2QTWA

The crystal structure of pcsk9 at 1.9 angstroms resolution reveals structural homology to resistin within the c-terminal domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9 Propeptide
publication title The self-inhibited structure of full-length PCSK9 at 1.9 A reveals structural homology with resistin within the C-terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 92
sequence length 92
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2qtwA01
3GCXP 3QFHA 4K8RA 2Z57B 1SPBP 2E1PA 2W2QP 3WIVA 1ITPA 3CO0P 2Z30B 2XTJP 3BPSP 3H42A 2ZWPA 1V5IB 3T41A 3VV2B 3P5BP 4OV6A 3WHIA 2W2PP 1R6VA 3VHQA 3BGOP 2W2NP 3A3NB 2Z58B 4NMXA 3WIUA 3GCWP 2Z2ZA 2PMWA 2Z2YB 3AFGA 2W2OP 4JP8A 2Z56B 3SQOP 2ZWOA 2QTWA 4NE9C 2W2MP 3A3PB 3CNQP 1SCJB 4YN3B 3A3OB
chains in the Genus database with same CATH superfamily
1C0UB 1VLOA 2LQBA 2GMHA 1UEKA 3G6ES 3UCGA 4W90B 1QVGR 1NEEA 2VFUA 5KFNA 1L5UA 1FNXH 3KLHB 3FEYB 3FQLA 2B4PA 3DM2B 1CLFA 2IVYA 1RCXB 4I0WA 5DDQC 4OYAA 1PGZA 5I3UB 1KVIA 4IG0B 3IWLA 4QYZJ 2DBBA 5CYQA 2FQQB 2RUGA 1HPZB 3ZTOA 3PYDA 4F4YA 1UPPA 1OY8A 2DGTA 3Q8RB 4B3SJ 2OFHX 5B0DA 3L9ZA 3MR3A 3OV7A 2DNGA 3CIZA 1E6VA 2CDRB 2GQ2A 2KN4A 1RHMB 2RRBA 3E8OA 4KYZA 2XEXA 1K73T 4WTOB 4M5KA 3OXFA 4ILRA 3PR5B 4C0OC 1Q78A 2DIVA 2MZ1A 3NNAA 4QOTA 1Q7LB 3OTEA 4P52A 1XNRF 4HH1A 2ZBCA 1TKZB 5M2PA 4QW8A 3BKUA 2IM3A 4WIIA 3AJ1A 3HSGA 3GFZA 3W1YC 2V2KA 1R3NA 3HK2A 4MIBA 4BHQA 1KLNA 2I8EA 4J9QA 4OI0A 2W9CA 4ZPCA 5B0FA 2VBZA 5J2MB 1CJKA 4K2XA 3OQ2A 4DQRA 2EEYA 4QYRA 4C6AA 4ZN3A 3IWXA 3RB6A 2R7OA 5KT3A 5KG2A 5E3PA 2RRAA 1OYDA 1VIXA 5F8IA 4PEOA 3TQEA 2KG1A 4ED8A 2BKPA 3EPGA 4NMXA 3FK4A 3BV8A 1IKYA 1F9FA 3ILLA 2HKEA 4P71A 3HX9A 2C3PA 1WC3A 3K5MA 1IBKJ 5ETRA 4I6AA 2ZZTA 5IT9U 2D1CA 4QPTA 1AXQA 1FDDA 4F4XA 1OPIA 2FJVA 4LVNP 3U1NA 5M2UA 2UXBJ 3D0IE 3KG0A 1RAFB 3LGMA 1IBMJ 3SFUA 3LF0A 4ZIWA 4LQ3A 4PRFA 4E2FB 2V5HG 2C3YA 4YMEA 2YWGA 2UUCJ 4JV2A 3QJJA 4O4GB 1Q82T 1HI0P 2Q1LA 2JFDA 5D0RA 2HHWA 4FDFA 3D67A 4K4ZA 1K8AT 1X4GA 2JL9A 3HULA 2PMZD 4OFZA 1Q8LA 2B4OA 4DWIA 2LU2A 3V81A 5E5NA 5KFPA 1XNQF 3AY0A 1G6BA 2HVZA 4ICLA 2BXJA 5J2NA 4CLTA 3M9NB 4ZCLA 2CVIA 3K2YA 4GC6A 4ED5A 2CIMA 3KK1A 3BDPA 2BE2A 2FJXA 2O3DA 2QA4S 1Q16B 2JX2A 1SVDA 3MM7B 3NP5A 4XPCA 3AB4B 5KG3A 2C2DA 1R0BG 1TKTB 4X65J 1T03A 3ILIA 6FD1A 1FNOA 4DV4J 1ZM2A 4C0HA 3MM8B 3ET6B 1QSSA 2B51A 2GJ2A 3JTNA 1K1SA 3SBMA 1NLKL 1NH7A 3CJ8A 2D9OA 3G6XA 3MEKA 1FJEB 2HG4A 3M8WA 2QMXA 2J0QD 4LF8F 3GJSB 2XG8A 4JI7F 2EG1A 2LQ5A 4TKTA 3R9LA 2XLJA 3KLEA 3OR2A 3RGIA 1D0EA 5IXUA 1UWBB 2WVDA 2QV6A 1URRA 1MW7A 4M5LA 3MEEA 4RNHA 3PRVA 3W2WA 4PUOA 1X7VA 4U7UK 1IBLF 3RRKA 3MD3A 4P6QA 1T8EA 4I4BA 2ROEA 3MOJB 1FVQA 4JI6F 4MK8A 3G8TA 4LRAA 2YKPA 2NXNA 4ERDA 2XI2A 2R9LA 2CJQA 1GMUA 5DGBA 1T05B 2XSFA 4KIAA 3J81j 1N36J 3ILOA 1NPRA 4EYHB 5I42B 1U7LA 5ETVA 3AD9C 4KT0C 2BJ3A 3LH2S 4WFAQ 3IRWP 3R27A 4YHHF 3FJ2A 1HR0F 1O51A 3EZOA 2CQPA 1RT7B 4ED0A 5EHHA 1U45A 2EK6A 4RX6A 5H9EK 1WDTA 4ZPTR 2HNYB 1U0HA 1SL1A 4QIGA 2UUBJ 2QE5A 1S1VA 2XMTA 3BGLA 2R2UA 4NZ7A 3RJMB 2V9KA 2QLXA 3CD0A 2M88A 2VIHA 1NZAA 2ZBPA 1KEKA 3W64A 3R1HA 2ZH1A 2GJIA 3M6XA 3NBPA 1I51B 3CEDA 1F5CA 1HHTP 2NQPA 1YZ7A 3OLAA 3PX4A 1IQZA 5HSPA 5HP1A 1NCLA 2Z8QA 5IWAJ 4TY9A 4CLYA 3NGTA 3OUYB 1Y11A 4WXOA 3EM1A 4LRDA 2R2RA 4MKYA 1RTHB 4HHUA 3IBCB 2F7VA 3JQJA 4JI8J 4ECRA 1V3RA 4WTYA 2IAJB 3QAUA 5MLCV 3SCJE 3W65A 1S6PA 3H5SA 2I1RA 1TV6B 4RW6B 2AU0A 2GZOA 1CS4A 4F25A 1NHVA 3BREA 1IR2A 3GG0A 5LMUF 1W2IA 1Z2ZA 2OSQA 3V6DB 1AT1B 2BQUA 1WELA 3QNWB 4R0JA 2ZE2B 3TA0A 2OH2A 5DZ6A 4UOGA 1RLCL 1MU2A 3UR0A 1H2UX 5EN1A 2MDAA 3NAHA 1J27A 2VFTA 4NLGA 4ZDNA 2VBXA 1Q8IA 4ZVUB 4LR7A 1RZMA 3EXCX 2CZ9A 3EGWB 4IRDA 1JLAB 1QAXA 5IZHA 5LMNJ 1FRMA 4RNNA 4RUHA 1TVRB 3LPEA 5KFIA 2KI2A 3BSNA 1AFJA 1F2GA 2KTQA 3NAIA 4ZP7A 3R97A 2OTLS 4B3SF 3BH6B 2EC0A 1CQMA 4M5DA 2ZNZA 1YLXA 1LWCB 1U48A 4LSLB 2DEIA 4W92B 2O1PA 4FPIA 4C8NA 1S1XB 4LFAJ 1UFWA 1N4LA 3HVTB 3FRZA 2HEKA 5KFOA 1TKXB 1PKUA 2XNRA 1KNZA 3MCMA 4A8KA 2GHPA 3MFIA 4J37A 2CQ0A 5B0AA 4IOCQ 3CCES 3M2VA 1U1NA 4LT6A 3EUNA 3FBEA 4USMA 1BWEA 3MPUB 1N54B 3KUEA 3JYTA 4CO5A 2PFDA 3VZHA 4KQZA 1LFPA 1NSPA 1EZZB 2CPHA 4QJVA 3POTA 1S49A 3QBCA 1HNVA 2MKHA 2I6WA 2FD2A 5T41A 3D6TB 3DOKB 3K8VA 3PR4A 2FVRA 1Q95G 4HT5A 1O5JA 5IFMA 2IYIA 5J1NA 3QT6A 3KK3B 2CQDA 1QSLA 3S1TA 5IT4A 3HJVA 4CZCA 4NI2B 3ELHA 4Y2IA 4IQMA 4KHMA 4QWBA 1ITPA 1IBKF 3I9ZA 2POKA 2LDIA 5HO4A 2XI3A 1F9HA 1KR4A 4YS2A 3PW0A 2VU5A 3VVUA 5E3RA 1DARA 2WBRA 2XS5A 2H3EB 4O44B 4AE5A 1CJVA 3HZEA 3A3OB 1CC8A 2F65A 4WJBA 2ZOGA 2UXBF 1RYSA 2OUGA 2OI2A 2DNOA 3IS9B 1IBMF 1RT1A 3PX0A 2FVPA 3CJQA 2IJNA 3M30B 3H98A 2UUWA 2UUCF 1HMVB 2E1PA 2KYZA 1N32J 3DN9A 2NUUG 3BPSP 1G4CA 3M2UA 2HBRB 3K5LA 5BXIA 4J5OA 4AXJA 3UW1A 4NA2A 4F0HA 4WE1A 1RTDA 2BJEA 4I2PA 3QLHA 2RDJA 1RT5B 4USHA 1VBXA 3FSIA 3V4IA 3KXDA 2I38A 4OZ1A 1FCAA 3QT5A 4XPEA 4UY85 4DF4A 2F8MA 2ABYA 3T9NA 4FXDA 3CULA 4Y6IA 2IM2A 4HEA9 4FBUA 4WFZA 2YNHB 4RR5A 2EI5A 1F60B 3B8HA 3PW4A 4GKKJ 4OYBA 4X65F 2YKQA 1YX2A 5E33A 2KZMA 1X9WA 2DHHA 5HL7Q 1SPBP 3BYRA 4OI4A 1VC0A 3TAPA 2RE1A 2X3GA 3TANA 4M8LA 1X8DA 4A4JA 5CA5A 1KQSR 2ACMA 1U8SA 3C6UB 4K4VA 4LRFA 1SH3A 3OSPA 5F8MA 2MEWA 1S48A 2XY5A 3GIJA 3F44A 2MSTA 1VJWA 1RBLA 4QWAA 3UFCX 3PX6A 2XMWA 2J9DA 5ETOA 4ZVFA 2CVEA 4X4RA 3JSMB 1BMQB 4DJBA 3C6TA 2X7IA 2ATLA 1O0PA 1EKSA 3OT9A 1KOHA 2Q3PA 1R0AB 4LQ9A 2MJUA 2ROGA 4X62J 1X5SA 1RT3A 5CHCB 4B08A 1FWLA 1FWPA 2XMMA 3T1YJ 3ADAC 3GFYA 1EETA 3A13A 2OFGX 1N36F 2A6OA 4DX8H 1EX8A 1R8PA 1GMWA 2NPFA 3E51A 5A0YB 4F4KA 3TR5A 1ZPVA 2YNIB 5DQHA 4ZN1A 3AA8A 2FDNA 3SIPB 4I2QA 2JLFA 3DRPB 1GFWB 1RK8A 2BANB 3HHLD 3MUMP 1KWMA 2P8IA 2J7WA 5D15A 1S5ZA 2FHJA 2UUBF 2BOAA 1FK9B 1TUVA 5JXSA 1HL6A 1WI8A 3GLJA 4DG1A 4RNMA 5KFJA 2VICA 2VG6B 1QY7A 1MMDA 1J5OB 1FESA 4ITSA 3A8KA 1J5EJ 3DLBA 1RTIB 4J7CA 1N0VC 3VVTA 1WKJA 4WBFA 4OJ1A 5GMKa 5C24B 5EX3A 4WU2A 4NA3A 1MG7A 2V2VA 3NGUA 3DRXA 1HHQA 2RD5C 2WVEA 1WACA 9ATCB 1XEZA 4P7VA 1SQFA 1H7XA 2EFVA 4JI8F 4ILMA 3J7A1 3BS9A 1NJIT 4BC7A 3TOQA 4EI2A 4I7FB 4LF6J 1ZAWA 3TJ8A 3UR3C 3RBXA 4PPDA 1UPMB 1QAIA 5HI7A 3G86A 3HT0A 4DV2J 4R5PB 2CDQA 1RAIB 3W8PA 3QMQA 3OL7A 2KVQE 3H5UA 2GAHC 3GG1A 2GGPB 2IVMA 2E5HA 3K57A 4S0MA 3IM8A 2C2OB 4OI6A 3D7SB 1K0VA 2U1AA 4FYWB 2HWIA 1N33J 3AD7C 3IG1A 1LWEB 4DOZA 4FKXA 5KFWA 4IOBA 1PBUA 1AZSA 2MHNA 2E9ZA 4LF1A 2M4MA 5LMNF 4C9DA 1TU0B 2KL8A 3SSSA 5HBMA 4EZ6A 5EX0A 3SDEA 3J81U 4DV1J 2AHOB 3UN2A 1JJ4A 2LCWA 3UNYA 2PMWA 2AGPA 1A0OB 2JZ5A 3B6BA 2VPXB 2NXUA 2GQQA 3CXCR 2KXFA 2MYFA 3PO5A 2C2MB 2XNQA 3F0NA 3GE9A 3UDCA 3N5BA 3QSYB 2N3OA 4NL5A 4LFAF 1VCTA 4FYXB 3MAAB 2RKIB 5IT0A 1XMBA 4OZ3A 3THTA 4RBVA 4A48A 1NK6A 4OI2A 5CYQB 2HURA 1BQMA 2B7CB 1PJ6A 1N6QA 3PM9A 2D9PA 2WSFC 4CP5A 3L4BC 3HVRA 3ENWA 1NDCA 3LA0A 2W4DA 2HHQA 1XR5A 2CWXA 1YJRA 5AE3A 4RW4A 4F4ZA 1UKUA 1WHYA 2ILZA 2MZRA 1D1UA 4WF9Q 1PG5B 2Q66A 3RG6A 3TUJC 3MWBA 2BOPA 3EZUA 5HLFB 2CXEA 2ILYA 3CSKA 3MR2A 2ZDPA 2G0IA 4A8OA 3TUPA 1D9AA 2CJBA 4WKRA 1M5PC 4GVBA 4WZQA 1FDNA 3M4XA 2EVZA 4ZA1A 5DDPC 1CJKB 1WUUA 3U27A 3LUYA 1KONA 1VBZA 2EKYA 3DU5A 3GV8B 3QJLA 2DD8S 4DCJB 1T02A 3DLEA 2G0CA 3H42A 4ETZA 3TA2A 3MD1A 2RMLA 1TTHB 2FC8A 2RF2A 1LW2B 5C7PA 3FSYA 2BQRA 1VRTA 3H2LA 1IKYB 1ZZFA 1YRUA 5KFLA 5IQ6A 3HFVA 1FE4A 1N32F 1U2FA 3WHIA 5A8RA 4IG3A 3I5AA 2FLPA 2WOMB 5C25B 4BDPA 2YPZA 3LP1A 4UTGA 3BF4A 4HLBA 4WP9A 5L1IA 5L1LA 4ECVA 3R8YA 1B0VA 4H54A 5K9FA 4F0MA 3ZZYA 3WC0A 2YWWA 2E1RA 2YX7A 4AQYJ 5IV4A 3LTOA 3N5FA 2OPRA 3H59A 3KLVA 3C8YA 3GV7B 2E1CA 4N41A 4NEYA 2DHGA 1WG4A 2NLWA 4IFYB 3O8WA 5D0HA 3KHHA 3W7BA 5KOXA 4GKKF 2KFNA 2VQEJ 2DEJA 2FHOB 3UDEA 3FMWA 1QTNB 4ANEA 4ID5A 3C15A 5KFFA 1BE4A 2DYAA 3RAMA 3Q86A 1OMSA 4FS1A 3BZQA 2KKHA 1S9EB 2V34A 3BO3A 2N82B 4H4MA 1KVJA 1T03B 1V3SA 3O44A 1HHSA 2VA3A 3TVZA 1C4AA 4RWXA 4CDIA 4ALZA 5K20B 3R6LB 3BSOA 2QX0A 3DLHA 2B3TB 1ULRA 2OTJS 3LP2B 5FDLA 4X62F 5D4OA 3W9IA 2LU1A 2Y3YA 3G71S 2YH0A 4GVLA 5A8WB 2UV8G 4HDGA 2DR5A 2OSRA 1S6QA 1RT6A 5F41A 3IFEA 3T1YF 5JVHQ 4C3LA 1GXUA 5H1SV 3L3CA 4BLGA 3D0HE 4C8MA 5T14A 2DGSA 4QIEA 3W2WB 2IFXA 5AXNA 3TUIC 3D6MB 3R6GB 4KH0B 4L6V3 5LOQA 2EC2A 2EPIA 4RBUA 2ZH8A 5I3QA 4OX7A 3J80Y 3CD6S 3WC2A 3OVAA 4NLRA 2BVZA 3M32A 4DR2J 3KLFA 2MSSA 5CAAA 1V6HA 2CJAA 2Q6CA 1VQLS 2IRXA 2UVRA 1KD1T 4RWWA 1S1UA 1C0TB 2ZD1B 3TVKA 3ZTPA 3LO3A 5J2QA 1R8CA 3CCMS 5RUBA 2LEBA 1J5EF 2YNGB 1U24A 4TVAB 1WKKA 3PJ9A 3PW7A 1Q4RA 2ZC4A 2F9JA 2DGWA 1XQIA 2SXLA 3MPDA 2HMIA 4FP9A 4OLOA 1YDLA 3DFEA 2GVZB 3VAHA 1Q0NA 1BLUA 2Z0GA 3CCTA 1Q8BA 3V6HA 2IC3A 4ZCIA 2ALYB 4TLQA 4MMOA 1S10A 3TZWA 3CC7S 3F41A 3NBPB 4RL1A 1RP5A 2CNNB 4LF6F 1TMMA 1D9DA 3DLKA 4WPAA 1HARA 4PQAA 5LT5A 5LL6d 3BM7A 2FHMA 3L09A 5AXLA 4DV2F 4RKUC 3MECA 4HI2A 1KHVA 4IQXA 2W7PA 2BJ7A 2AIRB 2V2QA 5B0BA 1NKBA 3EICA 1XIQA 1DZ5A 3N0VA 3W5ZA 1QE1A 2QA2A 4A8MP 1JLCA 1HBUB 1S6PB 2FTRA 2PC6A 1EP4A 2EW9A 1NPPA 1N33F 1JWWA 5F8GA 2H5JB 3BR9A 3I0SA 4CQ1A 3FSXA 2E7WA 2CPJA 4EYIB 4K5SA 4DV1F 2MQMA 1TK0A 4DR3J 1RHQB 2HGNA 4DQQA 5D8HB 3VF0B 3IM9A 2QG9B 1FKPA 2HVHA 2Q79A 1N88A 1GXLA 1LW0A 1UVKA 1VBKA 1UAWA 3QPIA 5HANA 3C19A 4M94A 4P74A 3BH7B 3K5OA 5KT7A 3DI6A 2JDJA 2J0XA 2AQ4A 4ETXA 4PCQA 2MLYA 4G1PA 1VOMA 3I4PA 3T5LA 5KFZA 4ZVSB 2FIUA 1BWVA 2VG5A 2VASA 3TNVA 2WTFA 2KJVA 1LV5A 1RWUA 3DGPA 1SH0A 2GMLA 2LXUA 3OBIA 1N52B 5D0EA 1SJ4P 4QU6A 4KE5A 3SCIE 1F9EB 5HJXA 1VHFA 4X4QA 3IR5B 3H25A 4R8UA 4MT1A 4ID8A 2ZBQA 3H5XA 3W66A 3M2VB 5D0GA 3DLJA 1WD6A 2DCUB 4TU8A 5L1JA 4LIRA 3MTJA 2IJFA 2R42A 2ZZNA 4IRCA 4Y2MA 5EWFA 4QCLA 1QAYA 4LRCA 2XM3A 4H4OA 2KDOA 4RZRA 2DH7A 1JLFA 3UNGC 3RR7A 2HNDA 2BJ8A 3DMJA 1NJWA 2ZH2A 1HBNA 1MMNA 1F1BB 3RB0A 1IKVA 2MB0B 3SI8A 3IRXB 3W63A 3M1VA 3I32A 1V9OA 2AT1B 1X31C 5U47A 4YEAA 3D1OA 4WP8A 3PJWA 3HJFA 3PHEA 3P5TL 2XZWA 2AV5A 2V8GA 4KC5A 2QTWA 3GYXB 4NZ0A 3QATA 2FHJD 2BYCA 1VHIA 2PDAA 1PBAA 3Q83A 1TFYA 1TZ0A 1RT1B 2HFZA 4AQYF 1WHWA 3W5YA 2ZEJA 8ATCB 1YBUA 2V69A 2XGPA 1XERA 3PW2A 1N8RT 1HNXJ 5KFVA 2JRSA 2WONA 4I6YA 2VL1A 1ZM9A 2EFQA 4OJHA 4MKBA 1NSQA 2VQEF 1GQEA 1HQUA 3UPFA 1G2EA 1N0UA 2WZ1A 3NLCA 3MZIA 2AGOA 2A0FB 1L3UA 3V4IB 3CJRA 4PYDA 4LBHA 2BV3A 2QA1A 2ZJRQ 3SQGA 4YN3B 3I82A 2XGQA 4JI5J 3I31A 1JNRB 2GFFA 5T7LA 3THPA 2G2OA 1R8AA 1WTFA 4DFMA 3F56A 2M3DA 2NYHA 5FJ4A 1OYEA 3IO1A 1KSPA 3CE8A 2C2ZB 2F8EX 3QO9A 1N56A 2H54B 2VKZG 2CPFA 2PSZA 3QIPA 4RJVA 3AFGA 3LP0A 3TX8A 3GILA 2DPJA 1RQ0A 5HVGA 4X4VA 1T95A 1Q1KA 5HVFA 1S79A 3FKBA 2QZ8A 4C8YA 3TZXA 1UFLA 4EFAC 1HKAA 3MEGB 2VFSA 2C3UA 1I1GA 2EFNA 4ECQA 2MZTA 1RTJB 3J7YU 4MTPA 4WIQA 2DNNA 1XC9A 2UXCJ 3RW7A 3HVWA 4NLVA 3NWGA 2HFSA 3OSNA 4QU7A 3RB3A 4RW8A 2ADCA 1XJWB 4EMDA 2WCXA 4QYZK 2CNKB 1CJUA 9RUBA 3TZYA 3DLGA 1KN6A 5DG9A 1HIYA 3IAM9 4PQUB 3JAMY 1D8YA 2PI4A 4F3MA 1RT3B 3U02A 5B7WA 3M9MB 3D54A 4DR2F 4X4UA 2VFVA 1EETB 4CTAA 3OTCA 3CGIA 3QFHA 2COLA 1NO8A 5LJ5Y 2XC9A 4A8WA 4ILLA 1RWVB 3GQCA 3EE3A 2E9TA 1SKUB 3G82A 3NGDA 2XS2A 1CULB 3CW2C 4F02A 4I2QB 3D6HB 2ZH5A 4IDKB 1MLAA 4LBIA 1JLEA 2C42A 3CJ2A 2BJDA 3CO0P 1IQTA 3CJKA 4DFKA 4ZLNA 1NDLA 1JLBB 4LSNA 4L3KA 1LXJA 1P8GA 3W3SA 4ZVRB 3MR7A 5BJRA 2ZWOA 3CJ5A 4DG1B 1HYSA 1UTAA 3D68A 1NNDA 3M6VA 5H9FK 2WW8A 1Y00A 4ZLJA 1Z4UA 3KLIA 2RQCA 3KJFB 2AEFA 4HH0A 1SH2A 5K14A 1H2VZ 3MM5A 1QTMA 2MQOA 1H3DA 1FE0A 5KG0A 3RW6A 4N7TA 1H6KX 1UETA 3VWSA 4P2MA 2MGZB 4C3KA 4OHWA 1UZHA 1I94J 3AQPA 1IJEB 4EBEA 1KC8T 3VQSA 5DGAA 4DSEA 2QO3A 1RHUB 2QLWA 1P1TA 2HQ3A 1KLMB 2RDIA 1WG1A 3R5DA 2K06A 1LEOA 3KTQA 1VQSA 1IXKA 1NUEA 4Q5VA 2W4PA 3AOCA 4OX9J 5L9NA 5E41A 3PYEA 3C14A 1TQLA 2RAQA 1S9GB 5KFDA 1DRZA 3KMSA 4X4TA 2MZJA 1NRKA 3FCHA 4NRTA 4YB5A 1UVIA 1MN9A 3CUNA 1UW9A 1A7GE 3UVJB 4FVCA 4ED4A 3M8SA 1AZSB 1TK8A 3R7SB 2ATCB 3I87A 2F40A 3IGNA 1FX4A 2FZKB 5HBMB 3G6YA 3GTYX 3SDEB 1RGVA 3CCSS 3W8GA 4JP8A 3BKTA 4F67A 3R5BA 1SL0A 2R8IA 2IJRA 5HMXA 5J1EB 1DLOA 2GA7A 1MMLA 1RWNB 2ROPA 3VV2B 1HWKA 4B3OA 4B9UA 2JHEA 3ETOA 3QWPA 2HWHA 3LWMA 1ICEB 3QT7A 1UVLA 2KG0A 1M0SA 5L39A 1FXDA 5KG7A 4DV5J 2AX0A 3FEXB 3KLGA 3SCKE 2D74B 3BGUA 3NXZA 4DR5J 2RS2A 2X1AA 1DTQA 1NK4A 1U25A 1ZTTA 2MQNA 2ZITA 2CWKA 1FT8A 1N6QB 1CQNA 3BBFA 1VQMS 2YKNA 4P2XA 2Z57B 1REGX 4OV1A 1UEVA 3TARA 4ES2A 3D1QA 1IJFB 4DL5A 1U6ZA 3B54A 1U0SA 3U1LA 2DVIA 5A6PA 3BBBA 1S4FA 5DS7A 2DK2A 4U67Q 2B6AB 2OPSA 3K5NA 2WSCC 4F0KA 1VQ7S 5IT9Y 4NXMF 1Q5YA 2OEJA 2HRYA 3F73A 1VC6A 3SV3A 1PJ7A 3RRHA 2BA9A 4FVMA 4GVBB 4QIFA 4CLKA 1JJ2R 1YI2S 4JI0J 1VIOA 5KFGA 3TA1A 1ZM4A 3ULHA 2K1RA 5CCLA 3D1HA 3ENAA 3NMRA 3RR8A 1RXOB 4LF4J 2NZ4A 2B5JB 4F3QA 5DQIA 3ZC4A 1B3TA 3AB2B 1V3ZA 4RUBA 4IUFA 3QRPA 4P75A 1NDKA 5JJBA 3IBFB 2JEFA 5DRKA 2HLUA 5CZVA 1HNXF 5A8RB 1MWYA 2V6AA 5KG4A 4XIUA 2UZAA 3GIIA 1ZPWX 1ZH5A 3UD5A 5GAGI 1UJ6A 2B9YA 3A1YG 2RQ4A 3QGGA 1FFSB 5J1PA 3IP0A 3HSJA 4QR2A 1X5TA 3M05A 2DH8A 2W1BA 5KFRA 2DNLA 4IH6A 2YQ3A 4USTA 3ZXWA 2PN6A 2QEXS 4LF5J 1UJ4A 4JI5F 5GAGU 1YRXA 1RCOB 3MTKA 3M8PA 4YB1P 1DQAA 1RT2A 3GIRA 1X5PA 5DM6Q 4PXDA 2BZ2A 2IDLA 3QZ7A 3KYLA 3N6NA 4F26A 4K59A 1ZA2B 3BBCA 2WSEC 2GQCA 3Q8QB 2GO8A 2BRKA 3T1HJ 3N9UC 3W2VA 3E3XA 5FIIA 4ID5B 3C15B 2NXCA 4ANCA 4DFPA 1U02A 2CPZA 2FLOA 2YKMA 4ECSA 3KJVA 1UA0A 1C4CA 1DTTA 3TW0A 4B3MJ 1K47A 1L3KA 4J9NA 4H4MB 1SKSA 3HD2A 5GMDA 2L08A 1DQ8A 3ZFVA 2K7KA 4B9TA 4B9LA 2UXCF 2OGUA 5K8MA 2V63A 3MFHA 1FDAA 3NKYA 1QDUB 2JJ4D 1YG0A 3LOUA 2ERRA 4CNYA 3B4MA 2MJNA 2Y9HA 4ZPVR 2AMCB 3Q8PB 3MMBA 4USVA 4FPRA 2MQLA 5HMZA 2FPHX 3NS7B 1NKCA 5GADU 5FDLB 4CT8A 4CO0A 4OI1A 2RNEA 4DXLA 1GAOA 4DPTA 3RAQA 3OL9A 1URNA 1VRQC 3SQOP 1L3VA 1RT6B 2ACYA 2WAQD 2E44A 2J6UA 1H38A 4N56A 3VAIA 3O1LA 3X1LB 1HFEL 3CDWA 3DDNA 3TJ9A 2FY1A 1JLQA 3UE2A 3KHRA 2BACA 1GMVA 1N34J 1P9QC 5KT4A 2OPPA 4XDCA 3GJQB 3R3TA 4LBPA 2ZUAA 3L95X 2G0JA 3PIPQ 4O3PA 3TQ1A 1TP7A 3TVYA 2BM1A 4DSLA 1I6JA 3DYAB 4NA1A 4KFBA 2KXHA 1S1UB 5J2QB 2OPQA 2C3MA 2FJWA 4UZCA 1RWWB 2WW4A 3KMQA 1SKWA 2XHCA 4MIWA 3HD1A 2HMIB 4ECTA 2CQHA 1I94F 3VCDA 5A76A 4WFNQ 2IC3B 2AP6A 2F4FA 4UT4A 2Y0BB 4ECZA 1WC0A 5ETMA 4URGA 1YJNS 4KHRA 2DY1A 3UN3A 3J7AN 4XAKA 1IUJA 3DLKB 1DHMA 3MPVA 2KRRA 3R5CA 4ATNA 1HQEA 1X4BA 5I3UA 4IG0A 2IRYA 2R2SA 4LSZB 1HPZA 4OX9F 1RTZA 3MECB 2MPUA 3MMAB 4H4KA 5LXYA 3CCRS 4DL7A 3R7NB 1WC1A 1FJGJ 1RWKB 2FJEB 3PRDA 4K8RA 1BQNB 1YSJA 4M95A 4ED1A 4B02A 3T19A 1HD1A 3P49B 5F3TA 1QE1B 3M6WA 3PEHA 2A18A 4OV6A 5KG1A 1YIJS 4G3IA 2XMJA 4A8XA 3U7JA 1JLCB 2V4RA 4P7TA 4G6VB 2XMAA 1QD1A 3DRRB 3EVWA 1T9TA 2HZVA 4I69A 1VQPS 1W26A 4LR8A 1SC3B 1TKZA 2BM0A 2YPYA 2R8HA 5GMEA 4CH0S 2GJFA 1VQ8S 2MQQA 3HHLA 2WBMA 2B4UA 2HWTA 2MLZA 2LQ8A 3K5PA 2MY7A 3RAXA 4Z7CA 1FKPB 1YGYA 5J2MA 4KSEB 4MKVA 1NHUA 2AJ0A 3W9HA 4P10A 2O66A 2RVJA 1Q53A 1RU1A 4KGVB 4MK9A 3OL8A 5L9XA 4DV5F 1B4SA 4X4OA 4CLUA 3N01A 3EXYA 2W7OA 4DR5F 2PFFB 4LVOP 4J9MA 3PCOB 4ZCMA 1MROA 1FRLA 5L8RC 5HN0A 2ZJQQ 3P45B 4V1Ak 3I5BA 1LFWA 5DLGA 5G0RB 2ASLA 1M5OC 1T11A 2CQ4A 5KFUA 4P2SA 2JSXA 4FZVA 2N4DA 1RJJA 4MFBA 4OI3A 2M9KA 4HKQA 2HHVA 3K59A 1DJ0A 3A4TA 4NPOA 1SIZA 1GK8A 2V9WA 5BR8J 4R8UB 1EAYC 4U95A 4NWBA 2MKSA 5F9LA 5LXRA 3JTOA 2LFVA 4PKDB 1SCJB 1NK9A 1X4FA 2P6SA 4OJGA 1R8HA 3IBWA 2P6TA 3EZ5A 3H4DA 2GNKA 4JI0F 2CZ4A 1FRJA 4O3RA 4H4OB 2HZCA 1JLFB 2RU3A 4MJKA 4ELTA 3DMJB 5AXKA 5JMNA 2N7YA 4LF4F 5F8HA 5IC6B 4KPYA 4MYUA 4ANDA 4UZBA 2IA6A 4MIAA 2F63A 4AL5A 4EK2A 3NNCA 2NCKL 5SUHA 5KFSA 5HATA 2P9EA 4A47A 3TZZA 4Y65A 4JV5J 4WK1A 4JI2J 2PA8D 1TKTA 1JIHA 1FX2A 4HHHA 4PXCA 3D3CJ 1PO6A 4LFBJ 3EWGA 1EARA 4RBTA 3M8ZA 3MM8A 3ET6A 4NLUA 2A1BA 3NCQA 4NCAA 5KFTA 3M9OB 1SUQA 2AKWB 1GTHA 2R4FA 3T6JA 1QAJA 3ISND 4MAKA 4E0DA 3NRBA 2VQFJ 2C2NA 4LF5F 4C7QA 4CLZA 3D3BJ 3U1MA 1KTQA 1FRHA 4EO8A 3GCWP 3OXGA 4KKOB 2WONB 1S97A 4WFBQ 3MPWA 2LXIA 2RU9A 2F1FA 5KFHA 5LM7E 3Q22A 4IYQA 1NK8A 2X51A 1HQUB 5L1KA 4IO1A 3T1HF 2DXDA 1T0TV 1LWFB 5IQQA 1Y4ZB 3KUGA 4X2BA 1VQOS 3MOZA 4USIA 4M5JA 2JVOA 1RAOA 1TK5A 4B3MF 4CYUA 4HHJA 5I42A 3TAQA 2HHUA 5KFAA 5D4NA 3PJXA 3QO9B 2D41A 3GR1A 2E29A 4G65A 2MKJA 3PFEA 4XTTA 3RU0A 2F4VJ 2HNYA 2W9BA 4KRWA 3RZAA 2M5YA 2Z58B 1WF2A 3MHYA 1U47A 2VODA 4OZ5A 4CO4A 2RSQA 4DSIA 3ONQA 1X4HA 2J6TA 4QR1A 4RUCA 5M2RA 3JSBA 4OMFG 2DNZA 1FI4A 4K4WA 1Q86T 1K0TA 2UVUA 2QSFA 2E5GA 1Y5IB 4XDDA 3AHPA 4K4YA 4KGZB 4OYXA 3I9V9 3GFXA 1N34F 5KAKA 1CJUB 2MMYA 3VTIA 1T94A 1T9UA 5DG8A 1RTHA 4OYMA 2HHPA 2ASDA 2IY5B 3HHKA 3T1AA 4CTAB 3W62A 3ISZA 4TQRA 2VDHA 3OW2R 4DZDA 3HPOA 1YK9A 2O01C 4NEZA 3G82B 3CCUS 2Y8WA 2QN6B 4GKJJ 3ENVA 4CIOA 1PC4A 4W98A 4TLRA 2AJQA 4X4SA 1ZYQA 1JLEB 2CZVC 2ZE2A 3CJKB 2FVSA 1VMBA 4PXBA 3CCLS 2HW3A 1GX5A 1SQEA 4WYLA 2J9DE 2BEFA 2V67A 5IM0B 1JXLA 1HYSB 2VONA 3BQ1A 3VZIA 1PIEA 2VKRA 4YB7A 4Y28C 2CQGA 3MEDA 1ZA1B 3GIMA 2JVRA 4N8NA 2UXDJ 5AXMA 3NS5A 4DN0A 2QT7A 2HNZB 1JLAA 3I0RB 3CCWA 2RIJA 5K14B 2CPYA 3MM5B 2JLGA 2OP5A 1TVRA 1HNZJ 1U2CA 4Y00A 3K17A 4ER8A 4J9SA 4CLFA 1SI9A 4CO2A 2W2OP 4DL6A 2RH3A 1FWKA 3BGRA 1FJGF 4PWDB 4YR0A 1LWCA 5G4DA 2W2PP 4NOHA 5B0CA 1Z1ZA 4DBQA 4DFJA 4IOAQ 2LQ9A 5E2QA 4ZP8A 2VPYB 3G96A 3HVTA 2XMUA 4IKAA 2XZDB 1U8WA 2RS8A 3J81Y 2FC9A 4RW9B 2G2YA 3DDKA 3EGVA 2CJKA 1X4DA 1YHQS 4K4SA 2ZH3A 3BGOP 4OHXA 2AYBA 3C14B 5C2CA 3Q89A 2VOPA 3PG9A 2G1HA 3FMBA 2QLJB 2GHVC 3DRSA 3PDNA 2ASJA 5K8NA 1S1WB 5KFXA 5D3GA 2ZZMA 3WIUA 1KQFB 1Y0HA 1NK5A 1ZS6A 2DTJA 4KO0A 2XWYA 3OJUA 3PKMA 1NJYA 2O67A 2HZAA 3MF5A 4XK8C 1X9SA 3E01A 1S0OA 4Q45A 2B56A 4L3NA 3LWLA 3T6BA 2AEJA 4DV6F 4NI2A 3UD3P 2NYIA 2IM1A 2JH3A 1NZ8A 1DLOB 2BABA 3NGRA 4B3OB 2DPIA 4A8SA 5GAHI 3HXMA 2CKWA 4NLXA 3TAMB 4O44A 2J0WA 2BKNA 2UUTA 4V19J 4F4WA 1SL2A 5I3PA 3KFWX 3KLGB 4IH7A 5A2QU 3MCNA 3I55S 2OMOA 5BR8F 3PW5A 4B9NA 1DTQB 4AL6A 4DN9A 2LA4A 2RJZA 3A3PB 3M30A 3W60A 1SBRA 2YKNB 1WOSA 3CJTA 4PZVA 1PYOB 2CUYA 1U4BA 3VAGA 1M90T 3EX7B 1VR6A 1CSJA 2QL7B 3KHLA 2J9CA 1HBOB 1PYSB 3K0JA 4Q2MA 4DSKA 4OHVA 3CC2S 4N76A 4HL9A 2Y0SD 1N5TA 4TYBA 6AT1B 2OPSB 1M1KT 4QZVB 2NXJA 5A8KB 4ZPAA 2QJ3A 3VAMA 2EKNA 2IBKA 2DR9A 2DISA 1WORA 4JV5F 2JNJA 2YNHA 4JI2F 1CJTA 4B3TJ 1U26A 2RT3A 1SJQA 1NB7A 4HACB 1E6YB 3VGTA 4EZ9A 4DR6J 4ZOSA 3CCQS 3NNHA 1KHWA 3A8JA 3BSAA 3MAHA 2D3OR 4LFBF 4FF4A 2PT0A 3GB0A 3AT1B 3N28A 1UMJA 1RUSA 3MCOA 1TUWA 4JI1J 3QIDA 1WC5A 4C98A 2DY9A 1SC4B 5AE2A 2VQFF 3ZNJ1 3ZTSA 2RUSA 2VG7A 3UO0A 1RABB 4CO3A 2V8HA 1RAEB 1P1LA 4WWSA 2N4CA 4O3SA 2VH7A 4R25A 4NXNJ 3GP9A 3AD8C 2K7JA 1CVJA 1C1BA 3QGPA 1D9FA 3HCXA 1N5YA 4LRBA 3B82A 1JK9B 1ZBTA 4USUA 1IBCB 2Y1JA 2YVSA 5ETLA 3GPAA 2Y1RI 2LYVA 1Q81T 2NR0A 2ZVSA 2DNMA 2AYEA 3JXOA 2LP4A 2M8HA 2X1GA 2CNLB 3MMJA 2GX8A 4WZMA 2YNFA 4EUVA 4PWWA 5ETTA 2H5EA 1FXLA 2N3LA 5A0YA 2Y1LB 4DU8A 3VAJA 2XCAA 2YNIA 3ISNC 1HNIB 1BQXA 4KR0B 3DRPA 5C5JA 1G3OA 3NS6A 3W2VB 4L72B 2BANA 4QWCA 4OX8A 3PXGa 2F4VF 2R8JA 1XBWA 2ZH7A 2YKMB 1F5AA 2I0XA 1RHRB 1LKZA 1SB6A 4LUBA 3CMQA 3KJVB 4Y2KA 5D78A 4Q43A 4BBYA 2HK2A 1VQNS 3BO4A 3S8SA 5HK4A 1HWUA 1AW0A 1BGXT 4FYYB 1JNZB 2VG6A 2X3DA 3Q24A 4Y34A 3FZ2A 2DXFA 3FFIB 3D28A 2FHKA 2D3UA 2EFPA 3SV4A 3KJQB 2MQ8A 1LOUA 3MMBB 4KV8B 3VALA 4TU7A 4J9OA 3QT8A 3D4JA 2P2CB 5HMYA 3PVXA 2IVFB 1YRTA 4DV7J 2C22A 1TELA 6FDRA 2DNQA 3T9ZA 1KBRA 5DDOC 3G8QA 4NYPA 1T7PA 1XN9A 1VISA 3MM6A 3CD7A 3ZZ0A 4NLWA 1CPZA 1S7IA 1OWXA 4GKJF 1JLGA 1KQKA 3ETMA 2BW2A 2OPPB 4CCHA 4ZLLA 2V8VA 4R5PA 4DSJA 1VFJA 3BPDA 2RHQB 2G13A 1YJUA 5LSLA 4F36A 2J7KA 4PR6A 1QM9A 1UJ5A 4X84A 8RUCA 1UW4A 1UVNA 2XY7A 2MLXA 3ITHA 2UXDF 4PWUA 2AD9A 2MZQA 3OFFA 2R7XA 1VGYA 3KKFA 2VJUA 2BE9B 2L41A 3H90A 3NGKA 4ECUA 3MR6A 2HQFA 1HNZF 3NCPA 5J2PA 1U2RA 3FBBA 2P9CA 1VK8A 1WWHA 4YDDB 3OR1B 1YWXA 2R7VA 3W5XA 2R7UA 2R7QA 1S99A 1VQ9S 5F8NA 2K2PA 4WFYA 3V6KA 2F5GA 4DPYA 3R5JB 3JSYA 1OSDA 2OEMA 2FVQA 1BXNA 2XO6A 5K8OA 3I6PA 2KFZA 4C2MA 1TL7B 4USKA 5DLFA 1IKWB 1Q8KA 4DDFA 1IM4A 3MAAA 2RKIA 1RWPB 4EBCA 2HGMA 5THWA 3TJAA 1HQEB 2G9OA 1S1TA 4F2SA 4DQSA 3T5JA 2VPZB 1FTCA 3HFZB 4BWJA 1WSRA 2LECA 1GT8A 4DQPA 4ZVGA 2IDEA 4NMLA 1GXTA 1T9YA 1FEEA 3BKFA 4CM2A 4O4RA 3MUTP 1X5OA 2FVCA 1XK8A 4PYAA 2IBOA 2RILA 2HGLA 2HHXA 3IXQA 1FD2A 2XBPA 5EWEA 2DNHA 4EGLA 3VAFA 2EFGA 5KT2A 4ELVA 3VQTA 1R43A 1HW9A 5HLFA 2I5JA 1ZOTA 4MYTA 3HHLB 1E6VB 3CF5Q 4C4WA 2VC0A 1T3OA 3OPKA 1B99A 1TL5A 4OZJA 4Q0BA 5I4MA 2YY3A 5C42A 1FXRA 3O3LA 3S6EA 2PEHA 2JEIA 2YWEA 3WDOA 3FDSA 5H9FJ 1AA1B 1HBMA 4ZPBA 1T9XA 1RBAA 2RQKA 4U96A 5FLXU 1H72C 5F8LA 4LF9J 1LW2A 3LW5C 1MROB 3KDOA 2XYPB 2H65B 4WU3A 2J9EA 2NS1B 2E9RX 3O6QA 5CZXA 4ZVTB 4PG5A 5A6WA 4IO9Q 2W9CB 1ZTWA 2WOMA 5BYRA 5C25A 1NB2A 4MFBB 4DU7A 1D8ZA 2QYGA 2W2QP 2ASYA 2H4WB 4AL7A 1S57A 1V5IB 1NKEA 1CEZA 3FBCA 5JVGQ 3T3FA 3RYLA 2AEMA 3BSCA 3M6UA 1RA6A 2LA6A 3Q8UA 1VQ6S 3SEOA 4IFYA 2FGOA 3DHXA 3UD4P 4UQTA 4CLPA 3MMCA 3JB9k 3HMJG 4B3TF 4K50A 3FVYA 4JUZA 1SXLA 4DR6F 1U49A 2XMVA 3NCRA 4J9LA 4YY3J 2ZHOA 4O3NA 1O6XA 2PO4A 2I9SA 3US5A 4ZVQB 5KT5A 3I4HX 1UCNA 3CIMA 4B3RJ 2QLFB 3TWZA 4K4TA 4I68A 1HD0A 4JI1F 5AJ3J 2LVWA 1WTBA 2ZOMA 1SKRA 1S9EA 4DUZJ 1SJ3P 4B9VA 2KM8B 4N5SA 2MKIA 1XMOJ 3M8QA 1FD8A 2FJAB 3V81B 1Q7YT 2HVIA 4NXNF 4ICLB 2ZH6A 1SUQB 2R8GA 5J2NB 1X4CA 1RDRA 1U1LA 1S12A 3DOMA 4ZVPB 3LP2A 3VGVA 3KK1B 2BE2B 4M63A 1PJ5A 2DHSA 4ZLPA 2G2ZA 1VDHA 2DITA 4C3MA 2W9AA 5A8WA 4DL3A 5E3AA 1F0XA 1CG2A 2WRMA 4FF1A 2KHDA 2K3IA 4YDXA 4JBCA 4DHVA 1FRKA 4YB6A 2C3OA 2DHXA 3HO1A 1FJCA 1R89A 1U1MA 4YP3A 3RTVA 4A8QA 3WQPA 2DGXA 2CADA 2NSBA 2HAIA 1PAEX 3K7RA 1KP6A 1UL3A 3FQKA 3OHAA 3KLEB 2R7RA 3OR2B 3FGVA 4CYUB 3TUZC 1RHJB 3G8SA 3DNCA 4DPOA 5EGYA 1C0TA 2ZD1A 2E7VA 1HI8A 3MEEB 2VFRA 2YNGA 3WZ0A 4PUOB 5KT6A 2QSWA 3OLBA 1REVA 5L46A 5CXTA 3GIKA 2HHSA 2W9BB 4KHPJ 1DY3A 1AYEA 1RAHB 3QRQA 1VRUA 2GVZA 3HHEA 1TFWA 1A6LA 4WK3A 2C1EB 1RADB 3R5GA 5IOLA 3K8WA 1FA0A 4H4KC 5F9NA 3UI3A 3GR0A 2C28A 4BC9A 3H8YA 1FEHA 4DV7F 1Y3JA 2PIIA 1IWGA 3ZTQA 4PAAA 2DR8A 2R7SA 4ZS6A 2NPIA 1U0HB 2EFOA 3W61A 1IWAA 3DXSX 3H40A 1P6TA 4DPUA 1KTVA 1S1VB 3I5CA 5DG7A 1F6TA 2QRRA 2IMWP 3KNGA 5F3ZA 4FF2A 4U9RA 3NWRA 1S0VA 4KAIA 2HFNA 4OIXA 4CI0B 3HHLC 4YFUA 2A2DA 2EBEA 1U6FA 1HBUA 2D3O1 5IC4B 1CC7A 1WJ9A 2BX6A 1SJ1A 5HP1B 2CPXA 1U1QA 3D9BA 1NJZA 2F8HA 3S7RA 1F3FA 4J91A 3OHBA 2ZNYA 3EDRB 3IR7B 3CJ4A 1RAJA 1NAQA 2W2NP 8AT1B 2ZOFA 1WOOA 4ZMMA 4NLQA 3UCZP 2CQCA 1HWIA 2XSJA 3DXBA 4RLEA 3EVMA 4M5NA 2B9XA 3P3DA 4K4UA 1KDNA 2L3MA 2FGCA 4DL2A 2M52A 2YQ0A 5LJ3Y 3MEDB 1CS4B 1X4AA 3KUHA 4ZVEA 1RWMB 2DKOB 2OELA 3Q2SC 4NRUA 1LWXA 3R5AA 1P9YA 2YBVA 3PRBA 1HNWJ 1ZAVA 3KDNA 1MU2B 4ZPWR 3MXHP 2ZDOA 1S6UA 3BGRB 3QZ8A 4TY8A 3H4BA 3MR5A 3DOLA 3D66A 2CPEA 4D3HA 1YQHA 2VC1A 2WVBA 2A3JA 4NYOA 4FXWA 2CJXB 1JKHA 5E7OB 3H20A 2J5AA 3G4SS 4NE9C 4UOFA 3C16A 2PGCA 3BJYA 1PYTA 3KK2A 1PAUB 1B64A 3NOCA 1WNEA 3DRSB 4M5DB 1MWZA 2DR7A 1H7WA 2ZVIA 5D3GB 1IVZA 3HDSA 3R2DJ 3R2CJ 3HT3A 4KO0B 2NUHA 3FEZA 3QFWA 1VLYA 3HI9A 2KM8C 2M7SA 4BCAA 1RBOB 2DHAA 2U2FA 3M2RA 3E01B 4LF9F 2VDIA 3S01A 1KS2A 1WC6A 5B09A 2FJBB 4OLPA 3UCUP 4DX5A 2AJ1A 1OIAA 2YH1A 2H1YA 2WB1D 3IRXA 3JYTB 1FKOA 4ENOA 3IWNC 3CT9A 4X64J 4DPWA 2HRUA 3POTB 1T9WA 5MAOA 1HNVB 2JEGA 4ZVHA 4XO0A 3RRGA 2ALZA 2CAJA 4NLSA 3G9CA 3IC1A 4A8FA 2YWFA 2WVCA 1QLNA 4J9VA 4NXMJ 3KG1A 1XMQJ 4RPFA 5LSOA 1LK7A 3P4UB 2X1BA 1RLDA 3EDQB 2H5IB 1S7HA 3SYZA 1HWLA 2HBZB 1R6YA 3T5HA 1TL1A 4NLDA 2D7SA 3FZBA 3C3LA 1SV5A 4OL8A 2KVIA 2RHSB 2XWXA 4J9PA 2HS3A 2OIHA 1K9MT 2QLBB 2C2KB 1CJVB 2EWHA 4HYKA 2E5LJ 4YY3F 3GONA 3PTWA 4RO0A 1FDBA 2QFJA 4OZNA 3GFHA 3M7VA 1ROFA 1ACMB 4B3RF 2RB7A 1M1HA 3ZNUA 3N79A 2VOOA 1B7YB 5AJ3F 2B43A 3BN4A 2RRNA 4IRKA 3THVA 1U1PA 4AT1B 1JXVA 3QQCD 3M2UB 3BB5A 1J2VA 4DUZF 1CJTB 2CJ9A 4Q8EA 5E0OA 1XMOF 4WE1B 1RTDB 4DV4F 1NHKL 1K1QA 3MCSA 4I2PB 3QLHB 1S72S 4KGKA 5KOWA 1X0FA 1Z2LA 4GC7A 4DEZA 2AWZA 4TNOA 4ZP9A 3KWMA 1Q79A 4WCEQ 3V2UC 2YQ1A 2BE7D 3TX0A 4FBTA 3MEGA 2VG7B 5F0WA 3HHNB 1RTJA 3RBEA 5BYSA 1GX6A 3CJ3A 1PCAA 4DL0C 2FUG9 2C2RA 2HQGA 2DR6A 1FFGB 1NU4A 1H98A 3GV5B 1OQ3A 4TU9A 1C1BB 1RKJA 4LREA 3PEJA 1N5YB 1WC4A 2XLIA 4PQUA 3N6LA 2OEKA 4KTQA 3RB4A 2DO0A 1H74A 1NH8A 2VHGA 2IRUA 4DLEA 1AUSL 5HMWA 4MKAA 1MWQA 2YXLA 4GRSA 3LAKA 4WKYA 1Y7PA 2B9WA 2YNFB 2KJWA 5JUMA 4NLYA 1UFKA 2NSCA 3GSDA 3C6TB 1CULA 4Q2LA 3MGJA 4ED2A 3RBZA 4IDKA 2W2MP 4KGMA 4F2RA 4NASA 1FNMA 4KHPF 1P27B 2KH9A 1JLBA 4QPXA 4U6PA 4HDHA 4RNOA 2BW7A 3CJSA 4QQBA 1KOOA 5F0UA 1WOPA 3VGUA 2KRBA 1X9MA 2Q43A 1RWXB 1M5HA 3C2PA 2V0NA 3PY8A 4ECWA 2OHDA 2GIRA 5ETSA 5KFMA 1AROP 3GZ7A 3KG4A 1DQ9A 5IWAF 3AXKA 4EWTA 2MGZA 1YJWS 2HQCA 1M5KC 2Z2LA 4OX6A 3EGNA 2CQ1A 2KHCA 1S77D 7FD1A 1LQ9A 2P5VA 4CLLA 1KLMA 2JWNA 2J7UA 4DR7J 4LFCJ 2VF3A 2ZKTA 3MM6B 4UY8T 3QYYA 2MY8A 1JLGB 3V6JA 2HK3A 3HHDA 1YJTA 5EUHA 2BQ3A 4TQSA 4KB7A 3FNNA 1OSCA 4QBUA 4O0NA 1EHWA 3D0GE 1LNQA 2HVEA 4NCGA 1S9GA 1EQ0A 3BR8A 3OVBA 1WKLA 4YOEA 4FNIA 2F9DA 2R8KA 3SZ2A 4HR2A 3ILJA 4HTIA 3UVJA 4K4XA 2FZCB 4ES1A 2IHR1 3ITHB 1D3WA 1VJQA 3QWUA 1B0TA 4ZK7M 4LMZA 4KPCA 1RE1B 2GIQA 4OQJA 4Z7YA 4ZHRA 5J2PB 4A8YA 3OL6A 1GNKA 1HNWF 1BD6A 1KFSA 3BO2A 2V50A 1R27B 2E1MC 5J1EA 2A6MA 2CJYB 4FYDA 1S0MA 4U7UD 3OXLA 2AYGA 3CC4S 2OMLA 3AOBA 4DS5A 3IG1B 3CDUA 1WEXA 2NXEA 1RI7A 4JB8B 4WFXA 4OZ0A 1T3NA 2DO4A 1IKXA 1WEZA 5H9EJ 3V4MA 1D09B 1S1TB 1FKAF 2J8AA 3P6YC 1EJ7L 3MUVP 4ZVOB 2IPOB 1FERA 4M1KA 5ETNA 4DR4J 1JQGA 3A8EA 3JTPA 3CMES 4OHYA 4O3OA 4X4NA 3IA0A 2CG4A 3GYNA 4URQU 1PILA 2B7BB 1WHVA 2W25A 3PHTA 1I3OB 1UVJA 3I96A 2GVDA 2B6AA 4IFVA 1BQMB 3P8BB 1BHNA 1UP1A 2I5JB 2JLEA 1MSWD 1IR1A 5DZ7A 1YTYA 1S6OA 2M2BA 2ZHBA 4DSFA 2KYXA 4UOHA 4X64F 4QWDA 4KH1B 2OO4A 3L7UA 4Q0BB 1N5VA 1W25A 2V94A 5C42B 3P96A 4FNHA 2P9GA 4RW7A 3BN7A 1HBMB 1Y5NB 4RW4B 1JMTA 1WEYA 5DQGA 3IR6B 3IN5A 2B5JA 5HQ8A 3AA9A 4L76A 2CPIA 1XMQF 3LPYA 1BY9A 1QSYA 4HT7A 3HKZD 4NLPA 1PC5A 3J7Z5 4IR9A 4C8OA 4OYZA 4Z37A 3O5TB 3QGIA 2XULA 3OFGA 2CQIA 4QWEA 1FO1A 4C11A 3ZZTA 1GEHA 4FYVB 4K5RA 2FLNA 1XTZA 3DLEB 4RNFA 4FS2A 4KY3A 2E5LF 1LK5A 3DC2A 2RF2B 3TRGA 1TL3A 3QGHA 4I56A 1VRTB 3HSZA 2OJ3A 4OYPA 2B8QA 1RA7A 1RSCA 2JOQA 4F7VA 3HKWA 1W2BR 3WX8A 4IG3B 2VV5A 1WF1A 1NXIA 3LP1B 4U8YA 2MKCA 3MMCB 3CCZA 1V5VA 2D3ZA 2NREA 2LMIA 2L9DA 4ZPDA 4OJ3A 4J90A 1K44A 3VHQA 3A8IA 1RACB 3MI7X 3PIOQ 4OZLA 1NSAA 4AFFA 1C1CA 2ZKUA 4AXIA 4USJC 2MTLA 5B0GA 2OPRB 2BBEA 1VS3A 2UVWA 4KJIA 2AZ1A 1RT4A 1Y9OA 4CLSA 2DGVA 3MDFA 1X60A 1HI1A 2UVVA 2OKQA 2VJVA 2CQ2A 2EXUA 3M8QB 3AODA 3HVAA 3P5BP 3D2WA 5HROA 2AJFE 4Y2AA 3LQVA 3KNAA 3WBZA 5F8JA 2AJ2A 3NY0A 4M5IA 3DOMB 2DNPA 1YZ6A 3Q0AA 2XY6A 5KG5A 1S59A 2QFIA 4F4AA 4IR1A 4O23A 4N77A 2V4JA 3FCVA 1UZDA 2HBYB 4Q7AA 3KJNB 2M8DB 4CM0A 4FXVA 1S9FA 2XHWA 1X4EA 2IMOA 3H0PA 1H2TZ 4M5MA 3MM9A 3X3UA 2DGUA 3HLUA 1PSDA 2EK1A 2BDPA 4JYAJ 4D3GA 4PG4A 1VC5A 2M0GB 1VI7A 4G1QA 4K2JA 2OAUA 2KFYA 1S6QB 3UWTA 4U8VA 5HQMA 1FTRA 5L38A 2RQMA 2APOA 3DYAA 4PABA 5KFEA 4M5GA 1OJ4A 3EYZA 3OTOJ 1EQMA 2XMKA 3DHWC 5CYMA 2KT2A 4L74A 1REVB 3HP6A 3IGVA 1OPZA 4YR2A 3G87A 1VRUB 1R31A 4B9SA 3M32B 1NPKA 1W7WA 3KLFB 2EBGA 2QGFB 1S76D 2J76E 1NK7A 2MKYA 4F3OA 2QIFA 1TMJA 3GU0A 4C8LA 4ZJOA 4JI3J 4DLGA 3LANA 1GH8A 4C8KA 3HM9A 4DR7F 4UF4A 4LFCF 1KQGB 1VQ5S 4UOCA 3GJRB 4Q8FA 2E5JA 3DDIA 2YKOA 1C0UA 2CNOB 1B70B 1OY9A 2K8GA 3MMAA 2YWHA 2OLWA 4ZIVA 2JEJA 2KU7A 2NZCA 2OD4A 4FF3A 4JV0A 3D5MA 3BQ0A 2HVDA 4F04B 1BQNA 2H4YB 2Y1IA 3KLHA 4UW2A 2V2ZA 2B8PA 3RUBL 4Z2XA 3VGSA 4R0EA 2PEBA 5KTQA 1YITS 2BKOA 3DM2A 4DCOB 4BS2A 1F3VA 3EJMA 5DDRC 5LSRA 3DRRA 1RHKB 3HSDA 2BMBA 1RISA 2HQIA 3H5YA 4DZ6A 4JOUA 1B7FA 3TYTA 4PG7A 4NLOA 1KVKA 2KXNB 2HBQB 2XSJB 1T9VA 3MPYA 2LEPA 4I67A 1JXEA 5AE1A 2N7CA 3FUYA 1U1KA 4I1TA 4ES3A 3K58A 1EP4B 4DF8A 2DNYA 4JI4J 1JJHA 3T5KA 1SC6A 3GYGA 4ZP6A 1FFWB 3FC9A 3I0SB 2MXYA 4PXEA 3AXMA 2GCFA 5ETQA 5EWGA 2L9WA 3CD5A 5KFYA 4P72A 5AT1B 4AUKA 2ADBA 4DR4F 4MK7A 4FKYA 4W4MA 3UDVA 4ZJLA 3GWCA 5G0RA 2XTJP 3SSRA 4TY8B 2O5DA 4CRJA 3Q8YA 1F5BA 4P73A 3DOLB 1JX4A 4N8OA 1WHXA 1LW0B 4IH5A 3NEKA 4QIVA 2JC1A 2HAFA 4GO7X 3CWJA 3CB4A 4J9RA 5KFKA 3DI6B 5CQGA 4B17A 3R1LA 1TL4A 3PACA 1JKHB 5B08A 3A3NB 1OS5A 2BJ9A 4DV6J 4ED7A 3DLLQ 2R3VA 3EMTA 1AUDA 4DV0J 4CLWA 3OTDA 4BWMA 3CMAS 1RB0A 3C16B 5ETPA 4DX6A 1H73A 4Y2CA 3BEGB 3KK2B 1YJVA 2VG5B 2Y8YA 3DKDA 4X4PA 1QUVA 3DGPB 4DCPB 3QSIA 3N4WA 4LR9A 4O3QA 1I5OB 5A2QY 2IYGA 1JJCB 2B4VA 2QL9B 1Y3KA 4M5HA 1FVSA 3SMZA 3B78A 1KKHA 3GSIA 3M2RB 1U09A 2LLZA 2DRDA 1XR7A 3TP2A 2AX1A 3GJTB 1UA1A 4O4GA 2GIFA 1GMWD 4DMZA 1FKOB 4HVZA 3NG8A 3TEGA 4C97A 4ZJQA 1MNEA 2ZM6J 2KT3A 4DR1J 4LJMA 2HNDB 1KRPA 1VQKS 1WG5A 2ZWPA 2VPWB 2FYXA 1M5SA 5HAOA 1NDPA 3ZZOA 1FRIA 3KHGA 1HBNB 2GW8A 1IKVB 4WXWA 1R7IA 2ZH4A 2E66A 2BR0A 2QA4G 1QUPA 3M1VB 4EO6A 1FJ7A 3MM7A 2HIYA 4OHZA 2MQPA 3DRYA 5D4PA 1TL1B 2ZHAA 1ZETA 2AW0A 4KKOA 1SV5B 4NCBA 2E1AA 3OFEA 2LDYA 1FHTA 1YBTA 3QJPA 2XO7A 2ZH9A 2Q6BA 3Q23A 2GS8A 1YBAA 4QIWD 1TR0A 5IS2A 1IM6A 5GAEI 5D6GA 1LWFA 3CO9A 2J0SD 2K3KA 1R0CB 2HFUA 4ECYA 2L9NA 1UEUA 4DUYJ 1N48A 2HRTA 1YKWA 2WB4A 5K5MA 1NK0A 2FJDB 3PYFA 2Z2YB 5HJYA 1UWBA 4OYIA 1TUGB 4EEYA 5GAEU 4F50A 4WYWA 4LF7J 2YKAA 4L75A 3DCAA 1QVFR 2MZSA 2G1DA 3J7YI 2B9EA 2HHHJ 3Q2TC 1KFDA 1TAUA 5EDWA 3FRYA 1H0HB 2QMUB 4ZITA 2X1FA 1HQ2A 2HLTA 3SQGB 3LGHA 2DJWA 2YX4A 4PPZA 2QYCA 2LKZA 3N6MA 3PV8A 2FY8A 3E2EA 2F3JA 1Y10A 4RU9A 3UN5A 3MURP 5T7LB 1T05A 3C66A 4AD6A 2JC0A 4DI6A 1ZAXA 3L7PA 4DV3J 2AF6A 2XLKA 5B0EA 4URSA 2WHOA 1RT7A 3QIPB 1LXNA 4CWBA 1F2HA 3LP0B 4QW9A 2XYHB 2UUAJ 2DNRA 4C8ZA 4JYAF 3M8YA 3TO8A 2PD1A 4V19X 3ZZUA 2UU9J 2UV8A 4YR3A 2A10A 4K0KJ 4O0IA 1HWJA 4PG6A 2HS0A 4G1IA 2XQCA 4A46A 3J80U 4K7QA 2BRLA 3W9JA 4C0BA 5DM7Q 3GCXP 3LAMA 2CPDA 4DX7A 5CH7B 3BGFA 4N47A 4X66J 4NX9A 4RW8B 3OTOF 1G7CB 2LQJA 1U1OA 2DT9A 3ZZRA 2OD6A 3OUYA 3DLGB 2KT5A 2Z30B 4F8RA 1S4EA 2H9ZA 3MAQA 3DGVA 3JS9A 4ED6A 1HA1A 2D69A 2ZUGA 1NM2A 3OD2A 5IM0A 2ZJPQ 2R7WA 2IAJA 4P9SA 3A12A 3AJ2A 5E3QA 3CCVS 2DXEA 4JI3F 1TV6A 4RW6A 1SQGA 3SXLA 4HTJA 4TXSA 3SFGA 2DGQA 2HNZA 2A2CA 2DH9A 3I0RA 5C2GA 3V6DA 4KGXB 1FF2A 1DFDA 2PMHA 4LSNB 1RAGB 2GV1A 2CQ3A 4CH7A 2W24A 2HYIB 5BYQA 2HPUA 4PWDA 3O2IA 3ZO7A 3ZZPA 2IM0A 3AAWB 1CBKA 1WSVA 3KLIB 2Z2ZA 2Z2MA 3B4DA 2HIQA 2Z56B 7FDRA 4OZ2A 2J6SA 2BJ1A 2KO1A 4AYBD 4RW9A 1N5SA 2XB2D 3I56S 2J8SA 2XYGB 1C2PA 2HFOA 1B0PA 4EBDA 3UQSA 4NCGB 4DR3F 4USWA 3QAEA 3AOAA 4LSLA 3WIVA 1S1WA 3JQMA 4EU0A 5ITHA 3KOAA 2B0GA 4OYOA 2E5IA 1S1XA 1A9NB 4YQWA 2AJ4A 2E7XA 2W01A 1TKXA 4UUXA 4JI4F 1JB0C 4CT9A 4RU2A 3ENQA 2KZZA 5HVHA 1RAAB 1M5VC 1R6VA 1OY6A 3Q8SB 2VBWA 4FN5A 4ZHRB 2WK4A 4ECXA 4J9UE 2JFKA 2CYYA 1RU2A 1DAXA 4DQIA 1IR0A 3RBDA 2LEAA 2V8DA 2VB6A 1L3TA 2DCLA 4DPXA 5DETA 3H7HB 3FCWA 3TAMA 3C46A 1RKIA 2YWKA 1TAQA 3DOKA 5KG6A 4CNZA 4MH8A 5E3CA 4U7CA 1IKXB 1XNRJ 2LXFA 2I2YA 3SSQA 1EKRA 3KK3A 4ZCKA 2DRBA 1APSA 2KB2A 3EVOA 2H51B 5KFQA 1TKDA 3ICLA 1NJXA 2FB0A 4DV0F 2VA2A 4JV1A 1RYRA 1L3SA 2W8LA 2CA9A 1OQ6A 4QR0A 3ZZZA 2W8KA 3TEHB 3VAKA 2VD3A 2CG8A 2GO9A 5FLXY 2VUGA 1HBOA 2FZGB 1XWLA 4I64A 2ZC3A 3IS9A 3TI0A 2GVDB 3L7OA 1YJ9S 4CH1A 4IFVB 4LIWA 2MHEA 1DBDA 1SIWB 1SJFA 1O8BA 5A8KA 3LGNA 1HMVA 2BUNA 5GAHU 3BYPA 2CFXA 3PFOA 3DU6A 5FD1A 2QMWA 2WVFA 4HACA 3D6FB 1E6YA 4ED3A 3OJSA 4PG8A 5CD4H 2ZM6F 1OO0B 4RW7B 3GMGA 2IIHA 2PA3A 4GMKA 4DR1F 1EIYB 2HS4A 1RT5A 3CDBA 3AH6A 5HQLA 3CVKA 3K89A 4UUWA 3CJ0A 3R7BB 3H2VE 1Q5VA 3AQOA 2HSEB 4I6WA 4NLTA 3VR1A 1GTEA 2R7TA 4E8UA 3SCLE 1S0NA 2XCPA 2XS7A 2AZ3A 1VQ4S 2RDDA 3PYGA 1U1RA 4P2FA 2GAGC 1NSKL 4C11B 4Y0FA 1EB0A 2DB1A 2K1RB 5CD4A 5CYJA 1XNQJ 4Y3CA 4DL4A 1YVFA 1NBEB 4RUAA 1SC1B 4ZKAA 1BUXA 1UWAA 1TL3B 5CABA 1WDDA 3NL0A 1NMEB 1YJ7A 1VK3A 2EG2A 2AYMA 2M70A 2GC8A 3C6UA 2G4BA 4C48A 1G1XA 4DUYF 2XZTB 5ADZA 5IV3A 3CTRA 5DO2A 2PI5A 2VZ9A 2DGOA 3JSRA 4WP3A 1ZZNA 5GVQA 3JSMA 4LF7F 1IN0A 1HNIA 2MKKA 2ZFHA 4TN2A 2HHHF 1R0AA 3WX4A 1C1CB 4KBIA 3QRRA 1MN7A 4LF8J 5D77A 7AT1B 1N5QA 1R8BA 2AGQA 4JI7J 5SZTA 5KFCA 3UDLA 1QJHA 4LF2A 1RT4B 3NOGA 3M8PB 1RT2B 2Z4PA 5GADI 2VBYA 3FBFA 1WI6A 2DIUA 2UP1A 4UQGA 2C2EA 1XR6A 4DV3F 1SJRA 4TYAA 4Q44A 3V5RA 3FFIA 3HFKA 3EGZA 5HROB 1IBLJ 5ETKA 2HQDA 4JI6J 4HI1A 2UUAF 4E98A 4KV8A 4NYZA 4YUDA 5D4LA 1DTTB 3T41A 4OYWA 1FK9A 1Y5LB 2V4QA 2W4CA 2UU9F 2GMJA 4K0KF 2V4JB 2ZBIA 4B9MA 1ELOA 3JAMU 4YHHJ 5K8PA 1J5OA 1HR0J 1RWOB 1RTIA 1X0PA 3CDEA 4X66F 3OFHA 3Q8VA 5C24A 3CPWR 2PE8A 3MM9B 4DUTA 3J7ZT 3JQKA 1VQYA 3PNIA 3LALA 2IA0A 4DS4A 3HZGA 4L73A 3IAS9 1U6BA 3HF5A 4G1QB 1HLWA 2YTCA 3PZPA 3IMQJ 3OVSA 3BQ2A 4GO5X 3NGSA 2HFVA 2L48A 3BDEA 2DRAA 3CNQP 1AFIA 1BC6A 2CQBA 4CO1A 1HW8A 3CCJS 4ELUA 2DNKA 2HHTA 2GHWA 4I7FA 3OTBA 2QL5B 3G2XA 1JLQB 5CYMB 5CCMA 1UVMA 3NMAA 2FLLA 2H48B 1AB8A 1FRXA 1VYAA 2YX1A 2V8PA 2ZBRA 3G6VA 3ZTRA 2W7AA 2GGPA 5KFBA 4NZ6A 3OR1A 2CRLA 3PKYA 3AJDA 2V68A 3EPIA 5DJBA 1DURA 1VBYA 1M1GA 2QC3A 3CDAA 4KFBB 1ZM3A 3M8RA 3H2UB 1LWEA 2OPQB 1TL7A 1WF0A 1IKWA 3PO4A 5LMUJ 4J9KA 2R2TA
chains in the Genus database with same CATH topology
3GCXP 3QFHA 4K8RA 2Z57B 1SPBP 2E1PA 2W2QP 3WIVA 1ITPA 3CO0P 2Z30B 2XTJP 3BPSP 3H42A 2ZWPA 1V5IB 3T41A 3VV2B 3P5BP 4OV6A 3WHIA 2W2PP 1R6VA 3VHQA 3BGOP 2W2NP 3A3NB 2Z58B 4NMXA 3WIUA 3GCWP 2Z2ZA 2PMWA 2Z2YB 3AFGA 2W2OP 4JP8A 2Z56B 3SQOP 2ZWOA 2QTWA 4NE9C 2W2MP 3A3PB 3CNQP 1SCJB 4YN3B 3A3OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GCX P;  3QFH A;  4K8R A;  2Z57 B;  1SPB P;  2E1P A;  2W2Q P;  3WIV A;  1ITP A;  3CO0 P;  2Z30 B;  2XTJ P;  3BPS P;  3H42 A;  2ZWP A;  1V5I B;  3T41 A;  3VV2 B;  3P5B P;  4OV6 A;  3WHI A;  2W2P P;  1R6V A;  3VHQ A;  3BGO P;  2W2N P;  3A3N B;  2Z58 B;  4NMX A;  3WIU A;  3GCW P;  2Z2Z A;  2PMW A;  2Z2Y B;  3AFG A;  2W2O P;  4JP8 A;  2Z56 B;  3SQO P;  2ZWO A;  2QTW A;  4NE9 C;  2W2M P;  3A3P B;  3CNQ P;  1SCJ B;  4YN3 B;  3A3O B; 
#chains in the Genus database with same CATH topology
 1C0U B;  1VLO A;  2LQB A;  2GMH A;  1UEK A;  3G6E S;  3UCG A;  4W90 B;  1QVG R;  1NEE A;  2VFU A;  5KFN A;  1L5U A;  1FNX H;  3KLH B;  3FEY B;  3FQL A;  2B4P A;  3DM2 B;  1CLF A;  2IVY A;  1RCX B;  4I0W A;  5DDQ C;  4OYA A;  1PGZ A;  5I3U B;  1KVI A;  4IG0 B;  3IWL A;  4QYZ J;  2DBB A;  5CYQ A;  2FQQ B;  2RUG A;  1HPZ B;  3ZTO A;  3PYD A;  4F4Y A;  1UPP A;  1OY8 A;  2DGT A;  3Q8R B;  4B3S J;  2OFH X;  5B0D A;  3L9Z A;  3MR3 A;  3OV7 A;  2DNG A;  3CIZ A;  1E6V A;  2CDR B;  2GQ2 A;  2KN4 A;  1RHM B;  2RRB A;  3E8O A;  4KYZ A;  2XEX A;  1K73 T;  4WTO B;  4M5K A;  3OXF A;  4ILR A;  3PR5 B;  4C0O C;  1Q78 A;  2DIV A;  2MZ1 A;  3NNA A;  4QOT A;  1Q7L B;  3OTE A;  4P52 A;  1XNR F;  4HH1 A;  2ZBC A;  1TKZ B;  5M2P A;  4QW8 A;  3BKU A;  2IM3 A;  4WII A;  3AJ1 A;  3HSG A;  3GFZ A;  3W1Y C;  2V2K A;  1R3N A;  3HK2 A;  4MIB A;  4BHQ A;  1KLN A;  2I8E A;  4J9Q A;  4OI0 A;  2W9C A;  4ZPC A;  5B0F A;  2VBZ A;  5J2M B;  1CJK A;  4K2X A;  3OQ2 A;  4DQR A;  2EEY A;  4QYR A;  4C6A A;  4ZN3 A;  3IWX A;  3RB6 A;  2R7O A;  5KT3 A;  5KG2 A;  5E3P A;  2RRA A;  1OYD A;  1VIX A;  5F8I A;  4PEO A;  3TQE A;  2KG1 A;  4ED8 A;  2BKP A;  3EPG A;  4NMX A;  3FK4 A;  3BV8 A;  1IKY A;  1F9F A;  3ILL A;  2HKE A;  4P71 A;  3HX9 A;  2C3P A;  1WC3 A;  3K5M A;  1IBK J;  5ETR A;  4I6A A;  2ZZT A;  5IT9 U;  2D1C A;  4QPT A;  1AXQ A;  1FDD A;  4F4X A;  1OPI A;  2FJV A;  4LVN P;  3U1N A;  5M2U A;  2UXB J;  3D0I E;  3KG0 A;  1RAF B;  3LGM A;  1IBM J;  3SFU A;  3LF0 A;  4ZIW A;  4LQ3 A;  4PRF A;  4E2F B;  2V5H G;  2C3Y A;  4YME A;  2YWG A;  2UUC J;  4JV2 A;  3QJJ A;  4O4G B;  1Q82 T;  1HI0 P;  2Q1L A;  2JFD A;  5D0R A;  2HHW A;  4FDF A;  3D67 A;  4K4Z A;  1K8A T;  1X4G A;  2JL9 A;  3HUL A;  2PMZ D;  4OFZ A;  1Q8L A;  2B4O A;  4DWI A;  2LU2 A;  3V81 A;  5E5N A;  5KFP A;  1XNQ F;  3AY0 A;  1G6B A;  2HVZ A;  4ICL A;  2BXJ A;  5J2N A;  4CLT A;  3M9N B;  4ZCL A;  2CVI A;  3K2Y A;  4GC6 A;  4ED5 A;  2CIM A;  3KK1 A;  3BDP A;  2BE2 A;  2FJX A;  2O3D A;  2QA4 S;  1Q16 B;  2JX2 A;  1SVD A;  3MM7 B;  3NP5 A;  4XPC A;  3AB4 B;  5KG3 A;  2C2D A;  1R0B G;  1TKT B;  4X65 J;  1T03 A;  3ILI A;  6FD1 A;  1FNO A;  4DV4 J;  1ZM2 A;  4C0H A;  3MM8 B;  3ET6 B;  1QSS A;  2B51 A;  2GJ2 A;  3JTN A;  1K1S A;  3SBM A;  1NLK L;  1NH7 A;  3CJ8 A;  2D9O A;  3G6X A;  3MEK A;  1FJE B;  2HG4 A;  3M8W A;  2QMX A;  2J0Q D;  4LF8 F;  3GJS B;  2XG8 A;  4JI7 F;  2EG1 A;  2LQ5 A;  4TKT A;  3R9L A;  2XLJ A;  3KLE A;  3OR2 A;  3RGI A;  1D0E A;  5IXU A;  1UWB B;  2WVD A;  2QV6 A;  1URR A;  1MW7 A;  4M5L A;  3MEE A;  4RNH A;  3PRV A;  3W2W A;  4PUO A;  1X7V A;  4U7U K;  1IBL F;  3RRK A;  3MD3 A;  4P6Q A;  1T8E A;  4I4B A;  2ROE A;  3MOJ B;  1FVQ A;  4JI6 F;  4MK8 A;  3G8T A;  4LRA A;  2YKP A;  2NXN A;  4ERD A;  2XI2 A;  2R9L A;  2CJQ A;  1GMU A;  5DGB A;  1T05 B;  2XSF A;  4KIA A;  3J81 j;  1N36 J;  3ILO A;  1NPR A;  4EYH B;  5I42 B;  1U7L A;  5ETV A;  3AD9 C;  4KT0 C;  2BJ3 A;  3LH2 S;  4WFA Q;  3IRW P;  3R27 A;  4YHH F;  3FJ2 A;  1HR0 F;  1O51 A;  3EZO A;  2CQP A;  1RT7 B;  4ED0 A;  5EHH A;  1U45 A;  2EK6 A;  4RX6 A;  5H9E K;  1WDT A;  4ZPT R;  2HNY B;  1U0H A;  1SL1 A;  4QIG A;  2UUB J;  2QE5 A;  1S1V A;  2XMT A;  3BGL A;  2R2U A;  4NZ7 A;  3RJM B;  2V9K A;  2QLX A;  3CD0 A;  2M88 A;  2VIH A;  1NZA A;  2ZBP A;  1KEK A;  3W64 A;  3R1H A;  2ZH1 A;  2GJI A;  3M6X A;  3NBP A;  1I51 B;  3CED A;  1F5C A;  1HHT P;  2NQP A;  1YZ7 A;  3OLA A;  3PX4 A;  1IQZ A;  5HSP A;  5HP1 A;  1NCL A;  2Z8Q A;  5IWA J;  4TY9 A;  4CLY A;  3NGT A;  3OUY B;  1Y11 A;  4WXO A;  3EM1 A;  4LRD A;  2R2R A;  4MKY A;  1RTH B;  4HHU A;  3IBC B;  2F7V A;  3JQJ A;  4JI8 J;  4ECR A;  1V3R A;  4WTY A;  2IAJ B;  3QAU A;  5MLC V;  3SCJ E;  3W65 A;  1S6P A;  3H5S A;  2I1R A;  1TV6 B;  4RW6 B;  2AU0 A;  2GZO A;  1CS4 A;  4F25 A;  1NHV A;  3BRE A;  1IR2 A;  3GG0 A;  5LMU F;  1W2I A;  1Z2Z A;  2OSQ A;  3V6D B;  1AT1 B;  2BQU A;  1WEL A;  3QNW B;  4R0J A;  2ZE2 B;  3TA0 A;  2OH2 A;  5DZ6 A;  4UOG A;  1RLC L;  1MU2 A;  3UR0 A;  1H2U X;  5EN1 A;  2MDA A;  3NAH A;  1J27 A;  2VFT A;  4NLG A;  4ZDN A;  2VBX A;  1Q8I A;  4ZVU B;  4LR7 A;  1RZM A;  3EXC X;  2CZ9 A;  3EGW B;  4IRD A;  1JLA B;  1QAX A;  5IZH A;  5LMN J;  1FRM A;  4RNN A;  4RUH A;  1TVR B;  3LPE A;  5KFI A;  2KI2 A;  3BSN A;  1AFJ A;  1F2G A;  2KTQ A;  3NAI A;  4ZP7 A;  3R97 A;  2OTL S;  4B3S F;  3BH6 B;  2EC0 A;  1CQM A;  4M5D A;  2ZNZ A;  1YLX A;  1LWC B;  1U48 A;  4LSL B;  2DEI A;  4W92 B;  2O1P A;  4FPI A;  4C8N A;  1S1X B;  4LFA J;  1UFW A;  1N4L A;  3HVT B;  3FRZ A;  2HEK A;  5KFO A;  1TKX B;  1PKU A;  2XNR A;  1KNZ A;  3MCM A;  4A8K A;  2GHP A;  3MFI A;  4J37 A;  2CQ0 A;  5B0A A;  4IOC Q;  3CCE S;  3M2V A;  1U1N A;  4LT6 A;  3EUN A;  3FBE A;  4USM A;  1BWE A;  3MPU B;  1N54 B;  3KUE A;  3JYT A;  4CO5 A;  2PFD A;  3VZH A;  4KQZ A;  1LFP A;  1NSP A;  1EZZ B;  2CPH A;  4QJV A;  3POT A;  1S49 A;  3QBC A;  1HNV A;  2MKH A;  2I6W A;  2FD2 A;  5T41 A;  3D6T B;  3DOK B;  3K8V A;  3PR4 A;  2FVR A;  1Q95 G;  4HT5 A;  1O5J A;  5IFM A;  2IYI A;  5J1N A;  3QT6 A;  3KK3 B;  2CQD A;  1QSL A;  3S1T A;  5IT4 A;  3HJV A;  4CZC A;  4NI2 B;  3ELH A;  4Y2I A;  4IQM A;  4KHM A;  4QWB A;  1ITP A;  1IBK F;  3I9Z A;  2POK A;  2LDI A;  5HO4 A;  2XI3 A;  1F9H A;  1KR4 A;  4YS2 A;  3PW0 A;  2VU5 A;  3VVU A;  5E3R A;  1DAR A;  2WBR A;  2XS5 A;  2H3E B;  4O44 B;  4AE5 A;  1CJV A;  3HZE A;  3A3O B;  1CC8 A;  2F65 A;  4WJB A;  2ZOG A;  2UXB F;  1RYS A;  2OUG A;  2OI2 A;  2DNO A;  3IS9 B;  1IBM F;  1RT1 A;  3PX0 A;  2FVP A;  3CJQ A;  2IJN A;  3M30 B;  3H98 A;  2UUW A;  2UUC F;  1HMV B;  2E1P A;  2KYZ A;  1N32 J;  3DN9 A;  2NUU G;  3BPS P;  1G4C A;  3M2U A;  2HBR B;  3K5L A;  5BXI A;  4J5O A;  4AXJ A;  3UW1 A;  4NA2 A;  4F0H A;  4WE1 A;  1RTD A;  2BJE A;  4I2P A;  3QLH A;  2RDJ A;  1RT5 B;  4USH A;  1VBX A;  3FSI A;  3V4I A;  3KXD A;  2I38 A;  4OZ1 A;  1FCA A;  3QT5 A;  4XPE A;  4UY8 5;  4DF4 A;  2F8M A;  2ABY A;  3T9N A;  4FXD A;  3CUL A;  4Y6I A;  2IM2 A;  4HEA 9;  4FBU A;  4WFZ A;  2YNH B;  4RR5 A;  2EI5 A;  1F60 B;  3B8H A;  3PW4 A;  4GKK J;  4OYB A;  4X65 F;  2YKQ A;  1YX2 A;  5E33 A;  2KZM A;  1X9W A;  2DHH A;  5HL7 Q;  1SPB P;  3BYR A;  4OI4 A;  1VC0 A;  3TAP A;  2RE1 A;  2X3G A;  3TAN A;  4M8L A;  1X8D A;  4A4J A;  5CA5 A;  1KQS R;  2ACM A;  1U8S A;  3C6U B;  4K4V A;  4LRF A;  1SH3 A;  3OSP A;  5F8M A;  2MEW A;  1S48 A;  2XY5 A;  3GIJ A;  3F44 A;  2MST A;  1VJW A;  1RBL A;  4QWA A;  3UFC X;  3PX6 A;  2XMW A;  2J9D A;  5ETO A;  4ZVF A;  2CVE A;  4X4R A;  3JSM B;  1BMQ B;  4DJB A;  3C6T A;  2X7I A;  2ATL A;  1O0P A;  1EKS A;  3OT9 A;  1KOH A;  2Q3P A;  1R0A B;  4LQ9 A;  2MJU A;  2ROG A;  4X62 J;  1X5S A;  1RT3 A;  5CHC B;  4B08 A;  1FWL A;  1FWP A;  2XMM A;  3T1Y J;  3ADA C;  3GFY A;  1EET A;  3A13 A;  2OFG X;  1N36 F;  2A6O A;  4DX8 H;  1EX8 A;  1R8P A;  1GMW A;  2NPF A;  3E51 A;  5A0Y B;  4F4K A;  3TR5 A;  1ZPV A;  2YNI B;  5DQH A;  4ZN1 A;  3AA8 A;  2FDN A;  3SIP B;  4I2Q A;  2JLF A;  3DRP B;  1GFW B;  1RK8 A;  2BAN B;  3HHL D;  3MUM P;  1KWM A;  2P8I A;  2J7W A;  5D15 A;  1S5Z A;  2FHJ A;  2UUB F;  2BOA A;  1FK9 B;  1TUV A;  5JXS A;  1HL6 A;  1WI8 A;  3GLJ A;  4DG1 A;  4RNM A;  5KFJ A;  2VIC A;  2VG6 B;  1QY7 A;  1MMD A;  1J5O B;  1FES A;  4ITS A;  3A8K A;  1J5E J;  3DLB A;  1RTI B;  4J7C A;  1N0V C;  3VVT A;  1WKJ A;  4WBF A;  4OJ1 A;  5GMK a;  5C24 B;  5EX3 A;  4WU2 A;  4NA3 A;  1MG7 A;  2V2V A;  3NGU A;  3DRX A;  1HHQ A;  2RD5 C;  2WVE A;  1WAC A;  9ATC B;  1XEZ A;  4P7V A;  1SQF A;  1H7X A;  2EFV A;  4JI8 F;  4ILM A;  3J7A 1;  3BS9 A;  1NJI T;  4BC7 A;  3TOQ A;  4EI2 A;  4I7F B;  4LF6 J;  1ZAW A;  3TJ8 A;  3UR3 C;  3RBX A;  4PPD A;  1UPM B;  1QAI A;  5HI7 A;  3G86 A;  3HT0 A;  4DV2 J;  4R5P B;  2CDQ A;  1RAI B;  3W8P A;  3QMQ A;  3OL7 A;  2KVQ E;  3H5U A;  2GAH C;  3GG1 A;  2GGP B;  2IVM A;  2E5H A;  3K57 A;  4S0M A;  3IM8 A;  2C2O B;  4OI6 A;  3D7S B;  1K0V A;  2U1A A;  4FYW B;  2HWI A;  1N33 J;  3AD7 C;  3IG1 A;  1LWE B;  4DOZ A;  4FKX A;  5KFW A;  4IOB A;  1PBU A;  1AZS A;  2MHN A;  2E9Z A;  4LF1 A;  2M4M A;  5LMN F;  4C9D A;  1TU0 B;  2KL8 A;  3SSS A;  5HBM A;  4EZ6 A;  5EX0 A;  3SDE A;  3J81 U;  4DV1 J;  2AHO B;  3UN2 A;  1JJ4 A;  2LCW A;  3UNY A;  2PMW A;  2AGP A;  1A0O B;  2JZ5 A;  3B6B A;  2VPX B;  2NXU A;  2GQQ A;  3CXC R;  2KXF A;  2MYF A;  3PO5 A;  2C2M B;  2XNQ A;  3F0N A;  3GE9 A;  3UDC A;  3N5B A;  3QSY B;  2N3O A;  4NL5 A;  4LFA F;  1VCT A;  4FYX B;  3MAA B;  2RKI B;  5IT0 A;  1XMB A;  4OZ3 A;  3THT A;  4RBV A;  4A48 A;  1NK6 A;  4OI2 A;  5CYQ B;  2HUR A;  1BQM A;  2B7C B;  1PJ6 A;  1N6Q A;  3PM9 A;  2D9P A;  2WSF C;  4CP5 A;  3L4B C;  3HVR A;  3ENW A;  1NDC A;  3LA0 A;  2W4D A;  2HHQ A;  1XR5 A;  2CWX A;  1YJR A;  5AE3 A;  4RW4 A;  4F4Z A;  1UKU A;  1WHY A;  2ILZ A;  2MZR A;  1D1U A;  4WF9 Q;  1PG5 B;  2Q66 A;  3RG6 A;  3TUJ C;  3MWB A;  2BOP A;  3EZU A;  5HLF B;  2CXE A;  2ILY A;  3CSK A;  3MR2 A;  2ZDP A;  2G0I A;  4A8O A;  3TUP A;  1D9A A;  2CJB A;  4WKR A;  1M5P C;  4GVB A;  4WZQ A;  1FDN A;  3M4X A;  2EVZ A;  4ZA1 A;  5DDP C;  1CJK B;  1WUU A;  3U27 A;  3LUY A;  1KON A;  1VBZ A;  2EKY A;  3DU5 A;  3GV8 B;  3QJL A;  2DD8 S;  4DCJ B;  1T02 A;  3DLE A;  2G0C A;  3H42 A;  4ETZ A;  3TA2 A;  3MD1 A;  2RML A;  1TTH B;  2FC8 A;  2RF2 A;  1LW2 B;  5C7P A;  3FSY A;  2BQR A;  1VRT A;  3H2L A;  1IKY B;  1ZZF A;  1YRU A;  5KFL A;  5IQ6 A;  3HFV A;  1FE4 A;  1N32 F;  1U2F A;  3WHI A;  5A8R A;  4IG3 A;  3I5A A;  2FLP A;  2WOM B;  5C25 B;  4BDP A;  2YPZ A;  3LP1 A;  4UTG A;  3BF4 A;  4HLB A;  4WP9 A;  5L1I A;  5L1L A;  4ECV A;  3R8Y A;  1B0V A;  4H54 A;  5K9F A;  4F0M A;  3ZZY A;  3WC0 A;  2YWW A;  2E1R A;  2YX7 A;  4AQY J;  5IV4 A;  3LTO A;  3N5F A;  2OPR A;  3H59 A;  3KLV A;  3C8Y A;  3GV7 B;  2E1C A;  4N41 A;  4NEY A;  2DHG A;  1WG4 A;  2NLW A;  4IFY B;  3O8W A;  5D0H A;  3KHH A;  3W7B A;  5KOX A;  4GKK F;  2KFN A;  2VQE J;  2DEJ A;  2FHO B;  3UDE A;  3FMW A;  1QTN B;  4ANE A;  4ID5 A;  3C15 A;  5KFF A;  1BE4 A;  2DYA A;  3RAM A;  3Q86 A;  1OMS A;  4FS1 A;  3BZQ A;  2KKH A;  1S9E B;  2V34 A;  3BO3 A;  2N82 B;  4H4M A;  1KVJ A;  1T03 B;  1V3S A;  3O44 A;  1HHS A;  2VA3 A;  3TVZ A;  1C4A A;  4RWX A;  4CDI A;  4ALZ A;  5K20 B;  3R6L B;  3BSO A;  2QX0 A;  3DLH A;  2B3T B;  1ULR A;  2OTJ S;  3LP2 B;  5FDL A;  4X62 F;  5D4O A;  3W9I A;  2LU1 A;  2Y3Y A;  3G71 S;  2YH0 A;  4GVL A;  5A8W B;  2UV8 G;  4HDG A;  2DR5 A;  2OSR A;  1S6Q A;  1RT6 A;  5F41 A;  3IFE A;  3T1Y F;  5JVH Q;  4C3L A;  1GXU A;  5H1S V;  3L3C A;  4BLG A;  3D0H E;  4C8M A;  5T14 A;  2DGS A;  4QIE A;  3W2W B;  2IFX A;  5AXN A;  3TUI C;  3D6M B;  3R6G B;  4KH0 B;  4L6V 3;  5LOQ A;  2EC2 A;  2EPI A;  4RBU A;  2ZH8 A;  5I3Q A;  4OX7 A;  3J80 Y;  3CD6 S;  3WC2 A;  3OVA A;  4NLR A;  2BVZ A;  3M32 A;  4DR2 J;  3KLF A;  2MSS A;  5CAA A;  1V6H A;  2CJA A;  2Q6C A;  1VQL S;  2IRX A;  2UVR A;  1KD1 T;  4RWW A;  1S1U A;  1C0T B;  2ZD1 B;  3TVK A;  3ZTP A;  3LO3 A;  5J2Q A;  1R8C A;  3CCM S;  5RUB A;  2LEB A;  1J5E F;  2YNG B;  1U24 A;  4TVA B;  1WKK A;  3PJ9 A;  3PW7 A;  1Q4R A;  2ZC4 A;  2F9J A;  2DGW A;  1XQI A;  2SXL A;  3MPD A;  2HMI A;  4FP9 A;  4OLO A;  1YDL A;  3DFE A;  2GVZ B;  3VAH A;  1Q0N A;  1BLU A;  2Z0G A;  3CCT A;  1Q8B A;  3V6H A;  2IC3 A;  4ZCI A;  2ALY B;  4TLQ A;  4MMO A;  1S10 A;  3TZW A;  3CC7 S;  3F41 A;  3NBP B;  4RL1 A;  1RP5 A;  2CNN B;  4LF6 F;  1TMM A;  1D9D A;  3DLK A;  4WPA A;  1HAR A;  4PQA A;  5LT5 A;  5LL6 d;  3BM7 A;  2FHM A;  3L09 A;  5AXL A;  4DV2 F;  4RKU C;  3MEC A;  4HI2 A;  1KHV A;  4IQX A;  2W7P A;  2BJ7 A;  2AIR B;  2V2Q A;  5B0B A;  1NKB A;  3EIC A;  1XIQ A;  1DZ5 A;  3N0V A;  3W5Z A;  1QE1 A;  2QA2 A;  4A8M P;  1JLC A;  1HBU B;  1S6P B;  2FTR A;  2PC6 A;  1EP4 A;  2EW9 A;  1NPP A;  1N33 F;  1JWW A;  5F8G A;  2H5J B;  3BR9 A;  3I0S A;  4CQ1 A;  3FSX A;  2E7W A;  2CPJ A;  4EYI B;  4K5S A;  4DV1 F;  2MQM A;  1TK0 A;  4DR3 J;  1RHQ B;  2HGN A;  4DQQ A;  5D8H B;  3VF0 B;  3IM9 A;  2QG9 B;  1FKP A;  2HVH A;  2Q79 A;  1N88 A;  1GXL A;  1LW0 A;  1UVK A;  1VBK A;  1UAW A;  3QPI A;  5HAN A;  3C19 A;  4M94 A;  4P74 A;  3BH7 B;  3K5O A;  5KT7 A;  3DI6 A;  2JDJ A;  2J0X A;  2AQ4 A;  4ETX A;  4PCQ A;  2MLY A;  4G1P A;  1VOM A;  3I4P A;  3T5L A;  5KFZ A;  4ZVS B;  2FIU A;  1BWV A;  2VG5 A;  2VAS A;  3TNV A;  2WTF A;  2KJV A;  1LV5 A;  1RWU A;  3DGP A;  1SH0 A;  2GML A;  2LXU A;  3OBI A;  1N52 B;  5D0E A;  1SJ4 P;  4QU6 A;  4KE5 A;  3SCI E;  1F9E B;  5HJX A;  1VHF A;  4X4Q A;  3IR5 B;  3H25 A;  4R8U A;  4MT1 A;  4ID8 A;  2ZBQ A;  3H5X A;  3W66 A;  3M2V B;  5D0G A;  3DLJ A;  1WD6 A;  2DCU B;  4TU8 A;  5L1J A;  4LIR A;  3MTJ A;  2IJF A;  2R42 A;  2ZZN A;  4IRC A;  4Y2M A;  5EWF A;  4QCL A;  1QAY A;  4LRC A;  2XM3 A;  4H4O A;  2KDO A;  4RZR A;  2DH7 A;  1JLF A;  3UNG C;  3RR7 A;  2HND A;  2BJ8 A;  3DMJ A;  1NJW A;  2ZH2 A;  1HBN A;  1MMN A;  1F1B B;  3RB0 A;  1IKV A;  2MB0 B;  3SI8 A;  3IRX B;  3W63 A;  3M1V A;  3I32 A;  1V9O A;  2AT1 B;  1X31 C;  5U47 A;  4YEA A;  3D1O A;  4WP8 A;  3PJW A;  3HJF A;  3PHE A;  3P5T L;  2XZW A;  2AV5 A;  2V8G A;  4KC5 A;  2QTW A;  3GYX B;  4NZ0 A;  3QAT A;  2FHJ D;  2BYC A;  1VHI A;  2PDA A;  1PBA A;  3Q83 A;  1TFY A;  1TZ0 A;  1RT1 B;  2HFZ A;  4AQY F;  1WHW A;  3W5Y A;  2ZEJ A;  8ATC B;  1YBU A;  2V69 A;  2XGP A;  1XER A;  3PW2 A;  1N8R T;  1HNX J;  5KFV A;  2JRS A;  2WON A;  4I6Y A;  2VL1 A;  1ZM9 A;  2EFQ A;  4OJH A;  4MKB A;  1NSQ A;  2VQE F;  1GQE A;  1HQU A;  3UPF A;  1G2E A;  1N0U A;  2WZ1 A;  3NLC A;  3MZI A;  2AGO A;  2A0F B;  1L3U A;  3V4I B;  3CJR A;  4PYD A;  4LBH A;  2BV3 A;  2QA1 A;  2ZJR Q;  3SQG A;  4YN3 B;  3I82 A;  2XGQ A;  4JI5 J;  3I31 A;  1JNR B;  2GFF A;  5T7L A;  3THP A;  2G2O A;  1R8A A;  1WTF A;  4DFM A;  3F56 A;  2M3D A;  2NYH A;  5FJ4 A;  1OYE A;  3IO1 A;  1KSP A;  3CE8 A;  2C2Z B;  2F8E X;  3QO9 A;  1N56 A;  2H54 B;  2VKZ G;  2CPF A;  2PSZ A;  3QIP A;  4RJV A;  3AFG A;  3LP0 A;  3TX8 A;  3GIL A;  2DPJ A;  1RQ0 A;  5HVG A;  4X4V A;  1T95 A;  1Q1K A;  5HVF A;  1S79 A;  3FKB A;  2QZ8 A;  4C8Y A;  3TZX A;  1UFL A;  4EFA C;  1HKA A;  3MEG B;  2VFS A;  2C3U A;  1I1G A;  2EFN A;  4ECQ A;  2MZT A;  1RTJ B;  3J7Y U;  4MTP A;  4WIQ A;  2DNN A;  1XC9 A;  2UXC J;  3RW7 A;  3HVW A;  4NLV A;  3NWG A;  2HFS A;  3OSN A;  4QU7 A;  3RB3 A;  4RW8 A;  2ADC A;  1XJW B;  4EMD A;  2WCX A;  4QYZ K;  2CNK B;  1CJU A;  9RUB A;  3TZY A;  3DLG A;  1KN6 A;  5DG9 A;  1HIY A;  3IAM 9;  4PQU B;  3JAM Y;  1D8Y A;  2PI4 A;  4F3M A;  1RT3 B;  3U02 A;  5B7W A;  3M9M B;  3D54 A;  4DR2 F;  4X4U A;  2VFV A;  1EET B;  4CTA A;  3OTC A;  3CGI A;  3QFH A;  2COL A;  1NO8 A;  5LJ5 Y;  2XC9 A;  4A8W A;  4ILL A;  1RWV B;  3GQC A;  3EE3 A;  2E9T A;  1SKU B;  3G82 A;  3NGD A;  2XS2 A;  1CUL B;  3CW2 C;  4F02 A;  4I2Q B;  3D6H B;  2ZH5 A;  4IDK B;  1MLA A;  4LBI A;  1JLE A;  2C42 A;  3CJ2 A;  2BJD A;  3CO0 P;  1IQT A;  3CJK A;  4DFK A;  4ZLN A;  1NDL A;  1JLB B;  4LSN A;  4L3K A;  1LXJ A;  1P8G A;  3W3S A;  4ZVR B;  3MR7 A;  5BJR A;  2ZWO A;  3CJ5 A;  4DG1 B;  1HYS A;  1UTA A;  3D68 A;  1NND A;  3M6V A;  5H9F K;  2WW8 A;  1Y00 A;  4ZLJ A;  1Z4U A;  3KLI A;  2RQC A;  3KJF B;  2AEF A;  4HH0 A;  1SH2 A;  5K14 A;  1H2V Z;  3MM5 A;  1QTM A;  2MQO A;  1H3D A;  1FE0 A;  5KG0 A;  3RW6 A;  4N7T A;  1H6K X;  1UET A;  3VWS A;  4P2M A;  2MGZ B;  4C3K A;  4OHW A;  1UZH A;  1I94 J;  3AQP A;  1IJE B;  4EBE A;  1KC8 T;  3VQS A;  5DGA A;  4DSE A;  2QO3 A;  1RHU B;  2QLW A;  1P1T A;  2HQ3 A;  1KLM B;  2RDI A;  1WG1 A;  3R5D A;  2K06 A;  1LEO A;  3KTQ A;  1VQS A;  1IXK A;  1NUE A;  4Q5V A;  2W4P A;  3AOC A;  4OX9 J;  5L9N A;  5E41 A;  3PYE A;  3C14 A;  1TQL A;  2RAQ A;  1S9G B;  5KFD A;  1DRZ A;  3KMS A;  4X4T A;  2MZJ A;  1NRK A;  3FCH A;  4NRT A;  4YB5 A;  1UVI A;  1MN9 A;  3CUN A;  1UW9 A;  1A7G E;  3UVJ B;  4FVC A;  4ED4 A;  3M8S A;  1AZS B;  1TK8 A;  3R7S B;  2ATC B;  3I87 A;  2F40 A;  3IGN A;  1FX4 A;  2FZK B;  5HBM B;  3G6Y A;  3GTY X;  3SDE B;  1RGV A;  3CCS S;  3W8G A;  4JP8 A;  3BKT A;  4F67 A;  3R5B A;  1SL0 A;  2R8I A;  2IJR A;  5HMX A;  5J1E B;  1DLO A;  2GA7 A;  1MML A;  1RWN B;  2ROP A;  3VV2 B;  1HWK A;  4B3O A;  4B9U A;  2JHE A;  3ETO A;  3QWP A;  2HWH A;  3LWM A;  1ICE B;  3QT7 A;  1UVL A;  2KG0 A;  1M0S A;  5L39 A;  1FXD A;  5KG7 A;  4DV5 J;  2AX0 A;  3FEX B;  3KLG A;  3SCK E;  2D74 B;  3BGU A;  3NXZ A;  4DR5 J;  2RS2 A;  2X1A A;  1DTQ A;  1NK4 A;  1U25 A;  1ZTT A;  2MQN A;  2ZIT A;  2CWK A;  1FT8 A;  1N6Q B;  1CQN A;  3BBF A;  1VQM S;  2YKN A;  4P2X A;  2Z57 B;  1REG X;  4OV1 A;  1UEV A;  3TAR A;  4ES2 A;  3D1Q A;  1IJF B;  4DL5 A;  1U6Z A;  3B54 A;  1U0S A;  3U1L A;  2DVI A;  5A6P A;  3BBB A;  1S4F A;  5DS7 A;  2DK2 A;  4U67 Q;  2B6A B;  2OPS A;  3K5N A;  2WSC C;  4F0K A;  1VQ7 S;  5IT9 Y;  4NXM F;  1Q5Y A;  2OEJ A;  2HRY A;  3F73 A;  1VC6 A;  3SV3 A;  1PJ7 A;  3RRH A;  2BA9 A;  4FVM A;  4GVB B;  4QIF A;  4CLK A;  1JJ2 R;  1YI2 S;  4JI0 J;  1VIO A;  5KFG A;  3TA1 A;  1ZM4 A;  3ULH A;  2K1R A;  5CCL A;  3D1H A;  3ENA A;  3NMR A;  3RR8 A;  1RXO B;  4LF4 J;  2NZ4 A;  2B5J B;  4F3Q A;  5DQI A;  3ZC4 A;  1B3T A;  3AB2 B;  1V3Z A;  4RUB A;  4IUF A;  3QRP A;  4P75 A;  1NDK A;  5JJB A;  3IBF B;  2JEF A;  5DRK A;  2HLU A;  5CZV A;  1HNX F;  5A8R B;  1MWY A;  2V6A A;  5KG4 A;  4XIU A;  2UZA A;  3GII A;  1ZPW X;  1ZH5 A;  3UD5 A;  5GAG I;  1UJ6 A;  2B9Y A;  3A1Y G;  2RQ4 A;  3QGG A;  1FFS B;  5J1P A;  3IP0 A;  3HSJ A;  4QR2 A;  1X5T A;  3M05 A;  2DH8 A;  2W1B A;  5KFR A;  2DNL A;  4IH6 A;  2YQ3 A;  4UST A;  3ZXW A;  2PN6 A;  2QEX S;  4LF5 J;  1UJ4 A;  4JI5 F;  5GAG U;  1YRX A;  1RCO B;  3MTK A;  3M8P A;  4YB1 P;  1DQA A;  1RT2 A;  3GIR A;  1X5P A;  5DM6 Q;  4PXD A;  2BZ2 A;  2IDL A;  3QZ7 A;  3KYL A;  3N6N A;  4F26 A;  4K59 A;  1ZA2 B;  3BBC A;  2WSE C;  2GQC A;  3Q8Q B;  2GO8 A;  2BRK A;  3T1H J;  3N9U C;  3W2V A;  3E3X A;  5FII A;  4ID5 B;  3C15 B;  2NXC A;  4ANC A;  4DFP A;  1U02 A;  2CPZ A;  2FLO A;  2YKM A;  4ECS A;  3KJV A;  1UA0 A;  1C4C A;  1DTT A;  3TW0 A;  4B3M J;  1K47 A;  1L3K A;  4J9N A;  4H4M B;  1SKS A;  3HD2 A;  5GMD A;  2L08 A;  1DQ8 A;  3ZFV A;  2K7K A;  4B9T A;  4B9L A;  2UXC F;  2OGU A;  5K8M A;  2V63 A;  3MFH A;  1FDA A;  3NKY A;  1QDU B;  2JJ4 D;  1YG0 A;  3LOU A;  2ERR A;  4CNY A;  3B4M A;  2MJN A;  2Y9H A;  4ZPV R;  2AMC B;  3Q8P B;  3MMB A;  4USV A;  4FPR A;  2MQL A;  5HMZ A;  2FPH X;  3NS7 B;  1NKC A;  5GAD U;  5FDL B;  4CT8 A;  4CO0 A;  4OI1 A;  2RNE A;  4DXL A;  1GAO A;  4DPT A;  3RAQ A;  3OL9 A;  1URN A;  1VRQ C;  3SQO P;  1L3V A;  1RT6 B;  2ACY A;  2WAQ D;  2E44 A;  2J6U A;  1H38 A;  4N56 A;  3VAI A;  3O1L A;  3X1L B;  1HFE L;  3CDW A;  3DDN A;  3TJ9 A;  2FY1 A;  1JLQ A;  3UE2 A;  3KHR A;  2BAC A;  1GMV A;  1N34 J;  1P9Q C;  5KT4 A;  2OPP A;  4XDC A;  3GJQ B;  3R3T A;  4LBP A;  2ZUA A;  3L95 X;  2G0J A;  3PIP Q;  4O3P A;  3TQ1 A;  1TP7 A;  3TVY A;  2BM1 A;  4DSL A;  1I6J A;  3DYA B;  4NA1 A;  4KFB A;  2KXH A;  1S1U B;  5J2Q B;  2OPQ A;  2C3M A;  2FJW A;  4UZC A;  1RWW B;  2WW4 A;  3KMQ A;  1SKW A;  2XHC A;  4MIW A;  3HD1 A;  2HMI B;  4ECT A;  2CQH A;  1I94 F;  3VCD A;  5A76 A;  4WFN Q;  2IC3 B;  2AP6 A;  2F4F A;  4UT4 A;  2Y0B B;  4ECZ A;  1WC0 A;  5ETM A;  4URG A;  1YJN S;  4KHR A;  2DY1 A;  3UN3 A;  3J7A N;  4XAK A;  1IUJ A;  3DLK B;  1DHM A;  3MPV A;  2KRR A;  3R5C A;  4ATN A;  1HQE A;  1X4B A;  5I3U A;  4IG0 A;  2IRY A;  2R2S A;  4LSZ B;  1HPZ A;  4OX9 F;  1RTZ A;  3MEC B;  2MPU A;  3MMA B;  4H4K A;  5LXY A;  3CCR S;  4DL7 A;  3R7N B;  1WC1 A;  1FJG J;  1RWK B;  2FJE B;  3PRD A;  4K8R A;  1BQN B;  1YSJ A;  4M95 A;  4ED1 A;  4B02 A;  3T19 A;  1HD1 A;  3P49 B;  5F3T A;  1QE1 B;  3M6W A;  3PEH A;  2A18 A;  4OV6 A;  5KG1 A;  1YIJ S;  4G3I A;  2XMJ A;  4A8X A;  3U7J A;  1JLC B;  2V4R A;  4P7T A;  4G6V B;  2XMA A;  1QD1 A;  3DRR B;  3EVW A;  1T9T A;  2HZV A;  4I69 A;  1VQP S;  1W26 A;  4LR8 A;  1SC3 B;  1TKZ A;  2BM0 A;  2YPY A;  2R8H A;  5GME A;  4CH0 S;  2GJF A;  1VQ8 S;  2MQQ A;  3HHL A;  2WBM A;  2B4U A;  2HWT A;  2MLZ A;  2LQ8 A;  3K5P A;  2MY7 A;  3RAX A;  4Z7C A;  1FKP B;  1YGY A;  5J2M A;  4KSE B;  4MKV A;  1NHU A;  2AJ0 A;  3W9H A;  4P10 A;  2O66 A;  2RVJ A;  1Q53 A;  1RU1 A;  4KGV B;  4MK9 A;  3OL8 A;  5L9X A;  4DV5 F;  1B4S A;  4X4O A;  4CLU A;  3N01 A;  3EXY A;  2W7O A;  4DR5 F;  2PFF B;  4LVO P;  4J9M A;  3PCO B;  4ZCM A;  1MRO A;  1FRL A;  5L8R C;  5HN0 A;  2ZJQ Q;  3P45 B;  4V1A k;  3I5B A;  1LFW A;  5DLG A;  5G0R B;  2ASL A;  1M5O C;  1T11 A;  2CQ4 A;  5KFU A;  4P2S A;  2JSX A;  4FZV A;  2N4D A;  1RJJ A;  4MFB A;  4OI3 A;  2M9K A;  4HKQ A;  2HHV A;  3K59 A;  1DJ0 A;  3A4T A;  4NPO A;  1SIZ A;  1GK8 A;  2V9W A;  5BR8 J;  4R8U B;  1EAY C;  4U95 A;  4NWB A;  2MKS A;  5F9L A;  5LXR A;  3JTO A;  2LFV A;  4PKD B;  1SCJ B;  1NK9 A;  1X4F A;  2P6S A;  4OJG A;  1R8H A;  3IBW A;  2P6T A;  3EZ5 A;  3H4D A;  2GNK A;  4JI0 F;  2CZ4 A;  1FRJ A;  4O3R A;  4H4O B;  2HZC A;  1JLF B;  2RU3 A;  4MJK A;  4ELT A;  3DMJ B;  5AXK A;  5JMN A;  2N7Y A;  4LF4 F;  5F8H A;  5IC6 B;  4KPY A;  4MYU A;  4AND A;  4UZB A;  2IA6 A;  4MIA A;  2F63 A;  4AL5 A;  4EK2 A;  3NNC A;  2NCK L;  5SUH A;  5KFS A;  5HAT A;  2P9E A;  4A47 A;  3TZZ A;  4Y65 A;  4JV5 J;  4WK1 A;  4JI2 J;  2PA8 D;  1TKT A;  1JIH A;  1FX2 A;  4HHH A;  4PXC A;  3D3C J;  1PO6 A;  4LFB J;  3EWG A;  1EAR A;  4RBT A;  3M8Z A;  3MM8 A;  3ET6 A;  4NLU A;  2A1B A;  3NCQ A;  4NCA A;  5KFT A;  3M9O B;  1SUQ A;  2AKW B;  1GTH A;  2R4F A;  3T6J A;  1QAJ A;  3ISN D;  4MAK A;  4E0D A;  3NRB A;  2VQF J;  2C2N A;  4LF5 F;  4C7Q A;  4CLZ A;  3D3B J;  3U1M A;  1KTQ A;  1FRH A;  4EO8 A;  3GCW P;  3OXG A;  4KKO B;  2WON B;  1S97 A;  4WFB Q;  3MPW A;  2LXI A;  2RU9 A;  2F1F A;  5KFH A;  5LM7 E;  3Q22 A;  4IYQ A;  1NK8 A;  2X51 A;  1HQU B;  5L1K A;  4IO1 A;  3T1H F;  2DXD A;  1T0T V;  1LWF B;  5IQQ A;  1Y4Z B;  3KUG A;  4X2B A;  1VQO S;  3MOZ A;  4USI A;  4M5J A;  2JVO A;  1RAO A;  1TK5 A;  4B3M F;  4CYU A;  4HHJ A;  5I42 A;  3TAQ A;  2HHU A;  5KFA A;  5D4N A;  3PJX A;  3QO9 B;  2D41 A;  3GR1 A;  2E29 A;  4G65 A;  2MKJ A;  3PFE A;  4XTT A;  3RU0 A;  2F4V J;  2HNY A;  2W9B A;  4KRW A;  3RZA A;  2M5Y A;  2Z58 B;  1WF2 A;  3MHY A;  1U47 A;  2VOD A;  4OZ5 A;  4CO4 A;  2RSQ A;  4DSI A;  3ONQ A;  1X4H A;  2J6T A;  4QR1 A;  4RUC A;  5M2R A;  3JSB A;  4OMF G;  2DNZ A;  1FI4 A;  4K4W A;  1Q86 T;  1K0T A;  2UVU A;  2QSF A;  2E5G A;  1Y5I B;  4XDD A;  3AHP A;  4K4Y A;  4KGZ B;  4OYX A;  3I9V 9;  3GFX A;  1N34 F;  5KAK A;  1CJU B;  2MMY A;  3VTI A;  1T94 A;  1T9U A;  5DG8 A;  1RTH A;  4OYM A;  2HHP A;  2ASD A;  2IY5 B;  3HHK A;  3T1A A;  4CTA B;  3W62 A;  3ISZ A;  4TQR A;  2VDH A;  3OW2 R;  4DZD A;  3HPO A;  1YK9 A;  2O01 C;  4NEZ A;  3G82 B;  3CCU S;  2Y8W A;  2QN6 B;  4GKJ J;  3ENV A;  4CIO A;  1PC4 A;  4W98 A;  4TLR A;  2AJQ A;  4X4S A;  1ZYQ A;  1JLE B;  2CZV C;  2ZE2 A;  3CJK B;  2FVS A;  1VMB A;  4PXB A;  3CCL S;  2HW3 A;  1GX5 A;  1SQE A;  4WYL A;  2J9D E;  2BEF A;  2V67 A;  5IM0 B;  1JXL A;  1HYS B;  2VON A;  3BQ1 A;  3VZI A;  1PIE A;  2VKR A;  4YB7 A;  4Y28 C;  2CQG A;  3MED A;  1ZA1 B;  3GIM A;  2JVR A;  4N8N A;  2UXD J;  5AXM A;  3NS5 A;  4DN0 A;  2QT7 A;  2HNZ B;  1JLA A;  3I0R B;  3CCW A;  2RIJ A;  5K14 B;  2CPY A;  3MM5 B;  2JLG A;  2OP5 A;  1TVR A;  1HNZ J;  1U2C A;  4Y00 A;  3K17 A;  4ER8 A;  4J9S A;  4CLF A;  1SI9 A;  4CO2 A;  2W2O P;  4DL6 A;  2RH3 A;  1FWK A;  3BGR A;  1FJG F;  4PWD B;  4YR0 A;  1LWC A;  5G4D A;  2W2P P;  4NOH A;  5B0C A;  1Z1Z A;  4DBQ A;  4DFJ A;  4IOA Q;  2LQ9 A;  5E2Q A;  4ZP8 A;  2VPY B;  3G96 A;  3HVT A;  2XMU A;  4IKA A;  2XZD B;  1U8W A;  2RS8 A;  3J81 Y;  2FC9 A;  4RW9 B;  2G2Y A;  3DDK A;  3EGV A;  2CJK A;  1X4D A;  1YHQ S;  4K4S A;  2ZH3 A;  3BGO P;  4OHX A;  2AYB A;  3C14 B;  5C2C A;  3Q89 A;  2VOP A;  3PG9 A;  2G1H A;  3FMB A;  2QLJ B;  2GHV C;  3DRS A;  3PDN A;  2ASJ A;  5K8N A;  1S1W B;  5KFX A;  5D3G A;  2ZZM A;  3WIU A;  1KQF B;  1Y0H A;  1NK5 A;  1ZS6 A;  2DTJ A;  4KO0 A;  2XWY A;  3OJU A;  3PKM A;  1NJY A;  2O67 A;  2HZA A;  3MF5 A;  4XK8 C;  1X9S A;  3E01 A;  1S0O A;  4Q45 A;  2B56 A;  4L3N A;  3LWL A;  3T6B A;  2AEJ A;  4DV6 F;  4NI2 A;  3UD3 P;  2NYI A;  2IM1 A;  2JH3 A;  1NZ8 A;  1DLO B;  2BAB A;  3NGR A;  4B3O B;  2DPI A;  4A8S A;  5GAH I;  3HXM A;  2CKW A;  4NLX A;  3TAM B;  4O44 A;  2J0W A;  2BKN A;  2UUT A;  4V19 J;  4F4W A;  1SL2 A;  5I3P A;  3KFW X;  3KLG B;  4IH7 A;  5A2Q U;  3MCN A;  3I55 S;  2OMO A;  5BR8 F;  3PW5 A;  4B9N A;  1DTQ B;  4AL6 A;  4DN9 A;  2LA4 A;  2RJZ A;  3A3P B;  3M30 A;  3W60 A;  1SBR A;  2YKN B;  1WOS A;  3CJT A;  4PZV A;  1PYO B;  2CUY A;  1U4B A;  3VAG A;  1M90 T;  3EX7 B;  1VR6 A;  1CSJ A;  2QL7 B;  3KHL A;  2J9C A;  1HBO B;  1PYS B;  3K0J A;  4Q2M A;  4DSK A;  4OHV A;  3CC2 S;  4N76 A;  4HL9 A;  2Y0S D;  1N5T A;  4TYB A;  6AT1 B;  2OPS B;  1M1K T;  4QZV B;  2NXJ A;  5A8K B;  4ZPA A;  2QJ3 A;  3VAM A;  2EKN A;  2IBK A;  2DR9 A;  2DIS A;  1WOR A;  4JV5 F;  2JNJ A;  2YNH A;  4JI2 F;  1CJT A;  4B3T J;  1U26 A;  2RT3 A;  1SJQ A;  1NB7 A;  4HAC B;  1E6Y B;  3VGT A;  4EZ9 A;  4DR6 J;  4ZOS A;  3CCQ S;  3NNH A;  1KHW A;  3A8J A;  3BSA A;  3MAH A;  2D3O R;  4LFB F;  4FF4 A;  2PT0 A;  3GB0 A;  3AT1 B;  3N28 A;  1UMJ A;  1RUS A;  3MCO A;  1TUW A;  4JI1 J;  3QID A;  1WC5 A;  4C98 A;  2DY9 A;  1SC4 B;  5AE2 A;  2VQF F;  3ZNJ 1;  3ZTS A;  2RUS A;  2VG7 A;  3UO0 A;  1RAB B;  4CO3 A;  2V8H A;  1RAE B;  1P1L A;  4WWS A;  2N4C A;  4O3S A;  2VH7 A;  4R25 A;  4NXN J;  3GP9 A;  3AD8 C;  2K7J A;  1CVJ A;  1C1B A;  3QGP A;  1D9F A;  3HCX A;  1N5Y A;  4LRB A;  3B82 A;  1JK9 B;  1ZBT A;  4USU A;  1IBC B;  2Y1J A;  2YVS A;  5ETL A;  3GPA A;  2Y1R I;  2LYV A;  1Q81 T;  2NR0 A;  2ZVS A;  2DNM A;  2AYE A;  3JXO A;  2LP4 A;  2M8H A;  2X1G A;  2CNL B;  3MMJ A;  2GX8 A;  4WZM A;  2YNF A;  4EUV A;  4PWW A;  5ETT A;  2H5E A;  1FXL A;  2N3L A;  5A0Y A;  2Y1L B;  4DU8 A;  3VAJ A;  2XCA A;  2YNI A;  3ISN C;  1HNI B;  1BQX A;  4KR0 B;  3DRP A;  5C5J A;  1G3O A;  3NS6 A;  3W2V B;  4L72 B;  2BAN A;  4QWC A;  4OX8 A;  3PXG a;  2F4V F;  2R8J A;  1XBW A;  2ZH7 A;  2YKM B;  1F5A A;  2I0X A;  1RHR B;  1LKZ A;  1SB6 A;  4LUB A;  3CMQ A;  3KJV B;  4Y2K A;  5D78 A;  4Q43 A;  4BBY A;  2HK2 A;  1VQN S;  3BO4 A;  3S8S A;  5HK4 A;  1HWU A;  1AW0 A;  1BGX T;  4FYY B;  1JNZ B;  2VG6 A;  2X3D A;  3Q24 A;  4Y34 A;  3FZ2 A;  2DXF A;  3FFI B;  3D28 A;  2FHK A;  2D3U A;  2EFP A;  3SV4 A;  3KJQ B;  2MQ8 A;  1LOU A;  3MMB B;  4KV8 B;  3VAL A;  4TU7 A;  4J9O A;  3QT8 A;  3D4J A;  2P2C B;  5HMY A;  3PVX A;  2IVF B;  1YRT A;  4DV7 J;  2C22 A;  1TEL A;  6FDR A;  2DNQ A;  3T9Z A;  1KBR A;  5DDO C;  3G8Q A;  4NYP A;  1T7P A;  1XN9 A;  1VIS A;  3MM6 A;  3CD7 A;  3ZZ0 A;  4NLW A;  1CPZ A;  1S7I A;  1OWX A;  4GKJ F;  1JLG A;  1KQK A;  3ETM A;  2BW2 A;  2OPP B;  4CCH A;  4ZLL A;  2V8V A;  4R5P A;  4DSJ A;  1VFJ A;  3BPD A;  2RHQ B;  2G13 A;  1YJU A;  5LSL A;  4F36 A;  2J7K A;  4PR6 A;  1QM9 A;  1UJ5 A;  4X84 A;  8RUC A;  1UW4 A;  1UVN A;  2XY7 A;  2MLX A;  3ITH A;  2UXD F;  4PWU A;  2AD9 A;  2MZQ A;  3OFF A;  2R7X A;  1VGY A;  3KKF A;  2VJU A;  2BE9 B;  2L41 A;  3H90 A;  3NGK A;  4ECU A;  3MR6 A;  2HQF A;  1HNZ F;  3NCP A;  5J2P A;  1U2R A;  3FBB A;  2P9C A;  1VK8 A;  1WWH A;  4YDD B;  3OR1 B;  1YWX A;  2R7V A;  3W5X A;  2R7U A;  2R7Q A;  1S99 A;  1VQ9 S;  5F8N A;  2K2P A;  4WFY A;  3V6K A;  2F5G A;  4DPY A;  3R5J B;  3JSY A;  1OSD A;  2OEM A;  2FVQ A;  1BXN A;  2XO6 A;  5K8O A;  3I6P A;  2KFZ A;  4C2M A;  1TL7 B;  4USK A;  5DLF A;  1IKW B;  1Q8K A;  4DDF A;  1IM4 A;  3MAA A;  2RKI A;  1RWP B;  4EBC A;  2HGM A;  5THW A;  3TJA A;  1HQE B;  2G9O A;  1S1T A;  4F2S A;  4DQS A;  3T5J A;  2VPZ B;  1FTC A;  3HFZ B;  4BWJ A;  1WSR A;  2LEC A;  1GT8 A;  4DQP A;  4ZVG A;  2IDE A;  4NML A;  1GXT A;  1T9Y A;  1FEE A;  3BKF A;  4CM2 A;  4O4R A;  3MUT P;  1X5O A;  2FVC A;  1XK8 A;  4PYA A;  2IBO A;  2RIL A;  2HGL A;  2HHX A;  3IXQ A;  1FD2 A;  2XBP A;  5EWE A;  2DNH A;  4EGL A;  3VAF A;  2EFG A;  5KT2 A;  4ELV A;  3VQT A;  1R43 A;  1HW9 A;  5HLF A;  2I5J A;  1ZOT A;  4MYT A;  3HHL B;  1E6V B;  3CF5 Q;  4C4W A;  2VC0 A;  1T3O A;  3OPK A;  1B99 A;  1TL5 A;  4OZJ A;  4Q0B A;  5I4M A;  2YY3 A;  5C42 A;  1FXR A;  3O3L A;  3S6E A;  2PEH A;  2JEI A;  2YWE A;  3WDO A;  3FDS A;  5H9F J;  1AA1 B;  1HBM A;  4ZPB A;  1T9X A;  1RBA A;  2RQK A;  4U96 A;  5FLX U;  1H72 C;  5F8L A;  4LF9 J;  1LW2 A;  3LW5 C;  1MRO B;  3KDO A;  2XYP B;  2H65 B;  4WU3 A;  2J9E A;  2NS1 B;  2E9R X;  3O6Q A;  5CZX A;  4ZVT B;  4PG5 A;  5A6W A;  4IO9 Q;  2W9C B;  1ZTW A;  2WOM A;  5BYR A;  5C25 A;  1NB2 A;  4MFB B;  4DU7 A;  1D8Z A;  2QYG A;  2W2Q P;  2ASY A;  2H4W B;  4AL7 A;  1S57 A;  1V5I B;  1NKE A;  1CEZ A;  3FBC A;  5JVG Q;  3T3F A;  3RYL A;  2AEM A;  3BSC A;  3M6U A;  1RA6 A;  2LA6 A;  3Q8U A;  1VQ6 S;  3SEO A;  4IFY A;  2FGO A;  3DHX A;  3UD4 P;  4UQT A;  4CLP A;  3MMC A;  3JB9 k;  3HMJ G;  4B3T F;  4K50 A;  3FVY A;  4JUZ A;  1SXL A;  4DR6 F;  1U49 A;  2XMV A;  3NCR A;  4J9L A;  4YY3 J;  2ZHO A;  4O3N A;  1O6X A;  2PO4 A;  2I9S A;  3US5 A;  4ZVQ B;  5KT5 A;  3I4H X;  1UCN A;  3CIM A;  4B3R J;  2QLF B;  3TWZ A;  4K4T A;  4I68 A;  1HD0 A;  4JI1 F;  5AJ3 J;  2LVW A;  1WTB A;  2ZOM A;  1SKR A;  1S9E A;  4DUZ J;  1SJ3 P;  4B9V A;  2KM8 B;  4N5S A;  2MKI A;  1XMO J;  3M8Q A;  1FD8 A;  2FJA B;  3V81 B;  1Q7Y T;  2HVI A;  4NXN F;  4ICL B;  2ZH6 A;  1SUQ B;  2R8G A;  5J2N B;  1X4C A;  1RDR A;  1U1L A;  1S12 A;  3DOM A;  4ZVP B;  3LP2 A;  3VGV A;  3KK1 B;  2BE2 B;  4M63 A;  1PJ5 A;  2DHS A;  4ZLP A;  2G2Z A;  1VDH A;  2DIT A;  4C3M A;  2W9A A;  5A8W A;  4DL3 A;  5E3A A;  1F0X A;  1CG2 A;  2WRM A;  4FF1 A;  2KHD A;  2K3I A;  4YDX A;  4JBC A;  4DHV A;  1FRK A;  4YB6 A;  2C3O A;  2DHX A;  3HO1 A;  1FJC A;  1R89 A;  1U1M A;  4YP3 A;  3RTV A;  4A8Q A;  3WQP A;  2DGX A;  2CAD A;  2NSB A;  2HAI A;  1PAE X;  3K7R A;  1KP6 A;  1UL3 A;  3FQK A;  3OHA A;  3KLE B;  2R7R A;  3OR2 B;  3FGV A;  4CYU B;  3TUZ C;  1RHJ B;  3G8S A;  3DNC A;  4DPO A;  5EGY A;  1C0T A;  2ZD1 A;  2E7V A;  1HI8 A;  3MEE B;  2VFR A;  2YNG A;  3WZ0 A;  4PUO B;  5KT6 A;  2QSW A;  3OLB A;  1REV A;  5L46 A;  5CXT A;  3GIK A;  2HHS A;  2W9B B;  4KHP J;  1DY3 A;  1AYE A;  1RAH B;  3QRQ A;  1VRU A;  2GVZ A;  3HHE A;  1TFW A;  1A6L A;  4WK3 A;  2C1E B;  1RAD B;  3R5G A;  5IOL A;  3K8W A;  1FA0 A;  4H4K C;  5F9N A;  3UI3 A;  3GR0 A;  2C28 A;  4BC9 A;  3H8Y A;  1FEH A;  4DV7 F;  1Y3J A;  2PII A;  1IWG A;  3ZTQ A;  4PAA A;  2DR8 A;  2R7S A;  4ZS6 A;  2NPI A;  1U0H B;  2EFO A;  3W61 A;  1IWA A;  3DXS X;  3H40 A;  1P6T A;  4DPU A;  1KTV A;  1S1V B;  3I5C A;  5DG7 A;  1F6T A;  2QRR A;  2IMW P;  3KNG A;  5F3Z A;  4FF2 A;  4U9R A;  3NWR A;  1S0V A;  4KAI A;  2HFN A;  4OIX A;  4CI0 B;  3HHL C;  4YFU A;  2A2D A;  2EBE A;  1U6F A;  1HBU A;  2D3O 1;  5IC4 B;  1CC7 A;  1WJ9 A;  2BX6 A;  1SJ1 A;  5HP1 B;  2CPX A;  1U1Q A;  3D9B A;  1NJZ A;  2F8H A;  3S7R A;  1F3F A;  4J91 A;  3OHB A;  2ZNY A;  3EDR B;  3IR7 B;  3CJ4 A;  1RAJ A;  1NAQ A;  2W2N P;  8AT1 B;  2ZOF A;  1WOO A;  4ZMM A;  4NLQ A;  3UCZ P;  2CQC A;  1HWI A;  2XSJ A;  3DXB A;  4RLE A;  3EVM A;  4M5N A;  2B9X A;  3P3D A;  4K4U A;  1KDN A;  2L3M A;  2FGC A;  4DL2 A;  2M52 A;  2YQ0 A;  5LJ3 Y;  3MED B;  1CS4 B;  1X4A A;  3KUH A;  4ZVE A;  1RWM B;  2DKO B;  2OEL A;  3Q2S C;  4NRU A;  1LWX A;  3R5A A;  1P9Y A;  2YBV A;  3PRB A;  1HNW J;  1ZAV A;  3KDN A;  1MU2 B;  4ZPW R;  3MXH P;  2ZDO A;  1S6U A;  3BGR B;  3QZ8 A;  4TY8 A;  3H4B A;  3MR5 A;  3DOL A;  3D66 A;  2CPE A;  4D3H A;  1YQH A;  2VC1 A;  2WVB A;  2A3J A;  4NYO A;  4FXW A;  2CJX B;  1JKH A;  5E7O B;  3H20 A;  2J5A A;  3G4S S;  4NE9 C;  4UOF A;  3C16 A;  2PGC A;  3BJY A;  1PYT A;  3KK2 A;  1PAU B;  1B64 A;  3NOC A;  1WNE A;  3DRS B;  4M5D B;  1MWZ A;  2DR7 A;  1H7W A;  2ZVI A;  5D3G B;  1IVZ A;  3HDS A;  3R2D J;  3R2C J;  3HT3 A;  4KO0 B;  2NUH A;  3FEZ A;  3QFW A;  1VLY A;  3HI9 A;  2KM8 C;  2M7S A;  4BCA A;  1RBO B;  2DHA A;  2U2F A;  3M2R A;  3E01 B;  4LF9 F;  2VDI A;  3S01 A;  1KS2 A;  1WC6 A;  5B09 A;  2FJB B;  4OLP A;  3UCU P;  4DX5 A;  2AJ1 A;  1OIA A;  2YH1 A;  2H1Y A;  2WB1 D;  3IRX A;  3JYT B;  1FKO A;  4ENO A;  3IWN C;  3CT9 A;  4X64 J;  4DPW A;  2HRU A;  3POT B;  1T9W A;  5MAO A;  1HNV B;  2JEG A;  4ZVH A;  4XO0 A;  3RRG A;  2ALZ A;  2CAJ A;  4NLS A;  3G9C A;  3IC1 A;  4A8F A;  2YWF A;  2WVC A;  1QLN A;  4J9V A;  4NXM J;  3KG1 A;  1XMQ J;  4RPF A;  5LSO A;  1LK7 A;  3P4U B;  2X1B A;  1RLD A;  3EDQ B;  2H5I B;  1S7H A;  3SYZ A;  1HWL A;  2HBZ B;  1R6Y A;  3T5H A;  1TL1 A;  4NLD A;  2D7S A;  3FZB A;  3C3L A;  1SV5 A;  4OL8 A;  2KVI A;  2RHS B;  2XWX A;  4J9P A;  2HS3 A;  2OIH A;  1K9M T;  2QLB B;  2C2K B;  1CJV B;  2EWH A;  4HYK A;  2E5L J;  4YY3 F;  3GON A;  3PTW A;  4RO0 A;  1FDB A;  2QFJ A;  4OZN A;  3GFH A;  3M7V A;  1ROF A;  1ACM B;  4B3R F;  2RB7 A;  1M1H A;  3ZNU A;  3N79 A;  2VOO A;  1B7Y B;  5AJ3 F;  2B43 A;  3BN4 A;  2RRN A;  4IRK A;  3THV A;  1U1P A;  4AT1 B;  1JXV A;  3QQC D;  3M2U B;  3BB5 A;  1J2V A;  4DUZ F;  1CJT B;  2CJ9 A;  4Q8E A;  5E0O A;  1XMO F;  4WE1 B;  1RTD B;  4DV4 F;  1NHK L;  1K1Q A;  3MCS A;  4I2P B;  3QLH B;  1S72 S;  4KGK A;  5KOW A;  1X0F A;  1Z2L A;  4GC7 A;  4DEZ A;  2AWZ A;  4TNO A;  4ZP9 A;  3KWM A;  1Q79 A;  4WCE Q;  3V2U C;  2YQ1 A;  2BE7 D;  3TX0 A;  4FBT A;  3MEG A;  2VG7 B;  5F0W A;  3HHN B;  1RTJ A;  3RBE A;  5BYS A;  1GX6 A;  3CJ3 A;  1PCA A;  4DL0 C;  2FUG 9;  2C2R A;  2HQG A;  2DR6 A;  1FFG B;  1NU4 A;  1H98 A;  3GV5 B;  1OQ3 A;  4TU9 A;  1C1B B;  1RKJ A;  4LRE A;  3PEJ A;  1N5Y B;  1WC4 A;  2XLI A;  4PQU A;  3N6L A;  2OEK A;  4KTQ A;  3RB4 A;  2DO0 A;  1H74 A;  1NH8 A;  2VHG A;  2IRU A;  4DLE A;  1AUS L;  5HMW A;  4MKA A;  1MWQ A;  2YXL A;  4GRS A;  3LAK A;  4WKY A;  1Y7P A;  2B9W A;  2YNF B;  2KJW A;  5JUM A;  4NLY A;  1UFK A;  2NSC A;  3GSD A;  3C6T B;  1CUL A;  4Q2L A;  3MGJ A;  4ED2 A;  3RBZ A;  4IDK A;  2W2M P;  4KGM A;  4F2R A;  4NAS A;  1FNM A;  4KHP F;  1P27 B;  2KH9 A;  1JLB A;  4QPX A;  4U6P A;  4HDH A;  4RNO A;  2BW7 A;  3CJS A;  4QQB A;  1KOO A;  5F0U A;  1WOP A;  3VGU A;  2KRB A;  1X9M A;  2Q43 A;  1RWX B;  1M5H A;  3C2P A;  2V0N A;  3PY8 A;  4ECW A;  2OHD A;  2GIR A;  5ETS A;  5KFM A;  1ARO P;  3GZ7 A;  3KG4 A;  1DQ9 A;  5IWA F;  3AXK A;  4EWT A;  2MGZ A;  1YJW S;  2HQC A;  1M5K C;  2Z2L A;  4OX6 A;  3EGN A;  2CQ1 A;  2KHC A;  1S77 D;  7FD1 A;  1LQ9 A;  2P5V A;  4CLL A;  1KLM A;  2JWN A;  2J7U A;  4DR7 J;  4LFC J;  2VF3 A;  2ZKT A;  3MM6 B;  4UY8 T;  3QYY A;  2MY8 A;  1JLG B;  3V6J A;  2HK3 A;  3HHD A;  1YJT A;  5EUH A;  2BQ3 A;  4TQS A;  4KB7 A;  3FNN A;  1OSC A;  4QBU A;  4O0N A;  1EHW A;  3D0G E;  1LNQ A;  2HVE A;  4NCG A;  1S9G A;  1EQ0 A;  3BR8 A;  3OVB A;  1WKL A;  4YOE A;  4FNI A;  2F9D A;  2R8K A;  3SZ2 A;  4HR2 A;  3ILJ A;  4HTI A;  3UVJ A;  4K4X A;  2FZC B;  4ES1 A;  2IHR 1;  3ITH B;  1D3W A;  1VJQ A;  3QWU A;  1B0T A;  4ZK7 M;  4LMZ A;  4KPC A;  1RE1 B;  2GIQ A;  4OQJ A;  4Z7Y A;  4ZHR A;  5J2P B;  4A8Y A;  3OL6 A;  1GNK A;  1HNW F;  1BD6 A;  1KFS A;  3BO2 A;  2V50 A;  1R27 B;  2E1M C;  5J1E A;  2A6M A;  2CJY B;  4FYD A;  1S0M A;  4U7U D;  3OXL A;  2AYG A;  3CC4 S;  2OML A;  3AOB A;  4DS5 A;  3IG1 B;  3CDU A;  1WEX A;  2NXE A;  1RI7 A;  4JB8 B;  4WFX A;  4OZ0 A;  1T3N A;  2DO4 A;  1IKX A;  1WEZ A;  5H9E J;  3V4M A;  1D09 B;  1S1T B;  1FKA F;  2J8A A;  3P6Y C;  1EJ7 L;  3MUV P;  4ZVO B;  2IPO B;  1FER A;  4M1K A;  5ETN A;  4DR4 J;  1JQG A;  3A8E A;  3JTP A;  3CME S;  4OHY A;  4O3O A;  4X4N A;  3IA0 A;  2CG4 A;  3GYN A;  4URQ U;  1PIL A;  2B7B B;  1WHV A;  2W25 A;  3PHT A;  1I3O B;  1UVJ A;  3I96 A;  2GVD A;  2B6A A;  4IFV A;  1BQM B;  3P8B B;  1BHN A;  1UP1 A;  2I5J B;  2JLE A;  1MSW D;  1IR1 A;  5DZ7 A;  1YTY A;  1S6O A;  2M2B A;  2ZHB A;  4DSF A;  2KYX A;  4UOH A;  4X64 F;  4QWD A;  4KH1 B;  2OO4 A;  3L7U A;  4Q0B B;  1N5V A;  1W25 A;  2V94 A;  5C42 B;  3P96 A;  4FNH A;  2P9G A;  4RW7 A;  3BN7 A;  1HBM B;  1Y5N B;  4RW4 B;  1JMT A;  1WEY A;  5DQG A;  3IR6 B;  3IN5 A;  2B5J A;  5HQ8 A;  3AA9 A;  4L76 A;  2CPI A;  1XMQ F;  3LPY A;  1BY9 A;  1QSY A;  4HT7 A;  3HKZ D;  4NLP A;  1PC5 A;  3J7Z 5;  4IR9 A;  4C8O A;  4OYZ A;  4Z37 A;  3O5T B;  3QGI A;  2XUL A;  3OFG A;  2CQI A;  4QWE A;  1FO1 A;  4C11 A;  3ZZT A;  1GEH A;  4FYV B;  4K5R A;  2FLN A;  1XTZ A;  3DLE B;  4RNF A;  4FS2 A;  4KY3 A;  2E5L F;  1LK5 A;  3DC2 A;  2RF2 B;  3TRG A;  1TL3 A;  3QGH A;  4I56 A;  1VRT B;  3HSZ A;  2OJ3 A;  4OYP A;  2B8Q A;  1RA7 A;  1RSC A;  2JOQ A;  4F7V A;  3HKW A;  1W2B R;  3WX8 A;  4IG3 B;  2VV5 A;  1WF1 A;  1NXI A;  3LP1 B;  4U8Y A;  2MKC A;  3MMC B;  3CCZ A;  1V5V A;  2D3Z A;  2NRE A;  2LMI A;  2L9D A;  4ZPD A;  4OJ3 A;  4J90 A;  1K44 A;  3VHQ A;  3A8I A;  1RAC B;  3MI7 X;  3PIO Q;  4OZL A;  1NSA A;  4AFF A;  1C1C A;  2ZKU A;  4AXI A;  4USJ C;  2MTL A;  5B0G A;  2OPR B;  2BBE A;  1VS3 A;  2UVW A;  4KJI A;  2AZ1 A;  1RT4 A;  1Y9O A;  4CLS A;  2DGV A;  3MDF A;  1X60 A;  1HI1 A;  2UVV A;  2OKQ A;  2VJV A;  2CQ2 A;  2EXU A;  3M8Q B;  3AOD A;  3HVA A;  3P5B P;  3D2W A;  5HRO A;  2AJF E;  4Y2A A;  3LQV A;  3KNA A;  3WBZ A;  5F8J A;  2AJ2 A;  3NY0 A;  4M5I A;  3DOM B;  2DNP A;  1YZ6 A;  3Q0A A;  2XY6 A;  5KG5 A;  1S59 A;  2QFI A;  4F4A A;  4IR1 A;  4O23 A;  4N77 A;  2V4J A;  3FCV A;  1UZD A;  2HBY B;  4Q7A A;  3KJN B;  2M8D B;  4CM0 A;  4FXV A;  1S9F A;  2XHW A;  1X4E A;  2IMO A;  3H0P A;  1H2T Z;  4M5M A;  3MM9 A;  3X3U A;  2DGU A;  3HLU A;  1PSD A;  2EK1 A;  2BDP A;  4JYA J;  4D3G A;  4PG4 A;  1VC5 A;  2M0G B;  1VI7 A;  4G1Q A;  4K2J A;  2OAU A;  2KFY A;  1S6Q B;  3UWT A;  4U8V A;  5HQM A;  1FTR A;  5L38 A;  2RQM A;  2APO A;  3DYA A;  4PAB A;  5KFE A;  4M5G A;  1OJ4 A;  3EYZ A;  3OTO J;  1EQM A;  2XMK A;  3DHW C;  5CYM A;  2KT2 A;  4L74 A;  1REV B;  3HP6 A;  3IGV A;  1OPZ A;  4YR2 A;  3G87 A;  1VRU B;  1R31 A;  4B9S A;  3M32 B;  1NPK A;  1W7W A;  3KLF B;  2EBG A;  2QGF B;  1S76 D;  2J76 E;  1NK7 A;  2MKY A;  4F3O A;  2QIF A;  1TMJ A;  3GU0 A;  4C8L A;  4ZJO A;  4JI3 J;  4DLG A;  3LAN A;  1GH8 A;  4C8K A;  3HM9 A;  4DR7 F;  4UF4 A;  4LFC F;  1KQG B;  1VQ5 S;  4UOC A;  3GJR B;  4Q8F A;  2E5J A;  3DDI A;  2YKO A;  1C0U A;  2CNO B;  1B70 B;  1OY9 A;  2K8G A;  3MMA A;  2YWH A;  2OLW A;  4ZIV A;  2JEJ A;  2KU7 A;  2NZC A;  2OD4 A;  4FF3 A;  4JV0 A;  3D5M A;  3BQ0 A;  2HVD A;  4F04 B;  1BQN A;  2H4Y B;  2Y1I A;  3KLH A;  4UW2 A;  2V2Z A;  2B8P A;  3RUB L;  4Z2X A;  3VGS A;  4R0E A;  2PEB A;  5KTQ A;  1YIT S;  2BKO A;  3DM2 A;  4DCO B;  4BS2 A;  1F3V A;  3EJM A;  5DDR C;  5LSR A;  3DRR A;  1RHK B;  3HSD A;  2BMB A;  1RIS A;  2HQI A;  3H5Y A;  4DZ6 A;  4JOU A;  1B7F A;  3TYT A;  4PG7 A;  4NLO A;  1KVK A;  2KXN B;  2HBQ B;  2XSJ B;  1T9V A;  3MPY A;  2LEP A;  4I67 A;  1JXE A;  5AE1 A;  2N7C A;  3FUY A;  1U1K A;  4I1T A;  4ES3 A;  3K58 A;  1EP4 B;  4DF8 A;  2DNY A;  4JI4 J;  1JJH A;  3T5K A;  1SC6 A;  3GYG A;  4ZP6 A;  1FFW B;  3FC9 A;  3I0S B;  2MXY A;  4PXE A;  3AXM A;  2GCF A;  5ETQ A;  5EWG A;  2L9W A;  3CD5 A;  5KFY A;  4P72 A;  5AT1 B;  4AUK A;  2ADB A;  4DR4 F;  4MK7 A;  4FKY A;  4W4M A;  3UDV A;  4ZJL A;  3GWC A;  5G0R A;  2XTJ P;  3SSR A;  4TY8 B;  2O5D A;  4CRJ A;  3Q8Y A;  1F5B A;  4P73 A;  3DOL B;  1JX4 A;  4N8O A;  1WHX A;  1LW0 B;  4IH5 A;  3NEK A;  4QIV A;  2JC1 A;  2HAF A;  4GO7 X;  3CWJ A;  3CB4 A;  4J9R A;  5KFK A;  3DI6 B;  5CQG A;  4B17 A;  3R1L A;  1TL4 A;  3PAC A;  1JKH B;  5B08 A;  3A3N B;  1OS5 A;  2BJ9 A;  4DV6 J;  4ED7 A;  3DLL Q;  2R3V A;  3EMT A;  1AUD A;  4DV0 J;  4CLW A;  3OTD A;  4BWM A;  3CMA S;  1RB0 A;  3C16 B;  5ETP A;  4DX6 A;  1H73 A;  4Y2C A;  3BEG B;  3KK2 B;  1YJV A;  2VG5 B;  2Y8Y A;  3DKD A;  4X4P A;  1QUV A;  3DGP B;  4DCP B;  3QSI A;  3N4W A;  4LR9 A;  4O3Q A;  1I5O B;  5A2Q Y;  2IYG A;  1JJC B;  2B4V A;  2QL9 B;  1Y3K A;  4M5H A;  1FVS A;  3SMZ A;  3B78 A;  1KKH A;  3GSI A;  3M2R B;  1U09 A;  2LLZ A;  2DRD A;  1XR7 A;  3TP2 A;  2AX1 A;  3GJT B;  1UA1 A;  4O4G A;  2GIF A;  1GMW D;  4DMZ A;  1FKO B;  4HVZ A;  3NG8 A;  3TEG A;  4C97 A;  4ZJQ A;  1MNE A;  2ZM6 J;  2KT3 A;  4DR1 J;  4LJM A;  2HND B;  1KRP A;  1VQK S;  1WG5 A;  2ZWP A;  2VPW B;  2FYX A;  1M5S A;  5HAO A;  1NDP A;  3ZZO A;  1FRI A;  3KHG A;  1HBN B;  2GW8 A;  1IKV B;  4WXW A;  1R7I A;  2ZH4 A;  2E66 A;  2BR0 A;  2QA4 G;  1QUP A;  3M1V B;  4EO6 A;  1FJ7 A;  3MM7 A;  2HIY A;  4OHZ A;  2MQP A;  3DRY A;  5D4P A;  1TL1 B;  2ZHA A;  1ZET A;  2AW0 A;  4KKO A;  1SV5 B;  4NCB A;  2E1A A;  3OFE A;  2LDY A;  1FHT A;  1YBT A;  3QJP A;  2XO7 A;  2ZH9 A;  2Q6B A;  3Q23 A;  2GS8 A;  1YBA A;  4QIW D;  1TR0 A;  5IS2 A;  1IM6 A;  5GAE I;  5D6G A;  1LWF A;  3CO9 A;  2J0S D;  2K3K A;  1R0C B;  2HFU A;  4ECY A;  2L9N A;  1UEU A;  4DUY J;  1N48 A;  2HRT A;  1YKW A;  2WB4 A;  5K5M A;  1NK0 A;  2FJD B;  3PYF A;  2Z2Y B;  5HJY A;  1UWB A;  4OYI A;  1TUG B;  4EEY A;  5GAE U;  4F50 A;  4WYW A;  4LF7 J;  2YKA A;  4L75 A;  3DCA A;  1QVF R;  2MZS A;  2G1D A;  3J7Y I;  2B9E A;  2HHH J;  3Q2T C;  1KFD A;  1TAU A;  5EDW A;  3FRY A;  1H0H B;  2QMU B;  4ZIT A;  2X1F A;  1HQ2 A;  2HLT A;  3SQG B;  3LGH A;  2DJW A;  2YX4 A;  4PPZ A;  2QYC A;  2LKZ A;  3N6M A;  3PV8 A;  2FY8 A;  3E2E A;  2F3J A;  1Y10 A;  4RU9 A;  3UN5 A;  3MUR P;  5T7L B;  1T05 A;  3C66 A;  4AD6 A;  2JC0 A;  4DI6 A;  1ZAX A;  3L7P A;  4DV3 J;  2AF6 A;  2XLK A;  5B0E A;  4URS A;  2WHO A;  1RT7 A;  3QIP B;  1LXN A;  4CWB A;  1F2H A;  3LP0 B;  4QW9 A;  2XYH B;  2UUA J;  2DNR A;  4C8Z A;  4JYA F;  3M8Y A;  3TO8 A;  2PD1 A;  4V19 X;  3ZZU A;  2UU9 J;  2UV8 A;  4YR3 A;  2A10 A;  4K0K J;  4O0I A;  1HWJ A;  4PG6 A;  2HS0 A;  4G1I A;  2XQC A;  4A46 A;  3J80 U;  4K7Q A;  2BRL A;  3W9J A;  4C0B A;  5DM7 Q;  3GCX P;  3LAM A;  2CPD A;  4DX7 A;  5CH7 B;  3BGF A;  4N47 A;  4X66 J;  4NX9 A;  4RW8 B;  3OTO F;  1G7C B;  2LQJ A;  1U1O A;  2DT9 A;  3ZZR A;  2OD6 A;  3OUY A;  3DLG B;  2KT5 A;  2Z30 B;  4F8R A;  1S4E A;  2H9Z A;  3MAQ A;  3DGV A;  3JS9 A;  4ED6 A;  1HA1 A;  2D69 A;  2ZUG A;  1NM2 A;  3OD2 A;  5IM0 A;  2ZJP Q;  2R7W A;  2IAJ A;  4P9S A;  3A12 A;  3AJ2 A;  5E3Q A;  3CCV S;  2DXE A;  4JI3 F;  1TV6 A;  4RW6 A;  1SQG A;  3SXL A;  4HTJ A;  4TXS A;  3SFG A;  2DGQ A;  2HNZ A;  2A2C A;  2DH9 A;  3I0R A;  5C2G A;  3V6D A;  4KGX B;  1FF2 A;  1DFD A;  2PMH A;  4LSN B;  1RAG B;  2GV1 A;  2CQ3 A;  4CH7 A;  2W24 A;  2HYI B;  5BYQ A;  2HPU A;  4PWD A;  3O2I A;  3ZO7 A;  3ZZP A;  2IM0 A;  3AAW B;  1CBK A;  1WSV A;  3KLI B;  2Z2Z A;  2Z2M A;  3B4D A;  2HIQ A;  2Z56 B;  7FDR A;  4OZ2 A;  2J6S A;  2BJ1 A;  2KO1 A;  4AYB D;  4RW9 A;  1N5S A;  2XB2 D;  3I56 S;  2J8S A;  2XYG B;  1C2P A;  2HFO A;  1B0P A;  4EBD A;  3UQS A;  4NCG B;  4DR3 F;  4USW A;  3QAE A;  3AOA A;  4LSL A;  3WIV A;  1S1W A;  3JQM A;  4EU0 A;  5ITH A;  3KOA A;  2B0G A;  4OYO A;  2E5I A;  1S1X A;  1A9N B;  4YQW A;  2AJ4 A;  2E7X A;  2W01 A;  1TKX A;  4UUX A;  4JI4 F;  1JB0 C;  4CT9 A;  4RU2 A;  3ENQ A;  2KZZ A;  5HVH A;  1RAA B;  1M5V C;  1R6V A;  1OY6 A;  3Q8S B;  2VBW A;  4FN5 A;  4ZHR B;  2WK4 A;  4ECX A;  4J9U E;  2JFK A;  2CYY A;  1RU2 A;  1DAX A;  4DQI A;  1IR0 A;  3RBD A;  2LEA A;  2V8D A;  2VB6 A;  1L3T A;  2DCL A;  4DPX A;  5DET A;  3H7H B;  3FCW A;  3TAM A;  3C46 A;  1RKI A;  2YWK A;  1TAQ A;  3DOK A;  5KG6 A;  4CNZ A;  4MH8 A;  5E3C A;  4U7C A;  1IKX B;  1XNR J;  2LXF A;  2I2Y A;  3SSQ A;  1EKR A;  3KK3 A;  4ZCK A;  2DRB A;  1APS A;  2KB2 A;  3EVO A;  2H51 B;  5KFQ A;  1TKD A;  3ICL A;  1NJX A;  2FB0 A;  4DV0 F;  2VA2 A;  4JV1 A;  1RYR A;  1L3S A;  2W8L A;  2CA9 A;  1OQ6 A;  4QR0 A;  3ZZZ A;  2W8K A;  3TEH B;  3VAK A;  2VD3 A;  2CG8 A;  2GO9 A;  5FLX Y;  2VUG A;  1HBO A;  2FZG B;  1XWL A;  4I64 A;  2ZC3 A;  3IS9 A;  3TI0 A;  2GVD B;  3L7O A;  1YJ9 S;  4CH1 A;  4IFV B;  4LIW A;  2MHE A;  1DBD A;  1SIW B;  1SJF A;  1O8B A;  5A8K A;  3LGN A;  1HMV A;  2BUN A;  5GAH U;  3BYP A;  2CFX A;  3PFO A;  3DU6 A;  5FD1 A;  2QMW A;  2WVF A;  4HAC A;  3D6F B;  1E6Y A;  4ED3 A;  3OJS A;  4PG8 A;  5CD4 H;  2ZM6 F;  1OO0 B;  4RW7 B;  3GMG A;  2IIH A;  2PA3 A;  4GMK A;  4DR1 F;  1EIY B;  2HS4 A;  1RT5 A;  3CDB A;  3AH6 A;  5HQL A;  3CVK A;  3K89 A;  4UUW A;  3CJ0 A;  3R7B B;  3H2V E;  1Q5V A;  3AQO A;  2HSE B;  4I6W A;  4NLT A;  3VR1 A;  1GTE A;  2R7T A;  4E8U A;  3SCL E;  1S0N A;  2XCP A;  2XS7 A;  2AZ3 A;  1VQ4 S;  2RDD A;  3PYG A;  1U1R A;  4P2F A;  2GAG C;  1NSK L;  4C11 B;  4Y0F A;  1EB0 A;  2DB1 A;  2K1R B;  5CD4 A;  5CYJ A;  1XNQ J;  4Y3C A;  4DL4 A;  1YVF A;  1NBE B;  4RUA A;  1SC1 B;  4ZKA A;  1BUX A;  1UWA A;  1TL3 B;  5CAB A;  1WDD A;  3NL0 A;  1NME B;  1YJ7 A;  1VK3 A;  2EG2 A;  2AYM A;  2M70 A;  2GC8 A;  3C6U A;  2G4B A;  4C48 A;  1G1X A;  4DUY F;  2XZT B;  5ADZ A;  5IV3 A;  3CTR A;  5DO2 A;  2PI5 A;  2VZ9 A;  2DGO A;  3JSR A;  4WP3 A;  1ZZN A;  5GVQ A;  3JSM A;  4LF7 F;  1IN0 A;  1HNI A;  2MKK A;  2ZFH A;  4TN2 A;  2HHH F;  1R0A A;  3WX4 A;  1C1C B;  4KBI A;  3QRR A;  1MN7 A;  4LF8 J;  5D77 A;  7AT1 B;  1N5Q A;  1R8B A;  2AGQ A;  4JI7 J;  5SZT A;  5KFC A;  3UDL A;  1QJH A;  4LF2 A;  1RT4 B;  3NOG A;  3M8P B;  1RT2 B;  2Z4P A;  5GAD I;  2VBY A;  3FBF A;  1WI6 A;  2DIU A;  2UP1 A;  4UQG A;  2C2E A;  1XR6 A;  4DV3 F;  1SJR A;  4TYA A;  4Q44 A;  3V5R A;  3FFI A;  3HFK A;  3EGZ A;  5HRO B;  1IBL J;  5ETK A;  2HQD A;  4JI6 J;  4HI1 A;  2UUA F;  4E98 A;  4KV8 A;  4NYZ A;  4YUD A;  5D4L A;  1DTT B;  3T41 A;  4OYW A;  1FK9 A;  1Y5L B;  2V4Q A;  2W4C A;  2UU9 F;  2GMJ A;  4K0K F;  2V4J B;  2ZBI A;  4B9M A;  1ELO A;  3JAM U;  4YHH J;  5K8P A;  1J5O A;  1HR0 J;  1RWO B;  1RTI A;  1X0P A;  3CDE A;  4X66 F;  3OFH A;  3Q8V A;  5C24 A;  3CPW R;  2PE8 A;  3MM9 B;  4DUT A;  3J7Z T;  3JQK A;  1VQY A;  3PNI A;  3LAL A;  2IA0 A;  4DS4 A;  3HZG A;  4L73 A;  3IAS 9;  1U6B A;  3HF5 A;  4G1Q B;  1HLW A;  2YTC A;  3PZP A;  3IMQ J;  3OVS A;  3BQ2 A;  4GO5 X;  3NGS A;  2HFV A;  2L48 A;  3BDE A;  2DRA A;  3CNQ P;  1AFI A;  1BC6 A;  2CQB A;  4CO1 A;  1HW8 A;  3CCJ S;  4ELU A;  2DNK A;  2HHT A;  2GHW A;  4I7F A;  3OTB A;  2QL5 B;  3G2X A;  1JLQ B;  5CYM B;  5CCM A;  1UVM A;  3NMA A;  2FLL A;  2H48 B;  1AB8 A;  1FRX A;  1VYA A;  2YX1 A;  2V8P A;  2ZBR A;  3G6V A;  3ZTR A;  2W7A A;  2GGP A;  5KFB A;  4NZ6 A;  3OR1 A;  2CRL A;  3PKY A;  3AJD A;  2V68 A;  3EPI A;  5DJB A;  1DUR A;  1VBY A;  1M1G A;  2QC3 A;  3CDA A;  4KFB B;  1ZM3 A;  3M8R A;  3H2U B;  1LWE A;  2OPQ B;  1TL7 A;  1WF0 A;  1IKW A;  3PO4 A;  5LMU J;  4J9K A;  2R2T A; 
#chains in the Genus database with same CATH homology
 3GCX P;  3QFH A;  4K8R A;  2Z57 B;  1SPB P;  2E1P A;  2W2Q P;  3WIV A;  1ITP A;  3CO0 P;  2Z30 B;  2XTJ P;  3BPS P;  3H42 A;  2ZWP A;  1V5I B;  3T41 A;  3VV2 B;  3P5B P;  4OV6 A;  3WHI A;  2W2P P;  1R6V A;  3VHQ A;  3BGO P;  2W2N P;  3A3N B;  2Z58 B;  4NMX A;  3WIU A;  3GCW P;  2Z2Z A;  2PMW A;  2Z2Y B;  3AFG A;  2W2O P;  4JP8 A;  2Z56 B;  3SQO P;  2ZWO A;  2QTW A;  4NE9 C;  2W2M P;  3A3P B;  3CNQ P;  1SCJ B;  4YN3 B;  3A3O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...