2QT1A

Human nicotinamide riboside kinase 1 in complex with nicotinamide riboside
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
189
Chain Sequence
LVPRGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinamide riboside kinase 1
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 58
structure length 189
sequence length 194
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qt1A00
1EWRA 3SOPA 1FMJA 2QP9X 2C03A 3M0EA 3PUWA 4BFUA 1OKKD 1UAAA 1BIFA 4A0GA 4DLYA 4YMVA 4Z51A 3W9YA 4BLRA 2R6DA 1I2DA 2D06A 2QGZA 3T5DA 2GESA 1UEIA 2JDIA 4BFXA 5KO2A 3R8FA 2VBCA 3R9XA 3SQXA 4Z1MA 1V43A 3ZZUA 1XTJA 1YJ5A 1GKYA 1CBUA 5K8LA 4P4TA 1CR1A 1G8HA 1MRNA 1NN3A 2CJWB 5G53C 5TV2A 1HT2E 1RFLA 2QZ4A 1OFTA 2D4HA 4RZ3A 3SE0A 4BECA 4YXWD 4Q4AA 2FZLA 1EX7A 4YC7A 3ZZTA 2VP0A 3QXSA 4DDWA 4RD1A 3QXHA 4YONB 2CXXA 2JA1A 2FX3A 4EPVA 1XTQA 2Q9BA 1E2HA 3CRVA 4I1UA 1W44A 4JLAA 1K5GA 3U3JA 3CRW1 1EK0A 1E2DA 3IO3A 2EFHB 2GAOA 1SZPA 4B32A 1VG9B 2PZGA 1CEEA 3C41J 4JKIA 2FWRA 5KPJA 1YZLA 1U8YA 4Q66C 2JDID 1KSFX 1XPOA 1E0JA 1G8GA 4HUTA 4Z1MD 4P4SB 1NJFA 1FQJA 1A4RA 2ANCA 4XD7A 3W3AA 5AJWA 1II8B 1CJVC 1LTQA 4NE2A 2WMOB 4P32A 3CBQA 3QPWA 1U2RA 1ESNA 4M1SA 4WAUA 2VA8A 3ADCA 3BERA 5K8UA 1LVGA 2CHQA 2F1RA 4G5GA 5KSYA 1DE0A 2O52A 1AZTA 1P2VA 2D2FA 2IBMA 3IKJA 4HLDA 4RKFA 5CM8B 1NSTA 2O8BA 2ERYA 2H16A 2HT6A 1UKYA 3FKSD 2QAGA 3TK1A 4NYMR 3WMGA 5FR1A 1MABB 3CH4B 2ZI3A 4DLWA 1W1WA 2OG2A 3TR5A 3K0SA 4JMPA 2RH5A 4JLVA 3EAQA 4GZLA 1F6BA 3WNCA 2JLVA 3U4QB 2BIFA 4PPNA 2QGNA 3LAWA 3SEAA 2FU5C 2JJ2A 2ORIA 1NIJA 3FHOA 4FD2A 4B3BA 4E03A 4F38A 1PUJA 1QHHB 1QBKC 3AP1A 3GFTA 2BMJA 3QF7A 4GMXA 2XTNA 5JMTA 2VHJA 3DZDA 2V6JA 2PCLA 2ASEA 3WNDA 1J8MF 1TMKA 4JJKA 1VCMA 1CKEA 1HTWA 1XXHA 4MGIR 2OLKA 2RGGA 2SHKA 4BZPA 1I4LD 3W5IA 2A5DA 2ONKA 1XCMA 1JNYA 1XF9A 4B3XA 2RHMA 4LYHA 1XMIA 2C04A 3TH5A 1Z6GA 1U99A 4H9GA 5FOTA 4B3DA 5HE9A 2EYQA 4AKIA 2ZSFA 1Z0FA 1CJTC 3K70D 1IN8A 5SZKB 2GEUA 2V3CC 3TSZA 2WAXA 2H1LA 2AD5A 3DO6A 4Q1CA 2JJ2D 3HYTA 5CDFA 2B6HA 4CDGA 3SJCA 2J41A 3BH0A 4ZI3A 2J0UA 4TWZA 1M34E 2QT0A 3C8UA 1W4BA 4HDCA 5JSZB 2YC4C 3RS3A 4CW7A 2EQBA 4BFTA 2QMOA 4IFEA 3I32A 2BBOA 3O47A 4G1UC 5FBRB 2CLSA 3WMFA 1T9HA 2CHGA 2GXSA 3H86A 4NH0A 3W8RA 1P2SA 1ZC3A 2Q9AA 3A4LA 2FGKA 4QBFA 4OK3A 1F2TA 2D74A 2EU8A 3I3SR 4OJKA 3T1TA 1T6NA 4NYIQ 4ZPXA 3ND9A 1U98A 2ZAOA 1UKVY 2QN6A 2VYFA 3AF1A 4TLBA 3A58B 4M2LA 4TMWA 1P6XA 3LVQE 3SHFA 2D3WA 1FL9A 4BLQA 5BYKA 1L8QA 2XB2A 2ANBA 3ZQJA 1D2NA 2QM8A 3PENA 4TMKA 3A1UA 2C98A 3IQXA 1KI1A 2ATXA 4URZR 2DWPA 5EE3A 3EIQA 5LPNA 2EWVA 2IEZA 2GEDA 3RS5A 3K9LA 2EVWX 3PUVA 1KK1A 4ZCIA 2YWGA 3QXCA 1LF0A 1TF7A 8OHMA 1AGPA 4KFTA 2VP4A 4TL8A 4IVPA 3PJRA 3OIVA 1XJ0A 4ZO4A 1T3SA 2IYTA 1DAHA 1S1CA 5KHOC 2P5SA 4GBMA 5G40A 4PANA 2BKUA 4KBFA 3BJIC 1XEWY 2ZJAA 1XBTA 4JJZA 4NYIR 4QGHA 4V03A 1IXZA 3THYB 1KSGA 1AS0A 4XTCS 4GOKA 4DUGA 1CR2A 1OSNA 3K09A 2GCNA 3VR5A 2FSIA 3MD0A 4PO9A 2V55B 3AKDA 4RY2A 4EJSC 4JL5A 1G8PA 4TMVA 2GXQA 4F91B 2EFGA 5TVKA 3L2OB 2P2LA 5J4LA 2GJKA 1L2TA 3P4YA 3Q7PA 3AKYA 1T91A 1YRAA 2NPIA 1OPXA 2Z4RA 3U3MA 3CONA 2B7BA 2MSDB 1J7KA 4RFSB 2WICA 2O8EA 2OCBA 1MT0A 1WRBA 4I1VA 5A0FA 5EP4A 1XMJA 4FMDF 3S1AA 3QI2A 5H70A 4K8OA 3N5CA 1P75A 4L8GA 2OT3B 1N3BA 2AXPA 2G83A 5JRJA 1U8ZA 3DL0A 4OKSA 4HSEA 5H8WA 1AJEA 2XTZA 3T15A 3TW4A 4NTZA 2LCFA 4WXPA 2AN9A 1VCIA 4Q18A 4ZIRA 3LWNA 3LXXA 2XSZA 4TQUS 2VP6A 4DLTA 4ZV4A 1NN1A 2YYZA 3SDZA 4PQYA 5TXGA 2R2AA 5HR5A 4MGZR 1AN0A 3QEJA 3QKTA 3EG5A 3UKDA 3KFVA 2J5XA 4GOJA 1KO8A 4A8JA 1R5NA 2J0QA 4JLKA 3W6PA 3FHTA 4LY6A 1HYQA 4IFBA 1KDTA 2OM2A 1QRAA 2VSXA 3QSYA 1P61B 1G3MA 1EFUA 1CP2A 4PO1A 3TRFA 4MYHA 1WMSA 4MRPA 1GRRA 4D81A 2VTKA 3T12A 4Q9JA 1OFUX 1QHSA 2OBNA 2AR7A 2QBYB 1Q12A 4CRWB 1IM2A 4D2IA 5L3QB 4AK9A 3I5XA 3VU9B 1OH6A 1G4UR 4CT4B 1FPMA 1Q44A 1R7RA 3GLFE 1OLOA 5FUWA 5D3MB 2XEXA 4FCTA 1FUUA 2JJ1A 2XSZD 3HU3A 3TQFA 2GILA 1N0VC 3TBKA 1PVOA 4OQLA 3GJ3A 3I92A 1A5TA 4LOAA 2ODBA 1DVRA 1P9RA 2D62A 3EW9A 4U02A 3U3KA 1XD2B 2WJHA 2FFQA 2WJYA 3C5HA 1ZIPA 4WZ6A 3VX4A 4B43A 3FOZA 4CZ2A 4GL2A 2ZRPA 1GAJA 3AEZA 3TE6A 4U5XA 3B85A 4RCZA 5J4KA 5BXQC 4R7ZA 4OHWA 3CWZA 2Z83A 4OL0A 2LWIA 4DSUA 4MRSA 5E4FA 5FPKA 5JBQA 2F43B 3PEVA 4QBIA 2CNWA 2E87A 4OI0A 3B9QA 4A9AA 4C0SA 5A4JA 3U7EB 2A5JA 3SI7A 3SBEA 1OB5A 2WSSA 4L9SA 4LHYA 4ASUA 3GJ8A 3CR7A 3EX7C 4C0QC 2A2ZA 4D25A 3WMEA 4LJ9A 3GLFB 2JJ1D 2OFOA 5JHHB 4TZ0A 2JLXA 4C0HA 4XVQA 1UKZA 3NXSA 3U6KA 2IC5A 3U3RA 2GETA 2W00A 3BS4A 1NMYA 3LQQA 3KZ1E 1WF3A 4X8LA 4UNQA 3R7WA 3IIMA 1SKYE 4EAQA 1UPTA 5AUQA 3AKEA 1ZINA 3BE4A 2BEJA 3PVSA 2P6NA 2ZREA 1HQCA 3IIKA 1SXJC 3I72A 4TMXA 2WIAA 1G8FA 3K0AB 2AXNA 5L8VA 1XD8A 2BM0A 2VHTA 2LKDA 5CLQA 1G5RA 1GNQA 1E94E 2AK2A 1E79D 5DGXA 1VYUA 4B47A 1W4AA 4UNNA 1BMFA 3UG6A 1Q1QA 2NZJA 3LH5A 3UIEA 4C0JA 1T3LA 3EASA 3R8CA 2WSSD 2HF8A 4ASUD 3OFNA 4Q1EA 2JIZD 5F98A 1OXSC 1P7CA 4L4UA 3RABA 2F1JA 4W5WA 4QNMA 1YU9A 5L3SB 3BBPA 3ICEA 4JYCA 3EZ2A 1X3SA 1VHTA 3NBFA 1HQYE 3UANA 3GFOA 3K9GA 5FPYA 1F2UA 1U90A 4MRRA 1DELA 1N0WA 2NG1A 3NKVA 5TMPA 4DDUA 3GPLA 4B44A 1KI8A 1OYYA 1ZM3A 5EXPA 2FV8A 3BB4A 4KFSA 5DE3A 2X1VA 4B3GA 2QMUA 2HCBA 2O8DA 3EA0A 5J47A 1SKYB 4JS0A 3EWAA 5IDVA 5LD2C 5GJBA 4M9XA 2AHOA 1WXQA 2VL7A 4Z8XA 4HAWA 1GRQA 1TF2A 1KI6A 1Z6AA 4KFUA 2OHFA 5LB4A 3CF2A 3EXAA 1GNRA 1SVOA 3BB1A 1EGAA 3REFA 3LVRE 2UZ3A 1QHXA 4OYHA 3TW8B 1LFDB 5FI0B 1ZD1A 4ACBA 1L4YA 1JXMA 1TPZA 2QT1A 2YKGA 4DIEA 1JQLB 1RJ9B 4TLEA 1OF1A 2HLDD 3F5FA 3GQBA 4G5QA 4ITRC 1GFIA 3BC1A 2O8FA 3TVDA 2QU8A 3RDPA 2FOLA 5FOVA 4GPTA 1IAQA 2GVZC 1KMHA 3RVBA 1JI0A 1R0WA 2CMKA 1E0KA 2G0NA 3TGPA 4MKFA 3AVPA 2CL7X 2F9MA 1N2CE 3EZ6A 1W0JD 3CM0A 3CNNA 2OAP1 3AVXA 5BN4A 3VR4A 4EJSB 3EZ7A 3GJ5A 1VIYA 2BWJA 2IEYA 1Z6YA 2WJIA 4PHFA 5DYIA 1R0XA 4BPBA 1GOTA 2IL1A 1JPJA 1K8RA 1AK2A 4ON9A 4R71A 2OXCA 1SHZA 1KGDA 2AFIE 3VKGA 2V4ZA 5JWOA 2DB3A 1E3MA 1SGWA 3PITA 4MKGA 5UKDA 4UXJA 1DARA 3SU8A 4D26A 5FTMA 2PLFA 1TF5A 4RFVA 6Q21A 3VR2A 2DFLA 4QJ3A 1RKBA 3E5HA 1S8FA 4NONA 1AA9A 4H1UA 4BLSA 3KUCA 3AV0B 1UM8A 4PAOA 1OIXA 4C0KA 5IK2A 4BLOA 3CZQA 1YZUA 5AJXA 5FFMA 1S9DA 4ARZA 1XCPA 1VG1A 4TQAA 3W90A 4AWXA 5DO9A 1G3RA 1E2PA 3P20A 3BXZA 1R2QA 4PHHA 1PLKA 2UZIR 2A30A 2GF0A 4JLBA 1XTKA 3TUJC 4O3MA 2H92A 4ZDJA 4ZKEA 4BGDA 1H8HD 3SJZA 4HZUA 4Q4AB 3TR0A 4QJ5A 2J9RA 4JLNA 3U7GA 3HR8A 2R44A 5EXXA 1UDXA 4JLMA 4XSGA 1G41A 1E2QA 4GMDA 1HV8A 1VMAA 1XD9A 2W2XA 1OH7A 3GD7A 2CL6X 2ORWA 3THXA 3D6TB 5B30A 4TT3A 4AKGA 4PZZA 3O8BA 2J45A 3CH5A 3FMFA 2N42A 3M1IA 4A92A 2NO1A 2REXB 3HU1A 4IOLA 4DVGA 2XB4A 4EPTA 3FFBA 4C0BA 3OAAA 1M7BA 1U0LA 5BN3A 1XXHE 2WJJA 3TUIC 1ZU5A 3EZFA 3F8TA 5DNYB 5F3WB 5BWMA 4OK5A 1KKMA 3B1WA 3WHLA 4OHYA 3Q85A 3ZZ0A 3JZAA 4BFZA 3HU2A 1TEVA 1MKYA 4NCNA 3B13B 1RIFA 3OESA 1KZGB 1ZM9A 2FFAA 1F48A 2K5UA 2ZJBA 1R0YA 2ZRDA 5ELXA 3U3OA 4E07A 3PEWA 1IBRA 2FMXA 4C7OA 2O8BB 4IW3B 4LRWA 3QVUA 2QAGB 2XITA 3RYTC 1UF9A 2XZLA 4HAXA 2UVQA 1MV5A 1SVLA 4F4CA 4PAQA 2RKOA 4LJ5A 1I2MA 2I3BA 4QL3A 3K70B 1EFRD 5CDFE 4C2UA 2X19A 4TT3D 1NVVR 2GAAA 2J7PA 2ZRCA 4LYAA 4QNRA 2ONJA 2ZQ5A 1LS1A 1RC8A 1E9FA 3QENA 5E7IA 4TQ9A 3BGWA 2YOHA 2WAYA 3LBHA 1Z0AA 1KNQA 3OAAD 2MMCA 1NVXQ 4HYYA 4KSCA 3RS0A 2IYSA 4Q7KA 3P26A 5FPSA 4YDHB 1NVUQ 1CJUC 3RRYA 1XXHB 1AQUA 2DR3A 5HE8A 2RCNA 4HAZA 4NCHA 1HURA 2VP9A 4M1TA 4RD0A 1Z0IA 2ZS9A 5KSPA 3DDCA 1GKIA 4TZ6A 1YE8A 4GP7A 4EUNA 2JLYA 3NC0C 4HLQB 4JZKA 3GLGA 1G1MA 4KLNA 1GWNA 3FKQA 4JBYA 4PR0A 2I1VB 1HE1C 1YZKA 3LA6A 3QG5A 4JT4A 3VMFA 3DOEA 4QHYA 2GZDA 2J7PD 3CUEF 5EP3A 1D9ZA 1KI4A 2J0UB 3AVWA 3MJHA 1D2EA 2OLJA 3LD9A 2ZRHA 4A15A 2R8RA 4TLCA 3A4MA 1G7CA 4PFSA 3Q8XB 1RW4A 3CRQA 4HDQB 4ILEA 4XVRA 3KQKA 2WIBA 4LZZA 4C9BA 5FPTA 3X1XA 1AKEA 2GJ8A 1F2TB 3E70C 4RCYA 4QM7A 2ZR9A 1G21E 3FGNA 4UXHA 3CO5A 1JXOA 3PIRA 2OFXA 4UJ3A 5FR2A 1OXXK 2CE7A 2R9VA 4URYR 2NO9A 1E9CA 2HDNB 3AM1A 2RGDA 2WMNB 3FDIA 4QGAA 5KTYA 4LJ6A 1YR6A 4PPGA 2ZSEA 1GL7A 2A5FA 2AFHE 2VP2A 5DI3A 2C2HA 3BOSA 4Q7JB 1GL6A 1NMZA 1BYUA 1E9SA 5JEEA 2VH5R 3V00A 3NHAA 5FOSA 3MRSA 2WWYA 2F1IA 4AYTA 4PZLA 2NIPA 1E2KA 1LW7A 5FBWB 3X1YA 1LY1A 4M9SA 2WWHA 4NYMQ 4DSNA 4PC1A 3FMPB 3IDQA 4PSAA 3VNVA 2MSEB 1FX0A 3AGPA 3PUZA 3SZRA 3E1SA 3O8CA 3O8DA 1Z29A 2GTPA 3AVVA 1P9NA 2IYWA 1ZNXA 3BORA 3H84A 3TAHA 1K6MA 2F3RA 1T0JB 1E2IA 2ODEA 4WZBE 5DI9A 3IEUA 5SZJA 3NBZC 2PEYA 4E5UA 5CYOA 2AWOA 1PV4A 3FTQA 3I8SA 3MJRA 2FE4A 2NPFA 4U00A 3N2IA 3IIJA 4RVCA 1AS3A 1UADA 2WJVA 1HE8B 2JLWA 4B71A 1ZC4A 1JEEA 1CRPA 3EC2A 5F2EA 4QM6A 1KO7A 3FFAA 2GDJA 1E6CA 4AI6A 3DVLA 1IJEA 2GK7A 4IXMA 4OQMA 2FFHA 4LBZA 1JECA 2EWWA 4M1KA 1DAEA 4NCJA 5DHAA 3RC3A 1NNEA 3LFUA 4M9ZA 1FNNA 1J70A 1W4RA 3VFDA 2GNOA 2O8EB 2C9OA 4XJXA 4CEJA 2EYUA 3TIFA 4W7SA 4A2QA 2F9LA 1D8TA 2GCOA 1E2EA 1E9EA 1XPUA 1FP6A 3MG9A 3S1AB 1Q1BA 2ZUDA 2ZJYA 4JVMA 4Y0AA 4M1MA 3KXIA 4FCVA 3KX2A 1XEWX 4BEBA 2AK3A 1HEIA 3KXKA 3K9NA 3WY9A 2VSFA 1Z0KA 4IHQA 1GDDA 4HATA 2BHRA 1H8EA 4L9WA 2IHYA 4XD7D 4AURA 3ZD7A 3CF6R 2ZITA 1VTKA 4ZIRB 3H1TA 4NBSA 3QKRA 2IF0A 3E2IA 2ZE6A 4G0NA 5IRCD 4DB2A 3F0TA 1UEJA 5JCZA 3PFIA 3CWQA 3RRZA 5J4YA 2G77B 4A8JB 2WBLC 1G291 5KSOA 5JWRA 2OFWA 2NGRA 1G5TA 1W5SA 3GJ6A 1SXJA 4JL6A 3AVUA 2IXFA 3PCRB 2YNMA 2QORA 3MCAA 2XNDA 3QEOA 3MWKA 3HR7A 3ECCA 1G16A 2BJVA 2PH1A 3OZXA 3I8XA 1AGRA 4US1R 1ZJ6A 1N5JA 4Q1AA 4C30A 4PTLA 5EUMA 4QKQA 3HPQA 4OHXA 4V0OA 1SVMA 2ZRAA 1Q57A 4R98A 2V9PA 4S2EA 5EP2A 1H8ED 3LQRA 3BK7A 1P3JA 4DXAA 2NOAA 1DBSA 2JLRA 4Q7LA 4RD4A 2QP3A 3U61B 4KO8A 3RRMA 4DCUA 2PT5A 2KSQA 2W2TA 3A4NA 2XZPA 2JCSA 2E1RA 3EA5A 721PA 3K8YA 2XJ4A 5FUVA 2C8VA 3SYKA 1W36C 1KK2A 5JLJA 1V5WA 5G3YA 1E9AA 1VG0B 1CU1A 3TLXA 1A82A 3UG7A 3HWSA 2H57A 2PT7A 2X2EA 4XWAA 1SXJD 1KK3A 2H18A 5DISB 4B6FA 2ZRGA 4Q21A 2QENA 2XNDD 4DJTA 3LW8A 2FSHA 2C77A 2QMEA 2VLIA 2REBA 2IS4A 4TLAA 4A6XA 2ZRFA 4IDOA 1CJKC 4FMCF 4IRUB 5AJYA 5B58C 2FPMA 1LS6A 1JB1A 1M7HA 4OI1A 5HPYB 1E1QA 2RGNC 2CCGA 2Q3FA 1WB9A 1XMVA 4QBHA 2F55A 3QQ5A 4Q9LA 2RGCA 2KBEA 2ZRJA 1DPFA 3Q7QA 1BKDR 2QMHA 3QVVA 2LKCA 1KTVA 1YQTA 4DWJA 3Q72A 3FMOB 5FTJA 4D0GA 2QQ0A 2BM1A 2FEMA 5CB6A 3NHBA 4YLGA 2OE2A 1E1RA 2TMKA 2XNSA 4Q4HA 2ZROA 4X8MA 2C95A 3TMKA 3VR3A 3GLIA 2R65A 5LBIA 1E2FA 5A5GA 1UBGA 1E69A 3DEFA 2NMVA 2ZETA 4DLSA 3GMTA 3L8ZA 3R7WB 1TU4A 1SVWA 4GRAA 1K5DA 1RVDA 4QXAA 4H1VA 5M04A 4M53A 4KJZA 4DRZA 3WNBA 3K53A 1QZXA 3DKVA 3KFXA 5EE0A 5TDHA 2GEVA 2B7CA 2YHSA 4L5BA 4BRUA 1NLZA 1SHKA 2IYRA 4ESHA 2GHIA 1PZNA 1UKEA 2WJGA 5FL7A 5C46F 2O8CA 4OI2A 4JSYA 1FUKA 4Q9KA 1OXTA 2QP4A 4A0RA 2ZXUA 1ZU4A 2YINC 3UWKA 4MGKR 4WVFA 5KUTA 1ZM7A 5DYGA 4TTRA 1CLUA 3JZMA 3NBXX 1KYIA 2PJZA 1ZM4A 2FDCA 3RWMB 5JJKA 4OQNA 4DLRA 2QTVB 4LBWA 1F2UB 4XOIA 1E1RD 3LX5A 4OQXA 1JR6A 2JLSA 4MQBA 3B1VA 4F4JA 1U9IC 3MWYW 1R0ZA 2FZ4A 4DUGD 3RS2A 3BD9A 1ZUHA 121PA 4CEIA 4PXAA 2XX3A 2O8DB 4Q1BA 2C99A 2AD1A 1C4OA 3WBKA 1WDTA 2HJVA 1U94A 2A7QA 1KI6B 2N1BA 2ZU0C 4B48A 2CCJA 4JLDA 5KNCA 2KE5A 4D0LB 2R6CA 2X8AA 1ZP6A 3ICQB 1NLFA 3ZLJA 4ZDIA 4MA4A 1QHGA 4NL4H 2HXYA 3JVUA 2IYYA 3ZS8A 1OT3A 5FL7D 3T06B 1Z0JA 2QSYA 2V6IA 4YMWA 1KO4A 3TSOA 3TAUA 1MO4A 4A36A 3DPUA 5C2JB 1NRJB 2GJAA 5EP1A 1CXZA 3B6EA 3QKSA 1QG2A 2FJUA 2H8KA 2P6UA 4HAVA 1NMXA 3C4JA 2O8FB 3IUYA 1AM4D 1CJMA 1MRSA 4I99A 5HCNA 3W8NA 1B23P 4Z54A 1D5CA 1KMHB 3DMNA 1NP6A 5HKKA 3DMDA 4DKXA 3I4LA 4B3FX 1E9RA 2IK8A 2ZPTX 1JBKA 5FTLA 2J1LA 2NZ8A 1DAIA 1W7AA 1E2LA 1RRGA 1X1SA 2DCUA 3CF0A 2WWXA 3RC8A 3SS8A 1GG2A 1IN6A 2Q3HA 4OQFA 4TYPA 2AL7A 4B2LA 1NBMA 2ZYVX 1E4VA 4LUCA 2ZRIA 4PHTA 4QHTA 4PPQA 1US8A 4LV5B 2HT1A 2ZJ8A 1XMSA 3F3YA 2WM9B 3CZPA 5FBLB 2BV3A 5BN5A 4XWKA 1WA5A 3FWYA 4LPKA 4HAUA 3QXJA 1R8SA 4LV8B 2FH5B 4P33A 1KDPA 1KKLA 1T5LA 3RHFA 4S35A 1PUIA 3U2QA 3NDPA 5JI2E 2IUUA 4NZYA 3KXLA 4MRNA 3B9PA 2VHUA 5KYKA 2ODWA 3GJXC 5FBVB 1R5BA 3SJAA 2P5TB 2ZUCA 5HKKD 2RMKA 5FOXA 5KNDA 1G4AE 3BIFA 4MYUA 2AKAB 2H7VA 3AVOA 1YVDA 4L15A 4Q9HA 1O87A 2OBLA 2KI5A 1IN4A 4UXIA 4ARZB 4BASA 4DCNA 2ODNA 3BFKA 2JGNA 2PLRA 2ZJOA 1CR4A 3IBGA 1IY1A 4PO8A 1G3QA 2HCJB 4YMSA 2VPPA 3ZQ6A 3PEYA 1KOFA 2AX4A 4LHXA 1R8QA 1T4GA 4HZUB 1YR9A 3NVAA 4RKEA 1O3YA 3T61A 5FUXA 5JRZA 1F5NA 1Z6XA 4UJ5A 1XEFA 4URUR 2FA9A 1RZ3A 3KQLA 4UKDA 3X2SA 3THXB 5TY0A 4DB4A 4F93B 1KJWA 4BFYA 2VSOA 1E9BA 4LHVA 3SJBA 2ZS8A 4DBLC 2CNWD 1ZUIA 1DAKA 4BWYA 3T35A 4DT1A 3X1ZA 3CRRA 4TTPA 2W0SA 4XTRA 1ZNYA 1SQ5A 2BMDA 5CB8A 2BKEA 2IX3A 2QAJA 5J40A 5JWHA 1ZVQA 3K0FA 3QPVA 3KJHA 4NHOA 1W36B 2N46A 2C78A 2ZR7A 3I1FA 4N0DA 1ZMXA 2EW1A 2I1QA 1OH5A 3GLGE 2P3SA 2RB4A 4HB4A 2BBWA 2RHDA 4MKHA 1LV7A 5KDOA 2YWHA 4C7OB 3HP1A 3NH6A 2FF7A 1KAGA 4URXR 2AKYA 1Z0DA 3T34A 2ZM5A 1DOAA 1G3IA 1KHTA 4DCTA 5CK4A 1NG9A 1N6LA 1XEXA 5JEDA 5TB5A 2D2EA 2QTFA 4CEHA 1N6PA 5H1YA 1NKSA 1N5LA 1HH4A 2CLDX 1L7VC 2QEQA 4FIDA 4QJ4A 5AWFC 1BMFD 3RS7A 4B74A 1XJQA 2WKPA 2XZOA 3SC3A 1UFQA 2Z6VA 3CW2A 3OFND 1NVWQ 3B7GA 4PC2A 5JHGB 1SVSA 1YRBA 2ZRKA 2QROA 4AKEA 4B2IA 2CEAA 2OO7A 1IONA 4KVAA 4LHWA 4AC9A 4K46A 4B34A 4XVUA 3THWA 1L4UA 4A4DA 2QSZA 4A82A 3KJGA 3QBVA 3WYAA 1KI7A 2ATVA 4JYBA 3QPUA 1E2MA 2G0TA 4JLJA 2PCJA 3A1WA 5HTKA 5SZIA 3AUXA 4QHSA 3GLGB 1M1YE 3X1DA 1C1YA 2VF8A 4C3ZA 4B75A 3BAFA 1Z28A 5IF9A 3AQ4A 1YKSA 4MUBA 4GDFA 4HB3A 2FPLA 3ZIAA 3AGQA 3M4YA 1ZRHA 2NO0A 1KY2A 5GVSA 2XXAA 4OBEA 3H4MA 3REGA 1WCV1 1G3UA 4LWZA 4KAXA 4YMUA 2EFCB 2IYXA 4LYJA 1QHNA 4Q01A 4HUQA 4LBYA 2FNAA 2ZRLA 1GIAA 1ZNWA 4M22A 4Q1FA 3ZVRA 1GUAA 2Z5FA 2W83A 1G19A 2O0KA 1OJLA 4EFLA 3N2EA 2ZIAA 3LXRA 1XFAA 4FCWA 1WE2A 2OBMA 1G6HA 2DWOA 2ZI5A 1R6BX 3QKUA 1Z6TA 1OHHA 1EFCA 2IF2A 3LX8A 4Q48A 2DBYA 3IQWA 3KUDA 1OE0A 4YDSA 5GVRA 1BO6A 3DZ8A 4ZCLA 4I81A 3JVVA 3ASYA 3TQCA 5DI3B 2CK3A 4NKRA 2NO6A 3P1JA 4PPFA 3NIBA 3KKQA 5CITA 3EC1A 3RAPR 1N0UA 3WBJA 1G17A 1GKUB 1II9A 3ZIAD 4DZZA 1NN5A 4F7WA 3CIOA 3HYRA 2ZRNA 3A1TA 5LB2A 1EESA 1RE0A 4EDHA 5KPDA 4ABYA 2GA8A 1VPLA 4FXPA 4BEJA 1XZQA 1JJVA 1TQ4A 3OHMA 3GEEA 4BQSA 1FX0B 5JCPA 5B64A 4ZDKA 4EPYA 2ERXA 1NVVQ 4G3XA 4KHZA 2GCPA 1N6KA 3DHWC 3CRMA 3B5JA 3UPUA 3AVTA 5F9FA 5FTNA 2R6GA 4G5SA 1OHHD 4F4IA 2O5VA 1Q1EA 5IK2D 3I62A 4Q47A 1T0HB 3EPLA 5LDDC 1X86B 2VHCA 4JBXA 4PX9A 4U7DA 3VNUA 3KTAA 1P60A 4YQFA 3A1VA 2C9CA 2ZYUX 4XSHA 4EFMA 3P32A 1G64A 1ZCAA 2D7CA 2RAPA 1OIVA 2IXGA 1SXJE 3ZVNA 1P62B 2GJ9A 4QC2A 4BZXA 2DYKA 4Q4JA 4RD2A 1DG3A 5CK5A 3U7FB 2O0JA 2WWFA 5DSZA 5L3VA 4DC9A 4CEJB 1N5IA 1VCOA 2KJQA 1NL3A 4RD6A 1FQKA 1SULA 2IS1A 2GCOB 1R5OA 4V02A 4D4MA 4RSGA 4P3YA 1Z8FA 1T8UA 2RGNA 3GLHA 5EE5B 1X6VA 4NYJQ 4TN1A 2WWIA 4FMDB 4D80A 1AS2A 4LX0A 5GADl 1OV4A 4F92B 4IVQA 1IXSB 1DG1G 2PZFA 3N70A 3KKOA 1CULC 4TL6A 1YR7A 2RGXA 3MAAC 2DFNA 1FMLA 3VTKA 1AIPA 3VHLB 1G6OA 1I4DD 1JAIA 2MSCB 3QKRB 1W36D 4GP6A 2JLUA 1ZYUA 3KKNA 2ZVQX 1OH8A 4DDVA 4M0LA 1Z22A 4KV9A 4DSTA 4AY2A 2OAQ1 1ZW6A 5HCIA 5G41A 3IILA 4O0MA 4FWIB 3WRYC 1AKYA 1JQJC 1NY6A 4UQOA 2A9KA 1G9XA 1P72A 1SXJB 2JASA 5AK0A 2J3EA 1N6RA 1GL9B 4AD8A 1ZNZA 2J7KA 3IO5A 3KJEA 2OILA 3TVTA 3B2EA 2QRNA 1N6IA 3L0SA 3VKWA 2ZS7A 1LF5A 5D3QA 1IN5A 1KJZA 5EJEA 3LBIA 4NYJR 4J0QA 1TU3A 1OKKA 5FI1B 4BFVA 1NN0A 1VYTA 3AB3A 3SHWA 3Q5DA 4OK6A 3V9PA 4MDEA 1UBCA 2ZSDA 1TL7C 1G5PA 2HJGA 2IHBA 2WTUA 1ANKA 4US0R 4C2TA 1J99A 1N6NA 2IUSA 4KI0A 3AP3A 3KQUA 1S3SA 5DH9A 3ONWA 5FBQB 4JL8A 1KNXA 1TAGA 2OV2A 3EIEA 4V0MA 4RJLA 1U9IA 4TMZA 4AYXA 1W2GA 2CL0X 3GLIE 1VDZA 3QBTA 1P73A 2ZI7A 5TARA 2MMGA 2NTYC 4MDFA 2YWFA 1KDOA 1WP9A 3W3ZB 3K0EA 1NG1A 4GI7A 1OXUA 3NEYA 4G5RA 5LD2B 4OJQA 1NF3A 1G20E 4BFWA 1E2GA 3KL4A 1QVAA 5B2ZA 2Q21A 3V4FA 2ZI4A 3CB4A 3KB1A 621PA 4B3CA 1ODFA 3FE2A 2NQ2C 2QI9C 4B33A 4D0NA 4KBGA 4W9MC 3BRWD 4RZUA 2CDNA 3KDSE 2J0VA 2R62A 2OCPA 5EZ6B 2J59A 4M21A 1MOZA 2IA5A 1W2HA 1W0KA 1OFIA 1P4SA 1W46A 1KJYA 3OIYA 1TQDA 4WW0A 3K0CC 3SNHA 3KB2A 2HYDA 2BCGY 4IDHA 2CVFA 4ACAA 5EUQB 1GILA 4Q4HB 3SN6A 2J46A 3GLIB 2OCAA 2X77A 1FOEB 4IOKA 1JALA 2DHRA 4M1OA 1YHNA 2O0HA 3FKSA 2WHXA 4JVSB 2B92A 3VR6A 5CJ2A 2A5YB 2NO7A 1BOFA 3ZGXA 4R2HA 4NCIA 4RD3A 1Z83A 2OESA 1CIPA 3G82C 1ZIOA 1Y3AA 3VX3A 2IS2A 1EFTA 2IS6A 1GZSA 2QNRA 5K8IA 2GXAA 2BCJQ 2WKRA 2G1KA 3AP2A 2O8CB 2F3TA 2V1XA 2ZUBA 4GNKA 4DSOA 3NDBB 1N5KA 3ZVMA 4HLCA 4LSGA 3OIUA 5E7MA 1GVNB 2GBLA 1W0KD 2P65A 1DAFA 4POAA 5E3HA 1VECA 4IDQA 4IOJA 1KO5A 1OFHA 1P5ZB 1DO2A 5KDDA 1KIMA 3Q9LA 3D3QA 4D82A 1DEKA 1XNJA 2XGJA 4W5HA 1VG8A 1P2TA 2GKSA 2FPKA 3ETLA 1GRNA 5J5CA 3OIWA 4RZ2A 3C16C 4RZXA 5G3ZA 3WP0A 3TUZC 2KBFA 2YV5A 1E2JA 4HLUC 1DTSA 4CEIB 4Q9IA 1NBME 1FFHA 3QF4A 2EFEB 2B21A 3U7HB 5HZKA 2QPTA 2ZJZA 1ELOA 1E4YA 5C4GB 4A0HA 5CJPA 4MRVA 2PMKA 3D8BA 3NTUA 3QG1A 2ZTSA 3QNUA 1S3GA 1A1VA 3BH6A 1CR0A 2HUPA 4EIWA 3K9HA 4XH9B 4CT5A 4AIIA 1GNPA 1CTQA 5KU1A 4DCSA 2Y8EA 3EPKA 1G7SA 3QKSB 3UXMA 2QG6A 1U8AA 3D31A 5E95A 2ZAMA 5EXSA 2YZ2A 3W6NA 5JECA 2BMEA 2BC9A 4NU0A 3DOFA 1DADA 4ZI2A 5KSZA 3QXXA 2CCKA 4N1AA 1MH1A 2E9SA 3BWDD 2QRZA 4GSYA 2BBTA 1DAMA 4JSTA 1OW3B 5F9HA 1XZPA 1XRJA 3B82A 1A7JA 5CIWA 5J4VA 4KODA 2P6RA 4DDTA 3U44A 3PV0A 1M6NA 2ZI9A 5JS8A 1US8B 2YVUA 2WV9A 2ZI6A 2ZJ5A 1FZQA 3QE0A 2W58A 4EQ6A 4DLXA 1NSFA 3L82B 4Q4LA 1E32A 3I5YA 4IXNA 1NJGA 3MFYA 3EPHA 1ONBA 3V4RA 3TJZA 2VQSA 1UBFA 1Q22A 3G5UA 4BRWA 3AF0A 3X1WA 4NDZA 1FW6A 1IOZA 1P2UA 1DO0A 2C9YA 5FTKA 3BB3A 3SBDA 3EARA 4O25A 3UMFA 3SFVA 2BDTA 2WVJA 1Z3IX 1OB2A 3P4XA 1WQ1R 2FSFA 2OUKA 5JFGA 1XU4A 3MWJA 3DM9B 3THOA 1TADA 1RPZA 1DS6A 4ZDWA 2HV8A 2W2VA 3H2YA 4R2IA 3SFZA 2PBRA 4FI3C 5AUPB 1N6OA 2ZE8A 4EFNA 2OXRA 4Q1DA 1GSIA 2OZEA 4V0NA 4E09A 4CGZA 1JR3A 3NG1A 2ZANA 5JZVA 3CPJB 3C5CA 4LV6A 2CJWA 4LCBA 4FWTA 4I4LA 2GJSA 4Q19A 4B35A 3WHKA 2JEOA 1J2JA 3ZJYA 3A1SA 1HUQA 3RSLA 3WYGA 1B0UA 3AVYA 2ZRMA 1MO3A 4LC0A 5BQ5A 2GF9A 2WKQA 3KKMA 3T1OA 5K8TA 4KYIB 4LJ4A 2C96A 2GRJA 1D6JA 2XAUA 2QY9A 5E7JA 4TYYA 3RS4A 1F3OA 3DKPA 3OEEA 2YOGA 2EFDB 4FN5A 3A8TA 5CIQA 4FINA 4TYWA 1E1QD 4C0AC 4HEJA 3MUFA 4Z8YA 4DT1B 4AG6A 2JAQA 2C5LA 2Q9CA 1NIPA 5BYJA 2IYUA 4II7A 4P4SA 4PQRA 2XJ9A 1II8A 3C7KA 1JAHA 3RSOA 4M1WA 3SYLA 4CIDA 1QG4A 2QUZA 3K0FB 4QGFA 3PUXA 1OYWA 2DWQA 1Q21A 2WOOA 3EWSA 3FYHA 3Q5EA 4M1YA 4Q03A 3RANA 1Z5ZA 3A37A 4A6PA 4IDNA 4US2R 1JR3D 2IYZA 4R9UC 3UMSA 3LLMA 4PC6A 3SQWA 3CR8A 3UK6A 5C4MA 2UKDA 5JJLA 4PQFA 1T3HA 2A5GA 3LO5A 2ZRBA 1S0UA 1COWA 1KI2A 1S2MA 2RGEA 3ZDQA 1MABA 3TNFA 3P27A 1KI3A 4BUJA 1OXVA 4UNRA 4M4SA 1X8KA 2BMFA 2PL3A 4UNPA 4WIAA 2YJTD 2DFTA 3U4QA 4TL9A 2W0MA 3UMRA 4DLZA 1XEXB 4GFDA 2IXEA 3OEED 4CEHB 4YMTA 1XJCA 3KQHA 1ZUNB 3GJ7A 3WYFA 2AWNA 2YC2C 1QHHA 2Z4SA 4G5OA 4MKIA 3NH9A 1FNMA 3PQCA 3RWOA 1XX6A 1NLYA 2BJWA 421PA 4BLTA 5FL3A 1VIAA 3CX8A 2IW3A 2XTMA 3BFXA 5DN6D 1ZD9A 1T5IA 1ESMA 3THWB 4LBVA 3GJ4A 2PZEA 4CF7A 1MO5A 2V8OA 5EZ5A 4LJAA 4O2LA 1E0SA 1S9HA 1G8YA 4IDPA 5P21A 2P67A 2QQEA 4FW9A 1X8LA 1U0HC 1TX4B 2OSBA 1KZ7B 3T1QA 1X8JA 3IHWA 4A1FA 2ZVPX 4HI0E 2JLZA 2QTHA 3EZ9A 5FUYA 1COWD 4AYWA 3FHCB 4EKDA 2ZSBA 2G88A 4B2PA 4MGYR 1SVKA 5GJVC 4KYUA 1W47A 1BYIA 3VQTA 1VKJA 4TYQA 4C4PA 3AF4A 4P31A 3DM5A 3R9WA 3H0KA 2XXAB 2IWRA 2WWWA 5C1BA 3GEHA 4PHGA 1NY5A 4TTQA 2VF7A 4KFRA 2IWHA 2B8TA 3T1VA 5JSZA 2R6FA 2CLCX 2KB0A 4DIDA 4HUQB 2HXSA 3PG5A 3HPRA 4NMMA 2FFBA 1G18A 1Z08A 2FGJA 2V54A 1S4QA 1KO1A 4QRHA 4LK2A 1W5TA 1Z06A 2BEKA 4KSBA 4D4JA 3W6OA 2GBLC 3A6PC 2HYIC 1TEXA 1QHYA 3L0OA 3AKCA 4URWR 3TKLA 1Z2AA 1G7TA 1AQYA 1IQPA 3BH7A 4LHZA 4Y0VA 1XDBA 1Z07A 2QA5A 1VYVA 1ZBDA 3ADDA 1SKQA 3R20A 3MMPA 1II0A 1M8PA 1QF9A 2CVHA 1XPRA 1XTRA 3LDAA 1RRPA 1NBMD 221PA 2ECKA 4IOMA 1Q20A 2QAGC 3IPXA 5FPHA 1XWIA 1M7GA 3GJ0A 2PJRA 4FMBB 1Q3TA 3W34A 3IEVA 1ZM2A 5DN6A 1D9XA 2IYLD 2FN4A 2W6JA 3LRPA 1E79A 5C18A 3K70C 2D7DA 2ZEJA 5CYPA 3QOFA 3ND8A 1CRQA 4M8NE 5IT5A 4LYFA 5SZHB 3I61A 2FG5A 4M9QA 1VHLA 1QVRA 2JIZA 2YWEA 2ZE5A 3GLHE 4PAMA 4KITB 1JPNA 3FPAA 2V1UA 3CPEA 3IHLA 2RGBA 2WSMA 1R4AA 2RGAA 2CHVA 5J4HA 2GZAA 3MWLA 3PUYA 2VIIA 4G01B 4QFMA 2I4IA 1ZAKA 4A2WA 4JLOA 4KLZA 1TQ2A 1TUIA 2PX3A 2REOA 4GOXA 3THYA 4NP6A 1GITA 3LV8A 1F60A 2GWHA 1XB2A 2CE2X 4P0TA 1XTIA 4D6PA 2L0XA 1XP8A 2VO1A 2KWIA 3M6AA 3CX6A 5EE9A 3NBYC 1ZD8A 1FTSA 2DPXA 1WBDA 3KTAB 5EQTA 3B1ZA 3CPHA 5IHPA 4E22A 4JT2A 4LJ8A 3ZH9B 4I1OA 2IYVA 3QIAA 4JIMA 4URVR 5DHFA 2W6JD 1UJ2A 3A36A 3D7MA 5H68A 2WZQA 3L43A 1U0JA 4Q4JB 4UNSA 4PC3A 2QM7A 4OHZA 4PSKA 4RFSA 3ADKA 5JI3E 2FSGA 1IHUA 3B60A 2XOKA 2F1HA 2HLDA 5AJVB 3GLHB 1IJFA 2IYQA 2Q0HA 3RRNA 1E98A 3GFPA 4HDOB 5CLLA 3AF3A 3GEIA 4PC7A 521PA 2IUTA 2OCYC 3L0PA 3TSWA 1W0JA 2GK6A 2QL6A 4Q02A 3K0CA 1Q3HA 4IJMA 1IN7A 2ZYWX 4V0ME 5KOYA 4GZMA 2ZJ2A 3L8YA 3ZYCA 1GP2A 1PLJA 4MYCA 1W48A 3CLVA 3B1YA 3C15C 1QDEA 1KSHA 5DLQC 2G3YA 2G1JA 1YZNA 1KY3A 1TUEA 2FEOA 1T8TA 4AG5A 4TYNA 1N25A 2JATA 3OF5A 2BBSA 4MITA 2G9NA 2PX0A 4LGMA 1JEDA 2R6AA 1EG7A 5AJZA 3FMIA 1BH2A 4NPHA 3CNOA 1ETUA 1XTSA 3MSXA 2QE7A 3B78A 2XOKD 1JJ7A 4B6EA 2VHQA 2VEDA 4DLUA 3U6BA 2ZYTX 4AKHA 3L0IB 1YZGA 4EPXA 4ZKDA 1KMQA 5EXTA 2WPDA 4JBWA 4WBSA 3BFVA 2Q6TA 2QBYA 821PA 3KQNA 5BW8A 4WZAE 5L3QA 1I4TD 1HA3A 1MO6A 2BVNA 3FVQA 4N0EA 3HJNA 1Z47A 4WOPA 4XWOA 3VU9A 4IEEA 5FOUA 2ZE7A 4BE7B 1NKTA 3FB4A 3HDTA 5D3MA 3NWJA 3K1JA 3GP8A 1W4CA 3K09C 4JVLA 4QBGB 1FP7A 4LC1A 2DFKB 1EWQA 4HLUA 1HT1E 2BOVA 3AH8A 3WRXC 1GM5A 4EPRA 4DEXA 1H8HA 1P9WA 3PXGA 2H17A 1D2MA 2ZR0A 1KK0A 3SR0A 1XD2A 2X2FA 1GTVA 3QY0A 3U5ZB 4A0FA 4A2PA 1TNDA 2QE7D 4WXRA 1W49A 4L16A 4V0LA 3IPYA 1Z2CA 2WOJA 2V7QA 2Z0MA 3LNCA 2F43A 3CKLA 3OE7A 4MH0R 2WPDD 3AF2A 1PJRA 1UBEA 4I1SA 3Q3JB 3AVQA 1Q1ZA 4FMCB 3UATA 5AR1A 4Q5IA 3QJYA 3WXMA 1XCGB 3T5GA 4LPSA 1AZSC 5JS7A 4JVNA 4LJYA 4CYMA 1EX6A 1VCNA 1EFHA 3LBNA 4TSFA 3ADBA 1E9DA 3GLFA 1WBBA 1H65A 1C9KA 2YOFA 2B8WA 2JJ8A 4KU4A 4ZCMA 1N6HA 2W6IA 2JLQA 2GZHA 1U81A 4DLVA 2VP5A 4MYTA 1NI3A 3LW7A 1RYFA 3ASZA 2G6BA 2OEPA 4A8JC 5L3RA 2J87A 2CK3D 4CVNA 1DAGA 1S96A 3OEHA 1EFRA 4GT1A 1LNZA 4X8OA 1IXRC 2V7QD 3K0AA 5AUNB 3ZD6A 3I73A 4IEIA 3VR1A 3B1XA 3OE7D 3ZVLA 1ZCBA 5KDLA 3VHXA 1TTTA 1OIWA 1QHIA 3CX7A 1TQ6A 1BS1A 1UDWA 3AUYA 3NC1C 3ZS9A 5AUOB 4DEYA 4ERNA 4LI0A 1S1MA 4HAYA 4O2RA 4NCKA 3NEJA 5EE1A 4KVGA 3CNLA 1A2BA 3U60B 1YZQA 2Q3MA 1FTNA 1KSJA 2ZU6A 5FOWA 4TSFD 5L3SA 3IGFA 2PMDA 5GJWC 4DCVA 2Z43A 5KNBA 5DIFA 1EXMA 4PZYA 4KCGA 4IVRA 4K81B 4V0KA 1YR8A 2HF9A 4KXFB 1R10A 2W6ID 3VKHA 4D4KA 2CBZA 3LY5A 1CF4A 3KKPA 1E99A 4OI4A 2P0EA 3EIHA 4PSVA 4W5JA 4BLPA 1CS4C 3QF4B 3PEUA 3MLEA 3O8RA 1Y63A 2H5EA 3OEHD 4Q00A 2QPOA 2VRWA 1IY2A 3WP1B 5CM9C 3RLFA 4LJ7A 1J8YF 3KJIA 3IBYA 1PLLA 1RRFA 5ANRB 1E0AA 4JKYA 5FH9A 1M74A 4B73A 2J0SA 4EPWA 2WWGA 5B57C 2ZSAA 3QUSA 4TMTA 1KDRA 1RJ9A 2IT1A 2ORVA 5GJCA 4D4LA 1E96A 1X1RA 3R9IA 1YZTA 1G7RA 2GVDC 1A2KC 2QPAA 2PEZA 4N3NA 3G0HA 2DY1A 4LDJA 1LB1B 1IY0A 1RYHA 4JLPA 4TL7A 4BZQA 4BFSA 4EJSA 4P4UA 4QGGA 1KAOA 2F7SA 4HZIA 1JR3E 3J81k 1MR3F 3GCGA 3PR1A 4Q7MB 2A78A 4WA7A 3W5JA 1Q0UA 4B76A 3VAAA 3U44B 1Z63A 2HEIA 3MGCA 3SYNA 5HZHA 4YXWA 1M2OB 3C14C 3EPJA 4MUAA 2A3RA 4EQ6B 1E2NA 4IKEA 4ESVA 3B8HA 2GXUA 2F6RA 4HB0A 4TLDA 4X8HA 1RRCA 1HY3A 5JJIA 4HB2A 4QG7A 4C0LA 3RNLA 4QOSA 4DHEA 4OHVA 4XIGS 1J90A 1KI9A 1SVIA 3LLUA 3UWOA
chains in the Genus database with same CATH superfamily
2VUUA 2WU0A 5JUWA 4JWKA 1FMJA 1QH9A 1BVUA 2C03A 4H4EA 3WA7A 5DRYA 5FTWA 1Q2UA 4YMVA 1Z45A 3A06A 4FEEA 2GUWA 3KT8A 5HGJA 1E3IA 1I2DA 1NASA 3G13A 3H2KA 2OWEA 2JDIA 3KLBA 2JD2A 4L8LA 3T5DA 2VBCA 1Q92A 2BRUC 2XUHA 1M1NB 4OOFA 3GWGA 3T94A 1I7PA 3NFRA 4JEHA 1QYVA 1Y3FE 4YCCA 4ZT4A 1GYRA 2WUFA 4L5YA 1UBKS 1L3IA 2FSVA 4P4TA 4BBZA 3DZJA 5K8LA 1CR1A 1GGNA 1IUKA 1HSZA 2WJ4A 4AX8A 4DQDA 3L8EA 4CIVA 1MA0A 3HDGA 2O1EA 2BR4A 2H4JA 1I2CA 4NU5A 3R3SA 1VL8A 3K32A 4A6DA 1V1JA 4BECA 4EBFA 2FZLA 3L8CA 4JODA 1D2HA 5G1PA 3ZZTA 3QXSA 4RD1A 2HDWA 3O2QB 3QXHA 4OXNA 3KQYA 1DC8A 2YWXA 4CKBB 4EPVA 2ESRA 1U3CA 3A0RB 4I5GA 4W7HA 4JLAA 1K5GA 2C9MA 1P31A 3H87A 3M6MD 4PZ0A 2VDJA 5ARBA 1FDVA 4TN5A 2VPXA 1WD5A 1V3VA 4HBZA 3GP5A 3KYJB 1JIJA 1SZPA 1VG9B 3NV7A 2Z8YM 4PM4A 2GK3A 4KE7A 2UU9B 4B85A 2YIMA 5LP6B 3BQNB 3EGXA 4MRMA 1Y6JA 2OGTA 5C0OE 1SFRA 2H54A 2JDID 1KSFX 1QQTA 1YJQA 3AR3A 2HQRA 1Z8DA 2VJCA 4FGSA 1TM1E 1GXSB 3GBSA 2BEVA 4HUTA 5L45A 1ZO8A 2ANCA 1TFRA 2OHOA 1PJLA 4OQPA 1RLIA 2OV8A 3OQOA 1U2RA 1VXOA 1ZIYA 4M9UA 1OREA 3DUFB 3ZHVA 1NXPA 2O5RA 2VQDA 1XQXA 3EK2A 4WAUA 3BERA 4HGOA 1THTA 3VO9A 1LVGA 4X64B 1A4UA 1JVNA 3MCUA 2F1RA 2B82A 1KEPA 2VNKA 3SOZA 1IEWA 5KSYA 2O52A 4HGZA 4CKWA 4F3YA 2E6UX 1W5AA 3H1PA 2P9ZA 4W1SA 4GOOD 1BRMA 2B78A 2ERYA 1C8VB 3N0WA 3QE2A 1IHOA 3TK1A 3WMGA 4RZQA 2ZI3A 4II3A 5JROA 3CEHA 4WFJA 1W1WA 3RNOA 2EGHA 3C2QA 1O95C 3E7FA 3W2TA 5MGBA 3EOBI 3K0SA 3EAQA 2DUMA 4GR5A 1J56A 4NR0A 3JTMA 5F35A 5EXEA 3BT7A 1P6QA 2NZXA 2ORIA 3G8CA 1PEAA 1PJSA 4YJ3A 1QC5B 1QRUA 3KR0A 3TPZA 3GFTA 4CR7A 3WFJA 3QF7A 4X6UA 2OO5A 1QS0B 2VHJA 1GNSA 2I8CA 4LDQA 3BXFA 1QGOA 1N32B 5KX5B 4PZCA 3GN1A 1CKEA 1CJBA 1NT4A 3LHKA 4BQIA 3UT5A 3KL2A 4DE5A 4QEDA 1DXOA 4NZOA 3VGPA 2XGSA 1YVEI 4BZPA 3Q3GE 1I4LD 1X8XA 2IY7A 5CFPA 3N8GA 1U63A 4O5AA 4JBIA 3EVFA 3C7DB 4LYHA 5DN9A 2D00A 1Z7BA 2FMFA 3OLVA 4DV7B 1U99A 2P2GA 2OK8A 3KOWA 1KPGA 3ODGA 4NI5A 1NVEA 2IZ6A 2E6KA 4FZ3A 4B3DA 2OVBA 1NBOA 1Y5NA 4RHCA 4DCCA 4AKIA 1AKUA 3HFJA 4PSCA 1ODLA 3SSMA 4BQPA 5AFSA 4YRJA 3T7CA 2MYNA 5AW0A 3V7WA 5I4KA 3R4VA 2ZJ1A 3FDFA 4UPEA 3TSZA 1A69A 4BWVA 1XRPA 5KINB 2H1LA 4ER6A 2YVAA 3FTEA 4N9QA 1CQZA 1YZVA 2VZLA 2J0UA 1QMPA 3WYNA 4XQ0A 4L4RA 4FWBA 4X1OA 1M34E 2PWZA 5TEWA 2GKOA 4HDCA 3RS3A 4UOZA 3M5CA 4CW7A 4HMPA 4E3WA 4IDBA 3PQ2A 3R4CA 3O47A 4JSRA 5FBRB 1U7PA 3VHQA 2AJCA 1MX5A 2GXSA 5JLJA 3RLIA 3W8RA 2VUIB 2FGKA 4QBFA 4HCJA 2Z56A 3QZUA 2D74A 3DNPA 3I3SR 3FYDA 4W82A 3T1TA 4F6CA 1VGQA 2IOQA 3ND9A 1U98A 1KVUA 1F17A 4PLHA 5CG2A 1GNTA 4JENA 3UCFA 2A0YA 2JIMA 1RAGA 2HH9A 3OPXA 5BQPA 1DOHA 1QOQB 2RI0A 4A5SA 1P44A 2QXTA 3TZLA 5KSWB 5LXTF 5LLSA 5IM4A 4AF8A 4BLQA 3L01A 1CRLA 1L8QA 2XB2A 3O8OB 1CHDA 2YR0A 3DKIA 2NP7A 3IQXA 4ISBA 3KQTA 3ETHA 1TFUA 1BU8A 3VKUA 3SQOA 3RV4A 1XZBA 2IEZA 2AOVA 4PIPA 4P08A 4YUAA 3NJ4A 2EVWX 3WYBA 3JWEA 4DYDA 2GARA 1I36A 3PIDA 4J6EA 4DMMA 1CUWA 2PX6A 1YTUA 1NNLA 1TF7A 4WZAA 1UDRA 4CU5A 4PCVA 2AC4A 3S2IA 4PX3A 4IVPA 3PJRA 3QLUA 5IAAA 1CX9B 2W2KB 1XJ0A 5FFNA 4N40A 4BJ6A 2UYOA 4BFCA 5AI8A 3H5VA 4JXXA 4G25A 4II2A 1S1CA 2RGRA 1I13A 3Q7TA 4GBMA 4QSMA 1Q0TA 5JPDA 3QMVA 4NYIR 2OZLB 2VPWA 1R88A 1XBTA 4QGHA 4CL2A 4DIFA 4J0DA 4BRZA 5JFOA 1AS0A 1G21A 1WOMA 4EKYA 5D1NA 4CFYA 5E6UA 4AO7A 1CR2A 3AM5A 3PD0A 1RLOA 5AK4A 2WC1A 3F7TA 1VSTA 4RVGA 4QFBA 1JAZA 4PO9A 3N86A 2V55B 4YQEA 1SXQA 3RRFA 3U9LA 3MIZA 4HN9A 3JWGA 1Y6ZA 3ET5A 1R4MA 1Z6QA 4TMVA 4EGQA 2FN7A 3T52A 3GRCA 5GM2A 4MV1A 1QTQA 2XUJA 3UAXA 4B9EA 2J3IA 2C7OA 3TO5A 1O77A 2WD9A 1L2TA 4KBYA 2VT6A 3OPMA 1T91A 2Z4RA 3EJWA 3GNSA 1F8GA 3EPRA 4UHBA 3QPCA 1IHDA 3QU9A 5F21A 1FJGB 3ONFA 3I1YA 1NW9B 1ZI6A 2AQHA 1MT0A 4BIIA 1U5AA 1OV6A 1M73E 1ZMBA 4QXOA 5ALFA 2VUSA 4BB5A 2VQFB 1F8UA 4N3BA 5D87A 1TK9A 5AKJA 2NTEA 1B6SA 3WGJA 1O5OA 2PPLA 2PVSA 4EMSA 3JARB 5KTSA 4FKBA 3K6SB 5JRJA 1U8ZA 2YXNA 4YJ2B 2Z9BA 4E5PA 5B1HA 1E5XA 3M3DA 2D5IA 1A8SA 1G9TA 4FR0A 4QUBA 4GXTA 4NTZA 2LCFA 3GELA 3N07A 4P98A 3VH3A 3VPCA 4AY5A 1EFAA 3OBBA 1BN6A 4QX6A 5FYQA 4JN6B 4WFQA 4EO7A 3HUUA 4E70A 5CAEA 5HS6A 5J23A 2VP6A 1CRZA 3E15A 2YWBA 3UJ7A 2PIDA 3AY7A 4ZV4A 3SDZA 1K7FB 3FTCA 4MGZR 1AN0A 1C3JA 3I0ZA 3QEJA 4C03A 3CLKA 3UKDA 4X65B 2WD7A 1U0SY 2J5XA 4R41A 1E7MA 1FBTA 4A8JA 2XDYA 4FSHA 1HYQA 4FN4A 2H07A 4TVOA 4DJEC 1KDTA 2E4UA 2RK4A 5IWCA 3AG6A 3NJRA 4WJZA 1GPJA 5GPBA 4UTPA 2X58A 4IHJA 3DBOB 2Q5OA 2FEWB 1CP2A 2QTGA 1DBVO 3FX2A 4J75A 4PO1A 4UEWA 4E5KA 1G59A 4NCAA 1JWBB 1W5BA 3LECA 4XE5A 5M34A 3T12A 3SCZA 3KVVA 3WSTA 2PYDA 2OBNA 2AR7A 4W9RA 2C2YA 4F5YA 4CRWB 1IM2A 2YHUA 5AKHA 3UMJA 3FCUB 5LQCA 3OE1A 3RRXA 3N7TA 4L2IA 2BFCA 4DJAA 1G4UR 3PRYA 4AZ3B 1Q44A 4CFSA 5BWCA 1T0PA 5FUWA 3GLFE 3CKYA 3BFPA 4QGBA 2Q3CA 5GP1A 2C4UA 4CTJA 3CUVA 2PANA 1NJ8A 4EL0A 4RW0A 3CTPA 2CZGA 1TEZA 4Z7QB 3I92A 3EXHA 4G5FA 3KWFA 4KWIA 4LOAA 5J63A 2C5SA 2D62A 4WDQA 2G63A 2Z8YA 4XQEA 5LA6B 4U02A 1P1BA 4RK7A 4F5WA 2WJYA 2JFBA 2GHQA 1HXHA 3PQDA 3LBAA 1FUIA 5F3RA 3ZHUA 1OBFO 2ZRPA 1GAJA 1XHFA 3AEZA 3D3EA 4KTTE 4TLLB 5J4KA 3RK1A 4R7ZA 1NMQA 3KWLA 3PDCA 3QI7A 3S2ZA 3UHOA 3UT0A 3EUFA 2E37A 1ML3A 5FPKA 5JBQA 4LOIA 3FNIA 1SU7A 3RG2A 1P8JA 1FLAA 4MVYA 4MS3B 3WDMA 5A4JA 2WJ6A 3SI7A 4XGRA 2JRLA 1OB5A 1P4JA 1VB3A 3PFCA 1DQNA 3GJ8A 5DBGA 4M83A 4D3XA 2EQ5A 5HSGA 4CGYA 1FFYA 2KQUA 3QMMA 1YC5A 2CLOB 5HWSA 4N8SA 3WMEA 2O48X 1COZA 1XSEA 3S8MA 4TZ0A 2JLXA 4WKPA 5EIHA 4OBXA 1SCIA 3WGKA 4KWEA 4UEQA 3U6KA 1JWLA 1ACMA 5IASA 2JJQA 2W00A 4JQSA 3ZNOA 4TKVA 2GZMA 4ER5A 2BUAA 3KZ1E 1LLFA 4MEBA 2NNLD 3GDGA 4URFA 1PGNA 5K0LA 1U80A 1PR0A 3IUBA 4NV1A 4EAQA 4QJIA 3CWCA 1R18A 1I3KA 2A4MA 2ZREA 4W5QA 4M0FA 1SXJC 4R16A 1W73A 2WIAA 4P84A 1G8FA 3RIYA 1JHDA 4MOWA 4RH3A 1U0NA 3ZY3A 4D45A 1C9MA 3LIPA 1GNQA 2Y0BA 1E94E 4D3ZA 2AK2A 3A6ZA 4LXGA 1E79D 5H3LA 3VHXB 1YS7A 2F48A 5DNDA 1BMFA 2WNHA 3UIEA 4HWKA 4FJ2A 3GHHA 1YRHA 2JKZA 3KAPA 3VZCA 4F3CA 2HF8A 4IH1A 1NLMA 2BHLA 2Q7OE 3T1NA 4B84A 4HJXA 2BFBB 3GB9A 5BSWA 1EKXA 3F49S 3UB2A 3OUZA 4Y9UA 1YU9A 3K2QA 2XPCA 4JYCA 4EVSA 4MUNA 1VRVA 1XZDA 5IXYA 5JQGF 1IAVA 2QTVA 4R2MA 4MRRA 4ZZ1A 1DELA 4FR2A 3NKVA 4JOQA 2NTJA 2BGMA 2FLWA 4QVKA 2J09A 4E1AA 4O4LF 1OYYA 4FD3A 2YTZA 4F0JA 4B4VA 4CLDA 3JQAB 5DE3A 3ZWAA 1M2JA 1Q11A 3V34A 1E0DA 4XB6B 2BSQA 3VUEA 2DPLA 3RO7A 2AHOA 3RUDA 2ZCUA 1YDWA 3GG9A 1CUCA 2WYVA 2YRFA 4HAWA 1CD5A 1W88B 4Z8XA 1MIOA 1V25A 1P29A 4M54A 4RIEA 3GDHA 1QFSA 1C7IA 2QIPA 2PYIA 2ZT8A 4GIBA 3REFA 2WU4A 3LVRE 3NNDA 4OYHA 3OZCA 3DDSA 3IEIA 4NBNA 1RJ9B 1I6MA 4EW3A 3F5FA 1NYTA 4MUMA 2RJOA 1SIUA 4JDUA 4PU0A 3SC2B 1SOVA 4KK3A 2I6XA 3TVDA 4BNHA 2QU8A 3RDPA 1WOYA 4G0VA 1IAQA 4TM7A 1KMHA 5FLYA 4IQ4A 3LU1A 1PTJA 2F3UA 4NAHA 2DCMA 4R1TA 3KZXA 3ME5A 2XCIA 4LKRA 1VA5A 5I9IA 3AVXA 4NQRA 3VR4A 5DX0A 2BWJA 3FNBA 2C20A 2Y1KA 1T5BA 4G6ZA 4NECA 1R3DA 5BYBA 4EL5A 5LIRA 1JDVA 4FFMA 1PKXA 3FR8A 1R0XA 3EFOA 5CH5A 2GCEA 5CH8A 1K8RA 3MT7A 4QEZA 2CGEA 1AK2A 3JAKB 4HFJA 4ON9A 5JO0A 3O1JC 3MHTA 3N2NA 2OXCA 5BSTA 1FFEA 2AFIE 3A2MA 2O7SA 2FWBA 3A6DA 3NM4A 4Y1FA 3VKGA 4DR5B 1JLMA 1W5EA 5AM2A 1K2VN 1XDZA 1SGWA 4XJSA 1D1TA 3W5SA 4TV9A 2Q41A 3ZV5A 5FTMA 2PLFA 1TF5A 4RFVA 1J8FA 3VR2A 3CJTA 3ZHYA 2X7XA 4EW6A 1R50A 4QJ3A 1PL0A 2HRDA 1O0CA 1DBQA 3DMYA 5AK3A 3BIOA 3E5HA 1QH8A 1AA9A 1XZCA 3FD8A 4NONA 4CR8A 4GPEA 1XZIA 2YWRA 2RHRA 2V7UA 3CZ9A 3KUCA 3AV0B 4NU6A 4BP9A 3QWFA 3R9XB 3T6KA 1DEAA 4C0KA 4DR2B 2Z1DA 2GPSA 1P4HA 1X2BA 4PGMA 3TI7A 4RHXA 5C7LO 5HQTA 2GASA 1O94A 4M0MA 4OLJA 5LWQA 2C82A 1L4EA 1UC8A 5DO9A 2WSLA 1VL6A 2UZIR 3R7AA 1C0KA 2JK0A 5MF6A 2DBRA 1UH5A 2FJ0A 2PV7A 3TUJC 4B09A 4RTQA 1U11A 4MQ4A 1L4LA 4GQAA 5IMBA 1XDSA 1H8HD 2OCDA 3B5IA 4HZUA 2OB1A 3OF3A 1AK9A 5FUBA 5G2OA 4JLNA 4G84A 3K7EA 3HR8A 2C9ZA 5EXXA 1UDXA 3IMEA 4DNQA 4WKCA 1L4MA 1QCZA 1G41A 2OV6A 3HCEA 2A8YA 2OCLA 3HG7A 1AX9A 3M6XA 4BLRA 4F12A 1HV8A 1W4LA 1MJGM 1XD9A 3GD7A 3NX4A 3A6HA 3H0CA 1BEZA 1KJJA 2ZR8A 2F8SA 2I29A 1ZRNA 4RV4A 4ENVA 2DBVO 1WXGA 4WRRA 4D43A 3IVCA 4JI6B 4JBGA 4MW9A 2REXB 4A92A 5BYAA 4MMZB 4ENRA 2XB4A 4EPTA 5FBKA 1T6BY 1QP4A 3B12A 2RBEA 2YICA 1MBZA 1KMNA 4RVUA 1OLSB 4QFDA 3IESA 1ZU5A 2PSHA 1O94D 5D7BA 3ADOA 1E9VA 1KKMA 3G79A 3KOOA 3FRJA 4OJYA 4OHYA 3Q85A 2AX3A 3T95A 3KETA 5F4BA 1P2BA 3DBLB 3PNQA 3MXTA 1RIFA 1YRYE 1ZM9A 3GXOA 4KMRA 1F48A 3TTUA 2GSDA 2QTTA 3EWIA 5ELXA 3NQ41 1MNAA 1TAUA 4U6NA 1JG2A 2FMXA 3MMSA 1F2VA 4LF5B 1G5FA 4Z4GA 4D96A 1B1CA 1ZN7A 3E8SA 3S8YA 2JBWA 3L7LA 3OCWA 5DTIA 3RYTC 2HSGA 3COYA 2OYRA 1SVLA 3HLKA 4FYPA 1H42A 1ZD3A 3DTTA 1R8JA 1VA4A 3HB9A 5CDFE 4C2UA 3N6VA 2J7PA 5ALHA 2CMFA 3M1AA 3RASA 2OGSA 3EW7A 4BE4A 5IJ0B 1OWOA 2ZTVA 4LN1A 1E9FA 1CUIA 5EMKA 3TNLA 3E1GA 4HGRA 4CLOA 3BGWA 1GZ6A 1CY0A 2WAYA 2YOHA 3D0QA 1Z0AA 2LGJA 1GJRA 1KNQA 3CVJA 1CUFA 5CNIA 3WICA 5C8XA 1KEEA 3LPAA 3BTSA 2EKLA 2MMCA 4HYYA 3HKDA 5F7ZA 5BSVA 2IYSA 2ISQA 4YXFA 4FVTA 4TUYA 1NXQA 3UWDA 5FAXA 1NVUQ 1UMDB 2XUOA 3JQ8A 2CV1A 2V9CA 2EC5A 1XXHB 3P2YA 4U7JA 2F67A 3WO1A 1KJ8A 4EO9A 3UYLA 1UZNA 4HAZA 3AHHA 1THGA 3K6RA 5KSPA 2VP9A 5T3YA 4ESOA 4R01A 3BF7A 3OY2A 3M34A 3S7TA 1V7CA 4GP7A 1EA7A 2ZBGA 4XIFA 4Z49A 2JLYA 3TDNA 3WAGA 1TJ4A 3EIOA 2O3UA 4JJ4A 1TMGE 2MYPA 2Q4RA 4QFCA 1GWNA 2RK6A 2YIJA 1AURA 4K05A 4YEDA 2H1RA 3QXGA 4U9HS 3G9ZA 4BY9E 1QVWA 2XNJA 3H5RA 3K96A 4JT4A 3NM5A 4P83A 3VMFA 5DBOA 4Z3DA 3Q1KA 4K26A 2LIVA 1AUVA 2J7PD 3CUEF 3HS3A 3W1EA 5IYZB 3CVXA 1Q77A 1F9AA 1WDKA 1PZFA 5ENZA 2Z3WA 3AVWA 1JL3A 3ZE1B 1L1QA 1LLQA 4FBLA 4ZT7A 4G8BA 1N4DA 3JQFC 3LD9A 1M5UA 1V2GA 2EZ4A 2R11A 2R8RA 3EEYA 3A4MA 4EB6B 4LSMA 4J1QA 4XVRA 4WACA 4CG2A 5EYPB 3IAAA 5LZ9A 3E7XA 1KOJA 1SCBA 3ZWMA 3B52X 3HI6A 1AKEA 4MI3A 2I9PA 1F2TB 3LGXA 5KTMA 1M6YA 2ZR9A 3PQ8A 1KBOA 3OZ7A 4BO3A 3CNHA 4UXHA 4ZOLA 1JXOA 2HADA 2OFXA 3F1KA 4PE5B 4UTZA 4Z7JA 3JU3A 4YK7A 1QMGA 2NO9A 1KRWA 1V6SA 1E9CA 2HDNB 1JTEA 5KTYA 3MS7A 5T8KA 1RCTE 1I01A 1M1YA 1YR6A 2ZSEA 4PPGA 5ALMA 2A5FA 4RTNA 3VAZA 5DASA 3AIOA 1PJ3A 3PQ3A 1JDJA 1GL6A 1NMZA 1O57A 2Q27A 3OQBA 3QFRA 4IWXA 3TW0A 4UTNA 4LJRA 2VH5R 1UXIA 3V00A 1U1CA 3NHAA 5HF5A 2PUEA 3VDQA 3BN3A 4H27A 5H9VA 3Q8LA 3VO2A 3Q8MA 1O9BA 3ZI0A 1PRYA 3X1YA 4DJ5X 2A9OA 2O57A 4YCJA 4FP9A 2WWHA 1TZKA 1O96A 2G1UA 3DJFA 1MN6A 3M9XA 2CVOA 4YP6A 2MSEB 1ZH0A 4WXYB 2OQVA 1W52X 2LIPA 3HJUA 3IQGX 3O8DA 4YAKA 2GTPA 5FP0A 1EGHA 2Q2OA 1K6MA 1SUEA 4M76B 4ZEWA 2F3RA 1E2IA 4IQGA 4K03A 4WZBE 3E8XA 5SZJA 2JGKA 4ZQHA 2RHTA 3FCCA 4DLAA 4LHSA 1GZ5A 2AWOA 3PCXA 5TPWA 3U13A 4A8PA 1GPLA 1PDVA 4LY3A 1TAQA 1T25A 2QSUA 4RVCA 3P0JA 4PIMA 1O1YA 4B87A 1MXHA 3HRHA 3K5HA 4NV3A 5I7RA 4FQ8A 3AOEA 4IYJA 1T2UA 4Y2UA 1RBYA 3NIDB 3EC2A 3T9BA 1GPWB 4WV3A 1ZK2A 3GL9A 2O54A 3WGNA 3LA8A 4Q34A 5BV2P 3LYAA 4AI6A 1T43A 5C34B 4D02A 1QIIA 4IXMA 1IH8A 2VAPA 4DDHA 1WM1A 4M1KA 1YHZA 2GLUA 4ARIA 1IG0A 1NNEA 3RC3A 1ZHFA 3AX6A 4A3SA 3T5MA 5MFZA 3N1UA 2YYYA 2D5CA 3V1KA 4Z1OA 4DV6B 2EYUA 2J4DA 4A2QA 4AAYA 2A9PA 2GCOA 3LL4A 5ICSA 2ZDGA 3B1KA 3S1AB 2ZUDA 3AC0A 4EG3A 1IHPA 1QFYA 1BU5A 3HXOA 4NEHB 4JVMA 4ZV9A 3V42A 5GMOA 4F9GA 5A1TA 1V48A 1XEWX 1IQUA 3KXKA 4S1TA 3AYXB 5FNVB 3INGA 4QQ8A 2VSFA 3CLUD 3HKCA 4WY5A 4LY0A 5AI5A 4NBWA 4BMVA 2V7PA 3AB8A 5CGQB 3DNFA 4AXXA 5T5QA 3A2KA 1FXWA 4XD7D 4AURA 3ZD7A 3BXEA 1O58A 3ZGVA 3ZYZA 3H1TA 4MJ3A 3F1LA 4ZIRB 4NBSA 3FZYA 4X24A 2E4VA 2FW0A 1KMIY 2IF0A 4G89A 5DW0A 4AULA 1YJXA 1IWOA 3ELUA 3E2IA 3WDKA 3GGCA 1D0SA 5LLDA 1RP7A 2LDBA 2HA5A 2VNJA 4D9MA 7REQB 2IHKA 1SO8A 2I2DA 3TXYA 3LCJA 5KAMA 2Z6UA 5KSOA 2IXTA 4NBTA 3SK0A 4M7OA 1KDZA 1JEYA 2M98A 2OFWA 2CZCA 4MVJF 1V1MB 1QK4A 1X19A 2D0DA 2WM8A 5AVXA 2ZYGA 3AVUA 4KIWA 2YNMA 4GBED 2C1XA 3A31A 3MWKA 1FP4A 5CFMA 1FFWA 3MC1A 2PH1A 4CU2A 3NVMB 4RHYA 1XQ1A 4PLCA 4WGGA 1SNYA 3I8XA 1AGRA 3E7DA 2GWRA 3IUJA 1HDRA 2WEKA 5D5HA 3B7WA 2CFIA 3N05A 3PQEA 3UAGA 1G42A 3H9BA 5BSRA 3L6BA 4DZTA 1WCWA 5J2UA 3VC2A 3IP3A 2PQ0A 1SVMA 1W75A 2ZRAA 4HH4A 4R98A 1JQAA 4DNOA 1PZXA 3DXYA 1P3JA 4DXAA 3VH2A 2FKAA 2NOAA 4IV5A 2JLRA 3N75A 5E9WA 4RD4A 2QP3A 5DK6A 2BW0A 1MJGA 1EFVB 2F1OA 4RANA 3CNQS 5C7IO 3CT6A 4YAUA 2XZPA 3TLCA 4RFLA 5ETJA 3HDVA 3GEMA 3K8YA 2XJ4A 2BZSA 1IOWA 5FUVA 2C8VA 3LUKA 4LZWA 3BE5A 4WASA 1N2ZA 3L4BC 4LNUB 1V5WA 3OHPA 3TLXA 5K2MA 1CU1A 2NAFA 5IN5A 4EMTA 1JDTA 2PVCA 3DAOA 1KQNA 2H57A 2PT7A 5F64A 3V4LA 1N8SA 2X2EA 1UWVA 2I6UA 2ONZA 5DISB 1EP3B 4GOLD 3R0QA 2YNMD 4NMWA 3WBBA 4OB8A 4EGJA 4U7HA 1XQVA 2AMVA 1BA2A 1OOEA 1VKRA 2C77A 2CXPA 3LW8A 2ZUWA 4OQYA 3E9MA 5LQJA 1IEXA 1WXDA 4FMCF 4J94A 4RACA 4JBLA 5JG7A 5LQMA 4BOYA 4PLZA 4J3FA 4OF4A 3QNMA 2OA0A 1WB9A 1HLPA 4QBHA 2F55A 1J8QA 4FUQA 3NAGA 4YP1A 2OPHA 2JD1A 2QZ9A 5H5JA 1EI9A 1M1XB 1JZSA 1PWEA 1C0IA 3O3CA 4U2GA 4UU8A 5C8YF 2LKCA 4HWOA 3TLGA 1CJSA 3HBLA 4KUEA 2Q1TA 4D0GA 1JA9A 2Z8ZA 2P6OA 4BN4A 9LDBA 1VMKA 4ZANA 3WGTA 4ZJZA 3JRNA 4C5AA 4YLGA 4S0ZA 1PCXA 4FOLA 2XVAA 3UF0A 2C95A 3GLIA 2HTEA 2NADA 1E2FA 4ENUA 2Q6VA 5D6OA 4WBNA 2R2GA 2QLLA 2UVPA 4G9EA 1FNCA 1TU4A 2FUNB 2G04A 3L93A 5E6RA 3I2KA 1K5DA 3A1EA 4GRAA 4QXAA 3W7VA 3TQSA 5EJ6A 1GTL1 4HTFB 1KIFA 2EIXA 3DWIA 4FGUA 3WNBA 3K53A 3VYTB 3X2FA 5CB4B 1QZXA 1NUSA 1GFWA 1L5YA 5TDHA 2NU6A 1C7ZA 5EJAA 3A2LA 2B7CA 1RQLA 3IB6A 3O9ZA 4GX0A 1CQXA 2IE0A 4JQYA 5CLGA 4AIRA 2Y77A 4BRUA 2YXEA 3X3HA 2GHIA 1FDSA 1XC7A 1JU3A 2P2YA 1IMOA 1Y8RA 3AEKB 4H3HB 1NI5A 3L1JA 2CYCA 3RYIB 4INZA 3TIIA 3L4SO 2HQ1A 3LUAA 2YINC 3IERA 4QYWA 2ZXUA 2NP6A 4GX2A 1YR1A 4K9KA 4DHEA 3FLMA 1KYIA 2PJZA 4PRZA 2YW9A 3RWMB 4C29A 1Z4IA 4YCSA 4NJEB 3HYCA 4LBWA 1F2UB 2Q6OA 4XOIA 2G9UA 3PNSA 1KH1A 4OXQA 3OPQA 2NT4A 2BCEA 2OFFA 1UWKA 3OZFA 4NS4A 3ROPA 1ZUHA 3IQFA 4G0MA 4L0DA 1L5LA 3H11B 2PZLA 3UZUA 3LPCA 3SHWA 3FOEC 2QUKA 4CDMA 3ID6C 1PD1A 3D8UA 4R7TA 2O8DB 4Q1BA 4F1WA 2C99A 1JU9A 3ANSA 5CPBA 1FUYB 4C0WA 5AVSA 5JFTA 4OREX 4RQTA 1C4OA 3WBKA 1QX4A 2X86A 4LFCB 5CT4A 2OYCA 5KNCA 2JAHA 2XUDA 3H9JA 2CCJA 4JLDA 2NUTA 3STYA 3CEJA 2RCYA 4REQA 5ES3A 3ICQB 1DUIA 4BFLA 3A9WA 3ZLJA 4MA4A 2HXYA 1H2HA 1P7PA 1OT3A 1V0JA 2IYYA 5ED0A 5BWOA 1K7CA 1UZMA 1WZCA 2IH5A 1AVTA 1F1JA 3AO0B 3RUPA 1MO4A 3TSOA 1EPUA 1GQYA 1O89A 4JUDX 3X2EA 3V2IA 4BQNA 2QR5A 2PZBA 5C2JB 5EP1A 3DR5A 2Q7XA 3B6EA 5CA1F 2VSNA 1QG2A 3CH7A 3GQBB 4G26A 1RMYA 2H8KA 1TVKB 2VHXA 2YJZA 4MV7A 4XQGA 3C4JA 2G07A 3I2HA 3IUYA 1AM4D 3EQZA 3I9V1 3V6MA 3ZHCA 1B23P 2O8FB 2Y93A 1YIOA 1ZZGA 1D5CA 1NUQA 4FGZA 4BN5A 1Z9BA 5HKKA 4DR7B 3H5LA 4U2FA 1Y8QA 5TQ0B 2YV3A 3HEBA 4DKXA 3NASA 4XPIB 2GM5A 2ZPTX 1YF3A 5CCBA 2J1LA 1GPMA 1MIHA 1GUDA 1DAIA 2GLTA 4JB8A 5BN4B 1P1IA 1MLDA 2I7VA 2QRPA 3AFGA 3CF0A 1C3EA 4X95A 9GPBA 2GMWA 4KG7A 4ZXFA 5ALSA 3NCHA 2HWKA 1U7OA 2LE0A 1GTG1 4BDSA 3H8WA 1HR0B 2VTBB 5KNCD 4C3VA 4QHTA 4ESEA 4YUXA 1UOEA 1UOOA 1YL7A 3SVLA 1AGXA 3TXAA 2AG5A 5MHTA 4IGFA 1XMSA 4EYGA 4M7WA 3G8AA 3G8YA 3CZPA 4MW0A 5BQ3A 4KRYA 2BV3A 2ODAA 3DGFC 1P2FA 3FWYA 4RJKA 4NLLA 2H2IA 4P3PA 4UVDA 4ZVMA 4UE2A 3THRA 4E51A 4NZNA 5JQWA 4QU0A 4ZI7B 1TVEA 2H2AA 1KKLA 1EG2A 5KQSA 3M6WA 1PUIA 1BKYA 2V9ZA 3T9EA 5JI2E 1R0RE 4XX0B 3TRHA 3B38A 4MRNA 1UJNA 2B0JA 3HKBB 5TMBA 5U9CA 4QOFA 2P5TB 1LRJA 4LZJA 2XB6A 4PNPA 5LYJA 4TKLA 4R8RA 4M9CA 4MR7B 4BAZA 4REOA 5IFLA 3BIFA 4MYUA 1KYVA 1MUUA 1YVDA 2DECA 1A5BB 1O87A 2ZULA 4DLPA 2R6ZA 1IN4A 1EHIA 4BASA 3QVJA 5HF9A 1SHJA 4DCNA 1DT3A 2V0NA 2Z95A 2JGNA 3B6IA 3BFKA 2ZJOA 2XB9A 3C1TA 4XLLA 1DCTA 4G1BA 3C1UA 3IBGA 1WWKA 4AJPA 1PAUA 5ICMA 5EKSA 2VPPA 2IEAA 3ZU2A 4NXNB 1T4GA 3CV3A 3QFSA 2VPQA 4K28A 1P80A 1CG6A 4HH3C 1O3YA 3GN2A 3B89A 5FUXA 2EJVA 3PEEA 4J1NA 4U3JB 4C07A 1NZFA 3AF5A 2V7WA 1B2LA 1Q95A 1WUIS 5E4TA 1Q83A 4KMSA 4OAPA 4OPMA 1RI3A 1XZNA 4ZO7A 1VBNA 4F71A 7MDHA 1RZ3A 4HWTA 4UKDA 3UB3A 4C22A 3KQLA 1SUDA 3THXB 4MR8A 4RLSA 2AHRA 3A1DA 3WFIA 1HBJA 2AS0A 3GW8A 1OX6A 3S29A 8ABPA 1TZMA 1E9BA 4QYTA 1CQPA 3VDXA 3C8ZA 3N8NA 4DBLC 1JFFA 2JPDA 3C8MA 3BGOS 1DAKA 5CW1A 5TC4A 3HP4A 2PA3A 1DEHA 2QRKA 4OLBA 2NU9A 3PLAE 1YOVB 1QANA 3LL7A 4UPVA 3ZX5A 2GBFA 4RZHA 4DM7A 1PE0A 1XDWA 3EXFB 3K8ZA 4BV3A 3LVBA 2OGZA 3DONA 5JWHA 3IXQA 4GPD1 2D54A 2DKFA 4NHOA 1DNPA 1LLUA 4UBJA 4GWKA 3IT1A 3E9YA 3I76A 2ZSJA 1QGYA 2EW1A 1T8SA 2J9GA 3FF4A 1Y9JA 2P3SA 1Y4ZA 2RB4A 2RHDA 2WP8J 1MB3A 1DWUA 3KK0A 1FS4A 4MLZA 5JU6A 4R51A 1VSVA 1ZD2P 4OXXA 4BQQA 5BVHB 3DV0B 3S0JA 3C3KA 3MVEA 4MVJE 3JCZA 3TXXA 2G70A 1TMOA 2PAAA 4RVHA 4AT1A 1Y3BE 4TTVA 5CEFA 5F5LA 1SHTX 2AI3A 1WNFA 2QRMA 4PS1A 2DY0A 4KIJA 1N6PA 4DMFA 1ENYA 1NKSA 3ANMA 4PYJA 4K3UA 1E58A 4E15A 1FFAA 1M2EA 1Z4PX 2ZIXA 4GI5A 1QKJA 3DMTC 3DZBA 2X5KO 3D2CA 1XJQA 1ZXXA 3DOJA 4HY3A 2WKPA 4O4HA 4LGYA 1T5TA 5GONF 2XZOA 2JAPA 1T2VA 1UFQA 3OFND 4KMMA 4PC2A 3ACBA 4XWKA 3AILA 4NOJA 2QZJA 2NUPA 2YJ6A 4CFZA 1MAUA 3I28A 4MW4A 3WGUA 3A9SA 4XVUA 1R4NA 4YYZA 4CG0A 1T8PA 3MTGA 3QVGB 3CT4A 3QBDA 4U63A 3VPXA 4A4DA 4LNAA 2JGEA 2XMZA 3WMXA 3KJGA 2ZBFA 3QBVA 1J9EA 1KI7A 3W1VA 3QLTA 4XCQA 4CMEA 2PCJA 1Z82A 4DJDC 3DZGA 2IYOA 3AUXA 1XZLA 4GECA 4YH1A 3GLGB 3X1DA 1LJ8A 1C1YA 3KYIB 5FWYB 3W05A 2HK7A 3UWSA 5GZ1A 3ZHZA 3GT4A 2HWWA 2DHDA 1D2CA 1V9SA 3JRWA 1AF4A 1IRXA 4Y9SA 1FBNA 2ZIVB 3AQ4A 1L1EA 3TLMA 3W9UA 4QPCA 1KL7A 4D4IA 1EXNA 2X2OA 3QELA 2QUAA 2MDTA 4PSUA 4V3CA 1P39A 1EZ4A 3I5UA 3IJPA 4EQZA 1PNQA 1ZRHA 1Y3DE 2WMYA 1KY2A 3AHGA 2YXDA 3ZK9A 3N3BC 5A3VA 1XAJA 1KVRA 4HKTA 3H4MA 3QK7A 1DKRA 2H4ZA 2BYTA 1G3UA 4KRGA 3RYFB 4YMUA 2IYXA 1SQSA 1N2JA 2C00A 2D8MA 4BX0A 3B3GA 3FNFA 1UJCA 2GLXA 1WSBA 3JALA 3LGAA 5C35A 3QEBZ 3ZVRA 2TYSB 2OHIA 2VCYA 2XRFA 2Z5FA 3FYCA 3KHSA 4DR4B 3DBVO 1KQOA 4RMIA 4C7JA 2Z5VA 2TMDA 4EFLA 1EM8A 3N2EA 2ZIAA 4FCWA 1XFAA 2OBMA 2O3QA 1ZVJA 1OHHA 4FPXA 4OMUA 4PRLA 3Q3EA 4PRKA 1Q7GA 3TZBA 4LVUA 2UUPA 4YDSA 4I1RA 2J5BA 4WBXC 3DZ8A 1L6RA 4LXHA 4BWGA 2Z3ZA 5DI3B 2FR8C 3BTVA 1K3TA 4EA9A 1ZX1A 2R00A 2R47A 1T0UA 3KQVA 2H63A 3NIBA 3HB4X 3IS3A 3MTAA 4OX9B 2VJQA 1C8LA 5LXTB 1GUBA 1RWXA 2VDKB 4DZZA 3E82A 4YUYA 3I9V6 3MJSA 3OLYA 3OZDA 1YQGA 3ROGA 4S1OA 3W5VA 2Q0XA 1BXGB 2AOWA 1VL0A 3QP9A 4O1IA 4UATA 2BFDA 4ABYA 4EDHA 3MBOA 3LBYA 5KYVA 3T7TA 1AV7A 3H6KA 4JEMA 1Z4OA 3UWPA 4NMLA 2B2CA 3UJNA 4L9AA 1YE3A 1Y4UA 3PNVA 1ZWKA 1VC2A 2PQ2A 3NYQA 1ZA1A 5B64A 3BHNA 5JCPA 2DP4E