITBL 4QOKA 2C3WA 3NIGF 5D71L 4HS3B 3SKNA 4JB9H 3P4OB 4HUXB 5CP7A 3V4VL 3IU3A 1LO3H 5JZ7D 3T0EB 3WEXA 1IM9D 4FQXA 2QR0A 3ALPA 3MFFA 3WLWC 5IB1A 1IGMH 3T3PF 4JZJB 3RDTB 2FR4A 4JY4A 5D7IB 1MRFH 5DS8B 1QQDB 3BKJL 3PL6D 5D93B 1EHAA 3OAZH 1T80A 3NACL 1MY7A 3RP1A 3O41B 3KLSA 1VESA 1YMMB 5CZXC 5DLMH 4OBSA 4WO4B 4KQ4L 5ID0A 3UJJH 5EOTB 2YR3A 4F9LC 4CVWA 3C5ZD 2CKNA 5HTSA 4O9HL 2FATL 3P4OA 3S3SA 2E6QA 4QRRD 4P23A 4PRNB 1FL5A 1D7FA 1QLEH 1YEGH 4PD4J 3BD3A 3NH7H 1RK1B 3IYLW 4MCZB 4X8XA 1IAIM 2AJYH 2UVEA 4E42B 3ZMRA 4S1QH 3NZHH 4LHUB 5DSCB 3F65A 1E6OH 1S9XB 4FRWA 4H88L 2J8UB 5E70A 4JZJA 3PWPD 3KPSB 1QHOA 1S7XA 3RDTA 3WIHA 1J8KA 5D7IA 1KTLB 4NQED 4OQ1A 5CD5D 5JIPA 1JWMA 1QQDA 1RI8A 3QDME 4JDVB 2I9LB 5CZVH 3HC0B 1EMTH 3IETB 2AJVL 2P24A 3UX9B 4O2CB 5L8KB 5E2UL 1CGUA 1E27B 1ZVYA 3I3BA 2XZAH 3AB0B 4KJPD 4GT7A 5L2JB 1F90H 5IG7B 3OKYA 2JCCA 1JVKA 4MQXD 4PRNA 3MCLH 1KSRA 3HE7C 2NZ9D 3MV8B 5FM5O 4J4PA 1RK1A 5F97E 3D3VE 3WS6C 4ONGH 2A6IB 3MOBL 5I30H 2HWZH 4F8QA 4XP4H 4U3HA 3OF6D 1ZLWH 5CCKL 1OT2A 5DSCA 1S9XA 1FNSH 5ID1B 2J8UA 2GFBB 8CGTA 2FO4B 3KPSA 2P45B 1YEKH 1F00I 1S9KC 1KTLA 4XI5C 5DD6A 5F7MC 2VOTA 3IJYB 4JDVA 3TEUA 3QI9C 1N6QL 1LDPL 3OJMB 2FGZA 1UZ8B 2J1KA 4KZEH 2OR7A 3IETA 5F71A 4L1DA 5DEZA 1E27A 3N1PC 3QWOB 1F6LL 4ZTPL 5L2JA 3H9SD 2E27H 5IJKC 5DMYA 4RFNB 1C5DA 3TO4B 4R9HA 3SDCC 3UYPA 4BH8B 2A6IA 2PO6A 4KRMB 4Z76B 3LRHA 4O4YL 2IGFL 2MSPA 4ZFZA 4AG4L 5ID1A 2OJEA 2GFBA 4XNUL 5IBUB 4BYHA 2ADGB 3UTZB 4FFVC 1X5YA 1JFQL 2E9WA 4ODVH 4AIXA 3ULUE 3IJYA 4NQSA 2ID5A 5EG6C 5DJ6B 1WICA 4Z77A 2MPAH 2XQBL 3KR3L 3TVMC 1UZ8A 5E8PB 3V5DA 3V7MA 5FV2A 5C07E 3QWOA 3KS0J 5EWIH 1DLFH 4UDTB 3MRKB 4I2XB 4ODSH 1U9KA 2QQKL 1U8PB 1IAII 2NY5C 1UACH 2VXVH 3O3DB 3ZTNH 2MJWA 3J7HA 2P7TB 1J5OL 1EGJA 1J7VR 3TO4A 1A7RH 3LN4A 4L3AA 3HZMB 4KRPB 4EN3D 4LCCC 3FFCB 3FO9B 1M7XA 4BH8A 1T0PB 5FYJE 3K2MC 1OW0C 1NBZB 4NNYB 2GCYB 3PXHA 4Z76A 1D9KD 4XWOC 1T2QH 4P99A 1PFCA 5DJDB 3CFCL 3I50H 3UTZA 2WUBL 3EGSB 3G5XB 4YWGL 1CN4A 4YX2L 1U3HB 2EXWD 4OJFH 5DJ6A 1AC6A 2ED8A 4JGUA 1PD6A 4X5WA 2H6PB 3ULUC 5E8PA 5J57B 3FT3B 4XPBH 3W39A 4XC3L 3CX2A 1D5XB 4JPVH 1BWMA 2X1XR 3L3HB 1RFDH 4NFBA 5EUKA 4MQ7A 3MRKA 4UDTA 3H2WA 4I2XA 3MRLB 3M8OL 1U8PA 3E6FB 3W82A 1G7IA 2H3NB 3O3DA 5DUBB 4EXKA 5D7JC 2LU3A 2NY4B 3VFVB 3HZMA 3IU4H 2NY5L 2R4RL 3FFCA 3FO9A 4G9DB 1VFOA 2K9UA 1NBZA 3QNYB 4NNYA 4DK6A 2GCYA 3IDYB 4LSQL 5J6GB 3LQZB 1RHHB 3JBG7 4U1NA 2R15A 1CDJA 5DJDA 4PJIE 3HUJE 3D6GA 3P73B 2EEDA 3LEXB 4BH7B 1NCNA 1IC7L 3EGSA 3THML 1KULA 4LEXH 1NBQA 3G5XA 3MLWL 2ZUQB 4PGDB 5DVMA 1G6VK 5EORH 5TE4H 4L8DB 1F4XH 1X9QA 1KCUL 1VB9A 4P5TC 1AO7B 3SDAC 3LH2L 1EDQA 3L7FB 4C59B 1D5XA 1W8OA 3L3HA 4TSBH 5FYKL 4OFIA 3C09B 5SWSD 3MRLA 4WTWA 1H5BC 5I1HH 3ARRA 1NC2D 3H9YA 2H3NA 1DL7H 4U3XA 4PJ8C 5DUBA 3CFJB 4GRWB 4KC3B 3VMPA 4XPTL 3QUYA 3QXAA 5ENWA 4H25A 4FABH 3TF7C 3F7VB 5HVWA 3VFVA 2KQNA 3BKYH 3NABL 2IANE 4G9DA 5BMFH 4WDIA 2W07A 2XTJD 5HGAA 3LQZA 1IEAA 1RHHA 4DWHA 4QRTA 3ARFC 4FXGB 4HS6B 1AR1C 1YN7B 2AJSL 2JJSA 1GZPB 2Z93B 3LEXA 4BH7A 4XNQB 4KMQA 1JGEB 2E8YA 4NBZB 1A1NB 4XVJH 4PGDA 3C2SA 5DQDH 4L8DA 3Q1SH 5EOCL 4MGXA 3V7AE 5HDQL 3ESUF 4UT7L 5E8DH 3UTQB 1RURL 4S10A 3CPLB 3GMQB 5F1NB 1INEL 3BEWB 4PJAF 5IFHL 2AK4E 2OXHA 4OGAC 5JDJA 3F7VA 5A16B 5BRZD 3T8XB 5D1XD 4IRZL 4D3CL 5IROA 1IQWH 3CSBA 1TLKA 4YDIH 3MCKA 3L5IA 4Z7WB 4UBDD 3O81A 1VFBA 2GJ6A 4FXGA 5DEGB 4HS6A 1IQDB 1YN7A 1GZPA 2Z93A 5HGDA 4XNQA 1TFHA 1WZLA 1JGEA 3EHBC 3IRPX 1A1NA 3WD5L 3NFPA 3UYRH 1ORSB 2DLHA 1D3CA 2EC8A 3U7YL 1GGYA 3RVVC 4HMCA 4LU5L 1S5HB 5DK2B 1B90A 4PRHE 4K94H 1FNEB 3SJVD 3OXRB 3GMQA 1NAKL 2CXGA 3GI8L 1MHHB 3BEWA 3P30H 2XYCA 2RGSA 4I3RH 3BFOA 3Q5YA 2PYEE 4GKSB 5A16A 2CH8A 4YFLI 1NFKA 5F7HA 2OMNA 4JHAH 2OX5A 3LRSB 4Z7WA 5MEPB 2H32H 1VFMA 1YNLH 1AD9A 4JJHA 5EIIB 4DUXA 1DBJL 3X3GL 3WNNA 1IGCL 5FGSA 2D9QB 2Q8BL 3PWVA 4MVBC 4OV5B 5JMRA 1ORSA 3MMEB 2P43B 5D2NE 3QWQB 1QBLL 4WU5B 4N0UA 1OPGH 5DK2A 1VGKA 2CJUL 1FRGL 4NZUH 4O58H 1U8NA 1FNEA 3QUZD 3IT8D 5GZND 3HMXH 1FFNB 1MHHA 1MEXH 1QA9A 2XZQL 4XP6H 1MRCH 1F4AA 3QO1B 3JV6A 4U1SB 5IW3A 2Q3AA 1TENA 4GKSA 3DI2B 3ZTJG 1SEQL 3NCYP 1WIUA 4NC0B 3LRSA 1U58A 3ZE2E 3I75A 2QSVA 4NNPL 1GYAA 3D2UD 1IAOB 4XH2A 1A14H 4PYHA 5E9DD 5C70A 5FDWA 5DMKB 4G6AC 3SOBH 5J06A 2H9GA 2BY2A 2NY0D 1NAMH 4LLYB 4ENEC 4KI5E 4PGJA 5I74B 5T33L 3DSFL 3QEQE 4Y2DB 4Y16B 4I18B 4IRSD 4WU5A 5FK9A 4X80L 5D2NC 3G5YB 5I73B 2XV6B 4X6CB 2QJDA 5FV1L 1MCIA 3ARYA 1FFNA 3KJ6H 1AJ7H 2C3VB 4U1SA 3QO1A 3RY4A 3LD8B 3P77B 1OAUL 3CZJA 1FHGA 3SQOH 4GFTB 1AXTH 1U41A 3BIBX 4XCFL 4C56B 2EDJA 3B43A 3RBSA 3NCFB 1HWHB 3ZL4H 3SCMC 1OGAD 5BO1H 1IAOA 4NFCA 2XTLA 4HWBL 2BFVL 2XWBA 1KJ2L 3V0VB 1FH5H 2K3TA 5DMKA 4X6DE 5IMMA 2EICA 3U2SB 3O4OB 4XP9H 1P4IH 4P49A 1VGEL 3EW3B 1J1OH 1VA9A 3H6JA 4Y16A 4I18A 5IOPB 4YC2C 4KI5C 4Y2OA 2DQHL 1BBDH 3G5YA 4XBEH 3OB0K 4X6CA 3TJEH 3E2HB 4Y4KA 5GGQH 2C3VA 2IAMB 4JFZH 5IP4A 1TTGA 3O9WC 4OZIE 3QQ3B 5AWNH 5ITBH 4UIKL 4XMPL 1QFWM 5D71H 1C1EL 2EYSB 5C0AD 3IDNB 5ESQB 8FABB 4XPHL 3V4VH 4APQD 3VFTB 3OAUH 4WI3A 1RUQL 2WBWB 2GT9B 4HBCL 1FJ1B 1H3PL 2UUDH 4FQ1H 3WIHH 3QDJD 5IB2B 5EZLB 2AABL 3U2SA 4LOUC 4L5FL 3RZCD 5F9AC 4HIXL 5LBSL 2J12B 4B50A 4GAGL 1U42A 4M93B 4A2MA 1ZHKA 3VW3H 1LQSR 1NC4A 4J8RB 3BKJH 3NCMA 4EI5B 3IJSA 4LCWE 3UBXG 3NACH 2C3XA 2IAMA 1T3FB 3BZ4B 3QQ3A 1KB5L 4FQCL 3TA3C 2X4OB 4PRAB 1A6WL 3RNQB 1SY6A 2FATH 3IDNA 5F7FA 4QXTA 4WI4A 2IWGA 3VFTA 4NSKA 4OD1L 2GT9A 3ZYIA 5CEZH 1FJ1A 2BOBB 5F7UA 3V0WL 5LQBH 5IB2A 4WFFE 5EZLA 4KHXH 2YD7A 4AL8H 1ZHBA 1G1YA 1N3NA 2BC4B 4L29A 3E3QE 3OPZH 4KU1A 4YHLH 1OY3B 3WHE0 3QUXC 3BP6B 3B6SA 1T3FA 4PUBL 2YD5A 3BZ4A 3WO4C 4P2QD 4MJ4A 1OTTC 2X4OA 3I9GL 4PRAA 3NA9L 1TETL 3ULVE 5HY9A 3RNQA 3Q6GH 4TVPE 3BUYA 4GMSL 3BISA 1W72L 4XHJC 3UJIL 4ZD3L 4PRIB 4OLUH 3CD4A 3ORJA 2BOBA 4K71C 1O7SA 3OKDA 3PGCB 3MOBH 1CT8B 4Y5XA 1YYLH 3KPRE 3MQIA 2HJKB 2ED9A 2M1KA 5FUCE 2BC4A 1IL1B 1CGYA 4CJ1A 4M5ZH 3T0ED 1KCRH 3EDKA 2QL1A 1YPZA 1KENL 4LVOC 1PEWA 3BP6A 4R2GC 3E3QC 3DGGA 1CDCA 1QFWI 3GM0A 1LDPH 3JV4B 5DVOA 3U79A 1XF5B 4P5KB 1EGJH 3RDTD 2V2XB 1N26A 1EH9A 3BPOC 3SEPA 3AREC 2D3VA 5T3ZH 4OF0A 4KVCL 5T3XE 3G5VB 5CSBA 3MLTB 2O5ZL 3WN5C 3ULVC 2O26U 3PWLB 1IT9L 1YMMD 4PRIA 2X44D 2BVPA 4WO4D 2CMRL 3VWJB 3PGCA 1RY7B 5D7SL 5DQ9A 4J3OC 4LSVL 3ETBF 3IXAA 2HJKA 5T5FH 1RUPL 1RJYB 1KELH 2A9ML 1IL1A 1EAJA 3L3GB 4J4PD 1JFQH 2WP3O 2BXZA 5C0CA 5FUCC 2X4TB 1HHIB 1UEYA 3G04B 5HHNB 1RSFA 4LHUD 2F5AL 2FEDC 2XQBH 3JV4A 4FQ2H 2DYPB 1VFUA 4OM0L 4P5KA 3KPSD 5C0RL 1L0YA 2V2XA 5HPOA 1WZMA 2XT1B 2QQKH 4WW2C 2HJLB 4U1HB 5CLWA 3MLTA 2V9QA 3PWLA 4YUEH 3VXUE 3VWJA 5FO7B 1PW3A 1BQLL 3MGTA 1ZTXL 3TC9A 3L95B 1I9EA 4YGVB 4OLZL 3VGAC 3CFCH 3JTTB 5I1IH 4HLZH 2DL9A 2BVUA 2UZYB 1SHMA 3MV8D 3LKOB 1KJMB 1E4WH 2ZG1A 4YR6B 1GVIA 1JPTL 4R4FH 4MNHB 1HHIA 1D5ZB 2CGRH 3G04A 5HHNA 2AI0L 4U7KA 2DYPA 3S36X 1DQMH 3DSNA 3DO7B 4OLVH 9CGTA 3M8OH 4XX1G 2HJLA 4U1HA 5E2TL 1HK6A 3IDUA 5HHMB 3FQRB 4UOW1 5MI0C 3UDWA 2Q7NA 4ZUTB 3W0WE 2R4RH 1IILE 3LEVH 5E8OB 5FO7A 3KPOA 1UJTA 1Z2KA 2VUYA 2EDDA 3D48R 2WANA 4GQ9H 5F88B 1KG0A 3JTTA 4PJBA 3LKOA 3TO4D 2AKRB 3THMH 3GNMH 1KJMA 5FF6B 2XIDA 5T3ZD 2V17L 4UZGA 2KH2B 3GSQB 3RWDB 5HYFA 4WHYH 4DGVH 5LGHL 1D5ZA 1KCUH 3LY6A 5BXFB 4N0FB 3FQWB 4GRWH 1GSMA 1LK2B 2HFEA 4FMKA 3DO7A 3DETD 2R1WB 1JPGB 1JPSL 3F6LA 4A2LA 2X1PA 2AJXL 1WWWX 3HG1E 3A0OA 4XPTH 3EOAB 4TOYL 4I9WE 4BQ9A 3FQRA 1KCSL 3CVHB 4HT1H 4JPWL 5KSBB 5E8OA 3EJYC 2VO5A 2L0DA 3OGOE 4ELME 4FMFA 5TF1L 4PJEB 2DICA 4NZRL 4LIQL 3NCEB 1NMBL 3N50A 4WHCA 2AKRA 4B53A 1LE9B 1R6VA 2X10A 3FFCD 4AMKH 5GRUL 3GSQA 2NX5B 2VZ3A 4LSTL 2UY7A 5BXFA 2P48B 4N0FA 3FQWA 3EYFA 2GTZB 3SY0B 2R1WA 5C09B 4JQXC 3VFOB 4GG6F 2ZJSH 1ZLSH 1U3HD 2DMCA 2GK0A 3R06B 3EOAA 4NCC2 3F6IA 3L3DB 3VMOA 4HWEH 4IRZH 1KJ3L 5KSBA 5D7LA 3HNVH 4I8DA 4X4YB 2N7AA 4XNZB 4PJEA 4UAOC 3IDJA 5FA3B 3T0XA 3RHWF 2NY4D 3QQ4B 3C2AL 1WWAX 3EYQD 3H0TA 1LE9A 3MO1B 1G7MA 1DQJB 4O51A 3MRCB 4L4VE 3C6LD 5B3JE 5CFHA 3HAEB 3L9RA 3U7YH 5KVFH 1GOHA 3RPKA 1V7NH 2GTZA 3SY0A 4YHML 5GJSH 5LKNA 3CK0L 4YDKL 4F2MB 4WHTB 1KXVC 5C09A 4WWKB 1NLDL 1PKOA 3VFOA 5E8NA 4AZ8A 4NHUA 1HKLL 4EUPG 2G60H 4DW2L 3D87B 1JWUB 4WNQB 3L3DA 1FE8L 1AO7D 3WJJA 1AGBB 2UVFA 4JKPH 3RIAF 5E6IA 4X4YA 2B20A 3F12B 1FV1B 4MJ6B 1ZGLA 3AS0A 4DOHB 2E8ZA 3KXFE 3JVGA 1GGCL 5IEKA 5JNYB 5HI4C 3QQ4A 1DBJH 1EEZB 3X3GH 1E4KC 3MO1A 4ONHA 4ERSH 1DQJA 3JWDC 2Q8BH 3MRCA 3RPIB 2VITB 3MV7E 1CZ8H 3DTXB 4OGXH 2ADJB 1CLZH 4IDJL 1CICC 3JWOC 3DXAB 4U6HB 2CK2A 3CIQA 2VKXA 4OCYH 1UM5L 1DTUA 2CJUH 4F2MA 1JBJA 3D18B 4WWKA 1OT1A 3UROR 1DN2A 2YKLH 5HYQB 3DECA 3R1GH 3P9MA 4L9LC 4H26A 1R5WB 4XCYB 4AH2B 3D0LB 4OKDA 3LN9A 1Y18B 1SEQH 2VR4A 5LG1A 5GZOC 4P46C 3WE6B 2EDYA 2DIJA 1MNUH 5I1KL 5DZNA 2XY1A 5JHDE 2J6EL 3F12A 2HH0L 3AM8A 4MJ6A 4P4KC 3TP4A 2QSCH 3SE3A 1FIEA 5JNYA 3MRJB 3AY4A 5FGCE 5I1LB 3ZE2F 5D5MF 2YMXL 3P0VL 5CSZA 4J3XA 1YYMH 1UKQA 3RPIA 2VITA 5B8CB 3IDIB 2ADJA 5GSVB 3K0WA 4S1SL 3DSFH 4FTVA 5F7NC 1OB1B 3CFDA 3MV01 4MA1C 1DN0B 3DXAA 4U6HA 3MV9B 2E6JA 2OR8A 3BMVA 1Y6NR 4X80H 3D18A 5D6DC 2JK5B 5HYQA 1FZMA 1R5WA 2YC1B 1NBYA 5B22A 15C8L 4AH2A 3ARGB 5FM5M 4C83B 4XCFH 1ED3B 5E6YA 4CN6A 2C4FT 5FCSH 2MNUA 32C2B 3WE6A 1QUNA 3I3DA 3K74B 4URTB 4OF7A 4PRPB 4ZS7L 5TFSH 2KZWA 2XN9E 4JFHE 2CLZB 4RMTA 2Z9TA 3GHBL 3MRJA 4OIIH 3PHSA 5I1LA 3QIWC 2R1XB 1HQ4B 4KK5C 3NOIA 2AERT 4M6MH 4WUUE 3BH8A 1OB1A 1HILA 1VGEH 2BNQB 1DN0A 4FZEH 2MKWA 4X6DF 2H2PD 3MV9A 2DQHH 2DRUA 5KVEH 2H1PL 2DM3A 1OAYH 1NBVH 2VLRB 1IEBA 4F8TA 2AVGA 2JK5A 3MODH 2KL6A 3OL2A 1HSAB 4LEOB 4HPOL 1BFTA 2VLKD 3KPPA 1SY6H 3ZSSA 2B2XL 5HD8C 1OARH 2YOCA 3ARGA 2JKXA 5EDXA 1PG7W 4KK6C 2QKIB 2PW1B 4OZIF 5I1EL 1ZVHA 4U1LA 4PRPA 5FCUL 1JF1B 2CLZA 2QADB 1UXWB 2IPTL 4LPXA 3REVB 5GGUB 3VFUB 5INCB 1RZJC 5IM7B 1DSFL 4DGYH 4DN3L 2R1XA 2AABH 1HQ4A 4L5FH 2F54E 1MH5A 5C0IB 2GHWB 5HYSG 5EOQH 5K59E 3BGMB 5FHAL 4M9OA 4MQXC 1UB5B 1CGVA 5AAWA 1HSAA 4LEOA 3EDFA 3U4BL 2KQMA 3S37X 2A0LD 2EYRA 3HNSH 4Y2DD 4Y16D 1A7BA 4N0YH 1OTUD 1MWAB 4GXVH 1A6WH 1B88A 2QKIA 4ZUVB 1MVUB 2Q7YA 3UTTE 1JF1A 4YE4L 1QPXA 2BVTA 4JRXB 3CJJA 4JO1L 1UXWA 4OD1H 3E6HA 5GGUA 3VFUA 3V0WH 2CRZA 2PETA 3RY6A 1U8JB 2W1NA 4MCYA 4C56D 4Q6IB 4RAHA 5IUSA 5IM7A 1QFWL 5C0ND 3NGBB 2C1OB 1PLGL 3MRRB 1FYTB 5C0IA 2G75A 4NJ9H 2DMKA 1PQZB 4Z95L 3BGMA 4HEPG 2EO9A 1Z9OA 1FVEB 2FD6L 2VMFA 3IS0X 4RBPH 2UY6A 5E4IA 3WNMA 3BQUB 5DGQA 1IC4H 5AZEH 1YEHH 4NQUA 1DR9A 1TETH 3VA6A 1K4DB 4ZUVA 1MCLA 3RI5K 3ZDYE 5KAQF 3SPVB 1BM3H 4OLXL 2IAMD 3FB6B 5ISZE 1T22B 2DQCL 3FCTA 1U8JA 2A77L 3OGCB 5I8OH 5GS2D 2C1OA 3S9DB 4XAKE 3MRRA 2A1WL 1FYTA 5DK3A 4OLWH 1PQZA 1T66C 3O3UN 4Z18A 3SKJH 5SWZE 3BQUA 1EV2E 4NM4L 5E00B 4NWUL 4XMKH 1UWXK 1K5NB 1HNFA 5BQ7B 3FAWA 2DLGA 4M7LL 1J8HE 3QG7L 1EEQA 3OR6B 3QZWG 1D9KC 3QQ9D 4QXUL 4JM2F 5JUEH 1H0DB 3LB6C 4KVCH 1FN4B 2ARJB 4EI5D 2R0LL 3NPZB 4PJHF 4K9EL 4WW2F 1MQKL 2EDQA 5KOVC 3S7GA 2YZ8A 1CLYL 1DQLH 1RVFL 2AP2A 3SBWC 5D7SH 1T0MA 4LSVH 3OGCA 4JDTL 1T89C 4HJ0C 4LLWB 4U1IA 1RUPH 3T2QA 4P2OA 3FO0L 5IQ7L 4JPKL 5JQ6L 1IVLA 4M6OL 1BIHA 3QHZL 5DUPL 4YBQD 1JZ7A 2O61B 1HIML 1CR9L 1BVKA 5JW4R 1JHLH 3MPCA 3TWCL 2PTTB 4LNRA 4LRNH 3KPNA 1T21A 2F5AH 2XTJE 1QBBA 1K5NA 5BQ7A 2HRPL 4NKIL 2IH3A 5C0RH 2ZOLB 1I8MB 3OR6A 4POYA 1QSFD 1FDLL 2FECI 4WEUD 5IMOB 1H0DA 1AIFB 4LGSB 1FN4A 2KPNA 4YPGA 3H3PL 2AV1A 5ESVB 4KTDH 1F11B 1U3ZA 2CR6A 3QUML 4ISVB 1LMKA 2C4FU 1ZTXH 5DD3L 3C5SA 1AXSA 3MBXH 4K8RL 4OLZH 1CDHA 1N0LA 2DQGL 3SE8H 4PRID 5IJVA 3MLSH 3F7PC 3RWGB 4X6BB 5C6WH 3H3KA 3OKEB 2MCPH 3FB8B 4WGWB 4HQQL 3DARA 3HE7B 4XVUD 2AI0H 5DO2D 3GSNA 4PLKC 2ICEB 3OHXB 2B1HL 4TSCH 2ZOLA 1I8MA 2XTJC 3VGFA 3IAGC 5IMOA 1AIFA 1JRHH 4KMTL 1FGVL 2ENSA 5E2TH 3JWNC 3VI3F 1NCCL 4M3KB 1R3IL 2RJMA 3GMNA 2C26A 1EUTA 2IJ0C 2X1OA 2EIZA 5ESVA 1GOFA 3QI9B 2IQAB 1F11A 1ZT1B 3ZKSD 1AQKL 3QDMB 1JGDA 3SJVE 3EYSL 5ADPL 3VI4E 1OWWA 1DCLA 3VXME 1EVTC 4UOW0 3RWGA 1T6VN 4X6BA 1IFHL 3VWJD 2HYMA 4XBGB 3FB8A 1LDSA 3HE7A 1B0GB 3DMMA 2EZ0C 2B4CL 2AJUH 4RIRB 3WS6A 1R5IB 3SDCB 4IS6B 2UZIL 3AROA 1L9MA 1I8IB 4KY1L 2VAAB 5E2VH 2X4QB 3D3VB 3KPTA 3MC0A 3AGVA 5J13C 3TPUB 5FKPB 2VDRL 4PLOB 1EX0A 2BSRB 2DYPD 2HVJB 3DGCR 2W9DL 1JV5B 3QI9A 1AHWC 4JPWH 4N0CC 3QDMA 3TVMB 4CVZB 4J3UA 1CVRA 5EFIA 3HS0B 3OAZK 4X0KB 2KDGA 2ERJC 1LP9E 1NMBH 2P5EE 5F1KC 4U1JA 5CS7A 4GUPB 4ZFOB 1C5CH 4JGMA 4XB8A 1NFDE 4Q9QH 5IJKA 4WTZG 3KYAA 1ADQL 5GRUH 1FVDA 1Y0LB 5F9WC 1B0GA 4R4BA 1OCWH 4U6VL 4AENA 4RIRA 3QA3B 5MERB 5D4QA 4LCCB 1FCCA 3SDCA 2Y07L 4Q9RL 4DEPC 2A73A 1I8IA 2V6HA 2VAAA 3QO0B 2X4QA 3TESA 1A2YB 4NBXB 5L8JB 2VZVA 3TPUA 5FKPA 2ZCLL 3BDYH 4R4ND 1ZV5A 4WFED 4H20H 2BSRA 5DJAA 1TITA 2HVJA 3QCTL 1OAQH 1JV5A 3FONB 4NUGL 3LKNB 3V6OE 3SDYL 3RWCB 3TVMA 4CVZA 4X0KA 2ZNXA 4MXQC 5FYJU 1FAIL 4Z5RB 5B4MD 1LO0H 4ZFOA 4K3JL 2ENYA 3S3JA 1CCZA 3NPSC 5D7JB 3KVQA 5IF0B 2FX8H 2J88H 2BRRH 4NUJB 4MD4B 4HMEA 3VFPA 1FIGH 5MERA 4LCCA 2YK1L 5C2UB 1ADQA 1HE7A 1OW0A 3NVQA 2PNDA 2FB4H 3DVGB 5EO1B 2DJUA 4H1LG 2VC2L 3MJ7B 3SKUD 2WSKA 2FDBP 5CZKA 4DW2H 2OL3B 1CK0L 2DLFL 2FEEI 4JG0L 3AVEA 4HCRL 2NTSP 7FABH 1CU4L 1P53A 3FONA 5JOPE 1ZVSB 1TZGL 4JFQA 5H37H 1U3JA 3ZTJH 1QEWB 4V1DA 4P5TB 3SDAB 5CJ5A 2F19H 3V6OC 3MLUL 1T03H 5H94A 4R8WH 3QUKA 5FYLE 1MLCB 1H5BB 5C07A 1RZKH 2Y6SD 4QHKI 2Q1EA 3QRFM 5C9KA 4PJ8B 4BKLB 2F5BL 4EXPX 4OTXL 4WFGE 3EOTH 4IDJH 1BEYL 3EJZD 3OKLB 4ZPTB 4MD4A 1UM5H 4NQDD 4K7PL 5C6TL 4EDWH 4PJGE 4Y4HC 3DVGA 1CG9A 5EO1A 4R26H 4YDLC 1KPUB 3ARFB 3G9VA 3MJ7A 2NX5D 5JW4M 4KGJA 4CVXA 2OL3A 5F72S 2ADFL 4PJIB 3HUJB 3NA4A 4EKXA 1K6QL 2D2OA 5IT2L 5C09D 1T7VA 4EIGB 2EDRA 5I1KH 1QEWA 1OQOA 5E7FA 3SDAA 2J6EH 4LAQH 4UB0L 4XWGL 1MUJB 4GAFB 2DJSA 4LFHD 1CLOL 1P2CB 4H8WH 1MLCA 4XMLL 4PJFE 2Q87A 3P0VH 2RAMA 1MFCH 4PJ8A 5DTFB 4S1SH 4D0DB 3LQMA 3OKLA 3F8UB 4HK0B 4NBYB 4HX1B 4ZPTA 1FCGA 1YJDC 2CRIA 1K9TA 5F7EH 1MF2L 4PJ5E 4QY8A 4JQIL 2ADIA 2IANB 3FO1B 4MB4A 4RGOL 3ROLA 1ACYH 3TJHD 1JCKA 3DPBA 4X7TB 4PJIA 3HUJA 3VD7A 2IG2L 1JTOA 4HFUL 4YEEA 3S97C 4Y1AD 1EO8L 3ECBB 4WWKD 4OCSH 3GMRA 1E4XI 3GMMB 1NGQL 3X13B 4LQ1A 4ZO8A 1CD9B 4L4JA 2YPLE 4EZMA 4I0KA 3GHBH 4MNQA 7CGTA 1FZKA 2RCSL 4P2QE 1SYSB 1KEMH 3BX7C 3V5KB 5FEBA 3O6FA 2AJZB 5DTFA 1FG9C 4I5BA 2LQRA 4Q9BA 4HK0A 2AK4B 4KRNA 5JLZB 1M05B 1NCBL 4XC1L 4A6YB 1EFXB 2IANA 3GMPA 3TBWB 3FO1A 5J3HC 3VD5A 1F02I 3I2CL 1DE4B 3WNLA 3SHSA 4X7TA 4MS8C 2R1YB 1EO7A 5FDYA 3T0EE 2E7MA 2Q3ZA 2CLVB 5I8EB 1VHPA 3RUGE 5I1JL 3GMMA 3X13A 5I1EH 1BD2A 1U8MA 2H41A 3BE1L 5IMKB 5ERWA 3TBVB 4ZDHA 4P3CL 2VDQH 1EO5A 5GS0L 2VDOL 3GI9H 4PRHB 1SYSA 4DN3H 1B3JA 2AJZA 2I27N 1WEJL 5HYIA 5IKCB 4JAMA 4QRUB 1XF2B 1KCLA 1KJ2B 4JANB 2AK4A 2Z0BA 1RZIA 1UM6L 2PYEB 1M05A 5JLZA 4MNGE 4A6YA 4BFEA 5FHAH 1EFXA 2VDML 3TBWA 1R3JA 3REWB 1PZUB 3U4BH 4L8SC 4OZFB 5K59F 2FGWH 1LD9B 2IMNA 3OG6B 2QSQA 5LGJB 2R1YA 3EDJA 3WFCL 1EEYB 3D9AH 1I3RB 5I8EA 2CLVA 3DUHA 2EXYC 4AIZA 2ZCHH 1B2WL 1YEIL 5IMKA 3TBVA 3MNVB 5D2NB 1HHGB 1N64H 4ZXBA 4JLRA 4AM0B 3IGAA 5CGYD 5FO8A 4QWWC 4XBPB 3CC5B 5C9JA 3GMOB 5IKCA 4PRPD 1X5XA 4QRUA 1XF2A 2VL4A 4JANA 1QP1A 1X5AA 2HA1A 3WO3B 1A1MA 2PYEA 4Z95H 3UPCA 3ARPA 3SCMB 2H26B 3NN8B 2ZUWA 4JQVC 4UNUA 3CMGA 1CGXA 3VG9C 3REWA 3TN0A 3UZEA 5GS1C 3FRPG 1N4XH 1U92B 4OFVA 2BNQD 3OX8B 2XKNB 5LGJA 1SVCP 5ITFB 4JFEE 1EEYA 2DQEH 4Z7VA 1I3RA 2VLRD 2CIKB 3QT2A 3PV7A 4OLXH 4YC2B 5HHOE 4ZPVB 1BGXL 1KB5B 5DMIL 4KAQL 1HHGA 5D2NA 1IGJB 3QEQB 3ZDYF 4XRCB 2CK0H 4QXGL 1UC6A 5TJWK 2R2HB 4GJTB 2DIAA 5CP3A 4JFYB 3CC5A 3GMOA 3O9WB 4G42B 4GRMB 2NQCA 1Z6JT 2A1WH 1AXIB 4JEGB 2QADD 3MREB 1V5JA 4ZFGL 3VFGH 3SCMA 4Q9CA 2BCKB 3L5XH 4U3CA 1M71B 3P40A 4NRZB 1YEJL 4NWUH 4KJQD 2VR5A 3MR9B 3OZ9L 4MQTB 5J11C 1U92A 3OX8A 4UT9L 4EBQL 5ITFA 1K3ZA 1WCQA 4MWFB 2D7QA 4X6DB 4FQQA 1RHFA 1F4YL 2BSTB 4K9EH 3TYGH 1HYSC 4ZPVA 1MCWM 1P6AB 3QEQA 3WNKA 4XRCA 1LK3L 4D94A 1P5VA 2R2HA 2GSGB 1UM4L 4JDTH 4ODWA 1NGXB 5C08A 1W72B 1I7UB 3O9WA 3S35H 3U9UA 5KANI 2YA2A 4GRMA 3TA3B 3GSNH 4JRXD 1F3JB 4OZIB 2W60B 1WAAA 4XPAL 1G7PB 2AJ3B 4QYOB 1CR9H 2BCKA 4YXKL 3HZYA 3TWCH 4S1RL 4F57H 1M71A 3CH8A 4KHTL 4J1UB 4OT1L 4TVSa 4FP8L 2VXQL 5BVPL 1OAZH 1FYTD 4G80A 5HBBA 3KHQA 1FDLH 3VA2C 5E08L 2I60L 2P4AB 4MD0B 2W9EH 1K2DB 1QVOB 3BQUD 4YXLH 5DD0H 3O2WH 3QUXB 3V4PL 4AEHL 1NKOA 3HC4L 3FB5B 1I8LA 5DD3H 3TZVA 4LCWB 1I7UA 3WO4B 1S7WB 3B5TA 1YY9C 1B6UA 2K1MA 2W60A 3U7WL 1G7PA 2AJ3A 1FFPA 4QYOA 4B41A 3O6LL 4R6UA 2A6JA 2P5WA 3N9GH 4HQQH 3LS5H 4DQOH 1QBAA 4AEEA 3IF1A 3FKUS 1PGRB 4K71B 5BV7L 2AS5M 1CVSC 1TXKA 1F58L 5EU3B 2DM7A 3V5HB 2ZZUT 3IKCA 4MD0A 1JZ2A 1FGVH 4N0RA 1GPOL 1IC5L 1MFDH 1QVOA 1I8KB 2OR9L 2YHGA 4MA3A 4KRLB 3LDBC 3U36B 4LVOB 3CZFA 4TNVF 4G8EB 4R2GB 2P8MA 4HWUA 3WLWD 3QJHB 1PBYA 3STLA 3IDXH 4LCWA 4OD3L 5E4EC 4KDVA 1ZLUK 5ADPH 3FT4B 2FX7L 1S3KH 3B9AA 4LCIH 1MCOL 5K9KB 2Z35A 3BPOB 1Z0NA 3AREB 4F7CB 4NWTL 1IFHH 2XKUA 3WN5B 1I4FA 2D7TH 3WYRA 5CZXD 2VABB 4RAUA 1FC2D 2XPGB 3DX6A 3V5HA 2UUDK 2Y36L 3WHXB 5HI3D 1JGUL 1CXHA 3SGKC 1I9IL 3KPRB 1I75A 2DKSA 3ARSA 3I6KB 1ZHNA 4NNXA 5GGRB 5FFLA 3U36A 5F3HB 1IGYB 2FLBT 3C6LC 4DJMA 1B9ZA 4HHAB 4TQEL 5CEXB 3MBEC 3BXNB 3QJHA 2E3VA 1D6VL 1J0JA 3OQ3B 1DBBL 2VR9A 2IFFL 3MUGB 3LAFA 5J6HB 3U0WH 1H3UA 1A6PA 3AREA 4F7CA 2DDQH 4WW2B 1UCBL 3LSOB 3RU8H 1ADQH 3WN5A 4RFOL 4XNMB 5HHVL 3EO1B 2FEEL 5GGSB 2VABA 1NFDF 5IFAL 3V6FA 5L8LB 1GL4B 2XPGA 2GK2A 2EC9U 4Q9RH 3CX5K 1HH6A 2UYLA 4PRDB 3H42L 2WLYA 4G9FE 3WHXA 2HG5B 4WV1A 2ZCLH 1P1ZB 3VGAB 3ULUH 3KPRA 1JPFB 3HE7D 3I6KA 3RAJL 5GGRA 3CVIL 4P4RB 2D4DA 4TNWF 1QNZL 4FZ8H 5GGRY 2LFGA 4XNYH 4HHAA 3TCLA 2OP4L 4I1NB 2HN7A 3BXNA 3GJFH 3SDYH 2XRAH 4U2ZA 4F7PA 2Y23A 3MUGA 4NM8L 1FO0B 1ZOXA 3G5ZB 1IBGH 4XGZB 3T4YB 3FQTB 4XI5D 2VWEE 3U48A 1ZE3C 3BMWA 4M4RA 3QI9D 2EDHA 3LSOA 5CKGA 3LQAL 1SEBB 1SJEB 2A6DA 4OZHE 2SEBB 3AUVA 4N5UA 2I07B 3TIEB 4XNMA 3QDMD 3G6JA 3EO1A 1U3YA 5GGSA 5MI0B 5I8KH 4KKAD 4IEFB 1BQHG 5GGSY 1T2XA 2YK1H 3D0VB 3VXUB 4NO5B 1CXKA 2YPKB 5E2WL 2E9JA 4RA0C 5F9DC 2VC2H 1YEEL 1FZJB 4BM7A 3TV3L 4JG0H 5CUSL 4MJ5B 3SDCD 1AY1H 3WS3B 3D3VD 2N1KA 2R29L 4YHNA 4HXBL 2IH1B 3KWWB 1FO0A 2J7LA 4XGZA 2VLKE 2O5XH 3T4YA 4FFVD 1F45A 2DOCA 4NRXB 3ARVA 4XP1H 2HFFB 5IGXH 5FIEA 1SEBA 3TIEA 2SEBA 2I07A 2VWEC 4MDJB 1XEDA 4OTXH 4OCMC 3TVMD 4GKOA 5EB9A 2Z4QB 1RZ8B 1BFVL 5I71C 3MRPB 4YBHA 5IR1B 3ZO0A 4K7PH 3D0VA 3VXUA 4YQXL 2X4SB 4NO5A 2DM4A 5FB8B 1OD7A 2YPKA 3GSXB 4FQLL 4X7DC 3W0WB 4XXCC 4PY7B 1D5IH 4QRPA 3SE9L 3BKCL 1DLHA 1KACB 5C6PB 5IB5B 1FZJA 4LLMB 4PJGF 5LAXA 1AGCB 4XZUA 5EZIL 4ODUB 4IBLT 4MJ5A 5IT2H 3WS3A 3PDOB 5L9DL 2HLFC 4XWOD 4WJ5B 4PLNC 2IH1A 3KWWA 4M48L 2VXTH 4NN7C 4XWGH 5IVXF 3DURA 1UVQB 5AEAA 1CLOH 4F7TB 5HHPB 4PR5B 4XMLH 5FYKD 4NRXA 1LEGA 2E5EA 4DVRH 25C8L 4NKMB 1MCEA 1G9ML 4MDJA 4OFKA 3FN0L 1RZ7L 2VQTA 1DP0A 3QP3A 2HFGH 3HG1B 4PJFF 1RZ8A 3WFBH 5BW7C 3MRPA 5IR1A 2X4SA 3B9VA 5FB8A 3GSXA 1MF2H 5KW9L 4OFPA 1ONQB 4JQIH 1JN6B 1F3DH 1MFBL 2A6KB 4UAOB 2XA3A 2QBWA 4WU7B 5D7JD 1PG7L 4ELMB 5EIQA 4KPHL 1ZWIB 5IB5A 3V6ZA 4LLMA 4HV8A 3ABZA 4XCEB 4ODUA 1QSEA 1XIWA 5F93C 4YPJA 3TT1L 4Z7OF 2DF3A 1EO8H 2DKMA 4CVUA 4PY8J 3EFDH 3M45A 5A2LH 1I1AC 4ZS6C 4WJ5A 5FYJD 1E28B 1T5WA 5F9OL 5HGGS 1RJCA 5I16B 2KBGA 2VISB 4UTAL 2L4OA 3CU7A 4F7TA 4JQXA 5FHBL 1HHKB 2RCSH 5A43C 5KJRL 4ZAKC 4M7ZC 1WIPA 4A6YH 1T5XB 4NKMA 1KJVB 1VEMA 3MA9L 4F80A 1QBML 4P5TD 4PJ7F 2LVEA 3HG1A 2NMSA 1CTNA 1LGVA 2CUHA 4X9HA 1FBIL 3PWUB 2NXZC 2KZ1B 1XCQB 1ONQA 4PG9A 4C55A 1JN6A 3TH4T 5L88L 1CTOA 1J87A 2A6KA 4PJ8D 5E94B 2R2CA 4WU7A 4Z7QE 4ELMA 4LDOB 1G84A 1DUZB 3I2CH 1ZWIA 4MAYD 1PYWB 5GXBB 4BSJA 3DI3B 4PBVC 4XCEA 3QB7C 2NR6C 4NT6B 4MD5B 2D31B 5GJTL 1N5AA 4HH9A 1CICB 1FNGB 3BE1H 4L4VB 5BZWB 3ARFD 1AR1D 5CJ8A 2YD6A 5GS0H 4MSWB 2VDOH 3GO1L 3O2VL 1HHKA 4L9LB 1UJ3C 3PGDA 1T5XA 3TH3T 2YEZB 1KJVA 5SWQB 2F53E 2DQDL 2L7UA 3BDXA 4NO0A 5MEND 5ILTH 4PJ9C 3IDMA 1QR4A 4GAYB 4X6FB 4P46B 3TH2T 5DD5L 3ZDXF 1IKFH 4M03A 4P4KB 3H9ZA 3SDXE 1EXUB 1NDMA 3X12B 4OGAD 5DRXB 1PYWA 1OP3K 1E4KA 2HLAA 3KXFB 1N2RA 5KOMC 4KZDL 4KQ3H 3DV4B 1VERA 1W0VA 5J1SC 5I2IA 4D9LL 1BZ9B 1YUHB 1GC1L 4Z0BH 2VXUH 4DAGL 2D31A 2IAND 4MA1B 1YEIH 1CICA 3MV7B 5BZWA 5CP3H 5KS9F 2Y72A 4BSVA 2WUCL 5EZJB 1CIDA 1TPXC 3O45B 1ZLVH 3KS0H 2WAHA 3EHBD 1NL0L 3L5HA 4G7YL 1QSFE 5EUOE 5IFJA 5SWQA 3G08B 5IW1A 1MI5A 3AC0A 3RVVD 1TZIB 3T65B 2XXCB 4M1GH 5LGKA 3QQ9C 3B9KC 4QHUA 4OQTA 4X6FA 3RGVC 3EDDA 1I1YA 2JELH 3OKKB 1RIUL 2L7JA 1MCBA 3L3JB 4XCCH 4P4KA 2FBJH 2G2RB 3S88H 4RZCA 1EXUA 3PQYB 4FFWC 5JORB 3X12A 5C0BE 3VG0H 5JHDB 3PGFL 5DRXA 1UWGL 1A9EB 2F8VA 3GMLB 3GRWL 3QIWB 2AK4D 3DV4A 2NY3D 1QFUH 4F9PA 5FGCB 2VKWA 1YUHA 3ZHDA 3A6CL 1EFXD 1F42A 1CGSL 2VB5A 2V7NA 3MV7A 4J6RL 1A1OA 1BGXH 3VFSA 1NCAH 3WXWL 1J1XH 2CSPA 3O45A 2OTWA 5FOBB 4MVBD 5TQ0L 1IM9A 2AAVA 4ZOAA 3BWUC 1TZIA 3T65A 4XXDB 4M7KL 5JW3L 3BP5B 4G6KL 1KN2H 1BECA 4DN4L 1MJ8L 3OKKA 2WWKT 3DX7A 4PRHD 3NFNB 2G2RA 1LO2L 1OM3H 3DLQR 4OGYH 4RGNE 5JHDA 3OZ9H 2XN9B 1A9EA 2X1WL 3GMLA 3PUCA 4ALAL 1FPTH 1X5IA 2PR4L 1OP5H 4KKCC 2VQUA 2DS4A 2YN5A 4NZDA 4XPFH 1F4YH 4KK9C 1KLGA 3E1F1 4WUUB 3GRWA 3N1GC 4P9ML 3D25B 5DA4A 3RY5A 4HUUA 3T2NH 1TQBC 4QRRA 3S5LB 4G6AD 1TTUA 3HCVB 5FOBA 1UM4H 4ENED 2DQFB 3BZFB 5GGTA 5MEQB 5DWUL 1DDHB 5GRWA 4CDGC 4IOSD 4OM1H 5F44A 3MRBB 3BP5A 4XPAH 4OCWH 4EQ2A 1LO3L 3NFNA 5ACZB 3VWKC 2XN9A 4JFFE 4KDTC 2VXQH 3LKSB 4RGNC 2BK8A 1U8HA 1IGML 1UKTA 1KGCE 4O2FB 3SCMD 5E08H 4Z8FH 3F7RA 1REIA 1MRFL 4W6XB 3RHWK 4J7RA 4WUUA 1QFOA 3BIKB 2F54B 4ZSOA 3V4PH 5ELIA 4FQJH 3GIVB 1ZKAA 3HMWH 3NCJH 3S5LA 1S78D 3HCVA 3V79C 3MJ9A 5DLML 2XY2A 1DQTA 1U8QB 3B5GA 2DQFA 1U93A 5EU6E 3BZFA 5MEQA 1ITCA 1DDHA 4WIQA 4D0CA 3OF6A 2GI7A 1YNKH 3QEQD 5EC2A 1QLEL 1YEGL 3NH7L 3BRDA 3UTTB 1NGPL 4R96B 5BV7H 1NUDA 3NZHL 4YXHH 1IE5A 1BREA 1E6OL 4O2FA 4G7VH 3RIAK 2FBOJ 4X5XA 4RMUA 4YDJA 2E9IA 1GPOH 1IC5H 4MB5A 5DHYB 4W4OC 3BIKA 3H9SA 4HKZA 3K1DA 1EMTL 3VDCA 4LOUD 5KVGH 3I02B 2MCG1 2Q6WA 3ULVH 1I3UA 4M6NL 4OD3H 2EIDA 4RSVA 2XZAL 2X4UB 4NZTL 1OGTB 4U05A 3SE4C 1F90L 1MCOH 1D9KB 4J2XA 4PS4L 4NWTH 4ZODA 3QUMB 1CLCA 1YQVL 3MCLL 4OSUH 1C5BH 3MA7B 4ONGL 1AKJB 4I3SH 3ARWA 5I30L 5J12C 3TA3D 5ISZB 1OLZA 2HWZL 5EIVA 4W81A 5DJ2A 1AGFB 3L7EB 1FNSL 2KKQA 4LVNC 1L7TL 1JGUH 1YEKL 2J5LC 4Z7UE 2G5RA 5DHYA 3C8DA 3U9PL 4B7IA 3C9NB 5CBEB 2W38A 4U1KB 4NQDE 4KZEL 3ARBD 4N8CH 5IB4B 3T2OA 4X83A 2IPUG 4KUZH 2P8PB 5T3XH 5SWZB 2PUQT 3BPNC 1D9KA 1J8HB 3EOBB 3QUXD 1ORQA 5M7QA 1SVZA 5HHVH 3MA7A 5IFAH 1YEFH 4OUUB 3SBWA 1OTTD 4HZLA 3HZVB 5ISZA 3MLPA 5J1TC 4RA3A 2DQTH 1Z3GH 3H42H 1HZHH 5EH1A 4XHJD 4Q97A 1QLFB 3QDGE 3CVIH 4R0LA 1A4KA 4MA8H 3QBTB 1KIQA 1QNZH 4UUJA 5CBEA 2AEWA 2MPAL 4U1KA 5BCAA 2OP4H 2OJZH 4U49A 3B8SA 4RISH 2IBGA 3B83A 5HVHC 1X3DA 2D9CA 2DJ4A 1R3HA 1A6UL 5EWIL 1DLFL 4NM8H 2P8PA 3FHQA 1XGYL 3NFSL 5SWZA 2XTJB 5JR1L 1KF9B 1UACL 2VXVL 4PV9B 1J8HA 5DJYB 3STZB 5IBUG 2ZUTA 3TBTB 3ZTNL 4R2GD 1MCPH 4MJIE 5IVNA 3MNWB 3FQNB 3V9FA 4Y1AE 1A7PL 5L2KE 5HDOA 4N90E 2BNRE 4OUUA 2H2SC 1JNLH 3H9HB 4OZHF 1S7SB 3DIFA 1T2QL 3ARED 2O5YH 2UWEF 1YEDB 2MWCA 2VN4A 1K8IB 3I50L 2IALB 4TVPD 5SWSA 1QLFA 4X7SL 4EVNB 2A83B 1PSKH 2OS7A 3DX9B 2WINA 5TGBA 2APWA 1HHHB 2NY6C 4JKKA 2MOVA 2OLDA 4CL7A 2DQUH 4XPBL 4PJCA 1W0WB 4HXBH 3WIIL 3CX5J 4JPVL 4G6JL 2NW2A 4PV9A 4GAJH 1X7QB 5CMAA 5DJYA 3STZA 5J13B 3TBTA 3ZT6A 1INDL 3ALXA 4OFDA 3MNWA 3FQNA 3VXNA 2FEDD 5FECB 4JVPA 3IU4L 1BFVH 3HI6H 1AHWB 4JN2B 1A7OH 3H9HA 1HKFA 1S7SA 4HLZG 5I18L 4LNVA 1DEEB 2ERJB 2XICA 1K8IA 4JHWH 2IALA 2DI7A 2ORBH 4LEXL 3SJVB 5IV2B 2A83A 1K85A 4U7MA 5EORL 1HHHA 3VXMB 1F4XL 2HFTA 1NGYB 2I26N 5ALCH 5IESH 4X9IA 5F9WB 5BRZA 5D1XA 5FM8A 3OKMA 5ETUA 3WJLC 4TSBL 4FXLA 1RJZB 4DEPB 3VCLA 1DL7L 1X7QA 4JPIA 2Z8WC 4X9FA 3SGEI 3W11C 4LSSH 3DVFA 3S4SA 1RIVH 4FABL 3FN0H 1O0VA 4DGIH 1FFQA 1X44A 5FECA 3BKYL 3WFHB 1AHWA 1BIIA 3B8YA 1E6JH 1HH9B 1V8HA 4PTUA 4ZUSA 1DEEA 4XTRC 1MCRA 2V5YA 3MFGB 4J3WA 4KPHH 4WHYG 4CU6A 2W0FB 3SJVA 4ETYA 4X4XA 5IV2A 5D6CB 4XVJL 3L3OB 4HWNA 3VFNB 2BXYA 1LP9B 2P5EB 3VXMA 1CD1B 1CIUA 3Q1SL 3NPSB 3VXUD 1NGYA 3ZKXC 3MYZA 1NFDB 4U6XB 4PJAE 3R4DA 5E8DL 1N8ZB 3MRDB 3QDAA 3SGDI 4CGTA 1EHNA 2BNQE 4UV7L 3CSYB 4HFWB 2VLRE 3Q6FB 4XHQA 1IQWL 3WFHA 2D03L 4YDIL 3IB4A 4LK4A 1WV7T 4Y4FD 1HH9A 4WI9A 5GHWL 3SQBA 3SGJC 2R0KH 4QOKE 3JWOH 5D6CA 3RX8A 4MQSB 3L3OA 2PCPB 3VFNA 4E5XA 1HXYB 1LP9A 2P5EA 3CSPA 3EYUH 3EYVB 3R0NA 1CD1A 3UYRL 4Z7QF 1EZVX 3EJYD 2X1QA 3VH8B 5JW5A 3W0WD 2AXGB 1KYOK 1A21A 4QT5B 3N1QC 4HMDA 1KPRA 5IWLA 1P9MA 4K94L 4X7FC 5BJTB 1MJUL 3MRDA 1JZ6A 3GO1H 4Y4HB 3MACH 4OQTH 4YDLB 3D2UA 4LPVA 1WTLA 3P30L 2MMXA 2D0GA 5JXEC 3O3EA 4HFWA 3CH1B 2VSDA 5D8JH 4JHAL 1VEPA 2Z91B 2MQCA 4NQVB 1YY8B 3C60C 4GKZB 5DD5H 4CU8A 3U0PB 4IRSA 1TNNA 4YGAB 4LLDB 1A6VH 3GSUA 1U0QA 3HG1D 5TPWH 3TO2A 4OCXH 2PCPA 1HXYA 3EYVA 5E56A 4JRXE 1QKZH 4D9LH 3VH8A 3O4LD 5A40E 1VEOA 2AXGA 3ARUA 5JIHA 1OPGL 4QT5A 4LSUL 1U2CA 2DBLH 4NZUL 2WUCH 4O58L 4ELKB 3O6KL 2Z8VC 3ILQC 4FQXC 3HMXL 1I85A 1MEXL 1MRCL 1JNJA 3UJTH 4PJGB 5EBGA 1ZA3B 4NDMB 5JOFA 4AEIH 5EBWA 3QEUB 4UU9B 1UT9A 4NQVA 1XCTB 4GKZA 5IBTH 3U0PA 4PJDF 3ZDZE 5IVXB 2OZ4A 3CXDH 1A14L 4BFBD 3UXFA 3PGFH 3SOBL 3G6DH 5CWSA 3GRWH 5B3NA 1NAML 4Y8AA 2EE6A 4ODTH 5T1KD 2JCCE 3RTQC 3QPQC 1G9NC 4PJFB 5HGBA 4P23C 1CXLA 2WIIA 3LS4H 4PPTA 4QHMB 4RFEB 4ELKA 3WXWH 5HI4D 3GBMH 1HWGB 2C7UA 1X5KA 1QRNE 4FFZL 1AJ7L 4IOFD 1Q9KB 5CEZE 5TQ0H 1K8DB 4PJ5B 3SQOL 4MXWH 1ZA3A 4HKXA 4ESKA 4WW1B 1AXTL 3AU1B 4L4VD 3DROA 1JNNH 4M7KH 3C08H 1SMAA 4RWHA 4TUKL 1XCTA 3ZL4L 1RUAH 1TVBB 5KSAC 3RZCA 4Q2ZB 1NFIB 1RZJH 2PYFB 5BO1L 1MJ8H 4DN4H 2XG4A 5EOCJ 5F6HJ 4KTEL 2O93L 1LO2H 3HR5B 4X9GA 1FH5L 4U7SA 2FH6A 3F58H 1BPVA 5BS0E 2YPLB 3GZKA 1DZBA 5GZOD 3GIZH 4P46D 1P4IL 3R8QA 4HUWA 4PJFA 4P2QB 1J1OL 1Q8MA 4D9RD 3MJ9H 5FKAA 4K23H 1F5WA 1BBDL 4RFEA 4XBEL 4P9MH 3TJEL 5KSVB 3MRIA 1MIEH 3KXFD 1Q9KA 1TCMA 4JFZL 2GJZA 3MLRL 1K8DA 4PJ5A 5AWNL 4L8SB 4HPYH 3PP4H 4WW1A 2AV7B 3AU1A 1I9RH 2X4PB 3MV7D 1GHFH 4XT1C 5DYOA 1EJ6A 1TVBA 1NFIA 2PYFA 1EFQA 3OAUL 4NYLB 3PHQB 4I4WB 3RUGB 3HR5A 3CLEH 4FQ1L 3WIHL 5CD3B 5B38B 4UI2A 1NLBH 4ZFFB 4N8VB 2E7LC 1XGPB 4P2QA 2X41A 4BZ1H 3VW3L 2ZG2A 5ICZB 3CSGA 3PQYD 5CIPB 1JYWA 1UA6H 2J8OA 5JHDD 4L3EE 1WITA 3QIWD 4OB5H 3VG9B 4MNGB 2PO6C 4KK5D 4L8SA 3E8UH 5GS1B 4ZMAT 2AV7A 3QIBC 3CCHB 5GRXG 2X70B 4HLJA 4KVNH 3VGGA 5T5NF 3WNOA 4B7LA 4HS3A 1O5DT 4HUXA 5HI3C