2QT1A

Human nicotinamide riboside kinase 1 in complex with nicotinamide riboside
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
189
Chain Sequence
LVPRGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Nicotinamide riboside kinase 1
total genus 58
structure length 189
sequence length 194
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qt1A00
5C46F 4OQFA 1IY1A 3EARA 4LDJA 1YVDA 3KKPA 1U8YA 4KLZA 2ZANA 1H8HD 2ZRLA 1EG7A 5J4LA 3IQWA 3NDBB 5J4HA 1NN5A 1SKYE 4ACAA 4U02A 2QORA 4M0LA 4S35A 4QL3A 4PAOA 5AJYA 5P21A 2J7PD 1K5DA 3K09A 1VG1A 3K0FA 5KDOA 2GXAA 3AVOA 1QZXA 5EUQB 3H4MA 1NKSA 2IUSA 2EFHB 3HU1A 5H68A 4I1UA 1ESMA 1E2EA 1NKTA 4IDQA 3AGPA 5FOWA 1LTQA 1G21E 4AYXA 4PPFA 3RS3A 4UJ5A 1BYIA 1UBCA 1E2FA 3IIJA 2OUKA 4QHTA 1MT0A 4DCSA 3FVQA 4KXFB 2YWFA 1N6RA 2X19A 5JMTA 1ESNA 2AXPA 2C9CA 3KB1A 3PXGA 5KYKA 5FPSA 4OK5A 1CP2A 1W44A 3KKOA 4RZ2A 1XJ0A 3CH5A 2HCBA 3TQCA 3KX2A 5FUYA 3BXZA 3RRMA 4B3CA 4ZKEA 1J99A 2G6BA 3EZ9A 1KZGB 1CF4A 4A0FA 2CNWD 3FB4A 3CR7A 2W0SA 2J5XA 3QENA 4A2WA 1U81A 1G6HA 2XJ9A 4DLSA 1IXRC 2P6NA 2DPXA 2WZQA 1QHHB 1LS1A 3U3JA 1AS2A 3Q7QA 2Q3MA 4ZDWA 2LWIA 4NKRA 2NIPA 4QGAA 2ZETA 4C3ZA 2WMOB 2QQ0A 4A8JC 4Z8XA 3MWJA 4PSAA 2FV8A 3EIEA 1UADA 1AJEA 2GK6A 5FH9A 2RGNC 4TQAA 1MOZA 2ZRBA 4TSFD 4YQFA 2GVZC 1MABA 4HUTA 1U9IA 1Q21A 4EJSA 4MH0R 5CDFA 1NVWQ 1G7RA 2IYRA 4Q4AA 1DADA 1G4UR 4BFSA 3DPUA 1OSNA 4YC7A 1F2UA 4ZPXA 2ZIAA 3A6PC 3EC2A 3ZS9A 2ZRDA 2ZSAA 3K9HA 2NOAA 2R8RA 3CRRA 4KYIB 3DOEA 2MMCA 1R0ZA 3FMOB 3CWQA 1OT3A 4LV8B 1T4GA 4J0QA 3TUJC 1VG0B 2P5SA 2XTMA 2AK2A 3I61A 4B32A 2EFGA 4AYWA 1SHKA 1B0UA 2IHBA 4URWR 3SYKA 3KTAA 1ELOA 1DG3A 2ZS7A 5B2ZA 1RRCA 1EXMA 3NC0C 1GL9B 3EPKA 1VIAA 2H5EA 1OV4A 4D4MA 4DLRA 1G8YA 2KBFA 1EWRA 4IFEA 2KBEA 4KFUA 2DFTA 4PANA 1OXUA 2BCGY 2QY9A 4YMUA 2ZRNA 5EP4A 5FOXA 5AJZA 3SBEA 1KO1A 5D3QA 2H17A 1SXJA 2P2LA 3E2IA 2CJWB 3I72A 2P0EA 3ZGXA 1GAJA 4JLNA 2QAGA 1IN4A 4NZYA 3B1VA 3THWA 421PA 4FCVA 1ZCAA 3MSXA 2X1VA 1DPFA 3VNVA 3P1JA 2OILA 5C4GB 5FL7A 4DCNA 3R20A 2R6GA 2G1JA 2V55B 1Z5ZA 4QHSA 3U4QB 3CKLA 2C95A 4BEBA 1N6LA 4D26A 1LY1A 3SHFA 1S96A 4IEEA 4HB0A 3BH6A 4JBYA 1SXJD 4XD7D 2HXSA 2ZUDA 4TMZA 5D3MA 1RRGA 4D4LA 1W0JA 2GHIA 2J41A 1S2MA 1TPZA 4OQXA 1C9KA 5JBQA 1K8RA 1CBUA 3SU8A 3TQFA 2FWRA 2NMVA 2CCJA 4NCKA 5FBVB 4UNRA 1MRNA 3IGFA 3RS7A 2QPTA 2FDCA 4DJTA 1NBMA 4WAUA 1KJZA 1UM8A 1Z6AA 3EPLA 4EPXA 1KSJA 3QKRB 1KAOA 2OO7A 4WXPA 5DSZA 2JLXA 3PFIA 3ZZTA 1IN8A 2XGJA 5AR1A 1T6NA 1XU4A 2ZE7A 1OH5A 4P33A 5DN6D 5EZ5A 3VNUA 2BBTA 1GZSA 1YQTA 1T8UA 2JLRA 1JB1A 1GVNB 5DE3A 3VTKA 2VSOA 4HAUA 3W8NA 5TVKA 3T61A 1PVOA 2CDNA 3OFNA 3OEEA 4LJ6A 4DLVA 1UEJA 2PMKA 4JL6A 2GAOA 1HT2E 3RDPA 4LHXA 1YZKA 4UXIA 3ZZ0A 2JEOA 3HDTA 4XIGS 1V5WA 2QTHA 2IK8A 4NDZA 4URUR 1KDPA 4O2RA 1MV5A 1EWQA 1YRBA 1TF2A 3SJAA 4CF7A 5KNCA 2JIZD 4HB3A 1Z2CA 4RZ3A 1N6PA 2ZRPA 4DXAA 2QNRA 4A0GA 4QM7A 1JPJA 4TT3D 2GDJA 5HZKA 2IEZA 1S1CA 2F55A 4PX9A 1HA3A 1HE1C 2BEKA 3QY0A 1TQ2A 4LHVA 2O8DA 1VPLA 4URYR 1T5LA 5JZVA 2JDID 1Z2AA 3K70C 4QXAA 1EFTA 2J45A 4B76A 1R7RA 1PLKA 1TF7A 2YVUA 721PA 1P62B 3P4YA 4B33A 1XX6A 1NVVQ 2QBYA 1UBEA 2DYKA 2C9YA 2KJQA 3UATA 1GM5A 1W36D 1Q1ZA 1KY2A 2V8OA 3EIQA 3BGWA 2IXFA 4PPQA 5E3HA 2JLQA 4B44A 3BC1A 3VX3A 1MO4A 4NTZA 4M1OA 3THWB 1IXSB 4UKDA 4QC2A 2WKPA 4AK9A 4JBWA 2Q9CA 3ZJYA 4Q48A 3U7GA 2EYUA 3MLEA 3GLHE 1OYWA 2FEMA 2W6IA 5F2EA 3GCGA 4M21A 3CF0A 2CXXA 3CM0A 3OAAD 3A1TA 4QNMA 1Z6TA 2JASA 1J2JA 4HI0E 3IPXA 2CE7A 5AJXA 2HJVA 3I5XA 4GP6A 3FFAA 4BLTA 1W7AA 2OLJA 4C0BA 3GEHA 3AKDA 5JWHA 1TUIA 4RFSB 3THOA 2OCPA 1OF1A 3K0CC 3M0EA 5KUTA 5F3WB 2IL1A 4XVQA 1NMZA 3NH9A 4P31A 2LKCA 1OKKA 1CULC 4Q4HB 2QP9X 1ZC4A 2UZ3A 3ONWA 1YR6A 3PEUA 4EJSB 3QG5A 4MKHA 4ZCLA 5KNBA 4DZZA 1P6XA 2J0VA 3KJGA 4JBXA 1XTSA 4IDPA 5FOUA 5FTJA 2IYTA 4IOKA 1TQ6A 4BFUA 4XWKA 1Q1EA 1ZINA 2VF8A 4LY6A 3K1JA 5G40A 4N3NA 2YC2C 2IXEA 1SVWA 4PC3A 3WYAA 4A92A 1BO6A 5B64A 1G8FA 3B2EA 3MJRA 4L9SA 4ABYA 2WWHA 3BH0A 1HURA 1WP9A 5KPDA 2YINC 2IUTA 3I3SR 1E79D 2FMXA 3OIUA 4DDVA 5AK0A 2O8BB 4IVPA 4BLSA 2C96A 4GL2A 2EFDB 821PA 1XP8A 2A5GA 1XTJA 2IYLD 1Z22A 1SGWA 3CBQA 4BZXA 2QSZA 621PA 3RWOA 1YE8A 2GEVA 1U98A 2DWOA 1JNYA 3Q8XB 3M1IA 3SZRA 1IHUA 1QHHA 5HTKA 4ZDIA 4EFNA 4PHHA 2CK3A 4XH9B 2NG1A 1KDTA 4TL6A 3KFXA 3THXB 3TW8B 2GF0A 3C14C 4Z1MA 3C41J 3U7FB 2CLCX 2GXSA 3CX7A 4W5WA 3THYB 1NBME 2VHTA 1E79A 4OI4A 3X1WA 3SE0A 5KSYA 1TX4B 4M2LA 4RKEA 5KOYA 2EWVA 2ZJ2A 5G53C 1S1MA 1V43A 4EFLA 1JALA 4I1SA 1KMQA 1VMAA 3P27A 4WIAA 1WCV1 2R6DA 3T5DA 3B6EA 1N2CE 2CE2X 5FFMA 2XZPA 4KITB 2WSSA 1KO7A 4L5BA 1CR1A 5IRCD 4YDSA 3CRMA 5G3YA 1TTTA 1YZLA 1F2TA 2EQBA 3RRZA 4AKIA 3QPWA 2IX3A 1RYFA 3N2EA 3VX4A 1VYUA 1E2PA 2O8FA 1US8B 4PHFA 4MDEA 2GILA 4LJAA 5CDFE 3R9IA 5E7JA 2OCYC 4ITRC 2WOOA 4TMKA 1KI8A 3I4LA 1GUAA 4B75A 4TLAA 2VQSA 3QSYA 4B47A 2W58A 2OAP1 3DEFA 4MA4A 3A4NA 1VCMA 1PLJA 2QMEA 1WBDA 3KXLA 2YWHA 5D3MB 3MGCA 3TW4A 4CIDA 4Q4LA 2JLWA 1LS6A 2ORIA 4Q03A 3KXKA 4HAVA 1FUUA 3ADDA 4M53A 4A15A 1II8A 1SXJC 5FPKA 3PUXA 2QAGB 1W36C 4P4UA 2QZ4A 3PENA 4AC9A 4BPBA 4CZ2A 1LB1B 4KCGA 4LYAA 1FL9A 3K0CA 3VQTA 1ZNWA 4MYTA 4LYJA 3ZQ6A 1TNDA 3RRNA 1E9SA 1Q20A 1ZC3A 3RSOA 1W4RA 1NI3A 2WSMA 1KAGA 4DDWA 4CEIB 1XXHB 1G16A 2PZEA 1IXZA 1Z8FA 4OI2A 2NPIA 1AS0A 5CLLA 5BXQC 5DNYB 2ZRHA 4RCYA 4AG5A 3CNNA 2YNMA 2F1JA 2N1BA 2FZLA 2O8DB 3GJ6A 1IQPA 4EPWA 3DOFA 3U7HB 4IDOA 5DN6A 3I32A 3VR5A 2P6UA 3AF3A 1SVOA 5KSZA 3QE0A 1TU4A 1D2MA 4E5UA 1RIFA 3H1TA 3TSWA 4M4SA 1OW3B 4DCVA 2W00A 1XD8A 3UANA 3PCRB 1Z63A 1XD2A 3CF2A 3NG1A 3FFBA 3E1SA 4A2PA 1ZIPA 2XTZA 4DCUA 1T8TA 2WJJA 5E7MA 1DAHA 4JL5A 2CL7X 4LJ9A 2CCKA 1MABB 2OEPA 4KBFA 3QXJA 3RVBA 2QRNA 3HJNA 5JRJA 2VF7A 5TARA 4O0MA 1OHHA 3QF4A 3HYTA 3IIKA 5DIFA 1SULA 1KMHA 3CPEA 3I73A 3SR0A 3Q9LA 3O8RA 1RW4A 5TDHA 1E4YA 4PC7A 3KJEA 1XXHE 5JEDA 3RYTC 1UKZA 4DT1B 1BIFA 4LYHA 2QM8A 1AM4D 1H8ED 1UPTA 3EC1A 3GD7A 2O0KA 3A36A 4LBVA 2KB0A 4JVMA 4AG6A 3EZFA 3FDIA 2OM2A 4LYFA 3BD9A 4JYCA 2ZYTX 2ERYA 4MKIA 4C0LA 5IT5A 5HPYB 2J7PA 4RD6A 3X1YA 2K5UA 3QJYA 3PIRA 1UBGA 2ANCA 2B21A 1Z0FA 2ONKA 2Q3FA 4TTQA 4JVSB 3ZIAD 3QG1A 1G8GA 2BMJA 4RD2A 3KFVA 1G3MA 1OJLA 4G3XA 2V6IA 4F91B 1TADA 4F93B 1OH6A 1NLFA 2CNWA 2R6AA 1G20E 1OB5A 3RC8A 2ODNA 1G291 4C0QC 3U6KA 2VP2A 3O47A 4W7SA 1KO4A 2GJAA 2HF9A 1TEXA 3RABA 1SKYB 4Z8YA 2PBRA 1U8AA 3B5JA 3CRQA 3TJZA 2ZJ8A 4BZQA 4L15A 3QUSA 1ETUA 1XPUA 1CR4A 3DO6A 3QEOA 2GESA 1TMKA 1WBBA 4I1OA 3RWMB 3QKUA 3UG6A 4HSEA 4RZXA 1P9WA 1R5OA 4UNPA 3U4QA 3ZD7A 3NHBA 4CEIA 4LJ5A 2VPPA 2CJWA 4JIMA 2PH1A 3DVLA 3B8HA 3PG5A 4D80A 4TWZA 1SVIA 2OSBA 2KE5A 4PZYA 2CHGA 1Q3HA 2D7CA 5EZ6B 3TMKA 1ZNZA 3GEEA 1XMJA 4Z54A 3T5GA 4ZV4A 1NIJA 2AXNA 1PUJA 3LO5A 4NP6A 5FBRB 2C99A 1JAHA 4ERNA 1CR2A 5GJBA 5SZHB 3L43A 3I8SA 4JVLA 4Q1AA 4XSGA 3TKLA 2C98A 1A2BA 2AFIE 4IJMA 5C4MA 1XTIA 1E9AA 1E2HA 5FBQB 5C1BA 1EK0A 2UKDA 4LC0A 1XPOA 2PT7A 2GZDA 1D5CA 2V4ZA 4QGHA 2WWIA 1US8A 4Q9IA 2XZOA 4QFMA 2QU8A 1IOZA 5J40A 5KTYA 2GA8A 5EXPA 2CBZA 2WJHA 4NCJA 2CK3D 5JSZA 4XTRA 3F5FA 1OFIA 3AP1A 2FNAA 2W2TA 1ZM3A 4KVAA 8OHMA 1U8ZA 1GRRA 4YDHB 2F7SA 5EP3A 1UEIA 2WVJA 3A37A 3DMDA 4OQMA 3U60B 1Z0DA 1XEXB 4NPHA 3A1VA 4ESVA 3DM9B 3CPJB 3WNDA 5C18A 1YZNA 1XFAA 2FSFA 3UWKA 4ZI3A 2WJYA 4NU0A 5JHGB 2HLDD 3RHFA 4EUNA 2P6RA 1VG9B 4M9SA 5HKKD 4B3BA 1MH1A 5CJ2A 5JJKA 3GLFA 1N6NA 2ZJYA 1Z0AA 1FX0A 4P3YA 5BN5A 4OQNA 4PHGA 1KK3A 4B73A 4EQ6B 4Z1MD 1WDTA 3LVRE 4MGZR 3MFYA 4LV6A 1Z06A 3EIHA 1DTSA 2BMFA 5ELXA 3DMNA 4C9BA 1P2VA 1Q44A 3DM5A 2XX3A 5L3SA 4M1YA 1IN5A 5L3VA 3W6OA 4EKDA 1KNQA 3VAAA 1SKQA 1U94A 1XTRA 1T0JB 4KV9A 2AD1A 1KMHB 3K53A 2VO1A 4FD2A 2R65A 2ZU6A 1QHIA 1AA9A 2NO0A 2OCAA 3VR4A 1NNEA 1VTKA 3GJ4A 4I81A 1ZD8A 3UMFA 1P2UA 4ZDKA 2IA5A 3TNFA 2IYSA 2W6JD 3LBNA 2ODWA 2VA8A 4JKIA 5A5GA 1ZM2A 1COWA 1KO5A 1Z0KA 2IYZA 2ZVQX 4C0KA 3P4XA 4LJ8A 3EW9A 4LK2A 5JWOA 2J46A 3DKPA 4X8HA 2I3BA 4PC2A 3RANA 2QP4A 4RSGA 5JWRA 1AK2A 1G1MA 5FUVA 2BWJA 3LY5A 4DUGA 1YHNA 1HQYE 2ATXA 4BRUA 4DIEA 1WQ1R 2C04A 2ANBA 1JEDA 3GFOA 4CGZA 4PSVA 3WYFA 1G9XA 2ZR9A 4HB4A 2BJVA 4TQ9A 1S8FA 4X8MA 4G5OA 3SN6A 2NO6A 1ZW6A 2Z4RA 3F0TA 4HZUA 1Q0UA 1ZM7A 2XNSA 3IUYA 4FMCB 3KQKA 4PO1A 2O8EB 1N6IA 3RSLA 4POAA 5TXGA 2PLFA 2ZJBA 3T1VA 2C77A 1UKYA 1W36B 4DLTA 3N5CA 2J59A 4DCTA 2QN6A 5GVSA 3HU3A 2RGCA 1J70A 4ARZB 3A8TA 2FA9A 4AKEA 2GCOB 3ZLJA 1C4OA 1I4DD 2QMOA 3C4JA 4L4UA 2ZYUX 5G41A 2FH5B 1TQDA 4DDTA 2HEIA 3OHMA 1KSHA 4Y0VA 4A6XA 3K0AB 3KB2A 4NMMA 4CYMA 4XVUA 3VU9A 4MRRA 3WMFA 2AK3A 1JXMA 4KU4A 5FBLB 1E3MA 5DLQC 2BCJQ 2IYYA 1KK1A 2WICA 4NYJQ 2BKUA 4TTRA 4A1FA 2BOVA 3WYGA 1GTVA 4X8OA 3EX7C 1DARA 4DHEA 3I8XA 1YZUA 2PCLA 4N0EA 2H16A 2ZAMA 3R8CA 2EU8A 4RCZA 3GLIA 3EPJA 2D3WA 2WWYA 1GNRA 2A30A 3IHLA 4FINA 4S2EA 3SC3A 2C2HA 4C0AC 2IS4A 1ZUNB 1L2TA 2GCPA 4HDCA 4HEJA 2NZ8A 1DELA 4D81A 3SHWA 5HE9A 1R6BX 3QPUA 3T1OA 3BB4A 4V03A 1ZD1A 5AWFC 4DKXA 1ZJ6A 3LNCA 1E2GA 1G5PA 2AL7A 2Z83A 1XJQA 4HZIA 4HLDA 5KSOA 1VG8A 3OIVA 1TL7C 4UNSA 1E1RD 4I1VA 4U7DA 3U44B 1KSFX 1N5JA 2O0HA 3VR2A 4CVNA 2VTKA 5KPJA 3A1SA 4BECA 1ZVQA 4Z51A 1U99A 2ZJOA 5CK5A 4LCBA 3ND9A 3A1UA 5HZHA 1R4AA 2OLKA 4M9XA 4XJXA 3SS8A 3T06B 1OXTA 3H84A 4MRVA 3IHWA 1KK2A 1X3SA 3GJ8A 1P61B 3CF6R 4IOLA 1E2JA 4FMBB 2KWIA 3TR5A 1W4AA 4KHZA 4F92B 1T91A 4LJ7A 4OJQA 3SBDA 4NYMR 1MR3F 3UMRA 1MO6A 2JJ2A 1E4VA 1X6VA 2ZSBA 2Z5FA 1WF3A 1NJFA 4JKYA 3BOSA 5FPHA 4DT1A 1M74A 2YWEA 4DWJA 2YOGA 3I62A 3U3OA 3SJBA 2GXQA 2FU5C 3QXXA 1JAIA 3VHXA 5EP2A 1KY3A 1E9DA 2IF2A 2NZJA 2BBWA 2UZIR 2ZRKA 5K8TA 1PJRA 1NVVR 4B3XA 1VHLA 5F9HA 3C16C 2J7KA 3QXSA 1DAFA 5DI3B 4JJZA 2P5TB 2MMGA 2XXAA 2VP9A 1DEKA 1RPZA 2ZUBA 3B82A 2FPKA 3EAQA 4DUGD 3I1FA 1E99A 3MRSA 4YMWA 2RH5A 3OEHA 4TZ0A 3U44A 2WKQA 2ZSEA 3AVXA 1E1QA 5GJVC 4UXHA 3AF4A 4XVRA 3AVUA 5LBIA 1LNZA 521PA 1BYUA 2WHXA 1RZ3A 4BLRA 1HTWA 2ZUCA 4Q47A 1E69A 4KI0A 4Q4HA 3WRXC 2FEOA 4XTCS 2NPFA 2F9MA 1FMJA 2A2ZA 2QE7D 3KXIA 2PEZA 2JA1A 3AVPA 1GILA 1ZYUA 3OE7A 1XEXA 5C2JB 1U0JA 4CDGA 1M8PA 2VP5A 3ADKA 2CMKA 3S1AB 4B6FA 2XNDD 4TN1A 3UXMA 1MKYA 3FKSA 3C8UA 3RAPR 1II0A 4HYYA 3AKEA 4OK6A 1DO0A 2XOKA 3KJIA 4DC9A 2ZRMA 4TL7A 3TLXA 1NLYA 3AVWA 4R2HA 3Q7PA 1KI2A 5EXXA 3MWKA 1WA5A 4A2QA 1WXQA 1RYHA 4RFSA 2DCUA 1T5IA 1UFQA 3IO3A 1ZCBA 1ZP6A 2QE7A 2AFHE 1M7GA 3HWSA 2HYIC 1LVGA 3V4RA 1OXSC 2O5VA 1SXJE 1DAEA 1LW7A 3FKQA 4L9WA 4P4SB 3X1ZA 4GOXA 1FTSA 2GCNA 4BWYA 2R62A 4JMPA 2YKGA 4I4LA 3T35A 3EASA 2O8CA 1G5RA 1KNXA 2QTVB 3VR1A 5FOTA 2ZI3A 1J90A 3DKVA 5SZIA 4DEYA 1WRBA 1R5BA 3PUVA 3QBVA 1HQCA 1KO8A 4Q1DA 3GP8A 3LBHA 1FP7A 4LOAA 2IWRA 4MYHA 1F2UB 3W9YA 3ZZUA 4DLWA 2YJTD 3TIFA 4NH0A 2DY1A 5IF9A 3PUWA 4B3DA 2B7BA 3PUYA 5KHOC 3FOZA 2GJKA 1FZQA 3EZ6A 2G88A 2A78A 4EPTA 3DL0A 4JLOA 2WWFA 3Q5DA 1NSFA 2JIZA 1JQJC 4HB2A 4BFYA 5GVRA 4F4IA 1EESA 3AVYA 1CJMA 4TLBA 1KGDA 2ZXUA 3GLIE 1RE0A 3IEUA 1RFLA 3AUYA 1VYVA 4OBEA 4FXPA 2VP4A 1SVKA 3IILA 4V0OA 1QHYA 1IM2A 2NO7A 1Q12A 1DG1G 4WBSA 1G3UA 1H8HA 4MRPA 4NHOA 2HCJB 2JJ1A 3JZMA 5FOVA 5B58C 1G7CA 4Q5IA 4Q1BA 4PPGA 2BIFA 2HT1A 1XCGB 2NO9A 1N6OA 1OXVA 1FNNA 1SZPA 1VYTA 3PUZA 4NYIR 4PC1A 5E95A 4A0HA 1G4AE 2EFEB 1FFHA 2MSDB 3CB4A 4B6EA 4F38A 1DO2A 1KSGA 4PFSA 3KL4A 4FMDF 1AIPA 4D2IA 2CEAA 1CS4C 2RCNA 4EJSC 4BGDA 2OG2A 1YR8A 4AKHA 2IEYA 121PA 5AUOB 1HUQA 2F1HA 1XD2B 2I4IA 2Z4SA 3KDSE 3EG5A 2Q6TA 1UAAA 5EE9A 1F48A 2IT1A 5FTMA 1Z6GA 1F3OA 2G0NA 3E5HA 4Q9LA 5EE0A 1IN7A 2NGRA 3OF5A 3DHWC 3LXRA 4AI6A 1YZGA 5FPYA 3PJRA 5DGXA 5FPTA 4XWOA 1DAIA 3W34A 4GRAA 1OHHD 3C5CA 2FSIA 1TU3A 3AF2A 4JLKA 4Q7LA 1YKSA 4K81B 4R7ZA 2XSZD 5HCNA 2VSXA 1OYYA 1Y63A 3TSOA 3K70D 3B1WA 3VHLB 4DSTA 3K0SA 3FTQA 3MWYW 3PEWA 3NDPA 1XMVA 4C2TA 2GZAA 2C03A 2EFCB 4Q7KA 4AKGA 1K6MA 2D62A 2FSGA 2IWHA 5JS7A 4IW3B 3P20A 4LHZA 4OJKA 1DOAA 2AKAB 4PR0A 2ZE5A 2IUUA 5J4YA 2Z43A 5JFGA 3EWAA 2PCJA 3J81k 1L4UA 3KQUA 4PXAA 3C7KA 5A0FA 4C0SA 2QGNA 3KUDA 2OCBA 4LBYA 1S3GA 3K0AA 1NIPA 1Q1QA 2G1KA 2F3TA 5CB6A 4CEJB 2FOLA 1NY6A 2ECKA 5IK2D 5JJLA 1T3HA 2AN9A 3FMIA 3SJZA 2ZSFA 2XSZA 3K0EA 3MJHA 4NYIQ 1NG9A 1D9XA 2V54A 3D31A 4AD8A 5KDLA 2ERXA 1W49A 1NSTA 1E96A 1SQ5A 3DDCA 3N2IA 1X8JA 3TGPA 1OE0A 1A82A 1KDOA 2EYQA 2GTPA 2FFQA 2O8EA 2JLZA 4DB2A 3PEVA 2AR7A 5BN4A 1T9HA 4C30A 2DWPA 2JJ2D 1G7SA 3U3RA 4ASUD 3REGA 3FHCB 2QENA 4LPKA 4TMTA 5JRZA 1DVRA 3DZDA 3JVUA 3GFTA 1W2HA 2GVDC 2RHDA 4PAQA 5DI9A 1P75A 5KO2A 1N0VC 3HP1A 3TH5A 4XWAA 3HR7A 1W0KD 4BFZA 4Q7JB 4AIIA 5FI1B 2A5DA 5FTNA 5CLQA 1NRJB 5DHFA 4K8OA 4BFTA 3UPUA 3PR1A 4PZZA 1XB2A 2H92A 2VL7A 4KFTA 2BV3A 3X1DA 4YMSA 4AYTA 1AZTA 2HJGA 2Y8EA 3CW2A 2WV9A 4C7OA 1O3YA 4MITA 3V00A 2FE4A 2RGBA 4LUCA 2ZE8A 1XTKA 2EW1A 4PO9A 1P2TA 1JECA 2F9LA 4QBHA 4B2LA 2PL3A 1JI0A 5ANRB 3BWDD 1E9CA 2QT0A 5KDDA 2XXAB 2PEYA 3THXA 5A4JA 1E1QD 4TSFA 3RS2A 3VMFA 3X2SA 2FX3A 2V1XA 4MQBA 4ZDJA 2AKYA 2GEDA 5EE5B 5K8UA 2XB2A 1X8KA 5HKKA 4DSNA 4TLDA 2IXGA 1KKLA 1KYIA 1HV8A 3A58B 5IDVA 1KKMA 4JLAA 2JGNA 2ZSDA 3W3ZB 5BYKA 3QF4B 1OIXA 1XPRA 1QHNA 2ZYWX 2RGNA 4KBGA 1ZU4A 2YZ2A 4WXRA 1D8TA 2F43A 4OHWA 4B35A 2XNDA 1XEWX 3TRFA 2XJ4A 3LQRA 3LVQE 2IS2A 1VIYA 4FMCF 2G3YA 3UK6A 2GJ9A 2GF9A 1U2RA 5JHHB 2LKDA 3GLHA 4LHYA 4BLPA 1G8HA 3N70A 1TUEA 3Q85A 2ONJA 3WXMA 2XITA 2C8VA 4BUJA 3AP3A 2GXUA 2ZRCA 3U3KA 4LBWA 4FCTA 4US2R 1FOEB 1JPNA 221PA 5FR2A 1G19A 2HDNB 2WKRA 5FR1A 3AP2A 5JECA 2JATA 2QPOA 1ZUHA 2F6RA 2WMNB 1DS6A 1E0JA 2AWOA 1Z83A 3FMFA 3OFND 1X86B 2OAQ1 3OEED 5EXTA 4QG7A 1MO5A 3G0HA 1E2QA 1U9IC 1X1SA 4NCHA 5L3SB 3LLMA 4Q1EA 4O3MA 3T1TA 1KOFA 3ICEA 4G1UC 3U5ZB 5K8LA 4OL0A 1P7CA 2H18A 1CRPA 1W4BA 2QROA 2VSFA 4AURA 3BORA 2ZM5A 1SVLA 2L0XA 3W90A 3T34A 3WP0A 1XXHA 5JJIA 4G5QA 4QGGA 2OBNA 4B71A 5JCPA 3CR8A 1B23P 2P3SA 2OBMA 1Q57A 1XBTA 4FN5A 3BRWD 4TT3A 2IHYA 3M4YA 4B2IA 4V0ME 1M6NA 2Q9BA 3O8BA 1E9BA 1NN1A 3HPQA 4NCNA 1WE2A 3K8YA 3IDQA 3FGNA 4HLCA 4R9UC 3MUFA 3FE2A 5CYPA 4TYPA 1X8LA 2Z6VA 4RFVA 3CRVA 2JLVA 3GJ7A 2VHJA 4AY2A 3CZPA 1AQUA 3HU2A 2PT5A 2WWGA 1NL3A 4IHQA 2GEUA 1CXZA 3WHLA 2WIBA 3IKJA 5L8VA 3FPAA 3U7EB 4LI0A 2PMDA 1RJ9B 1W5SA 3RLFA 1BKDR 2O8FB 1XZPA 1OIWA 4YLGA 1F2TB 4IVQA 1A4RA 4MDFA 3QI2A 4JLBA 1N5IA 2N42A 4QKQA 2KSQA 2REXB 2IW3A 3BS4A 2JCSA 1FP6A 2F3RA 3L0IB 4F4JA 4UNQA 4NYMQ 2ZITA 2GBLC 1KIMA 2ZI7A 3BIFA 3C15C 3SNHA 5K8IA 4GMDA 3CNOA 3AKYA 3FYHA 3MAAC 1NN3A 3LQQA 4OHXA 4ACBA 4FWIB 4QJ3A 2IYXA 4KAXA 1RC8A 1M7BA 3ZD6A 4TL8A 3HYRA 3TSZA 1GDDA 4HLQB 1E1RA 2ZS9A 4LJ4A 2GNOA 4GT1A 3B60A 4KJZA 1OFTA 1GKIA 2DBYA 1RKBA 3ND8A 4LRWA 4RD1A 4TQUS 1XEWY 3KQNA 1PV4A 3X1XA 1W47A 2W83A 4Q1CA 3U2QA 3CX8A 2Q21A 2QUZA 1QG2A 4QGFA 1XMSA 2IBMA 3QNUA 3QXHA 3T12A 1GFIA 3LFUA 3LH5A 5L3RA 4ZCIA 4M1WA 2ODBA 4M9ZA 3D6TB 4GBMA 1Z0JA 3IQXA 4LHWA 5CB8A 1AGRA 1F5NA 3UG7A 1AZSC 4YXWD 2QQEA 3CRW1 1Z0IA 4CT4B 4LJYA 1E9EA 4LSGA 2HF8A 3O8DA 3IPYA 1JJ7A 1QRAA 2CL6X 5F98A 1YZTA 2GZHA 3VR3A 4M1MA 4C7OB 3QXCA 3K09C 3NXSA 3TUZC 3LW8A 3KKMA 1KHTA 4KSCA 1RRPA 1IY0A 1NVUQ 1G41A 1R8SA 1XF9A 3P32A 4GZLA 2W2VA 4BZPA 4F7WA 5LPNA 3GLGE 4IRUB 4MYCA 4Q9JA 3TE6A 5DO9A 2BVNA 4JLPA 4ZIRA 5CITA 3MG9A 2X77A 2V7QD 3GLFB 2E9SA 4Y0AA 2D7DA 1BMFD 3NTUA 4LGMA 4A0RA 1UKEA 3R7WA 1VECA 4BFXA 2N46A 5HCIA 3WBJA 5DHAA 1D2NA 1EFRD 1KDRA 2CLDX 4YMVA 3OEHD 2QRZA 2RGEA 4A6PA 4O25A 3CPHA 2BMDA 4PQFA 2EVWX 4D0LB 1J8MF 2QM7A 4MGYR 5FOSA 3L0PA 3K9LA 2ZS8A 3CUEF 3OESA 3R9WA 2AX4A 2GKSA 1GKYA 1KI6B 3JVVA 4WW0A 3RS5A 2A5YB 4CEJA 2H7VA 2CHQA 3Q72A 1JR3D 4E22A 4QOSA 2ZRFA 2OFXA 1KK0A 4URVR 1XRJA 4Q19A 2DB3A 3AEZA 3NBXX 1N0UA 4E09A 4Q00A 1S9DA 1E6CA 1EFUA 1TQ4A 3B9PA 5DYIA 4Q4JA 1VCOA 4JLVA 1N5KA 4IXNA 4OYHA 1D6JA 4XOIA 5LB4A 5TB5A 3BFXA 2R9VA 1JJVA 1H65A 5KU1A 4HATA 4PO8A 4PPNA 3W6NA 4D6PA 1YJ5A 3ZH9B 1XWIA 2ODEA 3K9GA 4IDHA 3UWOA 1E2KA 1ZRHA 2Q9AA 4JT2A 2DWQA 1A2KC 4RJLA 3L2OB 1NJGA 3B85A 4H1VA 4IOMA 3CO5A 4MGKR 1KI7A 1N3BA 3IO5A 4GMXA 2QBYB 4CEHA 2DFLA 4A9AA 5AUPB 3H2YA 4ZKDA 2OV2A 5BN3A 4RD3A 2YOFA 1GRNA 1NY5A 2FFAA 4GFDA 4QBGB 4C0JA 2XOKD 2O52A 2ATVA 2IYUA 4DB4A 1NN0A 1DAKA 3AH8A 2ORWA 2XZLA 2OZEA 4PHTA 3MMPA 1VKJA 5CM9C 1GSIA 3RNLA 4EPVA 3C5HA 1S0UA 1W48A 2CVHA 2W2XA 4DIDA 3QEJA 1S9HA 2JJ8A 1G3RA 2V3CC 4P4TA 2W6JA 3QQ5A 3WBKA 2V1UA 2FFHA 3KZ1E 4EIWA 4B3GA 4AWXA 5TV2A 1OH8A 1W2GA 2H8KA 3PV0A 5HE8A 3SDZA 1E9RA 1W4CA 4PAMA 2ORVA 2J0QA 1R0WA 2R44A 2WTUA 3BBPA 1FQJA 3LW7A 1XZQA 2C78A 3GJ5A 2A7QA 1FUKA 3Q5EA 1FNMA 4US1R 1LF0A 4OHYA 2NTYC 2H57A 1QHGA 1M1YE 3QPVA 2QP3A 1N0WA 3CZQA 2FSHA 4V0LA 3THYA 1JXOA 4EQ6A 4M1KA 2ZPTX 1VHTA 1AS3A 2E87A 2WPDD 4JSYA 4DDUA 2XEXA 5H8WA 3H0KA 2BC9A 3U61B 2IYWA 5JI2E 3TUIC 2JAQA 1G7TA 2AWNA 2R6CA 1P3JA 4ZO4A 2ZRAA 3BB3A 2A3RA 1U0HC 2ZJAA 4TZ6A 1E2MA 3CNLA 1Z6XA 1Y3AA 3A4MA 5EXSA 2YOHA 4FW9A 1S4QA 2REOA 4IXMA 4NCIA 1F60A 3NC1C 4DLZA 4B48A 3LA6A 4KFSA 4PSKA 3WHKA 1E9FA 3V9PA 4GDFA 3DZ8A 3NBZC 4A8JB 4TTPA 3VR6A 1KZ7B 2IYVA 4IKEA 3T1QA 3TR0A 1GG2A 1L4YA 1QVAA 2G9NA 2WOJA 1K5GA 1AGPA 2ZJZA 4M1SA 4GOJA 1UBFA 3LD9A 4Q01A 4HAZA 4LPSA 2WM9B 2D2FA 2O0JA 2IS1A 4TMVA 1E2NA 2DHRA 2PX3A 1OH7A 4GSYA 4H1UA 4LV5B 1NVXQ 3RS0A 4NONA 3SYLA 6Q21A 4TMWA 3RS4A 4RZUA 1A7JA 3Q3JB 1XNJA 5CK4A 1CJUC 4UQOA 2BEJA 5JI3E 3GLIB 1LFDB 2CVFA 3G82C 4LBZA 3W8RA 1EGAA 1CU1A 2ZREA 3RC3A 3KJHA 5FTKA 2DFNA 2C5LA 1G5TA 4C0HA 3WP1B 2G83A 1U0LA 3SOPA 3NIBA 2BKEA 1XD9A 5J47A 1GL7A 4KFRA 2GK7A 2QSYA 3NKVA 1XDBA 3ZVRA 1HEIA 4PTLA 4MKFA 2DFKB 2PJZA 1T3LA 1ZBDA 1W5TA 2RMKA 4K46A 4EPYA 4GI7A 4WZ6A 1E2DA 4Q9KA 3O8CA 3QOFA 4WZBE 1NP6A 4TYWA 1D2EA 3LDAA 4B3FX 5IK2A 4D4JA 3ZS8A 4MUBA 3AVQA 4RD0A 5DH9A 3D8BA 4O2LA 2FGKA 3EZ2A 4TLCA 3S1AA 2FFBA 3BFKA 1Z47A 2C9OA 3SEAA 2A5JA 3CWZA 4MGIR 2BMEA 3QKSA 4U00A 3OIWA 5CIWA 4HDOB 3ECCA 5SZJA 1NLZA 1RVDA 2ZYVX 4GOKA 3TBKA 2GJSA 4QM6A 1Z28A 1FQKA 4A8JA 5LD2C 5DYGA 2JLYA 3AVTA 3QVUA 2RGAA 1HH4A 1GP2A 2YHSA 2ZRGA 3WNCA 4ASUA 4OKSA 2VLIA 5UKDA 4B43A 4OHVA 3B9QA 2ZR7A 5LD2B 2Q3HA 1GL6A 2OFOA 1JR3E 4TMXA 2WAYA 4CW7A 1CJVC 3KQHA 2ZRIA 3KQLA 3OIYA 2CCGA 3GPLA 3ZYCA 1I4TD 2VHQA 2J87A 3EXAA 3R9XA 3VKHA 1G6OA 4KYUA 2RAPA 1O87A 2Z0MA 2QAGC 3BERA 3MD0A 2ZRJA 4V0MA 3BH7A 2AHOA 3B78A 4HLUA 4W5JA 5JEEA 4R2IA 1E32A 2F1IA 1NF3A 2QGZA 5FBWB 2J0SA 1OPXA 2GRJA 3FHTA 1Q1BA 1UDWA 4C4PA 3PQCA 3AKCA 4B74A 3MCAA 2TMKA 2IC5A 1ZAKA 3HR8A 5J4VA 3W3AA 2F1RA 1EFRA 2P67A 2H1LA 1Z3IX 1X1RA 2D4HA 3KKQA 2VP6A 2I1VB 1ZM4A 2FG5A 2V6JA 4Q18A 2E1RA 4V0NA 2VH5R 1MO3A 2HLDA 4DBLC 4YMTA 3AB3A 5BYJA 5CIQA 4BQSA 4C2UA 3GFPA 4W5HA 2V7QA 1EFHA 1W1WA 1G18A 2X8AA 5AUNB 1AQYA 2HYDA 3H86A 4UNNA 4URZR 3B1XA 3GLGA 1OXXK 4GZMA 3UIEA 2B8WA 1L7VC 4NE2A 4IOJA 3NEJA 1N6KA 3FKSD 3LLUA 4DSUA 2RGXA 2RHMA 1XTQA 1D9ZA 2BDTA 3R8FA 3F3YA 4QJ5A 1FPMA 1IAQA 3NVAA 1R8QA 5FI0B 1VCNA 4NBSA 4V0KA 5JLJA 1ANKA 2O8BA 2VP0A 1G3QA 3QVVA 1CR0A 1NMYA 1ZNYA 5EJEA 1IN6A 3AM1A 4CEHB 4FMDB 1GITA 5FUWA 2WJIA 2WWWA 3CONA 1DBSA 1KI1A 1CJTC 2FPLA 5BQ5A 3WY9A 4A4DA 1GNQA 2CLSA 1PZNA 3L0OA 2UVQA 4DRZA 1IY2A 1I4LD 2QEQA 3QKSB 2X2FA 1KJWA 3QF7A 2PZGA 1RJ9A 3BB1A 2CHVA 2RB4A 4XD7A 4BLOA 1J7KA 1ODFA 4Q4JB 4U5XA 2XAUA 3TAHA 3VU9B 1E0AA 1P4SA 5FL7D 4QBFA 1Q22A 4ILEA 1YU9A 1ZUIA 1OB2A 1R2QA 3AF1A 3PEYA 1WMSA 2R2AA 1IBRA 2J0UA 4MRSA 4Q66C 4DLYA 5GADl 5FL3A 4HUQB 1GIAA 3IIMA 1IONA 4TLEA 2FN4A 3WNBA 5KSPA 3G5UA 2GCOA 4D82A 1DAGA 1TEVA 1W46A 1SVSA 1W0JD 2ZTSA 1IJFA 1P2SA 4PZLA 2WIAA 3KKNA 1KI6A 3LAWA 1DE0A 4MRNA 3U6BA 4MYUA 4CRWB 2QT1A 4ZIRB 2ZROA 3WMGA 3AF0A 1II8B 4Q4AB 1FMLA 2ZVPX 2PZFA 4P0TA 3R7WB 5TMPA 5J5CA 2HUPA 2D06A 3ZVMA 3VFDA 4HZUB 3QBTA 5AJVB 2JLUA 2ZAOA 4OI1A 2ZQ5A 2WPDA 3BK7A 3PVSA 3GJXC 4RKFA 1RRFA 5FTLA 2XB4A 1SVMA 3SI7A 3EWSA 4QRHA 1Z08A 1R0XA 3M6AA 1ONBA 3AUXA 4JVNA 4HLUC 2IS6A 3GJ3A 1COWD 3TK1A 4Q9HA 1G64A 5DI3A 3FHOA 2MSCB 1A5TA 1VCIA 3OZXA 5EQTA 4IDNA 1C1YA 1Z6YA 1PLLA 5SZKB 1BOFA 4R98A 2OE2A 1LV7A 2MSEB 2FPMA 3WRYC 1EX6A 3UKDA 1GRQA 1YR9A 2REBA 1MRSA 5IHPA 4MUAA 1YZQA 2OT3B 2A5FA 4FI3C 4IVRA 4OI0A 4UJ3A 1R10A 1UF9A 2V9PA 3GLHB 4N1AA 4Q02A 3HPRA 4JLDA 1E0KA 3VKGA 5H1YA 1J8YF 5JCZA 4EPRA 1R5NA 4XSHA 1OFHA 3EPHA 4JLJA 3LV8A 3W6PA 3B1YA 1T0HB 2CL0X 4D0NA 1BH2A 1QHXA 4B2PA 3EA5A 3ZVLA 4EFMA 2GAAA 2J9RA 1G3IA 1CKEA 2XTNA 3ADBA 2RGDA 2JLSA 2BBOA 3T15A 3ADCA 5GJWC 1GOTA 2B8TA 3BFVA 3CX6A 5BW8A 2RKOA 4BLQA 3BAFA 3F8TA 2HT6A 1XEFA 4US0R 2G77B 2GWHA 2GJ8A 3NBFA 1OIVA 2B6HA 1M2OB 2OBLA 3IBYA 2AD5A 4LZZA 3B1ZA 3P26A 5E4FA 5EE1A 2FJUA 1PUIA 3QKRA 1E0SA 4FCWA 4ON9A 1E2LA 4QBIA 3W5JA 3IEVA 2WAXA 5J4KA 1Q3TA 4BE7B 4JZKA 1M7HA 2W0MA 1NG1A 2O8CB 4IEIA 1KI3A 4WA7A 2QPAA 2RGGA 4YXWA 1HE8B 1I2MA 3L8ZA 1L8QA 5F9FA 1OKKD 1T3SA 2FF7A 2OXCA 2ZU0C 2B92A 1U90A 4G0NA 3MWLA 3OAAA 5LDDC 3KUCA 3AGQA 4IFBA 2J1LA 3A1WA 3ZIAA 3ZDQA 1CTQA 2G0TA 2OXRA 1H8EA 3NH6A 4QJ4A 1CEEA 4JLMA 4TYNA 5G3ZA 1E94E 4P4SA 1JEEA 4HDQB 2KI5A 3GQBA 5CYOA 2GBLA 3SYNA 4EAQA 3SQWA 2ZI4A 2PLRA 2QTFA 1BS1A 4M22A 4KSBA 2D74A 1AKYA 3D3QA 3B7GA 4L16A 1JQLB 1QHSA 2ZI6A 1HT1E 1QVRA 5KNDA 2BBSA 4BRWA 4L8GA 1SXJB 3D7MA 4CT5A 1W0KA 5GJCA 3LRPA 2PX0A 1XJCA 3E70C 4JT4A 1E98A 4JL8A 1WB9A 2J3EA 4BASA 4LWZA 4II7A 4TL9A 5E7IA 1JBKA 1TF5A 4OQLA 1BMFA 1G17A 5TY0A 3TVDA 1CLUA 4EDHA 4A82A 3ASYA 2LCFA 2PJRA 3KTAB 1P72A 1P73A 4LC1A 4BEJA 4E03A 2HV8A 4LX0A 2YYZA 2ZI5A 4TYQA 1P5ZB 4HAYA 4ARZA 4A36A 2QMHA 3AV0B 4WVFA 1I2DA 3TVTA 5EE3A 1QG4A 2QG6A 1ZU5A 1QDEA 4W9MC 1P9NA 3ICQB 3GLGB 5B30A 1EFCA 2Q0HA 4NYJR 1JR3A 4QHYA 1P60A 3GLFE 3LXXA 4YONB 1KI4A 1YRAA 3NWJA 4BFWA 2F43B 1TAGA 5FUXA 4DSOA 3NHAA 2HXYA 4QNRA 2VEDA 1KJYA 1N5LA 4G5RA 3L82B 4H9GA 4URXR 2EWWA 4N0DA 1QF9A 1GWNA 4FWTA 2DR3A 2WSSD 3LX8A 3SFZA 4B34A 3GJ0A 5BWMA 3SFVA 3W5IA 1NMXA 5EUMA 4ZCMA 1CIPA 2B7CA 4ZI2A 3LX5A 4OK3A 3NBYC 2R6FA 2YWGA 1UDXA 2BHRA 1SHZA 4GNKA 3A4LA 1CJKC 3LWNA 1N25A 3I92A 2VHCA 1QBKC 2NO1A 5JS8A 3CIOA 4JS0A 2VRWA 3JZAA 4KLNA 4M8NE 5L3QB 2A9KA 3B13B 1FW6A 3ETLA 4GP7A 3QIAA 4G5SA 4M9QA 3OE7D 1E2IA 2OESA 2VIIA 1VDZA 2BM0A 2P65A 4WOPA 3FWYA 5L3QA 3L0SA 5AJWA 1HY3A 2IYQA 2BM1A 2QMUA 2WJGA 3EA0A 2VHUA 2ZE6A 3CH4B 3GMTA 4G5GA 4G01B 2ZEJA 4OHZA 3AQ4A 1JR6A 1NBMD 1M34E 1Z07A 4PQRA 4JYBA 5CJPA 1FTNA 1G8PA 1UJ2A 1ZM9A 2QL6A 2ZI9A 4RY2A 4P32A 4V02A 5LB2A 3RRYA 1AKEA 3UMSA 3ZVNA 4JJKA 4X8LA 2WJVA 2ASEA 4NL4H 5B57C 1IJEA 2VBCA 4D4KA 2VYFA 1FX0B 3V4FA 1DAMA 3K0FB 3TAUA 1GNPA 1N6HA 4HAWA 2JJ1D 4UXJA 1GKUB 1UKVY 4D25A 5JSZB 3BE4A 5CM8B 4R71A 3SJCA 3I5YA 4BFVA 3NEYA 1CRQA 5EP1A 2ZJ5A 2FZ4A 4F4CA 2YC4C 4TYYA 1KTVA 4GPTA 4ESHA 2WBLC 3VKWA 3REFA 1A1VA 3AVVA 4DVGA 3ASZA 3IBGA 3EZ7A 3GEIA 4Q7MB 1R0YA 3SQXA 2NQ2C 2OFWA 3CLVA 4DLUA 3BJIC 2D2EA 1ZIOA 4I99A 2QA5A 2GETA 1KI9A 1P9RA 2JDIA 4RVCA 1XMIA 5DISB 3U3MA 4DLXA 3K70B 2BJWA 4KO8A 2OHFA 1F6BA 3QKTA 4Q21A 4D0GA 1OFUX 2J0UB 2QAJA 2I1QA 3K9NA 2SHKA 2WWXA 3FMPB 1ZD9A 4PC6A 4FIDA 2IF0A 1ZMXA 4M1TA 4MKGA 4Q1FA 1EX7A 4E07A 1HYQA 5HR5A 3L8YA 4DEXA 4PQYA 3ZQJA 5M04A 1Z29A 1XCPA 4KVGA 4RD4A 1II9A 2YV5A 4JSTA 1XCMA 4KODA 1LF5A 5AUQA 3PITA 4HUQA 5H70A 1ZNXA 3LBIA 4WZAE 1S3SA 2ZR0A 3WMEA 1AN0A 1YR7A 2W6ID 1OLOA 2X2EA 4HAXA 2QI9C 2FGJA
chains in the Genus database with same CATH superfamily
1LBIA 1O97D 4LDJA 3T7EA 4HQ6A 3TLMA 3PXBA 3BT7A 3BMOB 4FQ8A 3OJLA 1EG7A 1Z74A 4GBJA 2HLPA 3OBIA 1K08A 4BEVA 8LDHA 2DWCA 3NDBB 2PWPA 2CXTA 1SD5A 1IHOA 2QORA 2FPPB 4GSKA 3V2GA 5T6MA 4PAOA 1QGUA 2GZMA 5AJYA 1OBHA 1U2TA 4ZJPA 3C3DA 3WC4A 4D0SA 4U3JB 4ZCSA 3K09A 3IOMA 3K0FA 1A5ZA 3T6KA 4CN8A 4DDHA 5KDOA 1QZXA 4DBLE 2CUZA 4Z4HA 2P8SA 3EQZA 1XRQA 1NKSA 5D00A 3KYBA 3HU1A 3A11A 5FB3A 3ME5A 3NYQA 1OI4A 1RXVA 3WK6A 1ESMA 4WGGA 5FOWA 3RREA 1GNTA 3MTJA 3TZHA 5ALQA 4MB6A 3HMQA 2J85A 3M2PA 1HSZA 4DOMA 3A26A 1X1BA 5G02A 5F1YA 4AMVA 5TX7A 2NTEA 2Q7XA 5CA1A 3UGTA 1F0KA 4FE3A 1NJ1A 3CLRC 4WNAB 4QEDA 1N6RA 2X19A 2AXPA 2C9CA 1KERA 3Q2KA 1MVOA 1POWA 3K94A 3QV1A 1C3EA 3ORSA 2C9ZA 4BLVA 1WQ4A 1XJ0A 4OKNA 2HCBA 1XZKA 1NM5C 4EQZA 1SBHA 1E63A 4UTRA 7REQB 5FUYA 3BXZA 3S70A 2JW5A 3O7MA 4RTLA 4KXUA 1U0FA 3VGPA 1J24A 1O96B 3CZ9A 4KGDA 2Q6VA 4Q9DA 1EQAA 3T54A 2I9PA 2FQWA 5CDGA 2J5XA 4JI1B 1U81A 3DE6X 2L2QA 2VSYA 3QYJA 3VSCA 2H2DA 3KM0A 3S8YA 1H4QA 2CT8A 4M54A 2AI2A 1LEHA 1Y8QB 3U3JA 3Q7QA 1LVHA 4YEDA 5JJCA 4JODA 2VJBA 2OL4A 2WMOB 1LW6E 5H7XA 4HWKA 3TLCA 1FXWA 1ZK1A 2Q5FA 2X5OA 3G2QA 2GK6A 1AX9A 2QN1A 1EUDA 1MOZA 2HMAA 3DBHB 3NU1A 5LQUA 3I12A 1A7KA 2O3TA 4YQFA 1T24A 1U9IA 3HCRA 4EJSA 1KVUA 2G28A 2IY7A 2VOJA 2XHZA 4MH0R 5CDFA 4JC4A 4ARSA 1NVWQ 1NASA 1JFTA 3QWIA 1G7RA 1CC1S 2B4AA 3GLSA 5EA2A 4Q4AA 2EZ8A 3DEHA 4R3WA 3L8GA 3DBIA 1F2UA 1QK3A 4QSHA 4HDSA 2WAOA 3EC2A 3JD4A 3N0VA 1J39A 4RZIA 2R8OA 3FROA 3ZR4B 2R8RA 5A6SA 4FZRA 3CWQA 4DQUA 1T4GA 2GN8A 3PDJA 2HSEA 2O57A 2QG9A 2OMKA 5IM4F 4KAJA 3LHIA 1VG0B 2P5SA 2VAWA 3L0ZA 3H2JA 2AK2A 4MR7B 2WUFA 3BMOA 1FFWA 1L8LA 2I6UA 3HV2A 4Q9NA 4ZEMA 1SKMA 1ECLA 3PFKA 4DSZA 3LQFA 5K0EA 1FB5A 2JRLA 2NXWA 1UMDB 4UHBA 4MQMA 4Y2QA 3T4PA 1ENPA 1EXMA 2DE0X 2X15A 1GL9B 2X7JA 2XWJI 1VIAA 3CGWA 4GVPA 5EJIA 4F2DA 3IOYA 5ER9A 3OJCA 5AO9A 4K2AA 4OH7A 1FYWA 3GRVA 1P5JA 3HWWA 1E92A 1JHDA 1WTAA 4IL5A 1GNVA 5AJZA 1RU3A 1QLJA 1U1IA 5D3QA 2H17A 1SXJA 5L7YA 2CJWB 3GRAA 3LUJA 3PCXA 3S7TA 2HCRA 3AJ8A 2ZGVA 6REQA 1PFYA 3B1VA 4M1EA 4NZYA 3VH3A 1VJRA 421PA 1I5EA 3LPLA 4YP5A 5E9AA 2VXBA 2QIOA 4WN9A 5H81A 3WGYA 4AKTA 1P5RA 1HM5A 2FOXA 5K3BA 4UPEA 3OCCA 5DHQA 1LCIA 5IJZA 1NULA 4GG1A 4TVBA 1NI4B 4DCNA 4B7ZA 3A7EA 2MTBA 2V55B 4QHSA 2W4IA 4QOFA 5C31A 4OXRA 3SHFA 4Z9AA 2NO4A 4FP9A 1K98A 1JLHA 2R1UA 1DRUA 4JBYA 2ISQA 2OP0A 4JQCA 1NXWA 3RC1A 4CU2A 2AQIA 2Q5CA 3ZWDA 2DR0A 4J29A 2QTLA 1ISSA 2XUKA 4ZOCA 3Q7SA 3OQIB 4AY4A 2X0JA 2X0KA 4FDAA 3R5HA 4OQXA 4PZEA 5F33A 2G80A 4W7IA 1UUFA 4DCCA 1APBA 4W5NA 3UK0A 4YX9A 4X00A 3IGFA 3RF7A 2FDCA 1KDZA 4JDPA 4JQYA 3TLAA 4QDZA 4DJTA 3RKUA 4PW0A 4EMBA 1NBMA 5K4AA 4WAUA 1HFEL 1KJZA 3DXZA 2NM0A 1UM8A 3UYLA 3L6EA 4K87A 1YFLA 1XZIA 2JFQA 3B3GA 4RUKA 5I47A 3U4MA 5I7OA 2G71A 2AEJA 1K27A 3PC8C 4KO1S 4Q12A 5DSZA 3RJ9A 4AICA 3H2HA 2B4TO 5EQJB 3B6KA 4IV5A 1T6NA 4X93A 2FE1A 1RQ7A 2F48A 5E7QA 1XU4A 2BSXA 3V3KA 1EFAA 4OB6A 1Z5VA 4OGWA 3KZCA 1S5PA 4XI9A 2BBTA 1YQTA 2JLRA 3OI7A 4MRAA 3VTKA 3ZHRA 1FSFA 3G13A 4HPWA 3VR6D 1FDIA 1O58A 4YCSA 2PXHA 1YAJA 1EM8B 2HV9A 2JHAA 3K1ZA 3K92A 4QBKA 3RSFA 3UCXA 2ZYDA 2PH5A 2I65A 3QI7A 2XR1A 4RHEA 3I9LA 5EWLA 2GAOA 4G2TA 5LUAA 2HPZA 2M9MA 1KH2A 1YZKA 2B20A 2ENWA 1J1IA 3KQOA 4XIGS 1V5WA 2QTHA 2VJMB 3S8MA 4EGCB 3UMYA 1FYEA 3NC4A 2JAHA 4I1PA 1XQ1A 4FSXA 2LRHA 1UXKA 4J3NA 4LXGA 2AA3A 2QRGA 2I8AA 1Y81A 3TXYA 3UV3A 4CF7A 2NYUA 4S1VA 2H9AA 4ZGWA 2WKWA 2YRFA 2O2DA 5ALMA 1Z2CA 1OOEA 1WNFA 3OPYB 2VVTA 4AUNA 1FLDA 1N6PA 5EZYB 4M87A 4DXAA 4A0GA 2BZGA 3DA8A 2FQYA 1QANA 3OX2A 3DULA 2GDJA 3UW1A 2OOSA 3C87A 4PX9A 1HA3A 1TQ2A 1F4PA 3ORFA 4RLSA 1YH3A 1YASA 5BQFA 3SDSA 2O8DA 4KQGA 2I34A 4GM0A 3K70C 1IATA 3GMSA 5A9SB 4XGNA 2OD9A 4BU0A 2J45A 1OGIA 1JAXA 721PA 2PNJA 5CFLA 2VAPA 2I71A 1E4OA 2WP0A 5EVCA 1OZAA 4Y1FA 4ZWNA 3RYIA 5J2TA 5CDTA 4I4TF 2XT0A 1T9DA 1USGA 4X97A 4QUBA 1TM1E 4HDAA 2V8OA 3NFRA 5E3HA 3HUUA 1G8AA 4RVFA 4CCYB 2JLQA 4RLFA 1UJ4A 3KJXA 3VX3A 4R9SA 1YO6A 5EN4A 1K2WA 1U9ZA 2A8YA 2PO7A 1IXSB 3H9BA 4EUSA 5FBKA 2J48A 1MB4A 3PFFA 3ZJYA 2QYOA 3PP8A 1X7YB 2H4ZA 4TUYA 3MLEA 5KJ6A 3GLHE 2FEMA 2DTDA 3E1GA 2W6IA 2FYTA 3GCGA 1S2DA 4I19A 1B8UA 2E4ZA 1OZHA 2P9CA 2DPMA 3CF0A 4M21A 1SCUA 3SX4A 3UPDA 3VYSB 5T4HA 1KMMA 2JASA 4Z3OA 1P91A 4JFAA 1F7VA 4ZYTA 3V8PA 3MGAA 3K32A 4UZSA 2FSSA 3FFAA 1NDHA 1UMCB 2BR4A 2WVHA 3CKMA 3HADA 3P2JA 4N6GA 1W7AA 1M6VB 1D7OA 4RFSB 5EWJA 2F8LA 1TUGA 1HF3A 2AMFA 2IUYA 4MQ4A 4N18A 5KQRA 2VT7A 3WQQA 3M0EA 3HXQA 3SPXA 2IL1A 2JGIA 3Q98A 4FFDA 4XVQA 5ITVA 4OHKA 2I2AA 3PYLA 4B4OA 1JRLA 4Q4HB 1JEQA 1P0PA 2B8JA 3CR3C 4HNSA 1H1LB 3NI2A 3UGQA 5KNDD 1YR6A 3MMXA 1DTWA 3VR6H 3QG5A 4MKHA 1H4SA 3HGMA 1A1SA 3N58A 1WB4A 3ILXA 1WHSA 2PQ6A 4TROA 1A95A 2IYTA 1IEQA 4Q6WA 4IOKA 3HU5A 4M8LA 3VNBA 1ZOLA 2V0GA 2VRNA 1C8BA 4XWKA 2EW2A 2IYEA 2XWBF 4FYKA 4L9AA 1ZINA 4FGWA 5G40A 1R9MA 2C3UA 1ACLA 1MTZA 1RWOA 1SM4A 2IXEA 2VATA 3OZGA 1SVWA 3PI6A 4EENA 4A92A 1P31A 2XNKA 1G8FA 2QXTA 3B2EA 4PEVA 1RPTA 2J08A 3VR0A 4NQZA 1HURA 1XU9A 2O7RA 2F3QA 2YINC 3H11B 3I3SR 2FMXA 3E23A 4CV0A 5F2KA 4DIOA 1XCLA 1A2QA 3PD1A 4BLSA 3OZFA 2CNLA 2C96A 3S40A 4GL2A 1ADYA 1XZDA 5K3FB 1XTJA 4AWAA 1QKJA 1YS7A 3Q41A 4MV1A 5T4BA 5IF3A 1NUAA 2R84A 621PA 1A5SB 3RF6A 1Y4UA 1SCNE 4LVUA 4LAFA 4GKKB 1VGRA 5HTKA 1DKQA 4I9GA 1OPRA 4PHHA 3KYCB 1SUWA 1VIDA 4HEQA 5AOVA 2TS1A 2FZVA 4EB6B 5KQMA 3B70A 5BMOA 3BDIA 1JS1X 1CUUA 4W5QA 3TW8B 2D6FA 4TOIA 2XGOA 3G2OA 2GF0A 3C14C 5C80A 1AU9A 1PQUA 3LE8A 2QR2A 2CLCX 1CB0A 4EYGA 5BW5A 1NBME 3F2IA 4EJ2A 5IKEA 2VHTA 3WGLA 4OI4A 1J2TA 3V1LA 2IJGX 3AFGA 3UAGA 5LBTA 2OXIA 4EWLA 1TEZA 4KLCA 4XX0A 5FOQA 3M81A 1WXHA 2VHZA 3PVCA 2FG7C 3I9MA 4FX5A 1UBKS 4RKEA 5ESRA 1LBEA 1XVVA 3H4VA 1S1MA 3ZGLA 3L1UA 2QX7A 5AT1A 1YJXA 3BF7A 1CZNA 3KBBA 2AB0A 4I1SA 3ZCTA 1PG5A 1UPCA 3IAS1 4HX9A 4JGIA 1AKWA 5E1DA 5H5JA 2D8AA 1K97A 4Y7DA 4Q3OA 2CE2X 1UH5A 1KBZA 2JGDB 3PZRA 5FFMA 4BO8A 4KITB 1KO7A 1CR1A 1IAVA 1V2HE 2FTKE 2ZWIA 4NQRA 5G3YA 2XMRA 4MV6A 5LVAA 2EZTA 2FW8A 3RRZA 5KYYA 2W8BB 1Z4KA 2ZWAA 2Q2VA 3MTGA 3N2EA 4XARA 1VYUA 3VX4A 4D4HA 2O8FA 4PHFA 5DTIA 4OMDA 2R7NA 5T7BA 2OR3A 3TECE 2WT9A 4KMSA 3T7CA 3D0RA 5JDCC 4EI2A 2VZ0A 3VZDA 2FI1A 4HYQA 4RVSA 2XQJA 1WUYA 4Y1EA 4TLAA 2VQSA 2P0YA 4M8SA 1GA1A 2OAP1 2Q0XA 3F6RA 5IM5A 1VCMA 1PLJA 4DY6A 5KVAA 4CIDA 1R12A 5D3MB 3RS9A 5CCXA 4Q4LA 1FU4A 1LS6A 2FSVA 1HLPA 4GBGA 4RHUA 5JAIA 4REOA 1N77A 1F0PA 2X4DA 2QRQA 1FUUA 4M53A 2O9JA 4A15A 4YAUA 2G8LA 2GX6A 2RSLA 5FPKA 1HETA 2FP4A 3JYHA 5TMBA 3IP3A 2WJPA 2EG9A 3K15A 4AN0A 4CQLA 3O8NA 3L92A 4PQGA 1W4ZA 1O57A 4D6YA 2PIDA 3ZQ6A 1F6DA 3D4LA 1MD9A 4HC4A 1Q20A 3QVMA 3ZXUB 4DMKA 4GKJB 1NI3A 1FUEA 5IHXA 1T3ZA 1QWOA 5TJHA 3SVZA 2C8KA 3Q3VA 4RVNA 3GWGA 1EFDN 4YUWA 1NJ6A 1W5EA 1MP0A 3OQHA 5ELMA 2NPIA 2QX6A 4JIGA 3LZCA 3MINA 5BSUA 5CLLA 5BXQC 5DNYB 3PX3A 3D6FA 5FA5A 2ZRHA 4A03A 2WT8A 3ORHA 4ITVA 4A73A 3JYNA 4AG5A 4B4DA 2CWWA 1SUIA 1JE0A 3DDUA 3JAWA 3LJKA 1A98A 2PZBA 3AHIA 1XOIA 2Y1CA 1NUPA 5H3LA 4CXMA 5LM3A 4P7BA 1Q7BA 4JUAA 5CUQA 5HOQA 3E8XA 2B1QA 5G1NA 4DCJA 2DQYA 5AVRA 3I32A 2V74B 2WNSA 5LYYA 4YBZA 1W8DA 3FHJA 1KYXA 4IV8A 1RWWA 2G9UA 2ZT8A 5H02A 5TEWA 4E5UA 3H7IA 1D2MA 2GGSA 3DLHA 3A6EA 4V0QA 5ESDA 1P33A 3UK1A 4LZOA 4DLBA 2GTHA 3TSWA 4D02A 1T13A 3H7AA 3OPYA 3DZCA 3U4HA 1OW3B 2AMJA 3K6RA 1UBOS 3KB8A 4IJKA 4QXOA 3U4CA 4A2PA 1ZIPA 3WZMA 2XTZA 4RV4A 5GAJA 1Y3DE 1ZNQO 2JFGA 4NX2A 5MN5A 4JL5A 1MQ9A 4P9NA 2B4QA 3G89A 2QD2A 3PNVA 1SUSA 3I23A 3OZBA 4CTNA 3IEIA 3M6WA 2XUOA 2QRNA 4F2HA 2VF7A 3AV3A 2DM6A 2VBFA 4O0MA 4R05A 5TARA 2EXXA 2ADMA 4PYOA 4MV4A 4C2AA 1M1NA 1VIMA 3IIKA 1PZXA 1PSDA 1KMHA 3EEBA 3EOBI 4HFJA 4U7HA 2GKOA 3HDJA 4KIGA 2UU9B 4ARCA 1WV0A 3PGMA 3AEKB 1Q14A 3PUHA 1GG5A 2GAIA 1UBNA 2VKTA 3RYTC 3DZGA 2P6OA 3JALA 3ND6A 4DT1B 4ZP1A 4UATA 1JV2B 1FQOA 1V47A 1ZJYA 3MRXA 4RQUA 2KB0A 1KYWA 3IR6A 3PBKA 4JVMA 3FDIA 4H7DA 4F3RA 3S1SA 1C4XA 5EJ2A 2FPSA 2FVXA 1OFGA 3HBMA 1CJSA 5H16A 1NMQA 1HLFA 2ERYA 8ADHA 4B8YA 4WK2B 5IT5A 1AO0A 1PT9A 4QQNA 3A14A 4QPDA 1Z2NX 4QDTA 2YYSA 2J7PA 4RD6A 4WOBA 4P35A 4HNAB 3EF3A 4BTEA 3PIRA 3AUKA 5HUJA 4WH0A 3O2NA 4IIJA 2ONKA 3RPEA 2Q3FA 2QS9A 2PBFA 5CTJA 4Y1RA 3DXXA 3GFBA 4RD2A 3QFSA 1A69A 1G3MA 4G3XA 4FFBB 4N0PA 4F91B 3X1JA 4MS4A 3SBXA 2XCLA 5BN5B 1SN7A 1OH6A 3H3FA 3WK9A 1SXPA 4L4XA 3BQ9A 3QBDA 1CUFA 4W7SA 2GJAA 2HF9A 1TEXA 3RABA 4CR6A 5KMGA 1UZUA 4EF4A 1QIKA 3KPVA 3GUYA 1RRKA 2WM3A 2FQXA 2HF7A 4FBLA 5LKRA 4BNXA 4BZQA 4L15A 3CNBA 4MUHA 4UBJA 1O2DA 3QEOA 1BD3A 1ABFA 2GPAA 2R7MA 1TMKA 2QN8A 4QRDA 2CVQA 4A2CA 3I64A 4I1OA 2PUGA 2DKOA 5I4IA 3VI4B 1E9VA 4HSEA 4MW4A 4RZXA 4FFNA 1P9WA 1R5OA 4Y2UA 3ABZA 4DV4B 1BG6A 1VE5A 3EHEA 3HSSA 2VPPA 4L7QA 2UXCB 4DZTA 4Q15A 4IJ5A 3DVLA 1M66A 1DCFA 4YVFA 4MJXA 1JDJA 1SHLA 4TWZA 4YA6A 3T5MA 4V0RA 1XRNA 2BEVA 2ZOSA 2GARA 3MJSA 3RLIA 2D7CA 3FVRA 3MT9A 5CG2A 4DHWA 3UO8B 3TMKA 1YUNA 1ZNZA 2J09A 3GNSA 1LKZA 3QX8A 1B26A 4RANA 4TKUB 1M0WA 4Z54A 4ZV4A 5C52B 5JC8A 4WCFC 1NW5A 3C6MA 3LO5A 4NP6A 4R1QA 5FBRB 2JRCA 3HXMA 3A6DA 3MWEB 2XLBA 4U7JA 3UT6A 2WE8A 1OQAA 3L18A 1CR2A 2C00A 5SZHB 4QU8A 1PJLA 4JUBA 3VU0A 3WB1A 1YL6A 5IANA 1A2BA 1VPEA 3C74A 5H9VA 1WXDA 2QTMA 1U0TA 4Z53A 1E5QA 3MWEA 5DBHX 1FTYA 5IJ9A 4EKEA 3KETA 3W77A 2UKDA 2XNCA 4LC0A 1ORWA 2WHPA 3ZE0B 3SYRA 3C3BA 1BW9B 4QGHA 5J1TB 2HRBA 1IXYA 2H4XA 3I9V6 2XZOA 4N65A 2EIXA 5LYJB 5J40A 1B6RA 2OG1A 1NW7A 3C6YA 3EK2A 3HA5A 1CX9B 2H2IA 1YB5A 2UYCA 2CBZA 3FYTA 1N1MA 3V4OA 3NUGA 2HBRA 2N0SA 3CXUA 1ZEMA 1U2EA 3F5FA 3PFGA 4IIDA 3ROMA 3WWOA 1PL8A 1SU4A 1YS4A 2FNAA 2W2TA 1G0OA 4KVAA 4I08A 3ZTTA 1U8ZA 1M76A 4EEZA 3QWFA 3Q8KA 2F7SA 1I94B 4R2XA 2X9QA 1KQFA 1Z0DA 3R3YA 3LKZA 3RUEA 2GVNA 4F72A 3O3MB 1RWNA 3BHIA 3V7UA 5JYBA 4MOWA 1M1ZA 4P3KA 2FKNA 5K3SA 3VU1A 3HACA 5C18A 4C4XA 2GNAA 1C80A 4ZI3A 2VTBA 2B5WA 1QWSA 2BFWA 2ECQA 2WJYA 3L4BA 3NGXA 4NU0A 3RHFA 1GAEO 4OOFA 1PE0A 3DHNA 3SSMA 4EUKA 4M9SA 3OJWA 1L8XA 1R18A 4D3YA 5JZMA 1QAMA 4ID9A 2NVUA 4B45A 4ZQFA 3CTMA 5JCXA 1KP3A 4I55F 5BRAA 3PKZA 3TMYA 5BN5A 1QK4A 4PHGA 1KK3A 3II6X 2CB0A 1LBSA 1WDTA 2BELA 1X2BA 1LX6A 1XVTA 2FLKA 3KVNA 4MO2A 2DT8A 3EIHA 1OLXA 2BMFA 5ELXA 4A8PA 1GSHA 4DXDA 5MDHA 3MT7A 1QU2A 2XKKA 1E3IA 4XW2A 5L3VA 1BXRB 1K92A 5AW6A 3U0BA 3VAAA 4Q93A 2XV1A 1T0JB 2CFRA 5DRYA 4AO6A 4K0KB 4FD2A 1HX7A 1VHDA 2W5UA 2HMSA 5DK4A 4OQZA 1SU7A 5AJTA 1NNEA 1VTKA 3PQ4A 4UFPA 4NOLA 1T0BA 4AJ9A 1PJ2A 1T4BA 4IHKA 3KL2A 4ZDKA 4BS9A 1DEHA 2J9YB 2V7VA 2W6JD 4LECA 3ZLUA 2PN1A 1H5NA 3QMWA 3V7YA 2ODWA 4JDUA 3P2OA 3I4FA 1KO5A 2RONA 2V5AA 2ZVQX 3MJFA 3DV0A 4LJ8A 1KU6A 3EW9A 1BHJA 3DKPA 3MERA 4R6XA 4X8HA 1CDEA 3C6QA 3I01A 1R8XA 2VA9A 2DMRA 4M88A 2F9FA 4HK4A 4BZWA 4ZAGA 4LFBB 4S2UA 3V4SA 5ALTA 2ZAYA 3CC8A 3JWJA 5EJ7A 3LY5A 3IUSA 3QUQA 3TTWA 1U2DC 3HBLA 2NAFA 1NTRA 2I22A 2QXUA 3IT2A 3IX7A 2AE2A 1BKSB 4FEYA 2H63A 5EFZA 1UT5A 5BOVA 4BRUA 4Z2AA 2ZSJA 3IP6A 1FFDA 4JXKA 2LR0A 2VTBB 2X9NA 5C32A 2Y99A 5D5QA 3U7RA 3WYFA 3MNFA 2M98A 3CUKA 2BJVA 4TQ9A 3SN6A 4BQPA 4G5OA 5LXTA 4HZUA 2ZT5A 1UJMA 3S81A 2VQFB 2X9VA 1R3DA 3LP8A 3LOQA 3R7NA 1ACJA 3O3NB 3PHHA 2FZ5A 2IY8A 3IUYA 4FMCB 2O8EB 5BN1A 1EDZA 1QUFA 4X20B 4IHAA 2JG3A 2PLFA 4EMSA 5HZMA 1WPQA 3ADPA 3ELUA 3TDMA 2J59A 4Q7EA 3NLLA 1B8OA 3HU3A 2RGCA 1AQNA 1K1EA 3KEQA 5FORA 1IJKA 1J70A 3PDWA 5IJ0A 4OX9Y 4QYSA 4JP8A 5HKLA 3QEMA 3IDFA 3EDQA 4GYKA 4PZUA 3ZTYA 1OU4A 3EVEA 1X70A 3OHMA 4MW9A 4A6XA 3KB2A 4A0SA 1PGNA 1JQEA 2GBCA 4WQMA 4CCYA 3WMFA 2AK3A 1GV1A 3D3EA 5FBLB 4ENUA 5DLQC 2P75A 2WTNA 3A0UA 4WX2B 4I3HA 2HEGA 4TTRA 3K1YA 4A1FA 2FUCA 3QHAA 4X8OA 5FYQA 3K9QO 4D97A 5C37A 2IODA 1JA0A 1YZUA 3MOGA 4E7OA 5JDIA 1Z82A 1E20A 1SG0A 3MTIA 2LIVA 2ZAMA 1HWYA 1KFBB 1B4DA 5DOVA 3WHPA 2WWYA 5IMSA 3EPJA 2BEVB 4TSKA 3IHLA 4FINA 2VDWA 4YQZA 4EDFA 3SC3A 1VYHA 2H07A 1K7EB 3G6KA 5K3CA 3U31A 3B48A 4NBTA 1ZUNB 2GQ0A 2GCPA 5KNBH 1NVTA 4PWZA 2NZ8A 1DELA 1UIMA 4HTFB 4MAMA 5AM2A 3SHWA 1IPHA 3AHJA 5B2FA 5HE9A 3T1OA 5JTTA 3BB4A 1NR7A 3PF8A 4K9LA 4HVAA 2JAXA 2Z83A 1L5RA 2CV1A 4OATA 4YJ2A 3I0ZA 1N9GA 3I2IA 3KSDO 1Z5PA 1XSEA 3G23A 3RAEC 3BDAA 4YJHA 1G59A 3MS7A 1QONA 3OQ6A 4I1VA 4U7DA 2VCYA 1N5JA 3VR2A 3F4BA 4RH0A 4CVNA 5FHQA 2N75A 4HVLA 3A1SA 4W5RA 4HXGA 4WK4B 2G5GX 4Z51A 2UVPB 1OLUB 4JT9A 5CK5A 1J0DA 4LCBA 3ND9A 1BQ4A 1OVGA 2OLKA 2C2ZA 4S0ZA 4U7FA 4XJXA 1L5QA 4I5DA 4IIHA 3FGPA 2GZRA 2UXDB 2BR5A 1E2JA 1I36A 2OB2A 4FMBB 2OOKA 3LTEA 2WUGA 4B4WA 4F3YA 3VDXA 4F92B 1T91A 2JGDA 2H4FA 2V6GA 3P9IA 4LJ7A 2G06A 4P34A 4QFDA 3SBDA 3UJAA 4DQLA 4NYMR 1XKTA 1AKTA 3LUPA 2YWDA 4NICA 1MO6A 1ZI8A 2L42A 1G6KA 2WABA 1KDYA 1MV8A 1MC4A 1W6RA 3UAXA 1KQOA 4J7UA 5JASA 3QNMA 4JKYA 5BW4A 4MVJE 3TSCA 2WQ6A 4RS4A 1OA0A 1NBIA 2R00C 3KQYA 3M89A 5KWSA 1PGQA 4U2GA 3DFFA 3TI9A 5BT9A 5HSGA 1NOJA 4QUGA 3ESZA 3QXXA 3SJBA 5KNBD 1Q6YA 1XV5A 2G25A 4U2KA 3OPQA 5AW7A 1FSZA 5ABPA 1MC8A 3A4IA 1FRZA 3UAOA 1RADA 1CUBA 2PKQO 2XUDA 3FIUA 3FSGD 4PSCA 4OLBA 1NVVR 2R5FA 2C1ZA 1KYYA 1GGKA 4JK3A 3ZGNA 3RC9A 4LF4B 4NZ9A 4ENSA 3QXSA 2Q41A 5DI3B 3SSOA 3BHNA 1Z45A 4AJEA 2XXAA 2VP9A 2AOUB 3JW8A 4NHEA 4NE7A 4OM8A 3L8FA 1E1NA 4JC5A 4XD2A 1RPZA 1LC0A 4N48A 1LSJA 2FPKA 1ZX1A 1RDFA 4CQMD 5JR3A 4KWCA 2BTOA 2RHHA 1HT0A 3W4JA 2V7BA 1LGYA 4QU5A 4TZ0A 4C04A 1FCJA 2F64A 1RVV1 1MN6A 4M1QA 4RY9A 4XLZA 4XVRA 5BVHA 1F0NA 2WHXA 4IP0A 1RZ3A 4IFIA 4YRGA 1NNUA 3M8KA 2AG5A 3O1HB 2QAIA 2RCYA 3EEYA 1FP2A 4UMEA 2JFWA 3AINA 1EDEA 4XTCS 1QPZA 1J1UA 1GV0A 1UP6A 2PEZA 2JA1A 3AVPA 3OE7A 3H8SA 2YZKA 2CXSA 3H4IA 3UKOA 3ZZ1A 1BN7A 3A9WA 3EIWA 2LD4A 1IWBB 3R0JA 4KACA 4H7JA 4RPJA 4EAAA 4MB0A 5C2JB 4FQ5A 1QFSA 1U2SA 3MTDA 5LQNA 4C7XA 5IC4A 5JQGA 3EY4A 2HWXA 1AKMA 2VP5A 2VTVA 2XT6A 4YAGA 3UXMA 2WRZA 4L6AA 3LXMA 4TN1A 3KEMA 5B53A 3D6JA 1PIWA 3RAPR 1JLLA 4S3MA 1W6UA 3CF4G 1XA0A 3DEJA 4HYYA 1IHYA 4U2EA 5LBUA 1SPXA 1JI3A 1UDAA 3KJIA 2YYYA 4OP1A 5T5QA 1WXFA 4JR2A 1NLYA 3VC3A 1FS5A 5JATA 1JT9A 2VHWA 3FPKA 3Q7PA 1XE3A 5KCMA 1JSCA 2HSJA 1WXQA 1S3FA 2A9VA 1GTG1 4RFSA 5AK4A 3HKBB 2HREA 2FHPA 5EWMA 4EEKA 3DZJA 1UFQA 1ZCBA 3QFHA 2ZIXA 4M9UA 5BO5A 2WF5A 4FNGA 3LGAA 1LVGA 3V4RA 1H9BA 1OXSC 1ZJWA 4BAUA 4BJ3A 2W2KA 3SM3A 4H0CA 4LE0A 1FFBA 4NK4A 2ESRA 1A9PA 4ZXPA 3CCFA 3EQ2A 3MW8A 4BMSA 1CB7A 1V8PA 3T35A 1Q6ZA 4CLHA 2I7DA 3EASA 5ILGA 2O8CA 1S89A 1YOVA 2QYSA 3KQTA 5FWXA 1GAWA 1DT5A 2ZI3A 2I2CA 4KE7A 1I9GA 1ZD4A 3BRCA 2V0CA 3FVTA 1EJ0A 5CXUA 4C03A 1HQCA 4L75A 1OV6A 2FSPA 4MCHA 3GP8A 1EX9A 1QZZA 4LOAA 4DLWA 1OI2A 3W9YA 3ZZUA 1JDTA 1UQTA 3NJ8A 3PUWA 3UWPA 4MDYA 5I45A 3OOYA 4BBZA 4ER3A 1M8GA 3AQIA 2MYPA 1O6CA 3DTYA 1FZQA 3B12A 1N4AA 2A78A 3OWXA 3K71B 1V25A 2SBTA 5LP6A 3P0JA 1PK9A 1FX1A 3ESQA 1L5SA 4KRYA 3NBKA 1JQJC 1OR8A 2D2IA 1FS6A 4BFYA 1I24A 4F4IA 4RKQA 1EESA 4K8RB 4C7JA 4PS1A 2ZXUA 3GLIE 1RE0A 2A9FA 1RFLA 1VYVA 1QVZA 1AUPA 4WFKA 3DMFA 3VUFA 2WVAA 2J3JA 2Z8YM 4PZ9A 3WGZA 4UPDA 5I7FA 5K0CA 4V0OA 1WU7A 2KS6A 3PPWA 4R7GA 1Q12A 4DYVA 1DG1G 1ONOA 4E12A 4YI3A 2F8SA 3RT9A 2HCJB 2JJ1A 3JZMA 4KIFA 2VF4X 5FOVA 1M73E 1HOTA 5B58C 5DMHA 5CFQA 1G7CA 2XRZA 1VB3A 2NXCA 1PW7A 3H5LA 2HT1A 1N6OA 4IV0A 1FNNA 4IAOA 2YJNA 3BKWA 4G4SO 1Y1KE 3TD9A 1G4AE 2EFEB 2MSDB 2YICA 1L7OA 1VL8A 3CB4A 2GMWA 2WAAA 1P4AA 1DO2A 1YK0A 1V7QA 1KSGA 4C6TB 3TIVA 4RE5A 4TTIA 4EJSC 2OG2A 121PA 3WV4A 1AKVA 1HUQA 2F1HA 3WK8A 4EP1A 3GA0A 1SXQA 2DQ4A 3H5NA 3KQMA 3PQFA 4KN8A 1W93A 4P7GA 4RZSA 4YQYA 3DJFA 3FDZA 1F3OA 3ZVKA 3E5HA 2NGRA 3NIDB 3OUUA 3TDNA 1O03A 1YZGA 1GTZA 3EYAA 3D4IA 1TYDE 1AB5A 2WFZA 5DGXA 5FPTA 4CI0B 2Y0PA 4HGOA 3G9XA 3A06A 1Y3IA 2BR3A 5J2UA 3OJEA 1G8KA 1HORA 2FSIA 4F4DA 2Z2YA 2VZEA 5JSFA 1Z2EA 1Y33E 1FY2A 3NOQA 4EGAA 5HCNA 2VSXA 2YXNA 1OYYA 4M7PA 5KHLB 4EG8A 2QKYA 3TSOA 3K70D 3B1WA 4GGPA 5JNVA 2R5WA 2QR5A 3NXKA 4NU8X 3FTQA 3KXPA 2YXDA 3MWYW 1TUBA 4MQEB 5FBZA 3PEWA 2QD5A 4J6EA 2EFCB 4L5JA 4R68A 1J0CA 2FSGA 1V5FA 2PYZA 3DKRA 3FNFA 2Y77A 1QNFA 3NAMA 4RIGA 3L7YA 5AKHA 3ZWPA 3EWAA 1L4UA 3KQUA 3R5TA 1GYQA 2PGDA 1I0IA 4NDAA 5E1MA 5E4YA 2QGNA 4LBYA 1NFFA 1JFFA 1KAMA 3DUFB 3DVSX 3AY7A 2BEWA 1KR5A 4CMHA 1Y8RA 3KWMA 1NY6A 1UMCA 4U39A 1F9EA 1YQXA 5TGTA 5ADVA 3X1KA 5IK2D 4BXOB 3P9RA 2W43A 3FMIA 2QLTA 4G1MB 3MJHA 3DAYA 3CJRA 4PE5B 3ODPA 4E3ZA 4WCVA 2V59A 3M1AA 4EHNA 4F0JA 5KDLA 3DMGA 1W49A 3JQFC 4TKLA 1M2VB 1SQ5A 1E96A 1JSZA 3EEFA 1I7LA 3EQ8A 2MYUA 3HKEB 4PFKA 4RY0A 4BV9A 4RTRA 3TGPA 4NE9A 1WLSA 5HF6A 1A82A 5B1SA 2DKNA 1A5AB 3ZHTA 4F9EA 1W1IA 4MEAA 4L4RA 1HRKA 3GUZA 4LXUA 3AWDA 4C30A 2JJ2D 5F35A 3ER9A 1PNRA 4TMTA 2ODPA 1DVRA 2NNLD 3WLOA 2VDKB 4ND8B 5HA5A 1W2HA 4NMLA 1QCCA 1U7DA 2CVPA 4FOLA 2R79A 2Z3VA 2BGLA 1P75A 3FXAA 4PZCA 5AKEA 5BVHB 4PLZA 3TH5A 2KMLA 4BFZA 2VC2B 3LDUA 3ZKWA 4ABTA 1FJHA 1WPGA 1P1IA 5DHFA 1R0LA 4AN1A 1FJXA 3PR1A 1XB2A 3NTQA 4ZVSA 1A2OA 4CKWA 1UC8A 1UBUS 1K75A 2BV3A 3H8VA 2NN3C 3CW2A 3DMPA 2WV9A 4KQXA 4C7OA 1O3YA 2PT9A 4MITA 5CVJA 2AEEA 1ZLXA 1WB6A 2O2CA 5DW3A 1P1FA 2HUNA 4LUCA 1PWEA 1W96A 4X54A 4GR5A 3H2KA 4EJMA 4FNMA 4CQMA 2PRJA 5B58T 2PL3A 3O4IA 1YS9A 3BWDD 1E9CA 1OWNA 2OBXA 2QT0A 4IHJB 4AJ4A 4YDQA 1SXIA 4BO6A 1SC4A 1VDMA 3WGTA 1TKRA 4NZPA 1ZEJA 5A4JA 3X2SA 2R2GA 4IXTA 4EARA 2JEYA 3KOUA 4PBSA 3S68A 2YS6A 1LD3A 2GEDA 2O59A 3BMNB 1IHDA 4KO3S 3MBKA 3GVHA 4AZ3A 5K8UA 3PJDA 4HHEA 4DYHA 5J43A 5DWVA 3RSZA 5BUQA 1C0IA 1KJQA 3F4KA 2BAGA 5JY6A 1KKLA 1KYIA 3THSA 2VQ6A 1NBEA 4DUGA 4JLAA 2JGNA 5LP6B 1XPRA 3QF4B 3ZC3A 1D2RA 2AGVA 4HVTA 4PYKA 2ETXA 1NYRA 1YB6A 2BM8A 2F43A 2O2YA 5ESXA 5CB4F 5K20A 3L7LA 2XJ4A 1VIYA 3PHJA 4FMCF 1QO0D 1H2BA 1P1JA 3HRIA 1U2RA 3ROGA 2NWQA 2LCIA 3EZNA 4RELA 4BLPA 4E70A 1TUEA 2AXEA 1J2EA 1O4VA 5KEIA 1KC3A 4YROA 2CFSA 3K72B 3NGLA 2ONJA 2C8VA 4TMYA 3VSDA 2DPLA 2AW3A 3LT0A 2OORA 3U3KA 3IUBA 4OREX 4OXKA 2DHQA 2FR1A 1JHUA 2R6HA 1BCSA 2C7RA 3ZDDA 5FR2A 1HEYA 3FOWA 4I7EA 3S5UA 2BW0A 3FSEA 3GLTA 1X7ZB 1WCIA 2FB9A 4YREA 1BMQA 3W5CA 3FETA 5GM2A 1LK0A 3OEED 3W2HA 3R7FA 4BO3A 4QG7A 1QGUB 3SMQA 3DE2X 2QUKA 2R8EA 3EVNA 3OCJA 4NCHA 4Y2GA 3GZNB 1MW8X 2W2KB 5ICCA 4ETNA 4Q1EA 1GZ6A 3MJTA 2OVBA 4EZEA 4DV5B 2RIPA 3LL7A 1C29B 3L7JA 1DRWA 3EFOB 4G1UC