2QT7A

Crystallographic structure of the mature ectodomain of the human receptor-type protein-tyrosine phosphatase ia-2 at 1.30 angstroms
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
89
structure length
89
Chain Sequence
EEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor-type tyrosine-protein phosphatase-like N
publication title Structure of the Mature Ectodomain of the Human Receptor-type Protein-tyrosine Phosphatase IA-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 25
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11548 Receptor_IA-2 Protein-tyrosine phosphatase receptor IA-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qt7A00
4HTJA 3N01A 3NG8A 3N4WA 4HTIA 2QT7A 3NP5A
chains in the Genus database with same CATH superfamily
5HO4A 3P49B 1S0VA 3OR1A 1HR0F 3TQ1A 5DM6Q 2MLXA 2EFVA 5LM7E 2VFUA 2R8KA 4KC5A 2EKNA 3W5ZA 3H5YA 1TKZA 1HD1A 4DEZA 3ZZRA 4F4KA 4OHXA 3QNWB 4UOCA 2K2PA 2DR5A 4M5MA 4ZA1A 5E3QA 2J7WA 1XNQJ 1B3TA 2EFQA 3ZTRA 3G96A 2BOAA 2JEJA 4F3MA 1RHJB 5KG7A 4RUCA 3OTCA 2EFOA 1CBKA 4DPXA 1YSJA 5D77A 3OD2A 4IG3A 1SJFA 4CO0A 4BC7A 3U1MA 4ES2A 2HMIA 4P72A 2IDLA 1WC0A 2CJKA 3KJFB 2YNHB 3W1YC 3D1QA 1J5OB 3OFFA 1NKCA 2MKCA 3UD4P 1OS5A 1SV5B 3HD1A 1M5VC 1GMVA 2MQNA 2V68A 3TRGA 4USHA 3HHKA 3OTEA 3N5FA 2DH9A 1NJXA 4P73A 1VR6A 1X4GA 4CO1A 2NCKL 1SCJB 5KG6A 3ET6A 3QT6A 1FDAA 3PTWA 2FHKA 3BKUA 3TR5A 3W7BA 1WI8A 1S99A 4NYZA 4ECRA 3KG4A 3CCLS 4LF5F 3TP2A 2WRMA 1QDUB 2V4JB 3CD6S 3T3FA 5HL7Q 4IRDA 4LFCF 2K1RB 2XI3A 3RAMA 4QJVA 2ZC4A 4ECUA 1UCNA 2C3YA 4J9SA 1KNZA 3IWNC 2VASA 3JSRA 1YWXA 4C3KA 3CDUA 1R89A 4Y34A 4PCQA 4ZKAA 1T9WA 2YTCA 2R7TA 1VRTA 3CGIA 1B0PA 4DL2A 4GC6A 5F8JA 4CDIA 1JLBA 3ENWA 1N36J 4IO1A 2FLNA 4R8UB 1KOOA 4AQYJ 4ZS6A 3D54A 1URRA 2Z4PA 2Y0SD 2E5HA 4WIIA 4OI4A 3A12A 3LAMA 3J7Z5 4DDFA 2XM3A 3EX7B 5E41A 2BOPA 2LDIA 3JAMY 5CCMA 5K8OA 2X1GA 4WZMA 3S7RA 4K0KF 3Q8SB 3TJAA 3D3BJ 2ZEJA 1E6VA 3CC4S 3L3CA 4H4MB 4QU7A 3IC1A 1KC8T 4PZVA 1SBRA 3CD0A 2GHVC 1S1WA 4O0IA 2AKWB 2OELA 1AROP 4JI0J 4NLGA 2OD6A 1X4CA 3OJUA 2NLWA 5HROA 3N0VA 3QWPA 4QCLA 1C1CB 3VAGA 4RWWA 1VQMS 4DU7A 2AYBA 2BEFA 1OWXA 1U6ZA 1FESA 4YB6A 1UFKA 3KK1B 2J9EA 3H5UA 4J9LA 2FYXA 1KQSR 2DR8A 1LFWA 1FRKA 2BRKA 4R25A 1NHUA 5B0BA 3FCHA 4C0BA 3M2VA 3GV5B 3PJXA 4ZJOA 3UCUP 1S1UA 2JVRA 3H2VE 2ASLA 5F8GA 5L1KA 1XEZA 2VONA 2GIFA 3D5MA 2DO0A 1Y3KA 3SDEB 3DI6A 4A47A 2YNIA 4KV8A 2C2KB 4OYOA 3VZHA 4IQXA 3KJNB 5DQHA 2V69A 3LO3A 2XGPA 4F8RA 1V9OA 2ZH4A 1FHTA 1Y9OA 2MKSA 1I94F 1ZM4A 3BSCA 4DUZJ 2KM8C 3UVJB 1KEKA 1NJIT 4MFBB 1KQGB 2VZ9A 1RKJA 4ZJQA 2MEWA 1NU4A 4DR3J 1U0HA 2Y1RI 4DOZA 2R7WA 1CJKA 3SV3A 3MEGA 3DOMA 1FKPA 1WG1A 4ED0A 4YDDB 2KHDA 3PW5A 3R8YA 5EWGA 1MMLA 1AFIA 3PKYA 2RDIA 2ZWPA 1OSCA 2OFGX 1Q8KA 2RRAA 4K4XA 2XY6A 1HI1A 2HHXA 2YNFB 4NCGB 2XYGB 3VVUA 4ES1A 2R3VA 4DN9A 2YH1A 1MLAA 2HVZA 6FD1A 4B9VA 5AXNA 3JTOA 2MQMA 3QGIA 3K0JA 2RKIB 3FUYA 4OHYA 4RZRA 4NLOA 2CJ9A 3BPSP 3NXZA 6FDRA 1Z2ZA 5F8NA 2OTLS 1Q82T 3FVYA 2XB2D 1YJNS 5KFGA 2O5DA 2Y9HA 5KT6A 2YNHA 2BM1A 4DL4A 1NNDA 2ABYA 4KJIA 1J5OA 3HSDA 1N33F 3UN5A 5DETA 4NPOA 1N54B 2IM0A 3GCWP 1SV5A 2DHSA 2VDHA 1JKHB 2ZH8A 2PFDA 3T5JA 1NAQA 2Z2LA 4M95A 3LGNA 3MMAB 1HQEB 3ELHA 2F65A 1SQEA 2D3UA 1CQNA 4Q7AA 3CCRS 3M05A 2BRLA 2EC0A 5KG1A 1DURA 2DR9A 3GIRA 4ER8A 1H72C 3IAM9 3MF5A 2VQFJ 1AT1B 3KHRA 2CQBA 3WC0A 4LF8F 3TVKA 4YEAA 4UUXA 1ULRA 1RT7A 2V4JA 3KTQA 4K50A 4F4AA 2ZJRQ 2K1RA 2QLWA 4DUTA 2AJFE 2Q66A 3RB0A 1YJWS 5LT5A 3THVA 3IWLA 4LVOP 1HLWA 3OVBA 3IBCB 2XZTB 5K14B 1S0OA 4GKKF 4UF4A 2FPHX 3KK3B 2CQCA 3M6VA 2CPJA 2V2QA 1WHXA 4QWCA 2CYYA 3DN9A 5IXUA 2KT2A 1VQOS 2HS0A 2Y1LB 2OPPB 3KK2B 2WBMA 1F5BA 4UTGA 2CPZA 4H4OA 4DV4J 4IH6A 4BLGA 1RBOB 1SC3B 1QAXA 4R8UA 2ZVSA 4ID5B 2RRNA 3O6QA 2VJVA 4NEZA 3OW2R 2R2SA 5LL6d 5EDWA 1WC1A 4NRUA 3CIMA 3T6JA 4FBTA 3RG6A 5F8MA 1XERA 5L9NA 3LP0B 4X62F 2CPYA 4ZVOB 5DDQC 3BJYA 1VFJA 3BN7A 4JI8F 2VG5B 1IWGA 3N28A 5KFEA 3F56A 3HT3A 2L9WA 4WTYA 3NGDA 1ZM2A 4HACB 3KLEB 4H4MA 3DHWC 5D4NA 1OJ4A 5AE3A 1W2BR 1WC3A 3D6TB 3N9UC 5ETMA 4USTA 2V6AA 4Y2CA 5CYJA 1S5ZA 3BREA 4CH0S 1ZAWA 1RAOA 2AQ4A 4F36A 4DQQA 2VFRA 4OMFG 3J81Y 1ITPA 3KMQA 3HVAA 2WB4A 3KK1A 3NP5A 2YKOA 3MTKA 4FF1A 1LFPA 4LSNB 3UO0A 2UU9F 3D7SB 1U2CA 1WUUA 1JJHA 2EFGA 4EYHB 1QAIA 1IKYB 3UE2A 1K44A 2CQGA 4DHVA 4ECZA 2H4WB 3Q8YA 5GAEU 4HTJA 1FFGB 2LYVA 4P10A 3THPA 3G8QA 3SDEA 3HSJA 4PABA 3BR9A 2OKQA 3KOAA 1G6BA 2M70A 4NX9A 5KFHA 3ZZ0A 4LR7A 3DLLQ 3BQ1A 4K4UA 2NXUA 2I9SA 2ZZMA 1HBUA 1HW9A 2AW0A 5E3RA 5IS2A 3UVJA 4MFBA 1RAFB 3OFHA 2Y8YA 5K8NA 3RJMB 1T9YA 2YWHA 1S4EA 4RNOA 1X5SA 3AOCA 4Z2XA 1I1GA 1KS2A 5KG0A 3DRPB 1U7LA 4OV1A 1HQ2A 3U1LA 3P5TL 5CHCB 4WBFA 1RISA 2E9ZA 3CF5Q 2DT9A 1HR0J 3G8SA 1AZSB 3NWGA 3V6DB 2YNFA 4NCGA 5GAEI 1R8CA 4DR4F 3TA1A 2BJ9A 1PJ6A 1M1HA 2IVYA 3IBWA 3NWRA 2AYEA 4WZQA 1HNIB 2IBOA 1VS3A 2BKOA 1JJ4A 2ZOMA 2RKIA 2OPSB 1RWUA 1U24A 4P52A 2BBEA 3O44A 4WFAQ 3CD7A 3KHGA 4FYXB 3HZGA 4QQBA 4U95A 5D15A 3TZYA 3CJ2A 1ZETA 5DG9A 2ZUGA 2XYPB 4M94A 3BBCA 5J1NA 3TAMB 1BD6A 3FFIB 4M63A 2RD5C 1KBRA 1JKHA 1Q8LA 2W7PA 2ACMA 4LIWA 4K2JA 2PN6A 2AD9A 2PSZA 3MXHP 1N48A 3MMAA 1UP1A 4MYUA 1HQEA 2CKWA 2ILYA 3F41A 1U4BA 3K5MA 3VQTA 3HVRA 2R7UA 4A48A 4E0DA 2W7OA 1ZAXA 1EIYB 5KFYA 3SCKE 3CMES 3H25A 4DU8A 2ROEA 4F50A 4DV5F 2SXLA 2FD2A 2G9OA 2GJFA 4A8MP 1D0EA 3QAEA 4F2SA 2DXDA 3Q2TC 1H7WA 4U96A 2LXFA 5L8RC 2ZUAA 4HDGA 4NLUA 4ZDNA 1S1VB 1AXQA 4ZVTB 4LFCJ 1CLFA 1YVFA 5EHHA 5F9LA 5K14A 1TMJA 4O23A 2AX0A 2HZCA 4DMZA 2C42A 1MN7A 4H4KA 2HHPA 1VQ5S 3TARA 1UA1A 1FRHA 2RQCA 4B3MJ 2PEBA 3DLKB 2IHR1 3A8IA 3FMBA 2OPPA 1UA0A 2E7WA 3UI3A 1FRXA 1UTAA 4KIAA 4NLDA 4A8KA 4C7QA 4RW9B 2FQQB 1QTMA 4ID5A 4EZ6A 1CEZA 1ZTTA 2LP4A 1QM9A 3I4PA 3X3UA 4NA1A 4JV2A 1RQ0A 2DNPA 4C0OC 3ILJA 1Y11A 1F2HA 3LP0A 2FJWA 1QJHA 1RAIB 3KMSA 3F73A 2XMAA 3BDPA 2VG5A 2PMWA 3GZ7A 3KJVB 3F44A 1RT2B 5AT1B 1TL7B 5KT4A 4K0KJ 4HACA 3KLEA 4LR9A 4C4WA 3I55S 2W4PA 1KDNA 2V8GA 4WE1B 1TFYA 2YXLA 1PCAA 2DNLA 5L1JA 1JLCB 1H73A 4P7TA 3BO4A 2MKKA 3Q8RB 3R7BB 2EWHA 4PQAA 1D9AA 2W2NP 4U67Q 2NSCA 2LCWA 3PDNA 3GJSB 1O6XA 3N6MA 2E66A 2IYGA 4J90A 2AJ4A 3R5DA 4PG4A 3QATA 1PILA 2JHEA 4X65F 2D1CA 2HWHA 4LSNA 3U7JA 4U8VA 1OPIA 1ZA1B 3AJ2A 3DRRA 3PKMA 2BQUA 4TLQA 2DNGA 1B70B 2X1BA 4P2MA 3D3CJ 2F4FA 3PFEA 5FJ4A 2XCAA 1IKYA 4ZIVA 3DU5A 1GQEA 2ZJPQ 2Z30B 1ACMB 5HVFA 1M1KT 3ZFVA 4X4OA 1YQHA 1TL1B 1RAAB 2FUG9 1SC1B 3D67A 4B3OB 1Q16B 4FNIA 2JLGA 2DK2A 2NPIA 2G2OA 3C8YA 1I94J 3NOGA 3G86A 2W9CB 3HP6A 2KRRA 5KTQA 4QIEA 1C0UB 5M2UA 2I6WA 2G1HA 5KFCA 4IYQA 3FZ2A 2HWTA 1Q78A 2HGMA 3DRPA 2HVEA 2GO8A 2VOPA 1RHMB 4BDPA 1AZSA 4OX9F 2M9KA 3V6DA 1OYDA 1FWKA 3KUEA 3MAAB 3CCQS 5L39A 2UUTA 2LLZA 5DDOC 4DX7A 1HNIA 1FJ7A 4UOHA 4LRFA 4DV0J 3CJ3A 4IRKA 1S77D 2UXCJ 2OPSA 3DXBA 5D8HB 2Z56B 2NR0A 2QTWA 2ZNZA 1RSCA 2FVQA 2ZH2A 3TNVA 3SEOA 2GS8A 2N4CA 2PC6A 1CQMA 2OHDA 2XMUA 2HAFA 2RHQB 2UP1A 1R31A 3EVOA 3I5BA 3FRZA 3TAMA 2HBQB 4UOFA 3KLHB 3NL0A 1DLOB 1IJEB 1V6HA 2OTJS 4PG8A 2WVFA 4OYMA 1N33J 1NZ8A 3A8JA 1FDDA 3L7OA 3BGOP 2O01C 4K59A 4AD6A 4ALZA 3TAPA 1NK4A 4WKRA 2DCLA 4CO2A 5CYQB 3NGUA 3E8OA 3KWMA 4DV2F 2DO4A 3Q24A 2GO9A 5D4OA 4YR0A 2XC9A 1GX5A 3NMAA 1IBKF 2XS2A 4X4RA 2BJ7A 1RABB 1N6QA 4J91A 2AT1B 3GTYX 4USJC 3PJWA 3AD8C 1F60B 2IMWP 1W2IA 3MEKA 2Y0BB 1VRUB 3PZPA 4JI4F 4LF8J 3AT1B 5DLGA 2H51B 1S10A 2P8IA 2RIJA 1S1VA 5SUHA 1U2RA 2HS4A 1PAUB 3VAIA 1T03B 3QT8A 4RW8B 1NHKL 2CQ4A 4RJVA 2BE9B 1MMNA 1GAOA 3BH7B 4XPEA 4A8WA 1IR0A 2DNNA 2A18A 2ACYA 1A0OB 5GVQA 3ZXWA 4GKKJ 2Y1JA 4HR2A 1WSVA 1XMOF 2QC3A 1XIQA 3DLKA 4Q5VA 1G1XA 4P71A 4RPFA 4AT1B 3EZUA 2BM0A 3QFHA 1LOUA 1TK8A 4RW9A 3V6HA 5IT0A 3L9ZA 4FXVA 1M0SA 3D6HB 3HHDA 2D3O1 4IRCA 4BHQA 2IBKA 3GG1A 2ZDPA 2ZITA 3H5SA 1FXRA 2V5HG 1U47A 4FYDA 3C16A 3M8PB 3HHLC 4X62J 3A3OB 3KJVA 1RT2A 1TL7A 3UDLA 4JI8J 2UXDF 4ZP7A 2V4QA 4WE1A 4GVBB 3N6NA 4U9RA 1JLCA 3MCSA 1NBEB 5ADZA 2CG8A 2EK1A 4C11B 1FNMA 3TQEA 4XPCA 4EBEA 2XI2A 1BQNB 2ZHBA 2FY8A 3PEJA 5G0RB 3T9NA 4EBCA 3NGSA 1S4FA 3D6FB 3EPGA 1RLDA 3IR5B 5KFSA 2FVSA 2Q6BA 3VR1A 2AX1A 1ZS6A 1JLQB 2HFNA 2UU9J 1N5QA 4F4WA 3CJKB 5LSRA 1DHMA 1UFLA 5GMEA 4YHHJ 3IG1A 3BV8A 5CXTA 1SJ3P 1XMQF 4NXMF 3PRBA 2HHSA 4KGKA 2CQ0A 2OJ3A 1TL1A 2HAIA 4JV5J 2ZDOA 3ZC4A 1HQUB 4B3OA 2PGCA 4IG0B 2JJ4D 4C3LA 3VGTA 4G1IA 4USWA 2X1FA 2RHSB 3Q23A 4IFYB 1MROB 4WFBQ 1UL3A 3FMWA 4L75A 4WFXA 4I0WA 2W9CA 3CCJS 1FJGJ 1ROFA 4LJMA 3E01B 1C0UA 4X4PA 3Q8VA 1RBLA 2OSRA 3H7HB 2R9LA 5E0OA 5B0FA 1VISA 1HKAA 4B9NA 1F3VA 2MKYA 3GFZA 2XNQA 2LXIA 1FRLA 4MK8A 1RWMB 2LEPA 3PIPQ 2LU2A 1VBYA 2YH0A 3MAAA 5HBMB 2DNMA 2WW8A 3AAWB 2BJ8A 2QYCA 4DR4J 1RWWB 4OL8A 4OYAA 4DSLA 3W9JA 3TA0A 1PG5B 1QY7A 1K9MT 3I9ZA 1IJFB 1VMBA 4U6PA 3QRQA 4IQMA 1OPZA 5C42B 1OYEA 2OEJA 2C3UA 1RTIB 3ILLA 4K4VA 1K0TA 3TVZA 1I5OB 4QPTA 1SJ1A 5F0WA 2EFNA 1XWLA 2AJQA 3KLHA 4K4WA 3SSSA 2VQEJ 3DLJA 1Q4RA 2XYHB 2JC1A 3MTJA 2ALZA 2G0IA 3ETMA 3T9ZA 2E5JA 5CYQA 4USVA 1JLFB 1KTVA 3CVKA 1DY3A 1YHQS 3WX8A 2GVZB 4LRDA 3R2CJ 3MFHA 3SSQA 3NCPA 1L3VA 1Q95G 3SQGB 4ILMA 5CQGA 3I0SB 4AXIA 4Z37A 1MWYA 1DAXA 2YX4A 1SH0A 1T03A 2B43A 5IOLA 3HFVA 2CQPA 2A6MA 2NYHA 5RUBA 3SIPB 3D6MB 2VFVA 3AH6A 4ZN1A 3PY8A 1VI7A 1Y4ZB 5BYSA 2XY7A 3LPYA 3FDSA 1HBNA 1NDPA 3CJRA 4O44A 4LBIA 3PV8A 2DH7A 4C3MA 1NDKA 2C3PA 2GJIA 1HBOB 4OYBA 2ZBQA 2IPOB 4P7VA 1DTQB 3T5HA 2PD1A 8AT1B 2P9CA 3BDEA 4YFUA 3DOKB 3B6BA 2MZJA 3KXDA 2V4RA 2GQ2A 1NB2A 4RW6A 2QSFA 1N0VC 2BQRA 3JYTB 3C3LA 2PT0A 2W9AA 1U1RA 2R2TA 3VCDA 5B0DA 3KDOA 1RLCL 4DL5A 1VK8A 3ULHA 4GVBA 4AE5A 4MK9A 4EUVA 1AUSL 4Q8FA 1FDNA 1GXUA 2XHCA 2XMMA 4KHPJ 1EB0A 3OTOF 5DS7A 1FWPA 2LMIA 4C11A 3R5AA 4J9VA 3RBZA 2DXEA 4NMLA 5L9XA 1MW7A 3AD9C 1U1QA 4CH1A 3VVTA 4HHUA 2PEHA 4ED6A 4DPUA 5G0RA 1VQNS 3OHBA 2VDIA 5MAOA 3D9BA 1O8BA 4IOBA 1BE4A 4XK8C 4MYTA 4FF4A 2RQKA 4B3SF 5K8PA 2C3OA 2HK3A 1ZZNA 5KFWA 3FK4A 5F8LA 1JLQA 3DMJB 3EXCX 1IBMF 3TEHB 1FD8A 3CJKA 3H42A 1RT3B 3GU0A 5F0UA 3OFGA 3MECB 2DITA 2QYGA 3TW0A 2B9YA 3BGRB 1YJUA 1U6FA 2HFUA 1N5SA 1U8WA 1IQTA 4G6VB 4NZ7A 1BQMB 4CTAB 3C15B 2HLUA 2RJZA 5ETRA 3I6PA 3M8WA 1HQUA 2DNYA 2WVDA 4IG0A 2E5LF 2AWZA 1Q8BA 4EBDA 3R9LA 3V6JA 4O0NA 3BBBA 5LXYA 4Q8EA 5HATA 3M6XA 5F9NA 4IFYA 4K5RA 1MROA 4CH7A 2DNQA 2H9ZA 4KH1B 4OFZA 5HVHA 2KVIA 4CCHA 4KAIA 3E01A 1KSPA 3P3DA 4JOUA 3GV8B 3LH2S 1GMWD 2J9DA 5ETOA 2K7JA 3TA2A 1RAGB 3IP0A 5JMNA 2GMHA 4YR3A 2BR0A 2RH3A 3PYDA 4EU0A 1FTCA 5HBMA 4OX9J 1RHUB 4B9LA 4PYDA 3GCXP 4ETXA 4J9KA 2KB2A 3MM8B 1GXLA 2BKPA 2R8GA 5F3TA 2MDAA 1U02A 1SUQB 3BH6B 2ZOGA 2JFKA 1S1TB 1H6KX 2LEBA 3CDWA 4C2MA 4ILLA 1Q1KA 4TN2A 3AHPA 1RTIA 5DJBA 3NEKA 1RHKB 2A2DA 2HNZB 2EI5A 3RBXA 2E1RA 4ELUA 3TO8A 2R2RA 4UY85 5J2PB 5C5JA 1U25A 3NBPB 1RCOB 2YKMB 4N76A 4RBUA 1B0VA 1G3OA 3C14B 4Y2IA 3JSYA 3FEZA 3J7AN 1P27B 1YJTA 2QE5A 3CIZA 2MPUA 2XS7A 4OI0A 1DZ5A 4WCEQ 2HQFA 1T9UA 3TUPA 2GVZA 1IM6A 1FVSA 4MKBA 3R5BA 2VICA 1DARA 1TELA 2GV1A 2DRDA 4RWXA 4ZHRA 2NXEA 3W9IA 2B4PA 4CLZA 3SQGA 3IAS9 1AFJA 1Y7PA 2ROPA 1R8HA 1TMMA 3I0SA 4I1TA 2B9XA 5EWEA 3V6KA 4JI4J 2QO3A 2NZCA 2AGOA 4FN5A 4ZPWR 2JOQA 1PC4A 4OZ5A 3C2PA 1KHVA 2Y1IA 5H9FK 2CQ1A 1T0TV 2ADCA 1X4HA 2HQIA 3CCVS 1IKXB 4OJGA 1UPPA 5KT7A 1LEOA 4DQPA 4ZVGA 4GKJF 1MMDA 1O0PA 4A8XA 5CA5A 1Q53A 1XMOJ 2I38A 1JIHA 4CNYA 4LQ9A 1LW2B 4ED3A 1HBOA 2ASJA 3IMQJ 1N34J 5FDLB 2JEFA 2ZJQQ 4Q45A 5KFBA 1DTQA 2HQDA 4URSA 3ZNUA 1HNXF 4NZ0A 2H3EB 1R6VA 4JI0F 1GFWB 3O3LA 2WOMB 3DOKA 1VOMA 3CC7S 3LANA 3ZTPA 2JH3A 3QQCD 2UVUA 2FDNA 4DQSA 1G4CA 3HJVA 1H98A 3JYTA 1UVMA 2B8QA 2W2QP 3MMCB 1XR6A 3OVAA 2MZQA 3HO1A 1S79A 2DRBA 2YKNB 1S0MA 1YG0A 2B8PA 3ZTSA 2XLIA 5KFKA 1QE1B 2UXDJ 1BXNA 1TUWA 1LKZA 5IZHA 1H0HB 5KFAA 3ZZYA 4X4SA 1VJQA 4DBQA 4ECQA 4DF4A 3IFEA 3VGVA 2MGZB 3BYPA 1N5YB 5I3PA 4WK3A 2JWNA 4DSEA 2CQHA 3HHLD 1M5OC 3MWBA 3NNCA 1O5JA 1UKUA 5HMXA 1EKSA 3CDAA 2Q6CA 2B6AB 3DMJA 4YY3F 3W8GA 3OFEA 1N5TA 4J9QA 5DDPC 4DUZF 3MECA 1ICEB 1EP4B 5KG4A 1Y5NB 3MM9B 4F2RA 2W1BA 1HWKA 3HFZB 3BGRA 4DR3F 1JJ2R 1EZZB 2WVBA 1RT6B 2FVCA 2MSTA 3MPVA 1Z2LA 1TKTB 1QVGR 1BQMA 3C15A 1XMQJ 3A1YG 4NXMJ 4ZMMA 3HKWA 1RAEB 4W92B 2ZHAA 4FDFA 2RUSA 3QGHA 2LFVA 3R7SB 2AJ1A 1FXDA 1UVLA 3QAUA 3OLAA 5HMWA 1ZM3A 3EZ5A 4F04B 2OEKA 1NHVA 4AXJA 2Z8QA 2OLWA 2BX6A 4DSJA 4TU7A 3KDNA 2RDJA 1KVIA 1T9TA 2MQ8A 2D3ZA 1FO1A 1JNRB 2HYIB 3NGRA 1SKRA 1K8AT 1VQ8S 2V63A 2WVEA 3PX6A 1FTRA 2R7SA 3KG1A 2QL5B 4OX7A 3Q89A 1RACB 3PW0A 2XMKA 3GFXA 1EQ0A 2KXHA 3MCMA 3MM8A 4X64F 2HBZB 1SKUB 1HBMB 1GT8A 1SUQA 1S49A 4O4RA 4KGMA 1S1TA 1WI6A 4ILRA 1U1PA 5KG2A 1YJ9S 2VPWB 2C2ZB 2FJVA 1CJTA 3FBCA 3IRWP 3B78A 4PXDA 1LW0B 3QIDA 4LUBA 2HNZA 3OLBA 1GH8A 3HCXA 1FX4A 4B3TF 4OYXA 5J2PA 4DCPB 1EKRA 2QL9B 2YWFA 2VQFF 1XBWA 2LECA 3NBPA 1X0PA 3MR5A 2YKMA 1FF2A 2FZKB 4DR1J 2W8KA 1NPPA 3C14A 1H38A 2RU9A 1TUVA 2V8VA 3BR8A 1XNRF 5KFUA 2OEMA 3OT9A 2MB0B 2CJYB 1WHYA 3CPWR 5E5NA 5EX3A 4KKOB 5KFJA 2ADBA 1JX4A 4RR5A 4BBYA 3RR8A 2YVSA 2JX2A 2BJDA 4OYZA 3PFOA 1P8GA 2NPFA 3OV7A 1JQGA 4LF2A 2GAHC 3P4UB 4AL7A 3A8KA 2R7QA 1F9HA 3K59A 3RU0A 3E3XA 2XNRA 3FKBA 1H2VZ 1U26A 4LMZA 2V67A 4DV4F 2LXUA 1CJVB 5GMKa 3MR2A 5ETKA 3L09A 4ZVQB 4L6V3 4HVZA 1FEEA 2XO6A 1C4AA 3M30B 4WYLA 3M7VA 1IKXA 2FVRA 2IJRA 4P2XA 4USKA 3MAQA 3GV7B 4M5JA 2DGQA 3DDNA 2GFFA 3HKZD 3DGVA 2HHHF 3UPFA 1HHTP 1LW2A 4DF8A 3NGKA 3SI8A 4C8KA 5A8WB 5FDLA 3TI0A 3OSPA 2ZD1B 2BUNA 1BUXA 4N41A 4QYZJ 1HIYA 1RTZA 2F9JA 3JSBA 4WXWA 1RWPB 4RUBA 5L46A 2MYFA 4JI7J 1NMEB 2QRRA 4QW9A 1V3ZA 3P8BB 1ZA2B 3RR7A 3F0NA 2YKNA 1WOOA 2JFDA 1QE1A 2XY5A 2C28A 1RCXB 3K5PA 1FDBA 1PYTA 5FIIA 1RB0A 3MEDB 4ECTA 4YB7A 1KWMA 2YKAA 1P6TA 4NL5A 1F2GA 4OZNA 1FEHA 3OTOJ 3HHEA 1HMVB 3CULA 2V8DA 3RBDA 1DFDA 1QSYA 4U7UD 2AF6A 3DC2A 2MGZA 5H9EJ 1RI7A 4QYZK 1N5YA 3RW7A 5J2MB 4IR9A 2G1DA 3MM6B 2VBWA 2RB7A 3NAIA 2CUYA 3IXQA 5EN1A 4MAKA 3HXMA 4TYBA 2QL7B 4B3SJ 3CB4A 1M5KC 2B6AA 3SCJE 4DZ6A 4XDDA 3N6LA 3H20A 2G4BA 1XJWB 1YRXA 1MSWD 2E5GA 1EP4A 1IBLJ 3ILOA 2FGOA 2KYXA 3M8RA 2FZGB 4DQRA 1RT6A 5CYMB 4NA3A 1TKTA 3C6TB 2N7CA 3UD3P 4WJBA 2DJWA 4N8NA 3M1VB 2Z2MA 5BR8F 2RNEA 4NLPA 3NRBA 2QMXA 3VTIA 5H9EK 1PBAA 3QGGA 4OIXA 1HW8A 2GIQA 4RW4B 3QIPB 2BE7D 2E5LJ 3EGNA 4P9SA 3OR2B 6AT1B 2CPFA 5EUHA 4DPYA 4LVNP 4N7TA 1WTBA 4ZVPB 1AW0A 4NASA 3CJ4A 3HDSA 2H65B 1WHVA 3D0HE 2J0SD 3I4HX 4DFJA 5LJ5Y 5IQQA 2B5JB 3W66A 1Q7LB 2LQ8A 5KFXA 5DM7Q 1S9FA 3GIMA 3GIIA 2V2KA 2J6UA 2MLZA 3CC2S 2R8JA 3J81j 4JV0A 3DXSX 2W2OP 4IKAA 5JJBA 2R8HA 3QSYB 3V5RA 2DIVA 3GPAA 3CCES 4PKDB 1TL4A 3THTA 3H90A 1HBMA 4ZPDA 2GQCA 2C2MB 2VPZB 3OPKA 1KVKA 1UVIA 3RBEA 1WEZA 1U8SA 1A7GE 3TJ9A 1MWQA 2HRTA 4KGXB 2QA2A 1WWHA 3MD3A 4FS2A 1LW0A 2IRXA 2PO4A 3H8YA 2M8HA 5CZVA 4QWAA 4F0HA 1IKWB 4C8YA 2HHVA 1EHWA 2AP6A 4M5LA 4OZ0A 2QGFB 2DRAA 4FP9A 1XR5A 1C0TB 1TVRB 2L41A 3ETOA 1XQIA 1M5SA 3R1LA 1RT7B 4O3QA 1D3WA 4NZ6A 4I2PB 3BKTA 3OTDA 1T11A 4OI3A 3CCZA 1HHQA 3HX9A 4KKOA 3C6UA 4KO0B 2QLJB 4CLSA 3CW2C 4UQTA 2GHWA 4WFZA 4AL5A 3BEGB 3DYAB 3FGVA 3J81U 1VYAA 3ISNC 4A46A 2QFIA 4B3MF 2BXJA 1WG4A 2V9WA 3K58A 1GX6A 1UEUA 3K2YA 5LJ3Y 2E1MC 4DV3F 3K57A 2RVJA 3CMAS 1CJVA 2J6TA 1DQAA 2HVIA 4H4OB 2J9DE 4CLLA 4OI2A 3UQSA 3T1AA 1W26A 1T7PA 4GVLA 2WSFC 3W8PA 1EETB 3DKDA 3M30A 1NK8A 3I9V9 2Z58B 3AFGA 1VQ6S 4RNHA 2B4OA 1LWFB 3JXOA 2ZBIA 2MXYA 4O3PA 4QR1A 3CXCR 4GKJJ 4N5SA 4J37A 3WIVA 4OHVA 2YNGB 1TUGB 2K8GA 5HLFB 5A8WA 1PBUA 2XGQA 4JB8B 2ZD1A 2IA6A 4USMA 2ASYA 4PWDB 1HNXJ 2NUHA 5L1IA 4D3GA 1QVFR 4KYZA 4FYVB 2OPQB 1HNWJ 2F8MA 2R42A 1FA0A 3TANA 1L3UA 4UUWA 4MT1A 4O3RA 4OJ3A 3MR3A 3K8WA 3D0IE 3MEDA 2GCFA 4Q2MA 3MMBB 1NSPA 5D78A 2KM8B 2HNDB 1HMVA 3RGIA 1X4AA 3FJ2A 3CE8A 2KYZA 4URGA 4IDKB 4MIBA 4I56A 4Y0FA 4PR6A 3LWMA 1LXJA 2JNJA 2KVQE 4LIRA 5J2MA 1NRKA 3MM6A 4CO3A 4RBTA 3VAHA 4LFAF 4RW7B 5HJXA 1GTHA 1KN6A 3QZ8A 2CXEA 1TK5A 2F9DA 4WWSA 1HBUB 4YY3J 1P1TA 5KT3A 2NXJA 2HWIA 5CYMA 1VHFA 3C6TA 2VPYB 3M1VA 2NZ4A 1FNXH 3EMTA 3NCQA 1MU2B 4LRAA 3M2RA 3IGNA 2JLFA 5ETSA 2W24A 3QIPA 4RW4A 4DXLA 4M5KA 1RTJB 2DIUA 2X3DA 3EJMA 2BKNA 3R5GA 2Q79A 1BMQB 3OR2A 5HSPA 3EVWA 2OAUA 3TVYA 3KLGA 4ED8A 4DV0F 2HURA 1NCLA 4TY8B 1TK0A 1APSA 2UXCF 1LWXA 4DCOB 2B5JA 2NXNA 2VB6A 2BJ3A 2POKA 2ZH7A 2JEGA 5MLCV 1RU2A 2WBRA 1TZ0A 1PIEA 4OYIA 1UJ6A 3W65A 1OY9A 2I1RA 3H4BA 3BGLA 1YIJS 3UN2A 3ZZZA 3L4BC 2R7OA 2Z0GA 4I67A 4O3SA 2UVWA 5ETNA 2M3DA 4J5OA 1UETA 2GA7A 4F4XA 2VV5A 4X64J 3M8ZA 2CPIA 2XULA 2CZVC 2MKIA 3CJ8A 4J9OA 4PPDA 1YI2S 2EVZA 1SIZA 3LP2B 2J0XA 4NLQA 2AZ3A 4F67A 3ZTQA 1F5CA 1TQLA 2F63A 3TX8A 3OXGA 1NSAA 1WNEA 1IKWA 4B17A 4K4TA 2VH7A 2ZH1A 4B3TJ 3J7ZT 1RWVB 5BYQA 3PYFA 1MN9A 4ZVEA 1R3NA 1IWAA 1C0TA 5D0RA 1TVRA 3UNGC 4F25A 1NK0A 1VLYA 4I2PA 2FGCA 2E1CA 4OLOA 2DGXA 5ETQA 4W98A 1XNRJ 4LF1A 1RTDB 5E33A 3CDEA 4KO0A 4NCBA 3T1YF 2JSXA 4RU9A 3PJ9A 2IRUA 5I3UA 3A3PB 3DYAA 3PYEA 4FF2A 3CSKA 1S12A 3WX4A 4NMXA 1RWOB 3CUNA 1M90T 1OY8A 2XCPA 1I6JA 3LOUA 5DLFA 5A2QU 1Y3JA 3DLBA 1F6TA 4YR2A 1CULB 2DY9A 4G3IA 5J2NA 1RYSA 4ZVFA 4KB7A 3RB6A 2N3OA 1EETA 1R0AB 2APOA 2WTFA 4GO5X 3ISZA 4K7QA 2VFTA 1LWFA 2IFXA 4ETZA 4ECSA 1PJ5A 2BABA 4M5NA 1SVDA 1ZZFA 5HVGA 4LF4J 1HNVB 2YNGA 2JZ5A 4DR7F 1LK5A 5HLFA 3EYZA 2HHHJ 1C1BB 5KFLA 1RWNB 2E44A 1PYOB 2QMWA 3OHAA 1M5HA 5AE2A 1EX8A 2PI4A 2YWKA 4CLYA 2VC1A 4B9TA 3M8SA 2P6TA 4DPTA 4PWDA 4QIGA 1WOPA 1RUSA 1SQFA 4YDXA 4WU3A 2OPQA 2AEJA 1QSSA 4I2QA 5IT4A 2JRSA 2CDQA 2GW8A 2RE1A 3UDEA 4N77A 2BVZA 2F8HA 2XBPA 3MMBA 2ZKTA 3VGSA 3DRRB 2HNDA 1RYRA 4NXNJ 4YHHF 3LF0A 3G6YA 2EFPA 4KRWA 3W2VB 2NUUG 1JLGB 1UVKA 1FX2A 4IDKA 3LAKA 4JV5F 2GZOA 2UUBJ 3Q83A 2WVCA 4K5SA 2YWWA 3PW4A 4RW7A 1HI0P 3ZO7A 2ZM6J 3V81B 4FVCA 1CSJA 3BGFA 1W25A 4M1KA 1LWEB 3E2EA 3FSXA 5I3QA 1U45A 5HMZA 4TXSA 4ZP9A 1FJGF 4WFYA 5DRKA 5KFNA 1S6OA 5IQ6A 5GADU 2PMHA 3QJJA 4WU2A 4RNFA 4C8NA 2UXBF 2V2ZA 4F3QA 2W4DA 3AB4B 1MU2A 4FF3A 1SL2A 4KT0C 5BR8J 4JI2F 2XZDB 1I51B 1VC5A 1YBTA 1RTJA 5HANA 1XN9A 5A8RB 3I0RB 4IOCQ 3PO4A 2KXFA 1CVJA 4OX8A 3HM9A 1NK6A 3JQJA 1GTEA 1XR7A 4N56A 4IFVB 4ES3A 1X9WA 4TY8A 1DQ8A 1PSDA 2FHJD 2IIHA 2RILA 3CCMS 4JV1A 3RTVA 2MTLA 4WPAA 4HLBA 4ZCLA 1AA1B 4X4VA 4G1QB 1F3FA 2FJDB 2FC8A 2HVHA 3RZAA 4OZ2A 3QRRA 2VD3A 5GADI 3H5XA 2BDPA 1RTHB 3N79A 2Q1LA 2CVIA 3NNAA 3V4MA 5KFQA 4U7CA 4FXDA 2CVEA 2DHXA 4I7FB 2VQEF 1BGXT 2HVDA 2MZ1A 3UFCX 3PX0A 1XK8A 4RNNA 3M9OB 3A3NB 2J0QD 5JXSA 3LP2A 2E5IA 1RHQB 3PEHA 2KRBA 4MIWA 5AXMA 3T41A 1OIAA 4J9UE 5CZXA 1U1MA 4RKUC 1N6QB 3AB2B 1REGX 2X1AA 3AOBA 2DPIA 2F40A 3H2LA 2G0JA 4M8LA 5GAGU 4HT7A 1UEVA 3MUMP 3DOLB 1RTDA 3T19A 1CJUA 3N5BA 1Z1ZA 2F1FA 3GFHA 1VCTA 2XMJA 5E3AA 4PWWA 1RBAA 2ZOFA 4HL9A 1UWAA 1GXTA 4ATNA 2N82B 1NO8A 4RLEA 2OMOA 3W2WB 1VHIA 2G2ZA 4B3RF 2IY5B 2CG4A 3TAQA 2XLKA 4QR2A 2IAJB 3OVSA 2COLA 2CZ4A 2IVFB 4DV3J 3PHEA 1S1XB 4DV7F 1IBCB 1CULA 3RRKA 5HN0A 4FPIA 2YBVA 1RU1A 1KVJA 4F26A 1WF2A 2HQGA 4ELVA 3QBCA 1R0AA 3ZZOA 3SZ2A 3KUHA 1SH3A 2AHOB 4TQRA 4E98A 2YPZA 4ANDA 1KP6A 2V34A 5GAGI 2IYIA 3C16B 2FJXA 1HNVA 3ISND 2ZH6A 2KL8A 3TUJC 2KT5A 2WSEC 1C1BA 3R1HA 1B0TA 4WFNQ 4KHPF 1X0FA 2HRUA 2D9OA 2BZ2A 3QT5A 3VZIA 4V1Ak 1WG5A 1YITS 3T1HF 4WTOB 3FRYA 4Y00A 1S7IA 1UAWA 4I6YA 2HZAA 1OQ3A 3OQ2A 3QJLA 1PJ7A 2I2YA 3SCIE 4DR5F 2DEJA 4Z7CA 4OHZA 3EGVA 4LF9J 1IQZA 4UZCA 2MQOA 1WKKA 2WCXA 4X4NA 2H54B 2C2OB 2AYMA 1J27A 3VWSA 2GJ2A 1JB0C 2XMVA 1H7XA 3GSIA 4ZIWA 1SIWB 3QSIA 3CWJA 2DGTA 4F4ZA 3FSYA 1RWKB 2W4CA 3KNGA 4HH0A 5A2QY 4YUDA 3H2UB 4DX5A 2AMCB 3W2VA 1GNKA 1JLGA 9RUBA 2VG7B 3IG1B 5A8KB 1R6YA 2M52A 5JVGQ 1A9NB 1UZDA 3BO2A 4CRJA 2YQ3A 5HI7A 2VKZG 4K4SA 1K73T 3UCZP 3LWLA 2UUCF 1S6UA 3V81A 2CPHA 3T5LA 2KU7A 2K06A 5C25B 2O67A 4LFAJ 4EFAC 3CTRA 2NXCA 3GP9A 3R97A 1LWEA 2B51A 2EXUA 4I68A 2R7RA 4TNOA 3DDKA 3RAQA 4EYIB 2DKOB 2X3GA 3MURP 5D0GA 1BWEA 1UFWA 4TY9A 4RUHA 2K3KA 3Q22A 1RA6A 1RGVA 3BBFA 4EO8A 3OJSA 5LMUJ 2QV6A 4R0EA 4CLWA 4TU9A 2YQ1A 2DR6A 4RL1A 5A8RA 2FJAB 3I0RA 4ECYA 4IFVA 3FEXB 4DZDA 1ZAVA 5A0YB 3NS5A 2KG0A 4ZN3A 1T94A 4WK1A 2PIIA 3G2XA 4HI2A 5H1SV 2C1EB 2J76E 4ZCMA 2HW3A 4X2BA 4G1QA 3GE9A 3EGWB 1WD6A 3A13A 2W8LA 5DGBA 5HP1B 1JWWA 3R7NB 3TZZA 1Q5YA 2MLYA 2V9KA 3UW1A 1NJZA 2RT3A 2HEKA 1RTHA 2V8HA 2AYGA 3BQ2A 4I64A 5LMNF 1YJ7A 3H40A 1S76D 4J9MA 2JLEA 4I7FA 3G8TA 3CCUS 3BKFA 2L08A 4M5DB 2C2RA 3SV4A 2MZSA 4Y2KA 2DNZA 1S72S 3L95X 4FXWA 4QPXA 2IA0A 1G7CB 3R3TA 4DWIA 5B0GA 3P96A 2XS5A 1YK9A 4DCJB 1HNZF 2MHEA 2BMBA 1GMUA 2JEIA 1FFSB 2GGPB 1YJVA 5U47A 2DHAA 1ZBTA 3NGTA 1JXLA 4DPOA 1X5TA 1PO6A 3IA0A 3IM9A 4QIFA 2G2YA 1KLMA 4KPYA 5ETLA 4B9SA 3KKFA 4X4TA 2GHPA 5IWAF 4B9UA 3I5AA 3NS7B 2A0FB 2DD8S 2C3MA 2QLBB 1BLUA 4F0KA 4BWMA 1JXVA 2DNKA 4DI6A 3W64A 3D68A 4LR8A 3ILIA 2CRLA 3DOLA 2KI2A 3GJRB 1HYSB 2O3DA 3QLHB 2HQ3A 1YLXA 1TTHB 1UZHA 3T1YJ 3GR0A 3FBBA 3GSDA 2HHTA 1ZOTA 3HHLB 3P45B 5KFIA 4HEA9 4TLRA 3W2WA 3NLCA 2VKRA 3A8EA 2ZH9A 1X9SA 1VK3A 2HKEA 5GAHU 2QJ3A 2ZKUA 1PC5A 2IAJA 2EBEA 2AEMA 2CAJA 1S1XA 4MH8A 1N34F 1FE0A 1HBNB 1OQ6A 2QLXA 4O44B 3BN4A 5THWA 1TV6B 5IT9U 3FEYB 4A8SA 2VOOA 2CWKA 1VLOA 3L7PA 2IM3A 3I87A 4Y3CA 4CM0A 1EARA 4C8LA 4YS2A 3WHIA 3US5A 5KFFA 1ZM9A 2YX1A 1RT5B 4RW6B 3QPIA 3RUBL 3K17A 2MQQA 2EEYA 2XWYA 2ZBRA 2W9BB 1KHWA 2ZZNA 2HPUA 5LXRA 4EZ9A 4DR7J 4XO0A 1JJCB 4A8OA 5CH7B 4TVAB 1RJJA 1GMWA 4PYAA 1OSDA 1NXIA 5IV4A 5GAHI 3BYRA 4JYAF 2G0CA 5J1EA 4UQGA 2J8SA 4I69A 2I5JB 2FLPA 1FXLA 1FRIA 3IN5A 4C8ZA 3CJ5A 2OIHA 4KFBB 1T02A 2YQ0A 3I56S 2UUWA 3HJFA 2D7SA 3ADAC 2FLOA 1NSQA 3JB9k 1N88A 2J6SA 2M88A 2A2CA 5CCLA 2J8AA 3CO9A 1YBUA 1QUPA 4PEOA 3UDVA 4I4BA 3H98A 4K8RA 2O1PA 1HWLA 1NSKL 3EXYA 1YTYA 2VG7A 5A8KA 2IM2A 7FD1A 1X5OA 3I5CA 1M5PC 1Q79A 4ID8A 1LNQA 1RXOB 2O66A 1RAJA 2FC9A 3AXMA 4NYPA 1T8EA 3K5LA 1YZ6A 1J5EJ 1HARA 1X7VA 4DG1B 2B3TB 5C25A 2J0WA 3KHHA 1VIOA 1O51A 3IWXA 2A6OA 2UV8A 2AEFA 1F1BB 1QAYA 5E3CA 1YKWA 1YDLA 1S6PB 1K1SA 3PXGa 2YPYA 1WC6A 3GMGA 2Z2YB 5EGYA 1U1OA 1FVQA 2RS2A 3BQ0A 4B02A 3AQOA 2FTRA 4OZ1A 3B8HA 2L3MA 2UXBJ 2HFVA 3MZIA 2PE8A 2HFSA 4L72B 2F4VJ 4ZPAA 4CLTA 2QT7A 4DL3A 2DVIA 4JI2J 3DLGB 1CC8A 4LSZB 3WBZA 5DZ7A 2XO7A 3RW6A 4L73A 1WKLA 2E29A 5A0YA 4ZP6A 4IH5A 3FNNA 4J9RA 2LEAA 4V19J 3DFEA 2LKZA 2P5VA 1K47A 4X4UA 9ATCB 1TKDA 4KHMA 5JUMA 3LPEA 1QD1A 5HP1A 2B9WA 2CWXA 4C6AA 2P9GA 4DX6A 4IO9Q 1YRUA 2QG9B 3GIJA 3AY0A 4F4YA 2BV3A 2XHWA 3DM2B 1GK8A 4FVMA 2CQ2A 2VUGA 1XTZA 2EK6A 4M5DA 1NPKA 1VQPS 1U1LA 4G1PA 3B82A 1X4DA 4M5IA 4JI5F 1KOHA 3PYGA 2G13A 3TJ8A 4DR1F 1T9XA 2Z57B 1SJRA 4MKYA 2KDOA 4DS4A 2PA3A 1Y10A 4AL6A 4PQUB 4GC7A 5ETVA 3MI7X 1K1QA 1E6YB 3S1TA 4NLSA 3EWGA 3SQOP 4DV1J 2GGPA 4I6WA 5IM0B 2N7YA 1WKJA 4LBHA 3W61A 4OHWA 4NI2B 1SJ4P 4FBUA 4H4KC 4ED4A 4PG6A 1WHWA 2HNYB 2I8EA 3LQVA 3M6WA 2OP5A 4NA2A 4ZHRB 2VBYA 4HH1A 3BO3A 2DBBA 3HZEA 4H54A 3MOZA 2VA3A 2WONB 2H48B 3IR6B 1YZ7A 3JTNA 3AA8A 4M5GA 2E9TA 3OL6A 1HYSA 4WP9A 3QLHA 2CFXA 1P9QC 5AE1A 1MWZA 2F7VA 3N4WA 1C1CA 4BC9A 2CJQA 3HHLA 1VC0A 3Q2SC 2DYAA 4FYYB 1V3SA 1N52B 2E1PA 2ROGA 3BF4A 4RUAA 4QWDA 1D8YA 3W62A 4B3RJ 3DCAA 2V2VA 1N5VA 4HKQA 3RRHA 1F0XA 1SB6A 1HD0A 1TV6A 5DO2A 4DV7J 1MG7A 3SBMA 3HSZA 4KQZA 4MKVA 2FVPA 4V19X 3MUTP 3R6LB 1IN0A 1VGYA 2LQ9A 2EKYA 3ZZTA 1JXEA 4JI7F 2K7KA 2MJUA 1PKUA 2VBZA 3Q86A 2CNLB 1SL0A 3M2UB 1RT5A 4W90B 2E1AA 3SFUA 4DFKA 1F9FA 3AOAA 4FKYA 2RU3A 1BQXA 4ZPVR 3IM8A 5IC6B 2KO1A 2W9BA 1H2TZ 2D9PA 3TUZC 4HYKA 3H0PA 1T95A 4MJKA 1WEXA 1Y5LB 4XTTA 3VAKA 4P74A 1IR1A 3CO0P 1VQ4S 1B7FA 3CMQA 1F9EB 2VG6B 3T1HJ 2RDDA 1D8ZA 1FJEB 4K4ZA 4QBUA 2I5JA 5DGAA 2GVDB 2RMLA 4RX6A 3LALA 3A4TA 3BM7A 4KFBA 4DR5J 3ICLA 4CI0B 1UMJA 2QFJA 4ZITA 4BWJA 4DSIA 5D3GB 4ZJLA 1IXKA 3OL9A 4S0MA 3MCOA 3Q8UA 2MY7A 2L9DA 1IBLF 1TP7A 1R7IA 4PG5A 4OI6A 1Q7YT 3HD2A 4TQSA 1JMTA 1WDDA 3T5KA 5FLXU 3MUVP 5IT9Y 4KTQA 5KT5A 3S8SA 4QZVB 2IMOA 3QO9B 2HIQA 2YKQA 3R5CA 1NM2A 5AJ3F 2J5AA 1A6LA 4DG1A 2EC2A 4L76A 4Q43A 2UUCJ 4UT4A 2UUAF 2VIHA 2AJ0A 2VJUA 1B99A 3HI9A 4QIVA 1S6PA 3JSMB 4NEYA 2XEXA 3JQMA 4GRSA 1FNOA 1RT4B 3CJTA 3PVXA 4ED2A 4JI3F 3O5TB 5B0EA 4F0MA 5IV3A 3NMRA 4ZLLA 4OYWA 3LP1B 4TKTA 5LSLA 3DLHA 3UNYA 3DLGA 2XZWA 1S48A 4QW8A 1ZPVA 3WQPA 2J7UA 4DL6A 3BSAA 3EGZA 1R8PA 2KZMA 1T9VA 3VQSA 1KONA 3NOCA 1Q8IA 4EWTA 2FJBB 1TKXB 4XAKA 4C9DA 2KFNA 3WDOA 5IC4B 5DG8A 4Y2MA 3JS9A 5C7PA 4LF5J 2DGUA 1IKVB 2EBGA 4A4JA 2C2EA 4LT6A 1Z4UA 1KFSA 5LOQA 3PR5B 4P75A 3KLVA 1CJTB 4ZPTR 4ZPCA 2Q43A 4USIA 2VA2A 1CC7A 3CEDA 3DM2A 3M8YA 1XC9A 3KK3A 2GC8A 4ENOA 2MQLA 2VPXB 4KR0B 3MPWA 5KFTA 5LMNJ 2OFHX 4IUFA 1VC6A 3FCVA 2F8EX 1R27B 1U1NA 3KK2A 2GAGC 2AJ2A 1UJ4A 4MTPA 2KG1A 1QAJA 4CT8A 1HFEL 1DBDA 2XMWA 4PQUA 1IM4A 1NKEA 4KPCA 5K9FA 2QEXS 1AUDA 3HULA 2DHGA 4C8MA 1H74A 1E6YA 4F7VA 2HLTA 2HHQA 5IM0A 1HNZJ 3OUYB 3MM5B 1H3DA 3GONA 2ZFHA 2MKHA 1QUVA 2BJEA 3LA0A 5DZ6A 4NI2A 2HNYA 2MZRA 1JLEB 2OMLA 3CCSS 1HA1A 5IWAJ 1EJ7L 2WONA 3QT7A 4JI6F 3SYZA 2Q3PA 5HK4A 4CLPA 3AD7C 1SQGA 1H2UX 1IVZA 2Y8WA 3C19A 5KFVA 1UVNA 2ERRA 1C4CA 2MHNA 2W2MP 4UZBA 2ZE2B 2U2FA 2CNNB 2R2UA 3AODA 4QOTA 5M2PA 5J1PA 2VODA 3MCNA 2DGSA 1ELOA 3EVMA 3OL7A 2M8DB 2NYIA 5B0CA 2CQ3A 4BS2A 1X5PA 4RBVA 2N4DA 3J80U 4C98A 1JK9B 2VHGA 1HNWF 4TU8A 1URNA 3M2UA 2ZVIA 4DR6F 4WF9Q 3LUYA 3AXKA 4Y28C 2AGPA 2W25A 5J2QB 3MEEB 1NH7A 2LU1A 3EZOA 3FSIA 4DL0C 1KKHA 1REVB 4EMDA 1B4SA 2M5YA 3EDRB 4R0JA 4YB1P 3HMJG 4DR2F 4ECWA 1DRZA 2LQJA 2VG6A 4ZP8A 4UW2A 5T41A 3D1OA 1GEHA 3J7YU 4JYAJ 4JI1F 1FKOB 5I42B 2GVDA 3EE3A 2WB1D 3O8WA 4AUKA 1NPRA 5F41A 4FKXA 2E7VA 2F5GA 3POTB 5D3GA 5KAKA 2OGUA 1RDRA 4JUZA 1UVJA 1RADB 1NLKL 4NYOA 5D0HA 3T6BA 3ZTOA 4E8UA 2QA4G 3FCWA 3B4MA 2HBYB 1NK9A 3Q8QB 3Q0AA 1B64A 2YWEA 4YN3B 3V2UC 3WIUA 3OL8A 4QWBA 4NWBA 3I82A 2WHOA 3OTBA 4AYBD 3QO9A 3MPDA 2DR7A 1R0CB 4B08A 2CIMA 2BYCA 3W5XA 4OYPA 3MR7A 3CJ0A 3X1LB 1S9EB 3J7YI 4OZ3A 5A6PA 5KFDA 4LF7F 3FFIA 3JSMA 5JVHQ 3OXLA 4UY8T 1N32F 4NLXA 1S6QB 3NKYA 2ZZTA 1RT4A 2UV8G 2B0GA 2B7CB 2ALYB 2OSQA 5KT2A 1BC6A 5E7OB 2DGOA 5I4MA 4DUYF 1KQFB 3D1HA 3LP1A 1FE4A 4MK7A 3PNIA 2CNOB 3NY0A 2QN6B 3H4DA 1SKWA 2RQ4A 4WYWA 1RP5A 1SJQA 2H5JB 2B4VA 1TU0B 5C2CA 2NQPA 2M4MA 3N01A 2CJAA 1TKXA 1T3OA 3MPYA 3G9CA 4X66F 3HFKA 3C46A 1QTNB 2V50A 4LREA 4ZK7M 1IKVA 2GMJA 3GILA 1FI4A 1FWLA 5FLXY 3P6YC 5K5MA 1EAYC 3O1LA 3W3SA 4P6QA 4CO5A 2UVRA 3M32B 1T05B 5EX0A 1QSLA 4M5HA 3PW7A 1KR4A 2BANB 1WC4A 1F5AA 3PIOQ 4ZCKA 2A10A 3EPIA 2HBRB 3IRXB 3S01A 4JI5J 5CD4A 3KLFB 3QJPA 4LBPA 4QIWD 4ZLJA 5KFMA 5GMDA 2ZH3A 1OMSA 1VRQC 3W9HA 2FHOB 2OUGA 3OUYA 3MM5A 3C6UB 3E51A 2D3OR 1W7WA 5KOWA 1SXLA 4OQJA 1SI9A 2JVOA 2P2CB 2LQ5A 3UR3C 2ZWOA 1JLEA 3HSGA 2RF2B 2R8IA 4WP3A 1VQ7S 4U8YA 3DRYA 3GB0A 3MM7B 1S59A 2MMYA 3LGHA 1D09B 2PMZD 3RB3A 1X4BA 2ZHOA 4KY3A 2XSJB 1SC6A 5KFOA 4KH0B 2HQCA 4KE5A 2OO4A 4ZVUB 2LDYA 1FJCA 1R43A 2H4YB 5CAAA 1EQMA 1X31C 2IVMA 2ZE2A 4DFPA 4J9PA 1RAHB 4LF4F 3WC2A 2PA8D 3UCGA 3V4IB 3U02A 2MJNA 2XQCA 2CZ9A 4EEYA 2KKHA 5IFMA 4LF6F 3BPDA 2AU0A 1FCAA 1PGZA 4DV6F 4YP3A 4OX6A 1LXNA 4ZOSA 1NDCA 2LA4A 1NDLA 2ZBCA 3G4SS 5J2QA 3MEEA 1L3KA 4QWEA 5DG7A 1ZTWA 1VBKA 4A8QA 4URQU 3TZWA 3KNAA 2HIYA 1REVA 4PXCA 2D69A 4C48A 3UR0A 1U1KA 3FQKA 5HAOA 3HT0A 4NXNF 1HWIA 2HS3A 4LFBF 3G6ES 3D2WA 2DCUB 1FKOA 5I42A 4OJHA 4HT5A 3HLUA 4NE9C 2UUBF 3GR1A 1WSRA 2RUGA 2HZVA 3TWZA 2ASDA 3POTA 1KTQA 2ZM6F 3G87A 2C2DA 3L7UA 4PUOB 3DLEB 2DNOA 3SFGA 3IGVA 2E7XA 4O4GB 2WK4A 1Y5IB 4EI2A 2PFFB 1WACA 2JC0A 4ECVA 2Z2ZA 3G82B 2JL9A 3DRSB 1TL5A 2B56A 3VAMA 4XIUA 1V5IB 3VF0B 1UW9A 3SCLE 1L5UA 1PAEX 2WW4A 2IDEA 5EWFA 3AJ1A 3J80Y 3GYNA 2XSFA 3OSNA 3MR6A 2OPRB 3M2RB 2BJ1A 4OLPA 5AJ3J 1S9EA 2QZ8A 2BW2A 2IRYA 2QSWA 2X51A 4NLYA 4LRBA 1CS4B 4FPRA 1V5VA 4RU2A 1C2PA 3BS9A 2ZH5A 3PW2A 2UUAJ 2CADA 3HPOA 1DLOA 4OI1A 3HHNB 2BA9A 4KBIA 1S6QA 3MAHA 3M9MB 2DPJA 5SZTA 3KLGB 2V0NA 5AXLA 2EW9A 1Q86T 2QMUB 3SXLA 3GIKA 2NREA 2W01A 4JI3J 3KUGA 1NJWA 1OO0B 5B09A 1U0SA 3CD5A 4C8OA 3R6GB 4CLUA 4D3HA 3QGPA 1NKBA 3PG9A 3KHLA 1FRJA 1LWCB 2XG8A 1VRUA 4DV5J 4DSKA 3PHTA 2GMLA 2Y3YA 2RSQA 2VBXA 5ETTA 2KTQA 3KG0A 3GFYA 4HHJA 4WXOA 5KFZA 1X60A 2U1AA 3M8QB 4RW8A 4CQ1A 7AT1B 5B7WA 4RNMA 4G65A 3DHXA 4NLRA 1L3SA 3M32A 3GG0A 5K8MA 2EG1A 3ZNJ1 1T05A 3K8VA 2B4UA 2BANA 1X9MA 4DN0A 4FS1A 5E3PA 1AYEA 3TOQA 1OY6A 4LSLB 5AXKA 2M2BA 1X4FA 3IRXA 2DGWA 2RS8A 1CG2A 3KLFA 3K5OA 1JLAB 2C22A 3CJSA 2FB0A 4USUA 4R5PB 1VJWA 4N47A 2WAQD 2CA9A 3DRXA 3BB5A 2IJNA 5HQ8A 1LV5A 2ATLA 7FDRA 3M8PA 4A8YA 1HWUA 2V8PA 3WZ0A 4PXEA 5I3UB 4NOHA 2J9CA 2HHWA 2RF2A 4ERDA 2KFYA 3KLIB 3ENVA 1SC4B 3MM7A 2DGVA 2MZTA 1RK8A 2L48A 2XSJA 2KJVA 4ED1A 2I0XA 3PACA 4OV6A 1U09A 4HHHA 1CPZA 3S6EA 3AJDA 1NK7A 1K0VA 3TUIC 1BQNA 3BGUA 4JI6J 5J2NB 5DQGA 1UWBB 2F3JA 1YX2A 4O3OA 4Y65A 1QLNA 2VU5A 3CCTA 1HWJA 4BCAA 2ILZA 2KN4A 4YMEA 1WF0A 2DB1A 2CJXB 4F02A 5F8HA 4X65J 3PO5A 3AA9A 3V4IA 2GNKA 4ELTA 3FZBA 5D0EA 5HJYA 1TL3B 5BYRA 2J7KA 2KJWA 3R5JB 5K20B 1R8AA 4JBCA 2QA1A 4NRTA 5HQMA 4DL7A 4Q0BB 4YB5A 2VFSA 4PPZA 3D66A 4LF9F 1VQYA 3IS9B 3ENAA 4DR6J 2DH8A 2GQQA 4I2QB 2FLLA 5T7LB 1NB7A 3MPUB 1WEYA 3W60A 2FHJA 1TAUA 3GJTB 1TFWA 3RRGA 4LQ3A 1XNQF 1TR0A 2LA6A 3IO1A 3D4JA 4OZJA 3M4XA 4DR2J 1SL1A 2YWGA 3RYLA 2NS1B 3GYXB 2EG2A 2FIUA 4CLFA 1VQLS 1FKAF 4DQIA 4PAAA 5D6GA 1NEEA 1HL6A 5KOXA 2WZ1A 4MMOA 4JI1J 1N8RT 4ED5A 3IR7B 4KGVB 2DISA 3BSNA 2FY1A 1FK9B 4P2FA 4PUOA 2D41A 2OD4A 5FD1A 2BE2B 3DLEA 2MSSA 5B0AA 1SPBP 4ANEA 5ITHA 1Q0NA 4O4GA 2B7BB 4U7UK 3G82A 3GLJA 3DRSA 1ZH5A 2EPIA 2XMTA 4K2XA 1HHSA 1N0UA 5C42A 2DNRA 4C0HA 1YRTA 2P9EA 2VL1A 5C24B 5LMUF 2KFZA 2OPRA 2DHHA 3SSRA 1WJ9A 1CS4A 2RAQA 1KQKA 3RB4A 4EGLA 2AV5A 3I96A 1S0NA 1VQKS 1X8DA 2FJEB 3ONQA 4LF7J 2LVWA 4Y6IA 1BWVA 2M0GB 3QRPA 1N32J 5H9FJ 3G6VA 3NG8A 4OZLA 1JLFA 3JQKA 3PX4A 4DV2J 3FBFA 5L38A 4DUYJ 2H5IB 1WDTA 2V94A 2ATCB 1WORA 1U48A 1IBKJ 1FKPB 1LWCA 2GX8A 1FD2A 3QWUA 2DEIA 4JP8A 1UW4A 2QLFB 4CIOA 2R7VA 4MKAA 4ZVHA 4EO6A 4YQWA 4J7CA 2CDRB 4DLEA 3VALA 4X66J 2CQDA 1UEKA 3CNQP 4NLWA 1N36F 2YKPA 4AQYF 3M8QA 2KH9A 3MFIA 3TYTA 1VIXA 3K5NA 1RHRB 4CP5A 4GMKA 3SMZA 4QU6A 1P9YA 3TEGA 2RRBA 4LSLA 3MMJA 4CWBA 2H1YA 2X7IA 4CO4A 4KSEB 4P2SA 4PXBA 5KG3A 3DGPB 4FZVA 4O3NA 4L3KA 2KZZA 4DPWA 1S9GB 3BSOA 3UWTA 1R8BA 1JLAA 2D74B 1FRMA 3MDFA 4R5PA 1MNEA 1SH2A 2N3LA 5HQLA 2MY8A 3LGMA 5BJRA 2OI2A 1SKSA 1CJUB 1DTTB 4QYRA 3EUNA 5BXIA 5KG5A 4CZCA 4IH7A 4ICLB 3ENQA 2UZAA 4DLGA 2GIRA 3KFWX 2B9EA 1S97A 2XLJA 1HPZB 1S7HA 3LTOA 1LQ9A 4NCAA 3KLIA 1J2VA 3NS6A 2IC3B 2JDJA 1RT1B 4RO0A 5A6WA 3R27A 3PR4A 3ITHB 4LRCA 3TZXA 3CDBA 3HVTB 1UWBA 2P6SA 4MIAA 1NK5A 2HSEB 3Q8PB 1RZMA 5D4LA 4PRFA 4X84A 2BQ3A 2DTJA 3GWCA 4ITSA 1KLNA 1D1UA 3K89A 4ED7A 4CLKA 4X4QA 1FT8A 1I3OB 3B54A 4KGZB 4W4MA 1RT3A 1TL3A 2MKJA 5C2GA 4I6AA 3GQCA 4L74A 3M9NB 2DNHA 1YJRA 1LK7A 2H5EA 2OH2A 4Q0BA 2HG4A 4CNZA 4N8OA 4CTAA 1KD1T 4LF6J 3QYYA 3RAXA 3CCWA 4DV6J 3IS9A 3ZZUA 4CYUB 3NNHA 1U6BA 3OBIA 3AQPA 1RKIA 1RA7A 1YGYA 3OR1B 2R4FA 2HFOA 3O2IA 3MD1A 1N4LA 5T7LA 4NLVA 1VQ9S 1TKZB 4ECXA 2HK2A 1FERA 3TX0A 3GJQB 2PDAA 3HK2A 4DX8H 1HI8A 2E9RX 2HFZA 5B08A 4KHRA 4ZCIA 3FBEA 2ZC3A 2RQMA 1Q81T 5D4PA 5CD4H 1T3NA 1BY9A 4LFBJ 1R0BG 1X4EA 2W2PP 2CJBA 4IOAQ 4CT9A 3ZZPA 4UOGA 4TYAA 3W5YA 1J5EF 4K4YA 3I31A 4ANCA 1DQ9A 4IG3B 3QFWA 1FK9A 1Y0HA 2BE2A 3G6XA 3MGJA 2HMIB 3DDIA 4OJ1A 1V3RA 4IR1A 1IR2A 3VAJA 3HVWA 1KFDA 3FC9A 3MOJB 4CM2A 3UD5A 3LW5C 4ZLNA 3MHYA 3DU6A 4WIQA 4HI1A 3VAFA 2VF3A 4Z7YA 1RE1B 5C24A 2C2NA 2F4VF 2M7SA 5LSOA 2DY1A 1NUEA 4ZVSB 3JAMU 4ZLPA 3D0GE 3ET6B 3PRVA 3GYGA 1JNZB 4E2FB 1IUJA 2R7XA 3C66A 1UPMB 2W7AA 1PYSB 1KRPA 3PM9A 3M6UA 3HF5A 2ZNYA 4DSFA 5M2RA 3U27A 2K3IA 2FZCB 1VBZA 5KFRA 1XMBA 1WOSA 4F3OA 4Q44A 3EDQB 4FNHA 4HDHA 5A76A 1G2EA 3KJQB 3PRDA 4QR0A 2QIFA 5ETPA 1WTFA 1AB8A 2KHCA 4EK2A 3VHQA 3I32A 3VGUA 2WSCC 2XTJP 1D9DA 1D9FA 2NSBA 4DJBA 4WKYA 4PWUA 2XWXA 1VRTB 3W63A 8RUCA 1JLBB 1Q5VA 2MQPA 4C97A 2L9NA 1WC5A 1ZPWX 3DNCA 2IJFA 3H59A 4DV1F 5CABA 3B4DA 1U49A 3EM1A 5L1LA 2BW7A 1P1LA 5T14A 4WP8A 1M1GA 4GO7X 2CPEA 2CPDA 2QA4S 3DGPA 4DFMA 1B7YB 1S9GA 1KLMB 2ZBPA 1S57A 4Q2LA 1E6VB 2AZ1A 2CQIA 2HGNA 2KT3A 3P5BP 1VBXA 2A3JA 2UVVA 3NCRA 3FQLA 2PI5A 2LQBA 2WOMA 1S1WB 3QMQA 4YOEA 1DTTA 3PCOB 3G71S 2HGLA 5KFPA 2HRYA 5HROB 3MMCA 4ICLA 2DXFA 1FFWB 2A1BA 3EICA 1Y00A 5E2QA 3BZQA 4FYWB 3OXFA 1NH8A 2YY3A 1HPZA 2CPXA 3CJQA 4Y2AA 3JTPA 2IC3A 4L3NA 1TAQA 1ZYQA 1RT1A 5F8IA 2KXNB 2AGQA 1VDHA 2YX7A 1DJ0A 5DDRC 2AIRB 3ITHA 3U1NA 3UN3A 3VV2B 3HVTA 1UJ5A 5G4DA 3R2DJ 1NZAA 3M2VB 3IBFB 1S1UB 2IM1A 4XDCA 1N56A 2CNKB 2VC0A 3DI6B 4HTIA 1YBAA 3J7A1 2YNIB 4KV8B 2QX0A 3KYLA 4B9MA 4ZPBA 5DQIA 3QZ7A 5F3ZA 3UDCA 3MM9A 3D28A 1IBMJ 1RWXB 4ZVRB 3NAHA 5HMYA 1U2FA 4DS5A 4PG7A 1BHNA 3K7RA 2BACA 4A8FA 3CT9A 1U0HB 8ATCB 4AFFA 1NJYA 1CJKB 2FHMA 5J1EB 3MEGB 2HHUA 3DOMB 4NLTA 4J9NA 4CYUA 1WF1A 1L3TA 1VQSA 1WELA
chains in the Genus database with same CATH topology
1OPZA 5HO4A 4QOTA 3P49B 1S0VA 3OR1A 5C42B 1HR0F 3TQ1A 5DM6Q 2EFVA 1NK0A 2VFUA 1VLYA 5M2PA 5J1PA 4I2PA 2VODA 2DGSA 2FGCA 2E1CA 2R8KA 4OLOA 1ELOA 2DGXA 4KC5A 2C3UA 1RTIB 3OL7A 4K4VA 1K0TA 3H5YA 2M8DB 3TVZA 1TKZA 2NYIA 1RTDB 4QPTA 5B0CA 2CQ3A 5E33A 1HD1A 3CDEA 4DEZA 3ZZRA 4BS2A 4KO0A 4F4KA 4OHXA 4UOCA 1SJ1A 3T1YF 4NCBA 2K2PA 2DR5A 5F0WA 1X5PA 2JSXA 4RBVA 4RU9A 2EFNA 2IRUA 4ZA1A 5E3QA 2N4DA 5I3UA 1XWLA 4C98A 2J7WA 3DYAA 2AJQA 1JK9B 3KLHA 4K4WA 4FF2A 3CSKA 3WX4A 3SSSA 3DLJA 1Q4RA 2JC1A 3MTJA 3CUNA 2EFQA 1HNWF 4TU8A 2ALZA 1M90T 1URNA 3M2UA 4DR6F 4WF9Q 3G96A 3LUYA 2XCPA 4Y28C 2JEJA 2AGPA 2W25A 4F3MA 5KG7A 5J2QB 3MEEB 1I6JA 1NH7A 2LU1A 3OTCA 4RUCA 2EFOA 3T9ZA 3LOUA 5DLFA 1YSJA 1Y3JA 3FSIA 5D77A 4DL0C 2E5JA 5CYQA 3DLBA 4IG3A 1SJFA 1REVB 4CO0A 4YR2A 2M5YA 4BC7A 3U1MA 4ES2A 2HMIA 4R0JA 1JLFB 4G3IA 4YB1P 5J2NA 3HMJG 1KTVA 3CVKA 1RYSA 4DR2F 4ZVFA 4KB7A 4ECWA 3RB6A 1YHQS 2N3OA 1DRZA 1EETA 2CJKA 2YNHB 1R0AB 2APOA 2WTFA 4GO5X 3D1QA 3ISZA 2LQJA 1J5OB 2VFTA 1LWFA 3OFFA 1NKCA 2MKCA 2VG6A 3UD4P 2IFXA 4ZP8A 4UW2A 5T41A 4ETZA 3MFHA 4ECSA 3SSQA 3D1OA 2BABA 3J7YU 1OS5A 1SV5B 3NCPA 4JI1F 1FKOB 1ZZFA 5I42B 1L3VA 1M5VC 3SQGB 4ILMA 2MQNA 5CQGA 2WB1D 1HNVB 3TRGA 3O8WA 4USHA 4AUKA 2YNGA 3I0SB 2JZ5A 5F41A 4DR7F 1LK5A 4AXIA 5HLFA 3EYZA 3HHKA 1C1BB 3OTEA 3N5FA 3POTB 5KFLA 4Z37A 5D3GA 1MWYA 1DAXA 5KAKA 2YX4A 2DH9A 1RDRA 2E44A 4JUZA 1NJXA 1UVJA 1SH0A 2QMWA 3OHAA 1T03A 1M5HA 5AE2A 1X4GA 4CO1A 5KG6A 4NYOA 2PI4A 2B43A 3T6BA 1FDAA 2YWKA 2VC1A 4E8UA 4B9TA 3M8SA 2QA4G 2FHKA 3TR5A 2P6TA 3B4MA 1NK9A 4PWDA 4QIGA 3W7BA 1WI8A 3Q8QB 3Q0AA 1B64A 2YWEA 1S99A 4NYZA 2CQPA 4ECRA 3V2UC 4YDXA 4WU3A 3OL8A 2OPQA 3KG4A 2VFVA 3CCLS 3AH6A 4QWBA 4NWBA 4LF5F 1QSSA 3I82A 3PY8A 3TP2A 1VI7A 1Y4ZB 2WHOA 3OTBA 5BYSA 4AYBD 2WRMA 2V4JB 4I2QA 2XY7A 3LPYA 3QO9A 3CD6S 5IT4A 3FDSA 2JRSA 1HBNA 2CDQA 2GW8A 3T3FA 4O44A 2RE1A 2DH7A 5HL7Q 3PV8A 2DR7A 4C3MA 4B08A 2C3PA 4IRDA 2CIMA 4LFCF 2K1RB 4N77A 2GJIA 2BYCA 2BVZA 1HBOB 2F8HA 3CJ0A 3X1LB 2XI3A 3RAMA 4P7VA 2XBPA 3MMBA 1S9EB 1DTQB 4QJVA 3T5HA 3J7YI 2PD1A 2ZKTA 2ZC4A 3DRRB 4ECUA 2HNDA 5A6PA 5KFDA 1RYRA 4LF7F 3FFIA 4YHHF 3JSMA 2P9CA 3LF0A 3BDEA 3OXLA 4YFUA 5JVHQ 3DOKB 2C3YA 2MZJA 4UY8T 2V4RA 2GQ2A 2EFPA 3G6YA 4KRWA 4NLXA 1S6QB 2NUUG 3W2VB 4J9SA 1N32F 1JLGB 1UVKA 3NKYA 4RW6A 1KNZA 3IWNC 1RT4A 4IDKA 2QSFA 2VASA 2UV8G 1N0VC 3JSRA 1YWXA 4C3KA 3LAKA 3CDUA 2BQRA 2B0GA 2B7CB 3JYTB 3C3LA 2PT0A 1R89A 2OSQA 2W9AA 1U1RA 5KT2A 2R2TA 4Y34A 3VCDA 1BC6A 5B0DA 4JV5F 4PCQA 5E7OB 4ZKAA 4DL5A 2DGOA 1VK8A 5I4MA 3ULHA 2YTCA 4DUYF 1KQFB 1VRTA 3D1HA 3CGIA 2R7TA 3LP1A 4K5SA 4AE5A 1FE4A 1B0PA 4DL2A 4MK9A 4MK7A 4RW7A 4GC6A 3PW4A 5F8JA 4EUVA 1JLBA 1HI0P 3PNIA 3ENWA 3V81B 4IO1A 4Q8FA 4FVCA 2FLNA 4R8UB 1KOOA 1FDNA 3H4DA 1GXUA 1D9FA 1SKWA 4ZS6A 2XMMA 1CSJA 2RQ4A 3BGFA 3OTOF 4WYWA 3D54A 1URRA 1W25A 1RP5A 2Z4PA 4M1KA 2Y0SD 5DS7A 1LWEB 2E5HA 2LMIA 1SJQA 3E2EA 4C11A 3R5AA 4WIIA 3FSXA 4OI4A 5I3QA 2B4VA 1U45A 5HMZA 3LAMA 3J7Z5 4NMLA 4TXSA 4ZP9A 5L9XA 4DDFA 1FJGF 2NQPA 2M4MA 1MW7A 3N01A 1U1QA 3EX7B 4CH1A 2CJAA 4WFYA 5DRKA 1TKXA 5KFNA 1S6OA 1T3OA 3MPYA 5E41A 2BOPA 2PEHA 2LDIA 4ED6A 3G9CA 5IQ6A 5GADU 2PMHA 3QJJA 5G0RA 1VQNS 4WU2A 4RNFA 3JAMY 3OHBA 5CCMA 4X66F 5K8OA 3HFKA 4C8NA 3C46A 2UXBF 2X1GA 4WZMA 3S7RA 5MAOA 1O8BA 4IOBA 4K0KF 3Q8SB 4XK8C 4MYTA 4F3QA 2W4DA 4ZK7M 1IKVA 3AB4B 1MU2A 2GMJA 4FF3A 4FF4A 3GILA 1E6VA 1SL2A 2RQKA 4B3SF 3CC4S 5K8PA 2C3OA 4KT0C 1ZZNA 4JI2F 5KFWA 5FLXY 3L3CA 4H4MB 4QU7A 3IC1A 3P6YC 1KC8T 5F8LA 1VC5A 1RTJA 1SBRA 5K5MA 1JLQA 3CD0A 3DMJB 3O1LA 3W3SA 1XN9A 5A8RB 2GHVC 4P6QA 4CO5A 3EXCX 3I0RB 4IOCQ 1IBMF 2UVRA 1S1WA 4O0IA 3M32B 1FD8A 2KXFA 3CJKA 3PO4A 1RT3B 5F0UA 1CVJA 3OFGA 4OX8A 1AROP 3MECB 1T05B 2DITA 3HM9A 5EX0A 1QSLA 1NK6A 3PW7A 1GTEA 2OD6A 1KR4A 1XR7A 2BANB 3TW0A 1X4CA 4IFVB 4N56A 3OJUA 2NLWA 4ES3A 2B9YA 3BGRB 5HROA 1X9WA 4TY8A 1DQ8A 1PSDA 2FHJD 3N0VA 3QWPA 1F5AA 1YJUA 1U6FA 2RILA 4QCLA 3CCMS 1C1CB 3PIOQ 3VAGA 4ZCKA 4JV1A 4RWWA 1N5SA 1VQMS 3RTVA 2A10A 2AYBA 1IQTA 3EPIA 4G6VB 1OWXA 3IRXB 1BQMB 4NZ7A 3S01A 4HLBA 4CTAB 1U6ZA 4ZCLA 3KLFB 1FESA 4YB6A 2HLUA 2RJZA 3QJPA 3KK1B 4QIWD 5KFMA 4X4VA 2J9EA 3I6PA 3H5UA 4G1QB 1HQUA 2ZH3A 2FJDB 2DNYA 2FC8A 4IG0A 2E5LF 4J9LA 2HVHA 2AWZA 1Q8BA 3RZAA 4EBDA 1KQSR 3V6JA 2DR8A 2VD3A 5LXYA 5GADI 4Q8EA 3H5XA 2BDPA 1RTHB 3N79A 1LFWA 1FRKA 3M6XA 5F9NA 2Q1LA 2BRKA 4IFYA 4R25A 4K5RA 2CVIA 2FHOB 3NNAA 1MROA 4CH7A 1NHUA 2DNQA 2H9ZA 3C6UB 3MM5A 5B0BA 3E51A 3OUYA 3FCHA 2D3OR 3V4MA 4C0BA 5KFQA 4U7CA 4FXDA 2CVEA 2DHXA 3M2VA 4I7FB 4OFZA 3GV5B 2VQEF 2KVIA 3PJXA 3UCUP 4CCHA 1BGXT 4KAIA 5KOWA 3E01A 1SXLA 1S1UA 2JVRA 4OQJA 1SI9A 3H2VE 3P3DA 2MZ1A 2ASLA 1KSPA 2JVOA 4JOUA 5F8GA 3GV8B 3LH2S 2J9DA 2LQ5A 3UR3C 2K7JA 5L1KA 3UFCX 3PX0A 1JLEA 3TA2A 1XK8A 4RNNA 1XEZA 2VONA 3D5MA 2RF2B 2R8IA 2DO0A 3M9OB 1Y3KA 3SDEB 3DI6A 1VQ7S 4A47A 2J0QD 5JXSA 2GMHA 2YNIA 3DRYA 3LP2A 3GB0A 4YR3A 2BR0A 3MM7B 4KV8A 3VZHA 2E5IA 4IQXA 2MMYA 3PEHA 5DQHA 2RH3A 2KRBA 3LO3A 2XGPA 4F8RA 1V9OA 2PMZD 3RB3A 4EU0A 1FTCA 2ZH4A 1X4BA 2ZHOA 4MIWA 5AXMA 2XSJB 5HBMA 1SC6A 1FHTA 5KFOA 1Y9OA 2MKSA 1I94F 1ZM4A 4B9LA 4KE5A 1OIAA 4ETXA 3BSCA 5CZXA 1U1MA 2KM8C 2OO4A 1KEKA 4J9KA 1NJIT 4MFBB 2KB2A 4RKUC 1KQGB 2LDYA 3MM8B 1FJCA 2VZ9A 1GXLA 1R43A 1RKJA 1NU4A 2R8GA 2Y1RI 1N6QB 5F3TA 3AB2B 2IVMA 2MDAA 2X1AA 4DOZA 2R7WA 2ZE2A 1SUQB 4DFPA 2ZOGA 2JFKA 3SV3A 4J9PA 1S1TB 3MEGA 3WC2A 3DOMA 4LF4F 1FKPA 2DPIA 1WG1A 4ED0A 4YDDB 2KHDA 1H6KX 2LEBA 3PW5A 2F40A 3H2LA 3CDWA 5EWGA 1MMLA 4C2MA 4ILLA 1Q1KA 1AFIA 4M8LA 4TN2A 3PKYA 2PA8D 2RDIA 5GAGU 3AHPA 1OSCA 4HT7A 3UCGA 2OFGX 1UEVA 1RTIA 3V4IB 5DJBA 3MUMP 3U02A 2RRAA 2MJNA 4K4XA 3DOLB 1RTDA 2A2DA 2XY6A 1HI1A 3T19A 2HNZB 2EI5A 2HHXA 3N5BA 1Z1ZA 2YNFB 2E1RA 4NCGB 2F1FA 4ES1A 4EEYA 4ELUA 3GFHA 4DN9A 3TO8A 2R2RA 4UY85 2YH1A 5J2PB 2XMJA 2KKHA 5IFMA 4LF6F 5C5JA 2AU0A 5E3AA 1U25A 2ZOFA 2HVZA 6FD1A 4HL9A 1FCAA 1GXTA 4B9VA 1PGZA 4ATNA 3NBPB 4YP3A 4DV6F 2N82B 5AXNA 2YKMB 3JTOA 2MQMA 3QGIA 1NO8A 4N76A 4OX6A 4RLEA 2OMOA 3W2WB 4RBUA 3K0JA 2RKIB 1LXNA 4ZOSA 1B0VA 4B3RF 2LA4A 1G3OA 2CG4A 4Y2IA 3TAQA 4OHYA 4RZRA 4NLOA 2ZBCA 3G4SS 5J2QA 3MEEA 2XLKA 1L3KA 4QWEA 2CJ9A 4QR2A 5DG7A 2IAJB 3JSYA 3OVSA 2COLA 2CZ4A 3FEZA 1ZTWA 4A8QA 1P27B 4URQU 2IVFB 3KNAA 1YJTA 3PHEA 1S1XB 1Z2ZA 6FDRA 1REVA 5F8NA 4DV7F 2QE5A 4PXCA 3CIZA 2OTLS 3UR0A 1U1KA 2MPUA 3FQKA 3RRKA 5HN0A 1Q82T 2XS7A 1KVJA 4F26A 1WF2A 3FVYA 1DZ5A 4ELVA 4OI0A 2XB2D 1YJNS 5KFGA 4WCEQ 2O5DA 5KT6A 2YNHA 2BM1A 1R0AA 4NXNF 1FVSA 4DL4A 1HWIA 3ZZOA 3SZ2A 1NNDA 4MKBA 2ABYA 3R5BA 1SH3A 2HS3A 4KJIA 1DARA 2GV1A 4TQRA 1J5OA 4LFBF 4E98A 1N33F 3G6ES 5DETA 4RWXA 4NPOA 1N54B 4ZHRA 2IM0A 3D2WA 5GAGI 1SV5A 2DCUB 2IYIA 1FKOA 5I42A 2B4PA 3SQGA 4OJHA 2DHSA 3IAS9 4HT5A 3HLUA 2FJXA 1AFJA 1JKHB 1Y7PA 2ZH8A 1HNVA 2ROPA 2UUBF 1R8HA 3ISND 3I0SA 2ZH6A 4I1TA 3GR1A 3T5JA 2B9XA 3TUJC 1NAQA 2Z2LA 2KT5A 2RUGA 4M95A 2WSEC 5EWEA 2C2RA 3LGNA 3MMAB 2ASDA 1C1BA 1HQEB 1KTQA 3POTA 2ZM6F 3V6KA 2C2DA 3R1HA 2QO3A 1B0TA 2AGOA 4WFNQ 1SQEA 4FN5A 4PUOB 4KHPF 1X0FA 2D3UA 4ZPWR 3DLEB 2HRUA 1PC4A 1CQNA 2D9OA 2JOQA 2BZ2A 4OZ5A 2DNOA 3SFGA 4Q7AA 3C2PA 1KHVA 3IGVA 3CCRS 2Y1IA 2E7XA 3M05A 2CQ1A 4O4GB 2BRLA 3VZIA 2ADCA 2EC0A 5KG1A 1DURA 1WG5A 1X4HA 2DR9A 2HQIA 2WK4A 1Y5IB 1YITS 3T1HF 2PFFB 3CCVS 1WACA 2JC0A 4ECVA 3IAM9 3MF5A 2JL9A 1IKXB 3DRSB 1TL5A 2B56A 3FRYA 4Y00A 3VAMA 4OJGA 3KHRA 4XIUA 5KT7A 3VF0B 4DQPA 1UAWA 4I6YA 3SCLE 1L5UA 2CQBA 4ZVGA 4GKJF 1MMDA 1OQ3A 3OQ2A 3WC0A 3QJLA 1O0PA 2I2YA 5EWFA 4LF8F 3SCIE 4YEAA 3TVKA 4DR5F 3AJ1A 4UUXA 1ULRA 1RT7A 2V4JA 4OHZA 3J80Y 4A8XA 5CA5A 1IQZA 1Q53A 3KTQA 3GYNA 4K50A 2MQOA 2XSFA 3OSNA 2I38A 1JIHA 2WCXA 4X4NA 2ZJRQ 4CNYA 4LQ9A 3MR6A 1LW2B 4ED3A 2AYMA 2K1RA 2QLWA 2OPRB 3M2RB 1HBOA 3VWSA 2ASJA 2AJFE 2Q66A 2GJ2A 3RB0A 1YJWS 1JB0C 2XMVA 1H7XA 5FDLB 4OLPA 5LT5A 2ZJQQ 3THVA 2JEFA 3IWLA 4LVOP 1S9EA 1SIWB 4Q45A 5KFBA 1DTQA 2QZ8A 3CWJA 2BW2A 4URSA 2IRYA 2X51A 2QSWA 4NLYA 2DGTA 4F4ZA 4FPRA 1HNXF 3FSYA 4NZ0A 2W4CA 3KNGA 4RU2A 3OVBA 4HH0A 1C2PA 5A2QY 3BS9A 4JI0F 4YUDA 2ZH5A 3PW2A 3H2UB 3HPOA 1DLOA 4OI1A 3O3LA 2WOMB 3DOKA 1VOMA 5K14B 1S0OA 3CC7S 4GKKF 3LANA 3HHNB 2BA9A 2FPHX 4KBIA 3W2VA 1S6QA 3KK3B 1GNKA 1JLGA 3MAHA 2CQCA 3M9MB 3M6VA 2CPJA 2JH3A 2DPJA 5SZTA 2UVUA 2FDNA 4DQSA 1WHXA 2VG7B 3IG1B 3KLGB 1H98A 1R6YA 2M52A 5A8KB 2V0NA 4QWCA 5JVGQ 1A9NB 2CYYA 3JYTA 1UVMA 3DN9A 5AXLA 5IXUA 3BO2A 2KT2A 3MMCB 2EW9A 1VQOS 1XR6A 2HS0A 1Q86T 3OVAA 2YQ3A 5HI7A 2MZQA 2VKZG 3HO1A 1S79A 4K4SA 3SXLA 2OPPB 3KK2B 2DRBA 3GIKA 2WBMA 1F5BA 1K73T 2YKNB 2CPZA 3LWLA 3UCZP 1S0MA 4H4OA 1YG0A 2NREA 2XLIA 2UUCF 1S6UA 5KFKA 4IH6A 1QE1B 3V81A 2CPHA 3T5LA 1QAXA 4R8UA 1NJWA 2KU7A 1OO0B 5C25B 5B09A 2O67A 2ZVSA