2QT1A

Human nicotinamide riboside kinase 1 in complex with nicotinamide riboside
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
189
Chain Sequence
LVPRGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinamide riboside kinase 1
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 58
structure length 189
sequence length 194
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qt1A00
4JVSB 3RS4A 3EIQA 3QQ5A 4BFZA 4BEJA 4M1YA 2W58A 4UNQA 4B75A 3BH0A 3CW2A 3GLFE 2JJ1A 1OB2A 3T12A 1KMHA 3GLFA 3L0OA 5J4YA 3LBHA 3I92A 1P9NA 3A58B 1QHHB 1TMKA 1U0HC 2W2VA 4OHXA 1DOAA 4EFLA 2G83A 3MSXA 3I5YA 1ZD1A 1CR2A 2DCUA 1CJTC 2OZEA 1ZM9A 4CZ2A 3UMSA 3SZRA 3LNCA 2CCGA 1HT2E 1DAFA 1ZNZA 3K0SA 2PZGA 4QHSA 2O8DB 5JI2E 2ORWA 4NYJR 3RS2A 1P75A 3C15C 3F3YA 4JLNA 2QP4A 3T1QA 1XXHE 5AJXA 3E1SA 5FOTA 2VA8A 1US8B 3A4LA 1EFCA 3UMFA 1G7TA 2NPIA 1AGPA 4DBLC 1KI9A 4O2RA 4L9SA 3FHCB 3NH9A 4EJSA 3H4MA 1MR3F 1R5OA 1P9WA 4LBWA 3REGA 4P4UA 4B2IA 3U2QA 3OFNA 4M8NE 2EWVA 2ZRNA 2FSFA 1G4UR 1U98A 4N3NA 4TMKA 3RS3A 3GLGA 4PHFA 5HTKA 4V03A 1ZU4A 2W0SA 4POAA 4PAMA 1E6CA 4YC7A 1G7RA 4Q1CA 5LBIA 2QMOA 4GZLA 4A2QA 3KB2A 4MGZR 4TZ6A 4YMTA 1E4VA 2ZUCA 2ZYVX 4WVFA 3K53A 1W49A 2ZREA 2ZSEA 1OFUX 4NCKA 3TQFA 1BIFA 4RD2A 5CM9C 1FTNA 4PZZA 1Z2CA 3VX4A 1KO4A 4DIEA 5CK4A 2PCJA 2QU8A 2D4HA 4QBGB 5F98A 2L0XA 4OI4A 2R2AA 1S9HA 4HB4A 1Z0KA 1F60A 3D31A 2FFAA 2MSCB 4TL8A 2A5JA 4IXMA 1GOTA 1ZM3A 1TTTA 3CX6A 2BBSA 3HPRA 2JAQA 4FMCB 4DSOA 5FL3A 3GJ7A 4O0MA 3LV8A 1U9IC 4BECA 3BIFA 4N1AA 5H1YA 3OE7D 1LS6A 5DGXA 1G4AE 5G3ZA 1OF1A 1VTKA 4EJSC 3FMPB 4CF7A 4I99A 4QGHA 5KO2A 3RWOA 3DOFA 3B1VA 4F92B 4G01B 3SJZA 1KDPA 3KL4A 1ESMA 5FTMA 4D81A 1D2MA 1UDWA 4FMDF 1JJ7A 1JB1A 1RRGA 1W46A 1XEFA 3W5IA 3UG7A 4RZXA 1MABB 1XU4A 1E9BA 1GFIA 1YHNA 2H1LA 4PC1A 3GPLA 3AVWA 2BM0A 2DWPA 1HA3A 3EAQA 2NQ2C 3CUEF 1YZQA 3B2EA 3W6PA 4A6XA 2IXGA 3RRNA 1GL6A 1LNZA 4GMDA 3TK1A 5GVRA 8OHMA 2GILA 1N0WA 2FJUA 2PX3A 4LJ8A 1E9AA 4A0GA 3MWLA 2H8KA 5JZVA 2G3YA 1EESA 4WW0A 3GEHA 4EPTA 3U3RA 4CEIB 4W5JA 1N6RA 3K0AA 3KJIA 3HR7A 1M34E 2J0UB 4IFBA 1W36C 1E79D 1JPNA 1UBCA 1EFHA 4MRVA 1UBEA 3SE0A 1KO5A 3X1ZA 3NEJA 1X8KA 5DYGA 3ZD6A 1L2TA 3T1VA 4NCJA 2OM2A 3OHMA 1M8PA 2A3RA 4CDGA 4PSVA 2FGJA 4MGKR 2WIAA 1GL9B 3IIKA 2JLUA 3VNVA 1OFHA 3FGNA 5E3HA 1OH7A 2XITA 3KJHA 1P2SA 4HAUA 1NKSA 1XJ0A 1AJEA 2BVNA 3CWZA 2FH5B 5HCIA 4B3CA 2FNAA 2HJGA 1DG1G 2VP0A 2YC2C 3ADKA 3GLHE 1YJ5A 2W6IA 4E03A 4JBXA 4JLOA 3PEUA 2AX4A 1VKJA 2W6JA 1EXMA 5G3YA 3QVUA 2Z4RA 2WJVA 1XWIA 3K1JA 2J59A 3GFPA 1OH6A 4KSBA 4DLXA 4GRAA 4IFEA 2QAJA 5IT5A 4NYMQ 3O8BA 5G53C 1P2VA 2VYFA 1XJCA 3TJZA 2ZE7A 3ADCA 1T3LA 4PO9A 1NBMD 5J47A 4Q4AB 3L43A 3AKEA 3SI7A 2YVUA 4LGMA 1XPUA 5B58C 1VPLA 2QG6A 5JFGA 1FMJA 2REOA 4O2LA 1SKYE 4PO8A 4QBIA 2BOVA 2G1JA 3PEVA 4HDOB 1W1WA 4KFRA 3CX7A 4EPVA 1DBSA 5JS8A 1OW3B 2VL7A 1NVUQ 1R0ZA 4FCWA 3U4QB 3TLXA 1F2UA 3SR0A 2IYVA 2OUKA 2VP2A 4F4JA 2QAGA 3IUYA 1DEKA 4DCTA 1XMSA 2OHFA 4RJLA 1TADA 3KXIA 3ZJYA 1QHSA 3WHKA 1CR0A 5A0FA 5L3SA 5AUPB 1LB1B 2NO7A 3FHOA 2DFNA 1S0UA 4KO8A 4NHOA 3LA6A 4GL2A 3CRMA 1ZIPA 1G8YA 2C95A 2EW1A 2O0JA 4PZYA 1LV7A 4ZI3A 4KLNA 1E1RA 4MQBA 3K8YA 5KSPA 4XD7D 4CYMA 3EIEA 1W0KA 1DAIA 2AK3A 2XJ9A 4LRWA 4PX9A 1YR9A 2KJQA 3LQQA 4OQNA 3S1AB 2RGNA 3IQXA 3JZMA 1W4AA 1E9CA 1IJEA 3CONA 2CNWD 4YXWA 3AGQA 3CM0A 1ZIOA 3SYLA 4PSAA 4DEYA 2GA8A 4UNPA 5FTNA 1IY2A 1SVLA 4RKFA 1RPZA 2HF9A 1TNDA 1LY1A 2AHOA 3CF6R 4QFMA 4KJZA 1RYHA 4LUCA 1WBDA 2GVZC 1XPOA 3PUVA 2VLIA 3A37A 1SXJE 4Q9IA 1DARA 1GWNA 2QPTA 3IEVA 1G7SA 3RWMB 5BN5A 4HLDA 1TQ2A 4HB2A 1AZSC 5EQTA 4Q1EA 1W48A 4MUAA 2C9OA 2QAGC 3TIFA 1WBBA 4IXNA 1HE8B 2GTPA 1NKTA 4DZZA 2JIZD 4JYBA 2RHDA 4BZQA 1GL7A 3LW8A 2HYDA 3A1TA 3FYHA 3LLUA 5IHPA 1SZPA 2GETA 3PFIA 3E70C 1KYIA 2WBLC 4I1VA 2QT0A 3W8RA 4V02A 4GSYA 2R62A 2ERXA 3QXHA 4J0QA 4LWZA 4JS0A 821PA 1X8LA 4PSKA 1JR6A 5EZ5A 4AWXA 2FFBA 1QHNA 2B8TA 1TPZA 4DCUA 2GHIA 3B1XA 3LY5A 1CP2A 3ZH9B 2RGNC 4MRPA 4JIMA 4TMZA 3V4FA 2QEQA 2H7VA 2WKRA 2ZJOA 3CKLA 2A5DA 3UMRA 2XTMA 4A9AA 1N2CE 2CVFA 1GRRA 3HU1A 2F3TA 4IDPA 2GXQA 2QRZA 4LBYA 2QBYB 1Q3TA 4HUQA 1F2TA 2GJ8A 2RGGA 3NBYC 1N5LA 3SU8A 4NCNA 4F93B 3ICQB 2F7SA 3C8UA 3ZIAA 2A9KA 2P6UA 2NZJA 3T5DA 4HZUB 5TMPA 3ND8A 3K9GA 1RRFA 3PJRA 1DAGA 3T35A 3FVQA 2G0NA 5C4GB 1E2NA 4PHHA 1LFDB 2BEKA 1CULC 2FE4A 3SBEA 4GT1A 3LXXA 1G6HA 2ZRIA 3SJBA 4QXAA 3R8CA 1SVSA 4KU4A 1U8AA 5DLQC 2F55A 1NP6A 2C8VA 4WZBE 4RCZA 4B2LA 3ZQJA 4Q18A 4QJ3A 5L8VA 3TUZC 3BE4A 3FOZA 2JEOA 3KQLA 5F9HA 1U0LA 4A8JB 5FUYA 3N2EA 4RD1A 4FW9A 1OB5A 2GXAA 1N5JA 4XJXA 1VYTA 2RHMA 1R0WA 1ZUNB 4XOIA 4Q1FA 2WSMA 4DLZA 1VDZA 2HLDD 3TSOA 4PAOA 1LW7A 1OPXA 3KX2A 4KAXA 2DB3A 4G3XA 3I1FA 1AM4D 1ELOA 5FPTA 3AV0B 2WM9B 3DM5A 4JVMA 1W47A 3DM9B 5EJEA 2DWOA 1RIFA 1U2RA 1U0JA 1Z6AA 3AH8A 1XZPA 3I61A 2VO1A 3B9PA 1R8SA 3FPAA 1N5KA 4NP6A 1R0YA 4QGGA 5FUVA 4EIWA 3B78A 3U6KA 5SZJA 4G1UC 4RZ3A 1RKBA 3RRMA 3RDPA 2NZ8A 4BLOA 2XX3A 5FTJA 1QHXA 2AFHE 2CEAA 3GLIE 4A2WA 3GLIA 3ZGXA 2B7CA 1M1YE 4E07A 2ECKA 5DNYB 1XMVA 3SC3A 2NPFA 4QL3A 3ZQ6A 3B5JA 5AR1A 1W2HA 3O8DA 4D4MA 3DPUA 1G291 4CW7A 3A4MA 2AWOA 4TLDA 4TYPA 4D82A 5C4MA 1LTQA 4M9XA 5DHAA 1E9DA 1Z8FA 2QP3A 2UZ3A 2GBLA 2IYTA 4CGZA 1AS0A 1VG0B 2G0TA 1DAEA 1RFLA 1VIYA 2XNDA 1TQ4A 2Q9BA 3PIRA 2QM7A 3R7WB 1V43A 1G3UA 1G5RA 1D9ZA 5D3MB 1S3SA 2ANCA 4URYR 1HH4A 1JEDA 5G41A 3U7FB 2XOKD 2AD1A 3AVYA 1V5WA 4RFSB 3RLFA 1FX0A 2P6RA 3IPYA 3T34A 3PCRB 3RNLA 1T5IA 2JLZA 1UPTA 1Z2AA 3SYNA 1R7RA 2V4ZA 2ZIAA 3HYTA 4I1SA 3BERA 2O8BB 1E32A 1OHHD 2WSSA 4OK3A 4Q19A 1YU9A 3LVRE 1NLFA 1NN1A 3B13B 4TTRA 3WXMA 5DN6D 3QKSA 1GZSA 4EQ6B 2QI9C 4HAZA 4RCYA 2V7QD 4DSTA 4EPRA 1P2TA 1W44A 1TQ6A 4NBSA 1KI1A 3WHLA 4ZIRA 2GJKA 1JAHA 1QZXA 2DFKB 2YINC 3AVUA 1RC8A 4L9WA 5JRJA 1OH5A 4Q4HA 5B2ZA 4TT3D 4HDCA 4C0BA 3UK6A 4V0KA 3U7EB 3A1SA 5TB5A 1MOZA 3ZZTA 3THYA 1F5NA 2JLWA 1SGWA 3I72A 4IEIA 4Q7JB 1UKVY 5H68A 2GDJA 2IA5A 3I8XA 1IHUA 4LHXA 3ZDQA 2GBLC 3OIYA 1T8UA 4HZIA 1A2BA 1YZKA 1XRJA 3KKOA 1KKLA 4I1UA 1OJLA 4Q1AA 4XSHA 1DO0A 4YMSA 4Q21A 1KIMA 2OXCA 5TXGA 1MKYA 2WJHA 1T9HA 3OIVA 4QHTA 2RGEA 3I32A 5BYJA 2QGZA 1U90A 1XX6A 1KI3A 2WWWA 3AKYA 1FW6A 1IN4A 2D2EA 4TMVA 4LY6A 2D7CA 2ZE5A 4KLZA 2YOGA 2G77B 1N0VC 3BWDD 1ONBA 3AF4A 1WXQA 1P9RA 2C2HA 1ZD8A 4HEJA 2WKQA 1U8ZA 3AQ4A 3U6BA 5AJZA 3P1JA 1ZAKA 4R98A 4PAQA 3VR2A 1DVRA 1G3QA 5JWHA 4G5GA 1FZQA 4FCTA 3I3SR 4N0DA 3WBKA 1HQYE 2YYZA 3TAHA 4ARZA 2W00A 4CT4B 3Q5DA 2CE2X 4TYNA 4A0HA 4UJ5A 4CVNA 2IEZA 4JKYA 1EX6A 4LC1A 1ESNA 2F9LA 2F43A 3CZQA 1AK2A 3M0EA 1M7HA 1NSFA 2X1VA 2FG5A 1DO2A 3ZZUA 2RAPA 2JJ2A 2R6FA 3FMOB 4CIDA 1JR3A 2ORVA 1NY6A 2GJAA 5HKKD 4QJ4A 4DSNA 2J0SA 4DLTA 2ZM5A 4FMBB 4S2EA 3QXXA 3EZ6A 3V00A 2BWJA 4RD4A 3EARA 1OYWA 2VIIA 3LO5A 4JVNA 4W5WA 4EFNA 2QENA 2D3WA 5K8TA 2HT6A 1A5TA 2CK3D 1CF4A 4KBGA 3F5FA 5JS7A 2FU5C 2VBCA 1NN5A 3HDTA 2ZSDA 1KI7A 2AD5A 3OEHD 2DPXA 3K0FB 1WB9A 5HCNA 1CEEA 4BRWA 5JBQA 1W4RA 2WPDD 1S1MA 4Q4JA 4BLSA 3KKNA 3RC3A 5JSZA 4KYIB 5EE3A 1D9XA 5EXXA 3U3OA 2CCJA 1JQJC 4I4LA 3UG6A 3H84A 1KMHB 4DKXA 1M2OB 3GMTA 2C96A 3KJGA 4HSEA 1E98A 3QG1A 2YKGA 3NIBA 3ADBA 3AF1A 3R9XA 1PUJA 1Z08A 4IRUB 1J8YF 3B8HA 4Q9JA 1T0JB 1XD2B 5FOUA 1CS4C 1SVKA 1TL7C 3AKDA 1KY2A 2ZETA 1WDTA 3H1TA 4KVAA 2OAQ1 2QE7A 2PLFA 4PO1A 1G20E 3O8CA 2FWRA 2O8CA 1XFAA 4DDTA 4RD0A 2IEYA 4RY2A 3R9IA 1Z3IX 3BAFA 2PH1A 2VPPA 2CJWA 5FBLB 3BB3A 5KNDA 2CMKA 1OKKA 1OLOA 3QENA 2QT1A 1G5PA 5FH9A 1AKEA 4RFVA 4EJSB 5FI0B 1KI6A 2Z4SA 3UKDA 2XSZA 3B1WA 1E2FA 4PXAA 5E7JA 4LC0A 3IHLA 4ESHA 1D8TA 2HXYA 1Y63A 4ZKDA 1KZ7B 2R44A 3RC8A 3GLGB 4F7WA 1E2EA 3HWSA 1E96A 3FFBA 3QEOA 3LAWA 1HV8A 4FI3C 4EDHA 1YQTA 3DHWC 3LX5A 2O0HA 3EXAA 2XAUA 1G18A 1SQ5A 5FUXA 3EPKA 4IOKA 5BN3A 1IXRC 2RMKA 4GI7A 3UWKA 2IF2A 2FFHA 4HLCA 5UKDA 2XEXA 1UAAA 4DDVA 3OF5A 1Q1QA 1VCMA 1ZJ6A 2RCNA 1E2PA 1OV4A 4Z1MD 1W0JD 4ITRC 5BQ5A 4GNKA 5LDDC 4D26A 2GEUA 2ZJYA 2XZOA 2AXPA 1OSNA 2OCYC 2D06A 1G8PA 1NI3A 2AN9A 2IK8A 1XEWY 2JCSA 1UADA 4V0LA 4C0LA 3AEZA 1W36B 4GP7A 2A5FA 1VYVA 1AS3A 1XMJA 4Q1BA 4LCBA 1YE8A 3CR8A 2B21A 1VCIA 4UXJA 3D3QA 4QG7A 3CO5A 3QPWA 5HR5A 1BMFD 2Z43A 1JXOA 3GD7A 1XXHA 4XVUA 2ZI4A 3L0SA 3EC2A 1Z22A 2GEVA 3TGPA 4HLUA 5BN4A 4HAVA 4ZI2A 2J7PD 3P32A 4I1OA 5EUQB 1ETUA 5KPDA 4KXFB 1W7AA 4GOJA 1DELA 2IYSA 4C7OA 2EYQA 3SJAA 1QF9A 4LJ7A 4YLGA 1HUQA 1E1QD 1S8FA 2QPOA 3VAAA 4B71A 4GDFA 5AJWA 3G0HA 1E3MA 2FGKA 1Z47A 4A0RA 2FSGA 4Q9LA 3W3ZB 3OAAD 2WMOB 4Q1DA 4DUGD 1COWA 2CLDX 4JLVA 2FOLA 3RS0A 5CK5A 4C4PA 2EFHB 1AGRA 1KK2A 2GK7A 4Q02A 1XTSA 4B3BA 3K70C 3K0AB 1P7CA 4PC3A 1A1VA 4OJKA 4OHVA 1FUUA 5F2EA 5FOSA 4B3XA 3A4NA 2ZYUX 5F9FA 4JT2A 2FPMA 2KSQA 2BBOA 2QNRA 721PA 3G82C 2FDCA 4C2UA 2IT1A 3ASZA 2ZRCA 4ZCMA 5KDOA 4TLBA 3AF2A 1J99A 4TMTA 3WYFA 2AR7A 1LVGA 5FOXA 4E09A 1FP7A 2MSDB 4TSFA 2J9RA 1EWQA 4P33A 2E1RA 2NOAA 1ODFA 2ZU0C 4KFSA 2C04A 3ZS9A 2VH5R 1NBME 3MWJA 4R2IA 4AKEA 1N6HA 4G5RA 3VFDA 4DHEA 1N6KA 3CPHA 3CZPA 3VR4A 1FQKA 5TVKA 3QF4A 6Q21A 5IK2A 4N0EA 4ERNA 1OFTA 2BCJQ 2V55B 5J5CA 4A15A 1II8A 1N6LA 2XNSA 5FPHA 2P65A 3ZVMA 3K0EA 2ZS9A 2GAOA 3I62A 4HUTA 4XVRA 2IF0A 1QHGA 4LYJA 2ZRPA 5B57C 2R6GA 4QBHA 4E5UA 2VHTA 2DFLA 2JJ1D 3TSWA 5J4LA 1Q22A 4FCVA 1XZQA 5CDFE 2HDNB 5CDFA 3TVTA 3O47A 3U60B 2HCJB 4U5XA 4KBFA 1E0KA 1L4YA 2CLSA 3CH4B 1VHLA 3B7GA 4P4SA 1XTJA 2P2LA 3KUDA 1ZCAA 2EFCB 1R2QA 1XTKA 4JJKA 5K8IA 1G3RA 1AA9A 2Q9CA 1Q57A 3WBJA 221PA 3PEWA 5HE9A 2O8EA 5JI3E 1F2UB 2WZQA 1PV4A 2HYIC 1HYQA 2VHJA 1E2IA 2QAGB 1J70A 1M6NA 2QMEA 2ZRJA 5E95A 2JLRA 2IYXA 2G1KA 1G5TA 5L3SB 1Z0FA 2CCKA 2BMDA 3NBXX 4XWOA 1RW4A 4WIAA 1E2DA 3U3KA 5EP2A 2P5SA 2VP6A 4DC9A 3QKRA 2D7DA 2O8FA 1VCNA 5FL7A 3ZVLA 1FMLA 1R5NA 4BRUA 1E2JA 3OFND 3Q5EA 4GZMA 2D74A 1EWRA 5TARA 2Q21A 4PC7A 1A7JA 5FTKA 5ANRB 1G64A 5KPJA 4OHWA 3GLHA 4TTQA 3EZ7A 4BFSA 1QVRA 2RGDA 5CYOA 4IW3B 3KTAA 3NDPA 2FF7A 1P5ZB 4UKDA 4PC2A 3TBKA 2ZRMA 1G8GA 2JJ8A 1W4CA 4M1KA 4DLVA 2PL3A 2GEDA 4DT1A 4PZLA 4JLAA 2ZS7A 3WMEA 2J3EA 1TX4B 3W34A 3HU2A 3AVPA 2OCAA 1T5LA 4EPYA 5KNCA 3U7HB 3A1VA 1EX7A 2Q9AA 1I4TD 1O87A 5GADl 3MLEA 1IM2A 2FFQA 4JL6A 4Q00A 1HEIA 1AQUA 1H8EA 3DZ8A 3QF7A 4Q66C 4JLJA 4EUNA 1C1YA 3U5ZB 3AB3A 2JDIA 2LCFA 4MKIA 1T4GA 1W36D 5LD2B 2ODNA 1OXUA 2BKEA 2FSHA 2F3RA 4EFMA 4ZDIA 2XZPA 3IO5A 1I4DD 5K8UA 121PA 1UEIA 4MKFA 3BB1A 4DDWA 3DOEA 2WWGA 1GILA 3SDZA 1KOFA 4MGYR 4BFYA 4OL0A 2VEDA 1TAGA 1NMZA 2ZPTX 3K0CA 3KXKA 3VU9A 2IS1A 2O52A 2ZAOA 1NMXA 3EZ2A 5JRZA 4BGDA 1BH2A 3FWYA 1YRBA 2R8RA 3ZVNA 5CIWA 3WYAA 3QPVA 3ECCA 1NJGA 4FN5A 1E69A 5JHHB 4IJMA 5JWOA 5TY0A 2ZRDA 2DYKA 2PMKA 1EFTA 4KYUA 2V3CC 1OXVA 1MO4A 2BJWA 1II9A 1W5TA 1NVWQ 2GCPA 1BO6A 1SVOA 4RZUA 1S2MA 2IUTA 2VQSA 3ZYCA 4HUQB 5AJYA 4JKIA 1DG3A 4TLAA 2IYQA 1Z63A 4IVQA 1J8MF 4P0TA 4F91B 5DH9A 5GJBA 3AUXA 3TR0A 4BFWA 2WWHA 3GFTA 4Q5IA 3PUWA 3BRWD 4IHQA 4UQOA 1CRPA 2PT5A 1QVAA 2LKCA 2ANBA 1MV5A 2JGNA 3UATA 5HPYB 4LJAA 2W2TA 1K5DA 1FNNA 2DBYA 4CT5A 2ODEA 4LJYA 4MRNA 1GKIA 1XTIA 1CU1A 3CRQA 1PJRA 1YZGA 4KCGA 3QJYA 1WA5A 4Z51A 3KZ1E 1DAHA 1SXJA 1OXTA 1E9EA 4P3YA 5FPYA 2CVHA 3NC0C 3OZXA 1C4OA 5CB6A 4PQYA 2IUSA 5CLLA 3EASA 3TRFA 2CXXA 4CEHA 3K0CC 4HB3A 4C0AC 1U8YA 1KDRA 2IBMA 4I81A 2JASA 4K8OA 1MO5A 2QM8A 4JSYA 1ZP6A 1F48A 2H17A 3FMIA 4TWZA 4ZCLA 5A5GA 2ZI5A 3FFAA 3VNUA 2YWGA 2QSZA 2B7BA 1PLKA 2V1UA 1Q12A 3EX7C 2HV8A 2D2FA 4NCHA 1XTRA 3RVBA 4PANA 2W6ID 4LV6A 5CYPA 2I3BA 4FMDB 4JVLA 1M7BA 2W6JD 1N5IA 5H70A 1GAJA 4QM7A 3GQBA 2CL7X 3E5HA 2H92A 4HDQB 4AK9A 3KQUA 3SFZA 3BGWA 4OK5A 1ZVQA 3WY9A 4URWR 3M4YA 4DJTA 4IDHA 1G1MA 3DMNA 5SZIA 2ODBA 4BE7B 3U4QA 5FUWA 4OKSA 5EP3A 2FX3A 2W83A 1Z5ZA 2YOFA 4UNNA 5C18A 3ASYA 1G41A 3KKQA 4JLKA 4TYWA 1XP8A 3QIAA 1JECA 2YHSA 2X19A 3LW7A 1E0JA 4B76A 1IONA 3A1UA 1YVDA 5KHOC 3ETLA 4Q9HA 3A1WA 4TL7A 4XSGA 1P62B 1SXJC 4HAXA 3J81k 4AI6A 2ZANA 5AK0A 2IW3A 1E2QA 4MKHA 4PPQA 3K9HA 1P4SA 5LD2C 4DLYA 3KKMA 3X1XA 5HZHA 4JJZA 4M21A 4EAQA 1QHIA 3QKUA 1GKUB 4HYYA 2BCGY 2ZQ5A 4QNRA 2ATXA 1XCGB 3PXGA 3GJ5A 2OESA 4TYYA 4ZKEA 5JJKA 3TW4A 4D2IA 1A82A 1FX0B 1IQPA 1CTQA 3PVSA 2VHUA 2YNMA 2ZI3A 5A4JA 3NDBB 2ZI9A 3NVAA 2VF8A 2ORIA 2H5EA 3IKJA 5CJ2A 3V9PA 4RD6A 4B48A 4Q03A 4IOMA 5JHGB 1JBKA 3BXZA 3I73A 4NYIQ 1KK3A 2REBA 1E1RD 2IUUA 5KU1A 3BFXA 1UJ2A 4R71A 1ZNXA 2IHBA 1W0KD 2Z5FA 2NO9A 1Q44A 3IILA 4AYXA 1H8HA 1LF0A 2QMUA 5BW8A 2F1JA 2EFGA 1AN0A 3QKSB 4R7ZA 3WNCA 4C3ZA 3CB4A 3Q7PA 4JBYA 4YXWD 1GITA 2CDNA 4O3MA 4A36A 4ZIRB 2WMNB 1GSIA 2X77A 2I1QA 4O25A 1YRAA 5J4KA 2OV2A 4Q4HB 3ZVRA 4AG5A 1X1SA 5B30A 2FV8A 1XMIA 1UFQA 1GRQA 4PC6A 2IYYA 1TQDA 2A5YB 3CNOA 4B6EA 1ZBDA 3KQHA 1R6BX 4LK2A 5J4VA 3LVQE 5F3WB 2DR3A 1CLUA 2PZEA 4AC9A 3N5CA 1YR8A 5EE1A 1R0XA 2VSOA 1CIPA 2RGAA 3QUSA 2H57A 1KHTA 3NHAA 1LF5A 4PFSA 3Q7QA 4D4JA 2O5VA 3RANA 1C9KA 2H16A 1G3IA 3THWA 5DISB 1HURA 3LWNA 2XJ4A 5FFMA 2CBZA 2ZVQX 3DZDA 2CE7A 4JLPA 2EVWX 1KO8A 1MO6A 1TF2A 5EUMA 3SHFA 3PV0A 4MA4A 3U7GA 5JEDA 4IDNA 1NNEA 3PG5A 2QBYA 4AY2A 5FR1A 3MWKA 4QRHA 2PBRA 3AF3A 4WA7A 5CJPA 5FOVA 3TVDA 2P5TB 1I2MA 1N0UA 2E9SA 2I1VB 2KWIA 2ZTSA 1E2KA 1S9DA 1TU3A 3GJXC 3NBZC 2P3SA 4UNRA 3AVTA 4TZ0A 1W2GA 1KO1A 4ILEA 3DKVA 1BOFA 3DO6A 1AKYA 2IS4A 3FKSA 5DI3A 4UXHA 2QZ4A 4DXAA 4EPXA 1EFRA 2GKSA 4LV8B 2WWYA 2ZVPX 5C2JB 4ARZB 3PEYA 2OO7A 1UM8A 3QXJA 4V0NA 1L4UA 2C99A 2RB4A 1G6OA 3ZIAD 5TDHA 3BB4A 1E9FA 1CJMA 3B6EA 2LWIA 2GCOA 4CEJB 3HP1A 2Q6TA 3P27A 3TR5A 3MAAC 4PQRA 4X8OA 5JJIA 4PPFA 3MD0A 2OT3B 1XCPA 3MRSA 1VIAA 2RGCA 3SJCA 3SYKA 4M1SA 3LQRA 5G40A 3THXA 2GAAA 2YWFA 3I8SA 2WV9A 3N70A 4PHGA 4AKHA 4X8HA 4GOKA 5JLJA 3SEAA 1E99A 2ZSAA 4P31A 4QOSA 3IQWA 1YZTA 4C0SA 3OIUA 3U61B 2QQ0A 3FMFA 2GNOA 2V1XA 3WRXC 1XEWX 2QY9A 5IF9A 3CRRA 1Z6GA 1D2NA 2EYUA 4NYIR 4Q4JB 3UXMA 1KDTA 5JSZB 3L8YA 2ZUDA 2ASEA 2J5XA 3D7MA 1NN0A 4LX0A 2ZRFA 3HU3A 4H9GA 4TQUS 1IY0A 1Q21A 1T8TA 1WP9A 2EQBA 4OBEA 4OQFA 2HF8A 4TL6A 4M53A 5L3QA 4D4LA 4HAYA 1F3OA 1UKZA 3BH7A 5LB2A 2Q0HA 2IX3A 4MYTA 4UJ3A 2PCLA 4DCVA 1R4AA 3R20A 1IJFA 2ZJ5A 4ZDKA 3EA0A 1QG2A 5JJLA 2QPAA 4WXPA 3QBTA 1TEVA 3K09A 3VX3A 4NPHA 4D80A 2HEIA 2BDTA 4B73A 1T91A 5JWRA 3X1DA 4URUR 5JCZA 5AUNB 5HZKA 1PUIA 4FWIB 4OI2A 2OE2A 1XEXA 3A36A 4G5QA 2CJWB 5DI9A 4B33A 1UKEA 3RRZA 1Q1ZA 4TQAA 1GDDA 5CM8B 3AP1A 1E2MA 1G9XA 1GKYA 4ASUA 1IAQA 3OEEA 3GJ6A 2NO6A 4MITA 1KI6B 3CNNA 4RFSA 1EFUA 2X2EA 1ZNYA 2XGJA 3F8TA 3KQKA 2NTYC 2AL7A 2ZU6A 1P2UA 4A82A 5CITA 3KUCA 1IOZA 4C2TA 3QBVA 1ZW6A 3CX8A 5KOYA 4FIDA 2BMEA 4US1R 1TEXA 2ZE6A 1M74A 2XNDD 4WZAE 3RSOA 1VCOA 2J1LA 2NO0A 4QGFA 4A1FA 2V6JA 3W8NA 2BHRA 2AXNA 4DWJA 5EXPA 2KB0A 3EA5A 4HI0E 3WMFA 1NL3A 2QORA 2C77A 1Z0IA 5DSZA 1SULA 3PENA 1E2GA 5EP1A 3PUYA 3U3MA 3MWYW 1GVNB 1OT3A 3CIOA 3GLFB 2ODWA 2J87A 2Q3FA 3L8ZA 2FPKA 4MKGA 3K70B 2WSSD 2XTNA 4NDZA 4C0JA 2KBEA 3G5UA 1BS1A 3V4RA 3BC1A 4C30A 1OIXA 4NKRA 4ZPXA 3IIJA 3D6TB 1MO3A 3AP2A 2AKAB 4P4TA 2IL1A 3RYTC 3SBDA 4II7A 2IYWA 2C78A 1P73A 1EG7A 2ZI7A 2C5LA 5E4FA 4AYWA 3LRPA 5DE3A 2WWXA 3QI2A 1RJ9A 1XXHB 4M4SA 4AURA 4NMMA 1XF9A 3KXLA 2ZRHA 3P4YA 4WOPA 2QUZA 4JLBA 1HT1E 2ZRGA 4LDJA 1XPRA 3FB4A 2YV5A 4TLEA 3ZS8A 2A5GA 4KV9A 4FXPA 1ZM4A 3W6OA 1OFIA 2IHYA 4W9MC 3MFYA 3MJHA 5BWMA 1OYYA 1W4BA 3SNHA 1FL9A 1XTQA 3HR8A 2J0QA 4AKGA 2ZR9A 3MG9A 1NG1A 2XB4A 2WAXA 3KKPA 4C7OB 1DTSA 2ZUBA 4L5BA 3LX8A 1Q1EA 3CRVA 2B8WA 2ZAMA 4TL9A 1MRNA 2QA5A 4HAWA 3DKPA 5IDVA 2V6IA 4GFDA 4YMUA 2WHXA 4Q9KA 4LPSA 4GBMA 1TU4A 2VHCA 1A4RA 4MGIR 5DYIA 4KFUA 1ZCBA 2B6HA 1CKEA 2W2XA 4BLRA 2QP9X 1U94A 3PR1A 4DIDA 3RABA 3OE7A 3CBQA 5KDLA 1MRSA 1SVWA 1E9RA 5FPSA 4YONB 1X6VA 4CRWB 1PZNA 3C7KA 1G21E 2DY1A 2WAYA 1XBTA 3IO3A 4LI0A 1B23P 1O3YA 2PX0A 4DLUA 1Q20A 3QEJA 2R6DA 2J45A 1Z6YA 2ZRAA 1CBUA 3IEUA 5IRCD 4V0OA 1E2HA 4TN1A 4W7SA 4G5OA 2WJGA 1KZGB 2C9CA 1KAOA 1UEJA 4DSUA 3IPXA 1GNPA 3Q9LA 4L8GA 3MJRA 4OQLA 1PLLA 1Q1BA 2JJ2D 3Q8XB 4OK6A 1JR3D 3IIMA 4M1OA 2IXEA 3X2SA 3NXSA 3QNUA 4TTPA 2FSIA 1NIPA 1TUEA 1UDXA 2UVQA 1OXXK 4TLCA 4XVQA 4C9BA 3C4JA 3QF4B 2PJZA 2QQEA 2JLYA 2REXB 1KK0A 4Y0VA 1NVVQ 4RVCA 1OH8A 5KSYA 3O8RA 3JVVA 1KI4A 1EK0A 1XD2A 1DADA 3TE6A 1II8B 1NVXQ 1X8JA 5EXTA 3TH5A 1BYIA 2A7QA 1ZNWA 2ERYA 2ZRLA 2GZAA 3WNBA 4IVPA 1E79A 1SHKA 4BQSA 3U44A 1XD9A 3EWAA 1B0UA 1UBGA 1IY1A 2OLJA 1VMAA 1T3HA 2V54A 2GK6A 3CR7A 3MMPA 2XXAA 3OESA 1U9IA 1NLYA 2ATVA 4AIIA 2VSXA 4B3FX 3VR5A 3ND9A 3QSYA 5HE8A 1Z0JA 5FI1B 4P4SB 2P6NA 4KHZA 4M1TA 2ZJ2A 2C03A 4NE2A 4KI0A 2QE7D 5KSZA 3A8TA 2O8EB 3M1IA 3T1TA 1KO7A 3GLGE 2JLXA 2WOJA 3CF2A 4DLRA 4JSTA 4LSGA 1DE0A 3BFVA 2G6BA 3WP0A 1ZINA 4GPTA 4D6PA 3VKHA 1JEEA 2R65A 3AF0A 4UNSA 1JNYA 1JI0A 1OKKD 4B3DA 4JYCA 4NL4H 2QL6A 3L82B 2WJYA 1UF9A 2BBTA 3R8FA 3QKRB 1IXZA 2O8FB 3TMKA 1OIVA 3EIHA 3MCAA 4HLUC 2XSZD 4B44A 2K5UA 4RZ2A 2ZITA 1CJKC 4BFXA 1GIAA 1NBMA 3DMDA 4EKDA 4OYHA 1IBRA 2FN4A 4L15A 5AJVB 2DWQA 5GJCA 2GF9A 1QHHA 1R10A 3BOSA 3GLHB 3UANA 1YZUA 3RAPR 4QM6A 3KTAB 2QN6A 2G9NA 4A4DA 4X8LA 1L7VC 2WICA 3SS8A 4DT1B 5BYKA 3I4LA 1KSJA 3EZFA 1Q3HA 1RVDA 3DL0A 4IEEA 1SKQA 1E2LA 4U00A 5SZKB 5C46F 2O8DA 3H0KA 1II0A 5GJVC 3ADDA 2EWWA 2ZJAA 3LDAA 3C5CA 4QJ5A 3H86A 4W5HA 4DEXA 1N6PA 5FBVB 3N2IA 4PQFA 3ICEA 1US8A 2B92A 3K70D 3P26A 4QNMA 2ONJA 1JPJA 5KDDA 3GJ8A 2F1IA 1SKYB 1J7KA 3F0TA 1KJWA 4IDOA 2HT1A 3SHWA 2J0VA 1FPMA 4H1VA 4IOLA 2QSYA 2MSEB 4JL8A 4BFUA 3IBYA 4E22A 3RS7A 2N42A 1FOEB 1QBKC 4M1WA 1XJQA 1NVVR 3TNFA 4XD7A 3HPQA 3ZLJA 1P3JA 2VP4A 3BFKA 2GVDC 2YJTD 3H2YA 2XB2A 3VU9B 2GESA 1BYUA 4LV5B 3AVQA 4JT4A 3SQXA 3SN6A 1IN6A 2CNWA 2JLSA 4U7DA 1VG9B 4M9QA 1AQYA 4DDUA 2O0KA 1N6NA 2CHGA 3SQWA 3ONWA 2OFWA 4B35A 1GUAA 2X8AA 3AKCA 3VQTA 1N25A 2GZHA 4F4IA 3FHTA 2WJIA 4IKEA 1ZRHA 4OJQA 2ZYTX 3T06B 2PLRA 4ACBA 4URZR 2NO1A 4US2R 4XTRA 2ZRBA 3IGFA 4U02A 4A6PA 2IS6A 2WJJA 3NH6A 3L2OB 1S96A 1COWD 4KFTA 4FINA 4BLQA 3WYGA 4PTLA 4YMWA 2C98A 4A2PA 4B3GA 2JIZA 3I5XA 2BKUA 1WRBA 3QVVA 3GJ3A 4LYHA 3KQNA 1GNRA 1NMYA 5EXSA 2ZS8A 1DS6A 5EP4A 3GJ4A 4M9SA 2BIFA 2BEJA 1H65A 4Z8YA 5BXQC 1SXJB 2TMKA 1TF5A 4LYFA 3TKLA 2NIPA 2YWEA 1KMQA 4GMXA 5FBWB 1ZU5A 3WMGA 4Q01A 1KJYA 2XZLA 2FZ4A 3P20A 4US0R 3LFUA 4TSFD 3SFVA 4B74A 4CEHB 1MABA 2NG1A 5J4HA 5KNBA 2ZJBA 2IWHA 4KITB 1ZC4A 3UIEA 2ONKA 4IOJA 2P67A 3W90A 2Q3MA 2ZR0A 4OHZA 1KNXA 4S35A 4BFTA 2KBFA 4NU0A 3VR1A 3U3JA 3EZ9A 3C16C 1Z0AA 4AKIA 2R6AA 3EC1A 3IDQA 3W6NA 3QKTA 3WRYC 5IK2D 4DB2A 1KDOA 2YZ2A 4QGAA 1L8QA 3CPJB 4DVGA 1XB2A 4CEIA 2GWHA 1I2DA 1XD8A 1IN5A 1G3MA 2OAP1 2J0UA 3M6AA 3EPHA 1E4YA 2ZEJA 5ELXA 3GJ0A 1GP2A 1T6NA 2AWNA 4A92A 3C14C 1KTVA 1NF3A 1SVIA 2F9MA 3NEYA 3B60A 1F2TB 2N1BA 4L16A 3PUXA 3ZZ0A 2I4IA 2GCNA 2AKYA 1S3GA 2NMVA 2BC9A 4XIGS 4BFVA 1JJVA 1HE1C 1VHTA 2HLDA 2LKDA 2RGBA 4C0QC 1RYFA 2JA1A 1GG2A 2QTVB 3CLVA 4FD2A 3WP1B 4LPKA 1GNQA 2OCPA 2D62A 3QPUA 5JMTA 3GFOA 5KTYA 3TAUA 4BPBA 3R9WA 4M0LA 4K81B 2A2ZA 2W0MA 1FQJA 3LH5A 4LHZA 2Q3HA 4YDHB 1WMSA 1JALA 3CWQA 2WTUA 5FL7D 5EE9A 3NC1C 3GEEA 2PEYA 4JLMA 4XH9B 4B32A 3NHBA 1NSTA 1NY5A 4ON9A 1FUKA 4Q4AA 1X3SA 2PMDA 4LOAA 1ZUHA 1BKDR 2R6CA 3LBIA 1OIWA 4PPNA 3UPUA 1ZYUA 2N46A 3DEFA 1Z07A 5DO9A 2BV3A 2HXSA 1KK1A 1WE2A 1M7GA 3MGCA 4MYCA 1IN7A 4B34A 1G19A 5K8LA 4DLSA 1KSGA 4YQFA 5LB4A 2OFXA 1OXSC 2WIBA 2WWIA 2ZR7A 4B43A 2ZSBA 1CRQA 3HYRA 3AUYA 2WOOA 3TSZA 2JLQA 4ZV4A 2BBWA 3AVVA 4NCIA 2EU8A 1ANKA 1A2KC 3HJNA 3GLIB 1FFHA 4HATA 5H8WA 4LJ9A 4H1UA 1H8ED 1ZC3A 3C5HA 4NYMR 521PA 2XOKA 1T0HB 2Z83A 3BBPA 4LJ6A 2JDID 4XTCS 4WBSA 3SOPA 1NLZA 3KDSE 2WWFA 3VR3A 4KVGA 4WAUA 2VHQA 2XTZA 5D3QA 3THWB 2GXSA 4LHWA 1GTVA 1HTWA 3CRW1 3FKQA 3NKVA 5CLQA 5JCPA 2FA9A 3KFXA 2J41A 4BLTA 1HQCA 2SHKA 3CNLA 1AS2A 4IVRA 4NTZA 1OHHA 4V0ME 1OE0A 4NH0A 2AK2A 2CHVA 4V0MA 1AZTA 1JAIA 3B85A 1ZMXA 1R5BA 3S1AA 5DN6A 5KSOA 2IYRA 3AM1A 3VTKA 3KB1A 5E7IA 4DB4A 2V7QA 4MRSA 5JEEA 3VHXA 1KSHA 1DAKA 1XCMA 3NBFA 2OFOA 2PZFA 4JLDA 1K8RA 4LZZA 2H18A 2P0EA 1KGDA 5DI3B 3THOA 5E7MA 1KKMA 3VKWA 3X1WA 1Q0UA 4TT3A 5FR2A 4B6FA 4F4CA 5CIQA 3CH5A 4AD8A 1LS1A 1SHZA 5AWFC 4MDFA 1Z06A 3QY0A 1CXZA 2OSBA 1D2EA 1YR6A 1E9SA 4D0NA 5M04A 5AUQA 1QHYA 3KFVA 3VKGA 4JBWA 4TQ9A 1X1RA 4LHYA 4Z8XA 3Q3JB 1CJVC 1PVOA 4OQMA 2DHRA 2YWHA 3T61A 1TUIA 1ZD9A 2GCOB 2Z6VA 1U99A 3QXCA 3GP8A 3X1YA 2OG2A 5EE0A 2C9YA 2WVJA 4ESVA 3THXB 2OBNA 2HUPA 1RRPA 1NN3A 1VG1A 1Y3AA 1KAGA 5EZ6B 3THYB 3BK7A 3GCGA 1VYUA 2ZI6A 1GRNA 2YC4C 4URVR 1DPFA 2CL6X 4PHTA 1SXJD 2BJVA 3QG5A 3LXRA 1I4LD 4DLWA 4JZKA 2IS2A 4QKQA 3REFA 4NONA 3KJEA 2E87A 3EW9A 2J46A 4HLQB 3Q85A 4UXIA 1CR4A 1JXMA 1N6IA 2Z0MA 2GJ9A 5L3QB 4G0NA 4RSGA 4GOXA 4ABYA 4WZ6A 4OI0A 4HB0A 2UKDA 2ZXUA 4D0LB 1ZM7A 1Z6XA 2FZLA 1G7CA 5TV2A 4AG6A 3E2IA 3QOFA 4LJ4A 1K5GA 4LHVA 1KI2A 1G8FA 4HZUA 2G88A 4KSCA 4MDEA 5HKKA 4B47A 3D8BA 3VHLB 1X86B 3B1ZA 3NTUA 4BEBA 3TW8B 5B64A 3T1OA 3EPLA 1FP6A 4AYTA 5DHFA 1XEXB 3UWOA 1NIJA 4M1MA 5FBRB 4ACAA 2CL0X 2CK3A 2CHQA 3T15A 5JECA 3CF0A 4MUBA 4D4KA 2MMGA 4D25A 1D5CA 3OEHA 2BMFA 4XWKA 1G8HA 5L3RA 3P4XA 2F43B 2GZDA 2RKOA 2WPDA 1FNMA 4Z54A 4A8JA 4D0GA 2ZJZA 1YR7A 2YOHA 4QBFA 1P60A 3OIWA 1XNJA 2HJVA 3B82A 3QE0A 2RH5A 4TMXA 1P72A 1FTSA 4TMWA 1Z0DA 3JVUA 4ZO4A 1YZLA 2WKPA 3RHFA 3RRYA 5KUTA 4OI1A 3MUFA 5GVSA 1S4QA 3Q72A 2OBLA 4BWYA 3QXSA 2BMJA 4LJ5A 2F1RA 4GP6A 4QHYA 2QTFA 2ZROA 1Z29A 1QRAA 3L0IB 2ZYWX 4YMVA 4MRRA 4DCNA 4C0HA 1J2JA 1E0AA 3IHWA 4MYUA 1IN8A 4MYHA 4IDQA 1F6BA 1G16A 2QROA 1H8HD 3AP3A 4R2HA 2FMXA 2QGNA 3T5GA 3FE2A 4M9ZA 4P32A 3RS5A 4KODA 3FDIA 4YDSA 2O8CB 2FEMA 1MT0A 3BD9A 2VSFA 3ZD7A 2F6RA 2MMCA 4C0KA 5FPKA 2NGRA 1DAMA 4BASA 1RJ9B 1Z6TA 1K6MA 4A8JC 3IBGA 4DCSA 2X2FA 2F1HA 2PEZA 3R7WA 1E0SA 1N6OA 2ZSFA 5D3MA 1ZUIA 4K46A 4DRZA 1CR1A 2KI5A 1MH1A 3WNDA 4ZCIA 1KY3A 2EFDB 5C1BA 2KE5A 5CB8A 2A78A 3DDCA 4Z1MA 2AFIE 3RSLA 1W0JA 1U81A 1S1CA 3L0PA 1NRJB 2O8BA 4X8MA 2IWRA 1PLJA 2ZRKA 4M2LA 4RKEA 1YKSA 4ZDWA 1HY3A 1P61B 3B1YA 5FBQB 1RRCA 4JMPA 4EQ6A 1WCV1 2R9VA 1NJFA 2HCBA 4JL5A 4FMCF 1KNQA 1JR3E 2OEPA 3W9YA 1GM5A 4CEJA 2PT7A 2QTHA 4B2PA 2OBMA 3C41J 3TQCA 3FKSD 4BZXA 1BMFA 2V9PA 4BUJA 5LPNA 2FEOA 4PPGA 2J7KA 1E94E 1EFRD 3JZAA 4BLPA 2DFTA 2IYUA 4TYQA 3CPEA 3K9NA 3K09C 2QRNA 2IXFA 2OCBA 5FOWA 4NYJQ 4NZYA 2JLVA 1QG4A 1WQ1R 2J7PA 2RGXA 3LLMA 4Q4LA 3TUJC 2IYLD 2ZE8A 3BORA 5KYKA 3EPJA 2V8OA 1J90A 3AGPA 3BH6A 1SVMA 1NG9A 1IXSB 1RZ3A 4Q47A 1Z83A 3VMFA 1UBFA 2GF0A 3FTQA 3PITA 4LYAA 5L3VA 1D6JA 1E1QA 2GJSA 4Q7KA 2IYZA 4XWAA 2CLCX 1EGAA 3OAAA 1KSFX 4FWTA 2OLKA 4LBZA 4Y0AA 4OQXA 4DUGA 1JQLB 2VTKA 3W5JA 3PUZA 3DVLA 3NWJA 1W5SA 4BZPA 1YZNA 1XDBA 4M22A 3EG5A 3NG1A 2ZJ8A 1WF3A 421PA 3B9QA 3U44B 3TUIC 4F38A 3GEIA 4Q7MB 3LBNA 2GXUA 2XXAB 4ZDJA 621PA 1AIPA 2IC5A 1P6XA 1VG8A 4Q7LA 2OXRA 2JATA 4WXRA 4LBVA 2VRWA 3BS4A 3LD9A 4OHYA 3BJIC 2Y8EA 1VECA 2EFEB 4G5SA 5GJWC 3AVXA 2QMHA 2PJRA 2FPLA 1RE0A 2VF7A 5P21A 4A0FA 4L4UA 1QDEA 1T3SA 1N3BA 4R9UC 4PR0A 1CJUC 3K9LA 1KI8A 1G17A 1R8QA 1TF7A 2UZIR 5EE5B 4QC2A 1Z28A 4URXR 3AVOA 4Q48A 5FTLA 3EWSA 2A30A 2BM1A 1ZM2A 5J40A 3A6PC 5DIFA 4ASUD 3K0FA 3VR6A 3OEED 5SZHB 3PQCA 2VP9A 4RD3A 1UKYA 4MH0R 2VP5A 3W3AA 2OILA 5AUOB 4EPWA 2GRJA 1KJZA
chains in the Genus database with same CATH superfamily
4B6OA 5EJ5A 5JJ5A 2OV4A 3RS4A 1FLNA 2Q5QA 1KQPA 3P19A 4UNQA 1ECCA 1OB2A 2A0YA 2M6SA 3GLFA 2RH9B 3MS4A 1HE3A 3I92A 5KYNA 3DE4X 4L57A 2DBRA 4IVNA 4DTCA 1H94A 4XPZA 5A5FA 2DHCA 5JCJD 2BGLA 3LX4A 1DOAA 3I0NA 4IHJB 4MUNA 3BL5A 3ZHVA 3EUWA 4CLDA 4I2VA 5E1OA 2COKA 2RI1A 3QE3A 1CR2A 4YV2A 1CJTC 1TO1E 2PHZA 2VK1A 3Q0TA 4PZ9A 4FCCA 4K0KB 2EAUA 1QCYA 3E5RA 3LNCA 1Z3CA 1DCKA 3EPRA 1DAFA 3G8AA 5DFAA 1IH8A 2PZGA 2O8DB 4FYJA 5JAPA 1Q19A 4M99A 2ORWA 2UXDB 4P6VF 2ENWA 3D4PA 3O26A 1UMKA 2W42A 3M2PA 3U4AA 2B83A 3VH4A 3CEAA 1NBOA 3TQHA 3F73A 1GUZA 1NF9A 1US8B 3PZBA 2J6BA 2OZKA 4LOKA 3O2JA 1V1MB 4XYEA 5HKLA 4D42A 4ERXA 2HMWA 4JMLA 4TYMA 1KI9A 2A6PA 4O2RA 4QOJA 2QX8A 3FHCB 1CY2A 3C85A 3CUWA 3G7UA 2P91A 4QYWA 4MV4A 5DM1A 1U7OA 1BDHA 1MR3F 3KEFA 3NHFA 1ADYA 4ARUA 2NAPA 5A05A 2HSEA 4AXBA 5FWNA 1EE2A 1XZAA 4J03A 4M8NE 1BVYF 3N1UA 3RROA 5AI9A 2ZRNA 3FZEA 1U98A 4CG3A 1Y6FA 4K2HA 5HTKA 4V03A 1YZYA 1KEZA 2W0SA 1CFJA 1VL0A 3F9CA 4PAMA 1YOVB 2J85A 4OLFA 1E7SA 4Q1CA 3RSZA 1YKFA 1ZK1A 2AFVA 4W1SA 1L6IA 2NVBA 5E6RB 1JL3A 4TZ6A 4YMTA 4WVFA 1K88A 3ND5A 3A6JA 3EHEA 1Y80A 3S8EA 5D7BA 2QLLA 1ULUA 1GPDG 3WMXA 1SURA 3L40A 4RD2A 5CM9C 3UHPA 2G63A 2RJ3A 1MX9A 1PS0A 5G4LA 3SJ7A 1QP4A 4WMLA 5C8YB 6AT1A 3GJZA 2VAWA 2QU8A 2D4HA 2OGWA 4QBGB 5MHTA 2ZUUA 4N03A 1E63A 2WDZA 1GN8A 2WT8A 4R1SA 2JKVA 3GPCA 4AU1A 4H1WA 2R2AA 5JPIA 4HB4A 4AO6A 2GASA 4CIXA 2A5JA 3C1TA 3NNNA 3N0RA 2BBSA 3V4VB 2W7TA 3ILYA 5FL3A 2LDBA 3ZBTA 2PUEA 1R6VA 4JBLA 1G6Q1 5F4BA 4LZWA 3BZUA 4KO1S 4N1AA 2D0DA 4YCLA 5G3ZA 5LYYA 2X4DA 1CFZA 3IQFA 3L4BA 4LX8A 4EEKA 3U09A 1ABBA 3ICVA 1LZLA 1BN7A 3DOFA 1N2JA 3PFWO 4F92B 4E88A 1YMQA 1UFVA 5FTMA 1ESMA 1G55A 5C8DA 1D2MA 4FMDF 3S5JA 4D4GA 4D9GA 4KLAA 4R8RA 1JJ7A 4J3NA 3V2UA 2ZYDA 4Y7CA 1WUHS 3RYCA 4PF1A 1XU4A 1KH3A 1E9BA 1Y5LA 3VOAA 4EB3A 4R1UA 5LN1A 1X0VA 2WT4A 3FUTA 1RPNA 1U2SA 1W35A 1UMDA 1Y5MA 2HSDA 3PHBE 4AUEA 5FKJA 1O0CA 3W1VA 1QP0A 1YZQA 3CLRC 1V45E 4R68A 3W6PA 4A6XA 3QYJA 4UHDA 3RRNA 3TK1A 3MHTA 3NGMA 1SQ0A 1P1HA 1XHEA 3LG2A 3MWLA 1A7KA 2H8KA 3OQJA 4BB9A 1W8DA 1CUSA 1ZDMA 3BRWA 2ODPA 3OZGA 3TLJA 5JFOA 4W5JA 1U7WA 1NJ8A 3C8HA 3K0AA 4KMMA 4LNUB 3WL6A 3CZ5A 4LJSA 4BN5A 3NHZA 4CTKA 4FZVA 1P1FA 3TQTA 1JQ3A 2RARA 3B20A 3TPFA 3C2QA 1Q0HA 3M49A 4WEOA 3X1ZA 1A97A 4MUYA 1L2TA 4Y2XA 4NCJA 3LU1A 2WJPA 3L4BC 4CWAA 1GR1A 1M8PA 1NYTA 3CISA 3GRZA 3WLTA 9ABPA 2NZVG 3H3XA 3NT4A 1Y3CE 4YRAA 4NECA 4NOKA 4M8LA 3BWYA 3VNVA 3FGNA 4W5OA 2J08A 2XITA 3DYBA 3CZCA 1NWHA 4EHNA 2HQOA 4B45A 1RXVA 3K0BA 4M0UA 1AX9A 1NKSA 3QP9A 1Q0RA 2BVNA 2QE6A 1CEXA 3OQIA 3CF4A 3L6CA 3QTBA 5HCIA 2WZBA 1VHWA 3DSRA 3GLHE 1E3TA 3GK3A 3IE2A 4MCAA 1T26A 1E58A 1KFKB 2K2WA 2PL1A 5ALXA 2LNDA 2J5BA 1VKJA 1IBCA 1EXMA 4QULA 4ZAFA 3I1JA 2Z4RA 3QLTA 5G3YA 4AZ3A 4DZRA 4ENRA 2J59A 2XNJA 5CNJA 5ARCA 3KV1A 5FNVF 1GZ6A 2BFCA 1V5GA 5G53C 3A9VA 3I2HA 5KQMA 1SKBA 3MF4A 2VBFA 5ALPA 3ADCA 3MS2A 4PO9A 5J63A 1ADGA 3II6X 1B16A 1Z4PX 1URPA 4ZWNA 4QU0A 5KHAA 5TPZD 3RQIA 3L43A 1QG6A 3PHLA 4OHYA 4JI2B 3SI7A 3V97A 3KHTA 4B3TB 1PFWA 4DLBA 3AINA 4NG4A 1ICEA 1BWRA 2HN9A 1KDZA 4AAYA 3UFBA 2A88A 1C0PA 1Z34A 3EUEA 1H0KA 1P5FA 1Z39A 5I9NA 4Q3AA 4MVJD 1W1WA 4PWYA 4X20A 4BNDA 3CX7A 2WAAA 3EGEA 3DFIA 5JAUA 5LR6A 6REQA 1NVUQ 3TLMA 4ZT6A 1O5TA 2BFEB 3BTUA 3CKMA 4I50B 3U4QB 4HDAA 2OUKA 3IKMB 3EXHA 1V6SA 5L4SA 5EYPB 4X1OA 2BZ1A 2QAGA 2JBAA 1DEKA 3DV0B 2OHFA 4C88A 5B7GA 4LXHA 2W43A 3BULA 4RTSA 4MMXB 5DNWA 3I2FA 4DGSA 3PDWA 2QVLA 2QRPA 5L3SA 1YE5A 2I6QA 2Z9BA 4NENA 3ZI7A 1E92A 4PV7A 1FXWA 1AHHA 2Z08A 5CCBA 3RAFC 2G1AA 3INTA 4OQQA 4NNJA 1OWMA 3IX7A 1G8YA 5HRAA 2WUGA 1UWKA 1H6BA 1OI3A 3DNPA 5FJJA 4B5KA 3KAKA 1SBIA 4PZYA 1K7EB 1O0SA 1TO6A 4YFYA 2HMSA 1FJGB 3FTFA 1ULTA 1AHIA 5KSPA 4KTVE 2ZT8A 3HBMA 4CYMA 3Q4GA 5KKCA 1QIDA 2GFIA 3QNMA 4G9GA 3IVRA 3CJTA 1YR9A 3LPMA 1MRZA 3S1AB 3AW8A 4C6SA 1MQSA 4GLFA 3PI6A 4KN5A 1V26A 1Z88A 1BXRB 1T0BA 1E9CA 2COUA 1IJEA 3IERA 2CNWD 4IDCA 4PZAA 4YXWA 2VYCA 3UBMA 3MHPA 5FX2A 2IGTA 3A9WA 1KFEB 2VOJA 1AUQA 2BY4A 2I7VA 4KQJA 1PGPA 4UNPA 3D6UA 4W82A 4DEYA 3MUOA 1SVLA 3R4CA 2P9EA 4XJTA 3OKAA 4C06A 1RPZA 1Y37A 3H8VA 4UPVA 2APJA 1XK7A 1WW3A 4UM8B 4IQ8A 4ND8B 3O38A 1A8PA 4B40A 1RYHA 2VEOA 1WOMA 3MWEB 2CBGA 2O9JA 1XV5A 4C3VA 4L4RA 4EVQA 5KYGA 3ILHA 3IELA 3DOUA 3RWMB 3EXHC 4WQMA 1RMYA 4HLDA 5L3ZA 3GAAA 3DTVA 2C9OA 2QAGC 3TRJA 3EG9B 4IXNA 1IBSA 3DC7A 2P6MA 1NKTA 3PLNA 2JIZD 1IEWA 3QTLA 4JYBA 4NE9A 5KTNA 2EBHX 2EARA 1GL7A 5FP0A 2BR4A 3H5VA 1SRQA 3A1TA 3LLUA 4KV7A 5A6VA 3IKTA 3DMTA 1ORHA 1Q91A 1SZPA 2HQSA 1T9GR 5EIHA 3OU6A 3SSMA 1KYIA 4HAIA 3ZCXA 1S3IA 3CY6A 1RPTA 2WBLC 4I1VA 1FFWA 3WE7A 4CKWA 4QA9A 1B74A 4X3OA 3IAFA 2EWMA 3RTGA 1E1YA 2R62A 4EFLA 3OPMA 1RCTE 1PL8A 2ZVJA 5A4JA 1XGKA 821PA 1P6QA 1Q7CA 1X8LA 3EGXA 4F9EA 5EZ5A 3A2NA 3RODA 3P9ZA 4K6FA 3WLNA 1YVEI 4PWZA 5I4BA 4C1BA 3EJWA 1BQEA 5CNMA 5K3EA 4DCUA 3RAGA 2D8AA 3LI2A 4TMZA 2P40A 4YUXA 4YWHA 2Q0XA 3VV2A 5CA0F 2Y0CA 3KR0A 4G37A 4I5EA 4X97A 2EBWA 4ZTUB 1SCBA 2ZB2A 4R1TA 3IKVA 3EGDA 3U13A 4MS4B 3KEGA 2P9TA 2CVFA 1YQDA 3HU1A 2F3TA 4I4IA 5CX1B 3W8EA 2LPMA 2QBYB 2YN2A 1JTVA 3C45A 2C97A 1I9CA 2IKQA 3IMFA 2GJ8A 3SU8A 3ICQB 2MSKA 4Q82A 3ZIAA 1YI1A 5KMGB 2P6UA 5HFNA 2ZAIA 3PSAA 3EPJA 1EJ2A 2FMIA 5T4BA 4AP6A 1TT5A 3FTCA 4J2OA 1RRFA 4MHSA 1DAGA 3DD5A 2HIHA 1T4CA 3B12A 2ZTMA 1P7YA 3FVQA 3KVNA 3P0HA 5C32A 3QU9A 3F49S 4F4UA 3GEGA 1LFDB 5TIIA 5DX1A 2TRSB 2HO4A 1CULC 2IDKA 2ZT5A 4GT1A 4CT0A 3ZX4A 3IAM1 4KO2S 2B34A 1X7WA 1CE8A 2QX7A 3R5KA 1SVSA 4YRQA 3SCZA 5EJGA 3NBQA 1M6WA 1V5IA 1V5FA 2FQ1A 4O1MA 4ALKA 3DMTC 1L5KA 4YJFA 5YASA 3ZE7A 4WZBE 3ZGLA 4C4ZA 3K6SB 2EHDA 3A1DA 3H42B 1FP2A 4V0SA 4HFRA 5DBHX 4B8YA 3KQLA 1U0LA 4LGYA 2G4LA 5LUAA 1GCAA 3BCHA 4RD1A 3I5UA 5TJHA 1J9EA 1UBNA 1SKUA 4C5AA 2EERA 1U8TA 1VYTA 4RMIA 2QRUA 3B7PA 2NU8A 4F3KA 1X87A 1D2GA 5BPFA 4YREA 1YNSA 1Y48E 4PAOA 1OPXA 1DFHA 3KX2A 4C7JA 2FG6C 3TQOA 1GQQA 3I1FA 1N75A 5B7QA 1JE0A 4KK3A 3UFXB 3J81A 2ZFUA 3BK2A 2E7ZA 1MG5A 1KBZA 3DM5A 1Q17A 1WPXA 4JVMA 1WZNA 2JARA 4KE9A 5EQFA 3JD4A 5FNVB 2R96A 5EJEA 5IEBA 8MHTA 4N8DA 3AH8A 2EKPA 1ZONA 1U0JA 5TQVA 3EF0A 1L4FA 5K05A 1S2IA 4P3PA 3IUMA 1GPKA 1A50B 1R0YA 4PFJA 1LDGA 1TZCA 4WCFA 2A1IA 4C01A 5IDYA 3BMOA 4BLOA 2NZ8A 1XMQB 3OO1A 5FTJA 4RK4A 2OENG 4MV0A 3CVJA 3VKVA 4BKRA 1AT1A 2AFHA 2PPLA 2ZQZA 4Z5XA 4MRAA 1T2AA 3EYAA 4TLLB 1ZG3A 1EH5A 2H51A 4L8WB 3COPA 2WK1A 3R3VA 1P0IA 1U8UA 2O2GA 4PNZA 2IOYA 1G291 3DPUA 1C7RA 5E0KB 5FBKA 5ULLA 5IXJA 2Z1NA 2PVCA 3DVSX 3A4MA 1QFZA 3OM1A 5LP6A 3AZOA 4M9XA 5DHAA 4RKQA 1Z8FA 2OAGA 3PVCA 2UZ3A 1RQNA 1EGQA 1G42A 2G0TA 1EVLA 5DLDA 3HCFA 1Q95A 5IJ0A 3UAZA 1VIYA 2DU8A 1TQ4A 2XNDA 2Q9BA 4J7UA 5AW1A 1HC7A 5EWMB 1V43A 1G3UA 1QK3A 1G5RA 2FQYA 4J7XA 1GPAA 3W5HA 1UMCA 4OM8A 2PO5A 4WLUA 3WNVA 1PNOA 5IBPA 3AVYA 1V5WA 3N2NA 4C20A 4TTVA 2C0CA 1L7MA 2P3QA 10MHA 3T34A 3PCRB 2P9CA 4JI1B 1N77A 1T5IA 4YYZA 4G9EA 1L5NA 3STWA 2QPLA 3KR2A 1QRTA 2V4ZA 5H59A 4UTRA 1GUYA 3HKEA 3KR1A 4GP9A 4OK3A 5B12A 3IR7A 3ZQ4A 2JGKA 1AV7A 3NCTA 4BP9A 1NLFA 1KPGA 3WLRA 1HK7A 5EQDA 5DN6D 3K4HA 3MWDA 4J9VA 3WFJA 1ZD3A 1T2CA 4HAZA 4XQ0A 4NZMA 2Z8YM 1M1XB 1P33A 1Y7HA 4RCYA 4DSTA 1P2TA 3HJGA 4BXOA 4KIWA 3GQVA 3TKAA 1ZK3A 4TV8A 1JAHA 5CHEA 2DFKB 1SVUA 2YINC 3BE6A 4RKWA 1J0XO 1UZUA 5JRJA 1RC8A 1ECPA 2BLNA 4TT3D 2ZSUA 2FN7A 3GZ4A 4X85A 3UK6A 3ETCA 2A92A 3A1SA 3AEYA 1WUTA 4OBWA 2Q1TA 2A9PA 5TB5A 5B1EA 2TSYB 1NLUA 2BFBA 2ZDGA 3LX6A 3PCXA 4Q7JB 4S0XA 5IN4A 3DHVA 2HLHA 1UKVY 1A76A 3HRIA 4O63O 5LP6C 5BV7A 2IA5A 1LVUA 4D9CA 4DR6B 1FFCA 5AVOA 5K7SA 1T8UA 4GKBA 1N2GA 2GX6A 3KKOA 3O8OB 1T5SA 1EFKA 2YJ4A 3SXUB 4Q21A 1KIMA 2ZT6A 3C0KA 4PBTA 5TXGA 3R3UA 3TN7A 4WT7A 1ZSYA 4RACA 1FYFA 3G9TA 7REQB 5JSQA 4HX9A 2I65A 3NOVA 5DT9A 3AFMA 4E12A 4TMVA 4LY6A 2D7CA 4YPOA 1PCXA 4PGGA 5IH3A 3OEWA 1VJ5A 2G77B 4U7PB 3ANSA 4FQ5A 1RM5A 4BQRA 2EZTA 4S1TA 4DL9A 1D6SA 2Z1DA 1MAHA 4X61A 1PFUA 2GPAA 1HLGA 1TVKA 2ZYGA 3GUCA 2C2HA 3V7YA 3L8HA 1CEYA 1F9EA 1CUJA 4DV3B 2PV7A 5GP1A 2OBFA 1M0SA 3U6BA 1M33A 1WB4A 5CA0B 1SOAA 4R98A 4PAQA 5IW8A 3RFXA 2ZBGA 1YCHA 1E62A 2E18A 4X1KA 4BJ5A 4FCTA 3IT0A 1J22A 2A5LA 3TAHA 4RLHA 4QOFA 4HRYA 4ARZA 2W00A 1G38A 4EMSA 4A0HA 2OQ2A 2MWMA 1EMDA 1DIGA 2YVKA 1WQ4A 1JLSA 3LFHA 4OJNA 1EX6A 3VC2A 3G1TA 4LC1A 1QQTA 1X7ZA 1YL7A 2F43A 1AK2A 2QRMA 3M0EA 1M7HA 4L50A 2AR9A 2P6OA 4BLVA 1DO2A 1TCVA 3L7MA 2RAPA 3BWXA 1JR3A 3ABOB 1WZCA 2BFFA 1U2GA 3G2KA 3X3HA 1FFAA 2FPSA 4DLTA 2ZM5A 3MGBA 4FMBB 3V00A 4H1HA 3GV0A 3BMCA 3EARA 2HRRA 5K8TA 1B0AA 4XWTA 4M0MA 3FLAA 2Y1KA 1A5TA 2CK3D 5B7PA 4KBGA 1C3LA 1XJ5A 1ZGBA 3L6DA 1GAEO 2ZGVA 3FWZA 3N2KA 3R40A 4Z9XA 5G02A 3SF8B 3TRIA 5BW4A 2ZSDA 4C6TA 1XNHA 2JI4A 4S0ZA 3OEHD 2DPXA 4TLMB 2HI0A 2VDPB 3K0FB 1DEOA 1EBBA 5HCNA 3RUAA 3WL3A 1WB9A 1CEEA 2I9PA 3R3HA 3WI7A 4NI5A 4JJIA 4RIHA 5EMNA 5KNLA 1NONA 1EVKA 3VBEA 2XBUA 5HMLA 3V7UA 3C5EA 2XVMA 2IEBA 3DZCA 1SCIA 1D9XA 1YJCA 3B3FA 4I4LA 4S05A 1T1RA 4H3SA 4BGIA 4DKXA 4OU4A 1M2OB 1PZFA 2B9EA 1J8QA 1U5BB 1HKHA 1BW9A 2UUCB 3WV4A 3PX2A 3AF1A 3HY3A 1CCWA 1JHQA 4P58A 5LQAA 3PFFA 4YRJA 1Z08A 1B26A 1MV8A 1J8YF 3NP7A 1KAEA 1XD2B 2PWBA 2ZYRA 4ND7A 1CS4C 1O0BA 1TL7C 4YRCA 4KVAA 1VA4A 5ALMA 1N7GA 3S3TA 4EI7A 4ZQHA 3E3AA 4W5QA 2O8CA 4ZJUA 2FWRA 3O8CA 1MX1A 5AXCA 1DRUA 2X3UA 4DDTA 3R9IA 5JAZA 1K3FA 4D3FA 4DABA 1JU9A 4AZ0A 4RNDB 2CJWA 3VR5H 3O8NA 3DOIA 3OX3A 4UE2A 2HHJA 1QO0D 2QM3A 3KT6A 3LRTA 4UTXA 1JV2B 3AC0A 2OA0A 3ZXUB 4BNJA 4D8VA 4EHDA 3QENA 5MGBA 4WXEA 4YMHA 2Q99A 1PT8A 3LECA 3PE6A 3ZY2A 2B4QA 4ME6A 5AFSA 2QXYA 1FXWF 1DC5A 2NVOA 5FI0B 4XYMA 3UKDA 1H2AS 3GBVA 2C8JA 4PXAA 5E7JA 1N3IA 4K88A 1Z37A 4YRLA 1U63A 1KZ7B 2J9XB 1N3LA 1B7GO 4LDPA 1VIDA 4DMHA 3FFBA 2WYIA 3N6XA 3QEOA 3HI6A 1RCUA 3RC7A 3UOGA 1L5HA 4S04A 3DAPA 1DOHA 1NQWA 1YQTA 4ZU3A 5HSGA 1YB7A 1NJ5A 2XAUA 1CB0A 4N6NA 4ZZ3A 1E1MA 3L9WA 1PJBA 5BN3A 2H65A 1JIUA 4GI7A 1N4AA 4MW7A 2O2JA 4HNAA 4WKGA 1E9VA 2FFHA 1GGHA 7ABPA 5UKDA 1RPAA 2XEXA 4P83A 5BSUA 4DY6A 1SG6A 2PTHA 5LQSA 3AFNA 5J43A 5K20A 1ZJ6A 1HL7A 4ZQEA 4CM9D 1B8UA 3BA6A 5BQ5A 4G8BA 1IOWA 4KRYA 2MU1A 1MGOA 2AVDA 1W19A 2GEUA 2ZJYA 3NGXA 2JFVA 2XZOA 1SM4A 2HBZA 1ATZA 1OSNA 2B2XA 1GAQA 3T38A 2VR1A 3CG4A 1CF2O 1XEWY 4V0LA 4JODA 2FWJA 2QVXX 4H7FA 4EYSA 2GEBA 5LSAA 4ER3A 4GP7A 1O89A 1VYVA 3MW8A 4TTJA 3SG0A 3KKKA 1DXOA 2E82A 2Q41A 1K9VF 2HNBA 2B21A 3EZLA 2QQ5A 3GDHA 4U9UA 4UXJA 4H18A 2INGX 4DMMA 5FADA 2Y0BA 3ZH2A 4EG4A 1KBOA 4GPAA 3QE2A 4UPEA 1U7ZA 4AQYB 2XYHA 3CTMA 5ER6A 1P3Y1 4XVUA 1F17A 2ZBVA 3EC2A 3L4JA 5E1MA 1Z22A 3AR8A 1SIWA 3TGPA 1PJTA 2PS1A 4MA0A 5HG0A 3HB5X 4KUEA 4H31A 5D87A 1RD4A 2I1WA 3ZLTA 5KPDA 1DKOA 3RYCB 2R84A 2ATIA 2Y67A 2IYSA 3WJ2A 4ZHSA 2GZ3A 4W7HA 4LKOA 4FGWA 5JMOA 3W9BA 1UMDB 3TX6A 4CI9A 1JDNA 4EB6A 1E1QD 1MENA 5C52B 2CLIB 3OZBA 2G70A 3ZWCA 1N5DA 2NVUB 2GR9A 4I5IA 4ZOAA 4HN4B 2SKEA 4HYYA 4NK5A 3W3ZB 1JVNA 1RBQA 4OGFA 1CRLA 5E0OA 2CLDX 3TIIA 4DV5B 3G0OA 4C4PA 2EFHB 3ANNA 1JBQA 3S2FA 1Z12A 2GK7A 5IAKA 1WLSA 2OGZA 3FRHA 1YD7A 4Q02A 2ZPUA 2X22A 3VJRA 3K2QA 1JDUA 4E1BA 1CWUA 2FP3A 2WB4A 3K0AB 4IWNA 1UOEA 4UU1A 1VDMA 3KDPA 3C3DA 2W2LD 3FPEA 3O2NA 1ZEJA 2P41A 3TZKA 5AI0A 4EHJA 2W6NA 2VZ0A 1K9SA 3ZN2A 721PA 2QNRA 4I2NA 3ZHCA 4CMCA 1IPEA 4Q3DA 4JX8A 4CV1A 1DBWA 2V4MA 4KJXA 4C2UA 4QELA 2I7DA 3AF2A 4ZANA 5LWHA 1RVV1 2IV7A 4CQLA 5B4TA 3UT5B 4TMTA 1OVMA 1TK9A 1OBVA 4E6EA 4PN3A 2PKQP 5HK9A 5FOXA 1YMUA 3RUFA 3VU1A 2H59A 4R41A 5A2GA 4Z0TA 4CCWA 1BHJA 3VC7A 3RVKA 5LYJA 3C3AA 3E0QA 4I1PA 1ODFA 3OWOA 4NU8X 4KFSA 1YGPA 3FYCA 3WIDA 3ZS9A 2OC4A 4CIAA 2DUNA 3QV1A 4R2IA 4R54A 4AKEA 3OQIB 2JIOA 1N6HA 1M1ZA 2FK7A 1IHXA 3EVEA 4GI3A 1RC0A 3OTOB 1PR2A 3NR2A 3CPHA 1B00A 1V3TA 1WIWA 3JW8A 4RO0A 4ALLA 6Q21A 6GPBA 3OSZA 1QZUA 5G0WA 4AZ3B 2DKNA 5BMOA 2I22A 3EVFA 2REQA 4JYPA 1F1BA 2QR3A 2V55B 5H4HA 5J5CA 1II8A 1BGXT 1N6LA 3LUCA 2P65A 5FPHA 3ZVMA 1IN1A 3K0EA 2BFCB 3JYOA 4MHOA 3I62A 3EQ6A 2I80A 4PG7A 1ONOA 3CW9A 1ZI8A 3OP4A 5JZOA 1XTZA 4LYJA 4N54A 3L4EA 3ICWA 3SK0A 5B2EA 2R6GA 3W2GA 4QBHA 4EUEA 3UUGA 2WSLA 4LTDA 2DFLA 3SP1A 3SZGA 4EMTA 2Z3ZA 1I9GA 5CDFE 3L1IA 3O9ZA 4BQFA 4QDUA 4AO7A 4ZQFA 2G28A 3N59A 2VKTA 3A6GA 1B4DA 1M8FA 2C3OA 4EARA 4EY5A 4YCMA 2OFPA 3J80A 2BR3A 2CLSA 2D0PB 3H13A 2O3RA 2CB0A 3CH4B 1VHLA 4HCJA 3B7GA 3QUAA 5DX8A 4X20B 1L4NA 4MUKA 4BNDB 1RYMA 1UIMA 4QSHA 1R2QA 1BMQA 1XTKA 3VZRA 4BNHA 1IC6A 5K8IA 1QIHA 6REQB 4JASB 1W93A 5HE9A 2O8EA 5A4DA 1M34A 3G9XA 3EXHB 3LHIA 3VNSA 3DMHA 3RTEA 2HYIC 1HYQA 1UPUA 3S2ZA 4GXQA 1XDGA 2QAGB 2JBAB 1ATIA 2AYZA 4K1XA 3L7CA 4RE5A 2HRBA 2QMEA 2GO1A 5GZ3A 3A7DA 4Q1VA 4HGZA 1G98A 1T8PA 2H0QA 2DFDA 3AQIA 1V7PC 4GEGA 5E95A 1GYRA 3GT7A 3KD3A 4FYWA 1DBVO 2CCKA 2FPGA 2JLBA 3LDFA 3MK31 2HOQA 1RW4A 4WIAA 3RBVA 2RAVA 3LYHA 2QN3A 2B4AA 5DRYA 2O8FA 3Q9SA 1DL5A 3PIIA 3TCXB 1MLDA 3O73A 4X1IA 1R5NA 3GGDA 3U3XA 4RELA 4NE7A 2D5AA 1U4SA 3IEIA 1M3SA 7GPBA 2HWUA 1XKLA 1QX3A 1A7JA 5LBUA 4CUZA 5DULA 2W2MA 3OZUA 1G64A 4XGNA 4ZOEA 1EHIA 1X1AA 2F4NA 4TZKA 4OHWA 4B5LA 3EZ7A 5BSFA 5TQ0A 2D2VA 3DLIA 2XNCA 3GLSA 4XJVA 5CYOA 4TTSA 5FQNA 4RPIA 4PC2A 2VDWB 4JR1A 1G8GA 2JJ8A 4M1KA 4DLVA 3HXQA 2GEDA 3PIDA 2GRUA 4RTQA 4JLAA 1OV6A 4HNGA 2B30A 2HBQA 3WLLA 1X42A 2J3EA 3AILA 3FF4A 5HIIA 4JYAB 4TV8F 1QVWA 1N2IA 3C6MA 3URKA 1VBNA 5KNCA 2PUBA 2Q9AA 1AF4A 1PJ2A 3GJQA 3D5QA 5GADl 1TC1A 1RMTA 4Q00A 4NFLA 4R83A 3QF7A 3S1SA 1VPEA 2W2KB 1OAAA 1U8CB 4JLJA 5E4YA 5IT0A 1TIPA 2J30A 1QQAA 3DEAA 3AFOA 3L4SO 2JDIA 2ZCUA 3R24A 3DTVB 2VDJA 2YWJA 1X7DA 3IMCA 4UVEA 5JCZA 3PKIA 1H93A 2YVAA 2DF8A 1WABA 3K2EA 3H75A 1GA1A 3OCWA 1VLQA 3S7ZA 3H9UA 4EFMA 5BSHA 5FLXA 2H0RA 3DO5A 3DBVO 3ZDRA 5I3CA 5FBZA 2X8BA 1Y4DE 4Y2QA 3I6QA 3BB1A 4DDWA 5FA6A 1GILA 4E33A 4KSYA 1KOFA 1WZUA 2B4RO 2F3SA 4JITA 4CKWB 2Q7XA 1V9CA 2PGIA 2VEDA 2ZPTX 1J20A 2RHGB 2I2BA 2XWJI 3EUAA 1LRKA 1ESDA 2ZAOA 3E27A 3OPNA 2IS1A 3NVKI 4BO9A 3NRJA 3DEKA 1PUXA 3EGXB 4JOCA 4F2PA 1BH2A 5DBEX 1YF3A 5K2OA 1XZGA 1LW6E 1GLNA 2O4CA 5AIAA 5CIWA 3PA8A 3N0WA 3UC9A 1Z7YA 2I71A 3QPVA 1ZQ9A 2E4UA 4DPMA 3L4KA 2ZUEA 1Y33E 1W94A 3I23A 3A04A 1BDMA 2BF7A 2CSUA 2POQX 3K4QA 5TY0A 1NBHA 3RIHA 4YIHA 3ZGOA 4ZVVA 2DYKA 1QH9A 4KC0A 3KLMX 4NFYA 3EGDB 1EFTA 2XD9A 4LWPA 4QTUB 5ITZA 1TAQA 3HUFA 4WFKA 1I51A 3LC2O 1MOPA 4CUJA 5BR7A 1NW7A 2W2PA 4WACA 2J9YB 4MZDA 2IUTA 2VQSA 2YH2A 1DG3A 4FKZA 4FHEA 1W30A 4E5YA 1Z63A 4IVQA 1J8MF 4F91B 2QVBA 2QL7A 1M9NA 2N75A 4BFWA 1TT5B 4I55F 5AVQA 3GRAA 4UQOA 4RIGA 5EIEA 4HQ6A 1QE3A 2W4MA 2GOYA 2LKCA 1T4CB 1MV5A 3ZW7A 2IIPA 3WLFA 1PR3A 1W0CA 1HDOA 5HF8A 2F3QA 1DEHA 3BG5A 1K5DA 1FNNA 2D59A 2HC9A 2AGVA 3OM9A 4Z0PA 3U26A 4YT2A 2WVGA 1XZLA 1SAYA 4MRNA 1X7WB 1CE8B 2YN0A 1YZGA 3CRQA 3OE5A 2GM9A 1YQWA 3PPIA 1SXJA 1OXTA 4UHHA 1E9EA 3Q0IA 2ECQA 4UHFA 5A7HA 1KAMA 2AMLA 3TZHA 4ZJPA 4RTRA 5CD9A 3AF6A 2PSEA 1C4OA 1XU9A 3NHLA 4G4SP 4ES6A 3ZWKA 1ITZA 2IUSA 4G84A 3EASA 5IFKA 1DWPA 1NQUA 1B76A 2KX7A 4UREA 2C4VA 3ZTWA 4HB3A 4OFXA 1U8YA 2IBMA 4I81A 4QUIA 2JASA 3HYSA 4GM4A 4ALJA 4JSYA 5IU6A 1Y1PA 3FMIA 1GA4A 1XC7A 2ZI5A 1LK0A 3G8BA 1QMPA 2HNAA 3DXFA 2BRUA 3I9OA 3PVZA 3V1KA 5A3RA 1XTRA 2CZQA 1IQ0A 1U1DA 4LV6A 4J1QA 2I3BA 5JADA 4JVLA 1V37A 3GLUA 1N5IA 5HJ2A 3K8ZA 3RWBA 3RRBA 3CNQS 1QNFA 1ZBQA 3ONEA 1WZIA 1EGMB 3O4RA 1MXHA 1R64A 3GQBA 4M9UA 5DN9A 5ERYA 3O0TA 4U8GA 3P9KA 3SFZA 3UGKA 1SU7A 1ZVQA 4DQUA 5INTA 5GIPE 3HTXA 3M4YA 2BISA 1PWZA 1G1MA 2D1RA 4FNMA 1I1QB 3BMOB 3DMNA 4DJTA 4BE7B 5BN1A 4DV0B 3N0TA 4AO8A 2WAOA 1ZKMA 1NT2A 3RVDA 5HWSA 1C9DB 5EP3A 3UJ7A 3WLJA 2W83A 4O2AA 4C6HA 2DY0A 3LE8A 5U9CA 5JQGA 1BFUA 1HNNA 1SCQA 4UM7A 2BFMA 5DHQA 3TTSA 4OH7A 2F8TA 3IXMA 3K96A 1DRJA 1M0EA 1XP8A 4ADSG 3DTYA 1BXGA 2J32A 2OV3A 1E66A 1JT2A 3GRFA 3ORFA 4JU8A 2I67A 5C5CA 1HMPA 3A1UA 4YT5A 1YVDA 5KX5A 2WYOA 2I33A 3D8HA 1JS1X 4XSGA 1SXJC 4HAXA 3ZR4B 5LP6B 3MJSA 5C53B 3J81k 3PRJA 3DL4A 4FHDA 4S1PA 4OKNA 5AVYA 3NEAA 5J9FA 3CTPA 3RCBA 1J33A 1P39A 2IODA 5IJ0B 4G5XA 4GGOA 2W6OA 4CG0A 1GKUB 1TZJA 3JVIA 2ATXA 2HW8A 1UMCB 5A9SA 5DYTA 1HLDA 1R8JA 4ZKEA 4POOA 3TW4A 2R8ZA 1SCAA 1EP9A 4WNCA 2VHUA 1A7UA 3V55A 3T3DA 3EJ6A 3I2JA 3NVAA 4TWRA 3PNQA 3IKJA 3N58A 4RD6A 5TX7A 3HEMA 5F3RA 3GRPA 5EHZA 3BXZA 3GBSA 1UFKA 1FSZA 2W6CX 4I1YA 3LY9A 4JEUA 1E1RD 2R7NA 3BFXA 2XCSB 3HKEB 5I7SA 1ZNXA 2XUKA 2HBRA 4NZZA 2MOKA 3C3BA 1FQOA 1JG2A 3PE3A 2QTGA 3L93A 3V8QA 2P77A 3ZHTA 3IAHA 3VHRA 1OZGA 3MOGA 3MWDB 4R7ZA 4HT3B 3Q7PA 1FSGA 1GYPA 4E31A 3KJFA 4DMGA 3O1LA 2V45A 3FFTA 4ZO7A 4BXOB 2A0FA 3D7SA 2HRCA 4TV8B 1ZAYA 3D5EA 1XLTA 2VH2A 1FZTA 2X77A 2I1QA 4L3VA 4OFWA 2HHLA 1MEOA 2ZJ3A 3QA9A 4AG5A 5B30A 3UV3A 2OHOA 1KU6A 3WWDA 5EJ4A 2CXRA 4ICIA 1VSVA 1UBMS 2BFBB 2IYYA 2ZBFA 1BEZA 3CNOA 3ZCQA 4B6EA 4F2DA 1XMOB 4LK2A 4U6NA 3T0GA 2DR3A 4BV9A 1V8ZA 2W9XA 2XEDA 1XKTA 3F9IA 4R9SA 2AR0A 4UE3S 4XB2A 3N5CA 5EXEA 3OPXA 3ZK9A 5EE1A 2JIDA 4PG5A 4QDOA 5TPWA 1B6GA 5L7YA 2H57A 1H4VB 3NHAA 3D2LA 4PFSA 3T95A 1OROA 2O5VA 4D4JA 3ANMA 2HMYB 1HURA 5JPDA 1PWEA 1Z4NA 2ZVQX 2C7GA 1GPBA 1KO8A 1H5QA 2VBIA 3MCUA 3GGPA 4UARA 3TLZA 2IZ7A 1ZWKA 1KRXA 3UA3A 1NNEA 1APBA 1NZJA 3OM8A 4ED9A 4ZAZA 5FR1A 1Z75A 3GZNA 4L4XA 4QRHA 5CJPA 3TVDA 3AB8A 3N07A 1N0UA 5IYZA 5JZSA 5ENVA 1TU3A 1S9DA 1TVKB 3H2ZA 3NBZC 2P3SA 2HR1A 1FS5A 4WTOA 1J23A 4XR4A 3DKVA 2I7TA 3DO6A 3PL5A 1AKYA 3AO0B 4LVCA 3S81A 1XMPA 3FKSA 4YAWA 4K6GA 1JVSA 3D02A 3RRJA 1SCKA 2ZR8A 1EFRA 3CLTD 4X1KB 1BMTA 2MYPA 1YQ9A 4ARZB 2I99A 1VPTA 3C39A 4QPPA 3I6MA 4KVZA 1UM8A 3GH3A 3QXJA 2E49A 2Q5EA 1V11B 1XLTC 1L4UA 2C99A 4YBZA 5DXAA 2J3IA 4QTZA 4ARIA 4WX2B 2WP0A 2G9VA 3R7FA 1CNEA 1KXZA 1G6OA 1X7ZB 2PAFA 3TLGA 1E9FA 1CJMA 2JANA 1MB3A 3PK0A 2V4UA 4O5AA 4X3PA 2QTWB 2GCOA 2WUDA 2Q6TA 2BGIA 1JDVA 1N8TA 2XMQA 3HP1A 2G07A 3P27A 3PJEA 2BFFB 4NULA 4X8OA 3MD0A 2OT3B 4N01A 5HQ3A 5LYJF 4L5IA 5MFZA 2WWRA 1VIAA 1OC2A 4NK4A 3SYKA 3LQRA 5G40A 5H80A 3GX1A 3H5IA 5FXMA 1MXFA 3BMCB 1WXDA 3UTCA 4DAEA 3KSBC 2BSQA 4CMKA 2JBHA 3HBJA 2WV9A 3N70A 1JTFA 3UWSA 4UPDA 1BXKA 4D97A 3N2KB 2YV2A 5JNSA 5JLJA 4FN4A 3SEAA 1B42A 3VZPA 3E22A 3UHAA 3VYRB 4C6TB 1MF7A 3U61B 1JXAA