2QU5A

Crystal structure of the vegfr2 kinase domain in complex with a benzimidazole inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
305
structure length
292
Chain Sequence
HAERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLADARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design, Synthesis, and Evaluation of Orally Active Benzimidazoles and Benzoxazoles as Vascular Endothelial Growth Factor-2 Receptor Tyrosine Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Vascular endothelial growth factor receptor 2
total genus 94
structure length 292
sequence length 305
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qu5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qu5A01
2G2IA 5ETCA 1YWVA 3E3BX 4G9CA 2C6LA 1ZWSA 3K3JA 1GOLA 3DPKA 1JKKA 3MIAA 3UOHA 2I7QA 3FLNC 2O0UA 4DGNA 3FE3A 3E8EA 3UZRA 2QOQA 2CGUA 2QOLA 3C5UA 3KKVA 4LV5A 4M67A 3DK7A 4KWPA 1Q97A 5A46A 4CKRA 1OPKA 4FZ7A 4EI4A 4BDAA 3A7JA 4FIFA 4FIHA 4WO5A 3IDPA 4YTFA 3BKBA 3FJQE 5FEQA 3UBDA 4U80A 2XH5A 4GG5A 5C9CA 3F2RA 3DZOA 1SVEA 2QG5A 4OLIA 2RIOA 4D4YA 4RIWA 3QHWA 2Z7QA 3RM7A 4E7WA 2IVTA 2F4JA 4J98A 2DUVA 4L9IA 3ZRKA 2X6EA 4EEVA 3D7ZA 4GG7A 4U45A 5EW3A 2VTQA 3G51A 4J97A 2VX0A 3KY2A 2ITPA 5FEEA 4R77A 2FSLX 1G8AA 3P86A 4KNBA 3PY3A 3W2QA 2XJ2A 3CY3A 4JXFA 5H9BA 1O6KA 3DAKA 5AP2A 4EUTA 4DH5A 2P2HA 3Q32A 5KHXA 2GNJA 3LE6A 4WA9A 4ZMFA 4AF3A 1U59A 4Q9ZA 4O7YA 3PWYA 4C7TA 3K5VA 3PG1A 1ZLTA 3PSCA 4JDKA 4MQ2A 3AOXA 3LFAA 3BU3A 3DKGA 3PG3A 4ARKA 2RL5A 3POZA 5EYCA 4AZEA 4IHPA 2ETMA 4M97A 5HO7A 4NYEA 4ZP5A 3VS1A 4PL5A 3MSSA 1FOTA 2B7AA 5AMNA 4I6BA 3CTQA 2BFXA 3G33A 4QNAA 4R1YA 3OHTA 3PJ2A 5BVFA 2OZOA 4RQVA 2WMWA 4UXQA 4C2WA 4C58A 2WOUA 2WTJA 3HP5A 5AFVA 4JRNA 1RQQA 3QQHA 4J1RA 3IECA 3DGKA 5CI6A 3ORKA 2BRNA 2AYPA 1XWSA 2IN6A 2JGZA 3QRUA 3CS9A 4HNIA 4NT4A 4O81A 2QOIA 4MNEA 1SNXA 3SV0A 3MTLA 1JVPP 4OBOA 2HZ0A 3QQFA 2YJSA 3R1SA 4MCVA 2VAGA 4A9RA 3QU0A 2PE1A 5B2LA 2CCHA 5AA9A 1TVOA 2PVNA 3ZFXA 3S0OA 1SVGA 3IK3A 4ACHA 1A9UA 2O63A 1S9JA 4IWOA 4YC6A 2PK9A 3DCVA 3RINA 4EONA 4DTBA 3IW7A 4AA0A 5J87A 2XNEA 3NUYA 2R3MA 2H34A 3AC4A 4IADA 3CXWA 3KFAA 1PJKA 4GYIA 3GC9A 4FKIA 4L45A 1OL2A 4QP3A 2UZEA 4U3ZA 2RSVA 1YWNA 2EXEA 5HX8A 4BGHA 5H2UA 4FG9A 2IZRA 1H28A 5CY3A 5CAVA 3R22A 5IISA 5CEMA 4RA4A 5C4LA 2W1DA 3C4CA 2ERKA 3W2CA 3KN6A 2ZDUA 3D94A 3FZTA 4G2FA 4DGOA 1J3HA 1XO2B 4FGRA 1IAHA 4UX9A 3SXSA 4W4WA 4E5BA 4G34A 4UWBA 5CF4A 2XKFA 5EYMA 3P9JA 1PMEA 2G2FA 4CFXA 3NMUF 5EYKA 2X4ZA 2PVJA 1ZY5A 3CD8A 3BWFA 5J95A 4MKCA 4F63A 3ANRA 1VZOA 4JLCA 4V05A 4ZZOA 4OT6A 3TEIA 4UZHA 2R3LA 4YBKA 4A4OA 5HKMA 3ZHPC 3DS6A 4I20A 5BYZA 5L4QA 2IO6A 4UEUA 2VN9A 5AAGA 4H1JA 4IW0A 1YW2A 2UZLA 5GZ9A 4APPA 4LMUA 2BHEA 4FZFB 4HVHA 3PIYA 2C0TA 2R5TA 4C4GA 5TE0A 1KWPA 2UW4A 4RG0A 2X1NA 3ID6C 2R3NA 5DG5A 2WMQA 4FTQA 3RCJA 4NM3A 3MH3A 4FV7A 3NNWA 1XH5A 3OBJA 4NIFB 4R3PA 4BCMA 2R3IA 5ANKA 4C3FA 3E7VA 4LYNA 4P7EA 3DQXA 2UUEA 5IA0A 4EYMA 3C0HA 2Q0NA 4O7NA 4D2TA 3KXGA 2W7XA 1XH6A 5JN2A 5AUZA 3O17A 4RC3A 5B2KA 2C3JA 4U42A 4KS7A 4Z3VA 1GIHA 3LLTA 4ZEGA 4AP7A 1OKWA 3UQFA 4IQ6A 2PTKA 3C4FA 3NYXA 5BYLA 5HNIX 4TT7A 4LOOA 2NP8A 3NSZA 4XV2A 4GFMA 3PJ1A 4FEUA 4F6SA 4TPTA 3UNZA 4GKHA 4D1SA 2Z2WA 4BZNA 3GNIB 4MXYA 2WEVA 3R30A 1LPUA 4QP9A 4EHGA 4NL0A 3IOKA 3KK9A 4L43A 4BHZA 2YLFA 3LXLA 4WBBB 5A3XA 5K5NA 4MXZA 5EOLA 3WE8A 4LM5A 3RTPA 5L2WA 5FRIA 5I9WA 3G0FA 5IA2A 5DR9A 4XMOA 4D2SA 3EN7A 4R3RA 2ZB0A 4Y8DA 4ZTNA 2DQ7X 4XG8A 5J5SA 4BTJA 2PULA 4BB4A 1J7UA 2ZVAA 3PYYA 5F95A 4XHKB 5BVKA 4DGMA 4MK0A 1ZYLA 3E8CA 4BDIA 2JIIA 4QMZA 4U9AA 4HNFA 4G6OA 3SXFA 5HLPA 3LJ2A 3NW6A 4PP7A 2QOBA 3ORTA 5CAUA 3PJCA 3KC3A 3L9NA 3DFAA 2QO7A 2PSQA 3DAEA 2WMTA 2J7TA 1J7IA 4YJUA 4JQ7A 4EKKA 5BPYA 3I79A 2QHMA 4C2VA 3TTJA 1REJA 2PZIA 4FKOA 2FVDA 4EC9A 3NYNA 1DS5A 2VZ6A 1VEBA 1Q8TA 3BHUA 3MTFA 1OL7A 5M07A 1YHSA 4I6HA 5FDPA 4HGEA 4QMWA 5E7RA 3UNKA 2DYLA 2BROA 5CF6A 2XBAA 1Q41A 4ZS0A 2VX1A 4ANQA 5CQUA 4FNWA 1Q3WA 3LMHA 3RHKA 5BNJA 5EM8A 2QOKA 1KE5A 2WELA 4L6QA 4FE2A 3AMYA 4IC8A 2OZAB 4XOYA 3EB0A 1CKJA 4GIIA 3EN5A 4JI9A 3PVGA 3R1NA 3ZU7A 1Q8YA 1YKRA 4E5AX 3R02A 1EH4A 1F3MC 2HY81 4PX6A 5AR8A 5AUXA 4L01A 2WXVA 2C47A 2OLCA 3W2SA 4MXOA 3L8VA 1PY5A 3ZFMA 3HLLA 3O8PA 4MXAA 3HDMA 5DGZA 5LXMA 5FUTA 4E4MA 2G2HA 4UWCA 4ZTRA 4CFNA 3QZFA 5G1XA 2C6IA 2WFYA 4AU8A 1GY3A 3P0MA 3QA0A 5DLSA 5KMKA 3S1HA 4AOJA 5HNBA 2FSTX 4HCUA 3V3VA 4BDDA 4JDJA 3RHXA 3L8PA 4PTEA 3ZUVA 4QOXA 3F88A 4MX9A 4PUZA 2CN8A 4WSYA 3VW6A 3F69A 5CNOA 3WF7A 2C5XA 3FMNA 1L8TA 4LFIA 4I5CA 5JFXA 5GZAA 3FLYA 4DEGA 2GHLA 3PLSA 3PXYA 4U0IA 3R8PA 4B4LA 1OKYA 3QD0A 5AIKA 4DBNA 3P7CA 5IEVA 4L00A 5KUPA 3UVQA 3CJFA 3QGWA 3SG8A 4M0ZA 4FEXA 2W1IA 4MBIA 1FGKA 2CNQA 3RNIA 4ACGA 4F09A 1OZ1A 2V0DA 1H1QA 4BZDA 4E6CA 4EQCA 3Q2JA 2YIRA 4Y72A 4O2PA 4E6AA 3BU6A 3CC6A 5HVKA 3ZH8A 1Q4LA 2R3HA 4JBVA 3HL7A 3HV7A 3AC3A 3W2OA 2BHHA 3WZEA 4FTLA 2Y6OA 4TYEA 4FEVA 2JAMA 4JIKA 5L8KA 2CHLA 4RZWA 3FLQA 3A7HA 2J0JA 3QCQA 5KKRB 3O7LB 3SRVB 3HMIA 4W8DA 1A48A 3VNTA 2ZMDA 3ZSHA 2C0OA 4B0GA 4MBJA 4BIDA 4YZMA 2B9HA 3Q5ZA 4FTMA 2QURA 4E26A 5TT7A 3VRYA 4IX4A 5IA1A 5L6OA 4O6EA 3VULA 3AT3A 4WNMA 3KRJA 3OEZA 3RM6A 3V01A 3QGYA 2X81A 3GOPA 2GQRA 2GHGA 1H8FA 5L6PA 4EQMA 3E88A 3UO4A 3JYAA 3OWPA 3V5QA 3EQGA 5H3QA 4E6QA 1R0EA 4I3ZA 1JBPE 4L44A 4WHZA 3ALOA 2WKMA 4YJNA 3UZTA 2IZUA 4I0SA 3IOPA 3SX9A 4O82A 5BQ0A 5M4UA 4FF8A 3VHKA 3F3UA 2EXMA 4FNZA 4O0UA 3KXMA 5GNKA 4CMOA 4KKEA 1H4LA 2IJMA 1T45A 5EG3A 5FQDC 3Q9YA 5AR3A 4KBCA 2QHNA 3MA6A 5ETFA 3P08A 3FI2A 5FP5A 5ANDA 4R5SA 4ASEA 4O86A 4Y5QA 5E8SA 5AX9A 5J1VA 3H4JA 4XBUA 2PVLA 4E73A 3D5VA 2YN8A 2XF0A 4DEHA 4YJRA 3TUBA 2R3JA 2ZM3A 3I7CA 2BKKA 3C4EA 4LV8A 5KMJA 1XH4A 1Z57A 4TYIA 3FZRA 4UMTA 4I6QA 4XYFA 3F6XA 4Q2AA 4KIKB 4BHNA 5A4CA 1M7QA 5T6KA 3UIMA 4BCFA 1ZOGA 2XK9A 5LCKA 3A62A 4PL4A 3O8TA 3D7TB 1YWRA 4O6LA 1S9IA 4X3FB 5A6OA 3OWLA 3Q96A 3RI1A 2X9EA 3ZLSA 1JNKA 3EOCA 3EWHA 2OW3A 3TUCA 3TNIA 3TACA 4J7BA 3WOWA 5K4IA 1XH7A 3CQEA 4N0SA 3H9OA 2Y4IC 2P2IA 3L1SA 5FP6A 3GFEA 5H8GA 4PV0A 4R6VA 2VNYA 3V5WA 3FQSA 4AGCA 4C37A 2C4GA 4PY1A 3PJ3A 4AGUA 3ZC6A 1QMZA 3EYGA 5D7VA 4QQJA 3HRFA 4DYMA 3PIZA 3M11A 2R3KA 5D7AA 5DR2A 4XS2A 2XUUA 4R7BA 4YO6A 4FI1A 2OJ9A 5D12A 5M09A 3WZDA 5E8XA 5HLWA 3LJ1A 4L8MA 3UP7A 1K2PA 5A14A 2R2PA 3EN6A 3LQ3A 4QQCA 4RMZA 1URCA 3DXNA 3QRJA 4S30A 4Y46A 2OI4X 1AGWA 1ND4A 4EHVA 1VR2A 3SW4A 2CSNA 1G8SA 1J1CA 2XCHA 5HU3A 3QRKA 4P5ZA 2BUJA 5J8IA 5C01A 4EZ5A 5CU6A 1XBBA 3MFUA 1OB3A 2B9JA 4O0YA 1FVRA 1H08A 3OF0A 4NH1A 4RJ7A 3TJDA 3AMAA 3C9WA 3CSVA 5EFQA 2OO8X 5EHOA 4X0MA 4RQKA 4CMUA 4C38A 4DHFA 4HCVA 4LMNA 4E3CA 2QVSE 2Y4PA 5BVEA 3C13A 4AZWA 2X4FA 1LR4A 3PTGA 5HEZA 4GFGA 1WAKA 2X8IA 4EK6A 2ITZA 3EN9A 4GT5A 5M4CA 3LXNA 3FKLA 4C3RA 2JBPA 1FVTA 3GU7A 3KMWA 5DOSA 4BCNA 4HVDA 2XMYA 3FBVA 4PRJA 1YHVA 3NEWA 4DFLA 3BE9A 3WYYA 4C57A 3SD0A 2J90A 3MVHA 3Q2MA 2PMLX 4FL3A 5E1SA 3BIZA 3R2YA 5IUGA 3RK9A 3A99A 3QQLA 2XNBA 3GB2A 2KTYA 4QP2A 3UG1A 4L3LA 4FSUA 2R3GA 2XEYA 2CGVA 3D9VA 5M08A 3BQCA 3C1XA 1W83A 4CQGA 5AIRA 4RVMA 4GU9A 4TY1A 4ACMA 1Y6BA 3I4BA 4F1MA 2GNLA 4IWQA 3JPVA 4TKSA 3KK8A 2O65A 2CGXA 4XRLA 5CU0A 1OVEA 4FTKA 3D14A 3L8XA 5EI8A 3NNUA 4YPDA 3MBLA 4RIWB 2C1BA 2PVFA 3EQHA 2OGVA 3HA6A 1U5QA 5CU3A 4J71A 5I9XA 5EQEA 3GCUA 5HNGA 2J51A 2C3LA 2GNFA 3NX8A 4KKHA 4AZSA 4F1TA 4YJTA 1V0PA 3QX4A 4Q9SA 1Y8YA 2XS0A 3M42A 4FT9A 4U44A 4FKLA 2VO3A 3R21A 4YP8A 4O7RA 1UV5A 4RIYB 3TXOA 4IACA 4NZWB 3THBA 4AXAA 4D28A 2BZJA 4FYNA 5CASA 2YACA 3IONA 4RPVA 2WGJA 5DEYA 2YJRA 3DBEA 4ZY6A 3EFKA 3HP2A 5I4NA 3DV3A 2VO6A 4FTRA 4ANLA 4AN3A 1UVRA 3CKWA 4FX3A 5EM5A 5IQFA 3U6HA 3WZJA 2XKDA 4NCTA 3OUNB 4RC2A 3UIUA 4DITA 3KRWA 4BCHA 3G5DA 3BLQA 2F2CB 3L9PA 3R8MA 4EH9A 2WO6A 2E9UA 4U5JA 3I1AA 4XV1A 5EW9A 3HMOA 4RT7A 5HIBA 5DT4A 2WQBA 4F65A 4X2GA 2UVXA 1WVWA 2EVAA 2OF2A 2DS1A 3TZ9A 4BDBA 5J7HA 1MP8A 4BCOA 3FUPA 3VC4A 4X2JA 3HAMA 4O84A 3OT3A 5BMMA 5FG8A 4K6ZA 5KKRC 1UKIA 1VYZA 4CZUA 5E8UA 4RX5A 2YCQA 3FI4A 1P14A 4FIEA 1PXOA 4LGGA 4RX8A 3OEFX 5ANEA 2ZV7A 2AC5A 4AW2A 1UU7A 4BGQA 3LLAA 1KOAA 3BYVA 1QPDA 2XIZA 2B4SB 2XNOA 4WNKA 5TR6A 3V5TA 5DFPA 3DB8A 2B54A 2R4BA 2YM4A 1I09A 4AZVA 5I9ZA 5AV4A 4AT3A 3SA0A 3W10A 3OZ6A 5HVJA 4IIRA 4EWHA 2UV2A 3OCGA 4HYSA 4D55A 1B39A 1K3AA 3VHEA 3GVUA 3C4XA 3BQRA 4IM0A 5CF8A 5AR4A 4W4XA 3FXZA 2I0YA 3QXPA 1JQHA 3GI3A 5HO6A 4GS6A 3SOAA 5HIEA 1JKTA 3G9NA 4IX5A 3F3VA 3PA3A 4H05A 4AACA 5IEXA 4DH7A 4USDA 4M68A 4YTIA 2ZB1A 4DINA 3F3TA 3ULIA 3R7OA 2XYNA 2P33A 5AWMA 2UW5A 3FI8A 4BI1A 2XRWA 1NA7A 4DEIA 5HTIA 2PYWA 4D1XA 1BYGA 1YXVA 3QTIA 4F08A 2CLXA 3II5A 3C5IA 3PXQA 2P55A 1QL6A 4CKJA 3QF9A 1OITA 1UU9A 1I44A 4E4LA 2QOOA 5B2MA 4G1WA 4JX3A 5FTQA 2XM8A 1W98A 4CTCA 3DJ5A 3A7FA 1M2QA 1ZY4A 1YXTA 4ANNA 2XP2A 4FKSA 4NM5A 5HU9A 5GIOE 4YNEA 4F9YA 4ALUA 1GZKA 1MRVA 2FSMX 5IF1A 2PMNX 2WIPA 3KQ7A 3MYGA 1YI3A 4V0GA 4UMRA 5DRDA 4BCIA 2WMVA 3P23A 5AM6A 2GNGA 4J8MA 3LHJA 4JDIA 2J2IB 3ACKA 3QRTA 4RFZA 3QRIA 4FBXA 2YCRA 3FPQA 3P5KA 3AD6A 2JAVA 3ZLWA 2C6DA 5C1QB 4FL2A 4IJPA 2C3KA 1OL6A 1TQMA 4I93A 4LRKA 1B6CB 3NGAA 1ZYCA 1UU3A 1STCE 1WBOA 3Q53A 3R7YA 2VTLA 3TG1A 5HZNA 3I0QA 3U54A 5BYYA 4NSTA 3PY0A 2GCDA 1K9AA 2I1MA 1IEPA 2X7GA 5LCJA 2IWIA 3KB7A 2HW7A 1UWHA 3EN4A 3GFWA 3OXZA 1PHKA 1M17A 2A19B 3FQHA 3K3IA 4O96A 4YLKA 5CT0A 3CR0A 3T8OA 4TWOA 4F0IA 4CZYB 3LJ0A 5B7VA 3F7WA 4NU1A 2BALA 5ANIA 4CTBA 4RVLA 2CLQA 2XCKA 4XG4A 2BMCA 2V55A 4ZOGA 4K8AA 5CSWA 3ZM4A 4BFMA 3LM5A 4KIPA 2HWPA 5FXSA 4QMMA 4GJ2A 3KVWA 3GQIA 2ITOA 1VYWA 1CTPE 4RWLA 3VAPA 4BDEA 4G5JA 4NJ3A 4B8LA 4PPAA 4D58A 3OFMA 3R9NA 3ZRLA 4Z16A 1YDSE 4BYJA 2A4LA 3ATSA 1W84A 2VTRA 5IQEA 3OCBA 3AMBA 4ALWA 3KXXA 3O96A 4BBMA 5JH6A 2GS7A 2JDVA 3OWJA 4DEAA 5HBJA 5TOZA 1YVJA 3QCXA 4YLLA 4O83A 1H24A 1YXXA 2IPXA 4OTRA 2GFCA 1Q99A 2VWZA 2WTIA 3A60A 3MPTA 2FO0A 3OD6X 4L46A 3U9CA 5BVOA 2PZ5A 2ITVA 3RPYA 2RFSA 3PRFA 2PMOX 4C35A 2HW6A 3ZYAA 3ANQA 4ANOA 5HQ0A 4IAAA 1F5QA 3HMPA 3R0TA 2Y8OA 4QD6A 4FVPA 4QMXA 5M44A 4F9CA 1APME 3BHVA 3D83A 4HVIA 4DFXE 4FSMA 4A9SA 4IVDA 4F7LA 1BLXA 3FAAA 4GU6A 5JZNA 4QPSA 3ORLA 2UW0A 4R1VA 3EL8A 5IQAA 4KD1A 2RG6A 4X21A 3CBLA 3NW5A 3SRVA 5IA3A 3VWAA 4OTPA 4QTAA 4KBKA 1XH8A 3R63A 4RRVA 2GTNA 4FG8A 3O23A 5I9UA 1IAJA 1U4DA 2IZTA 1FVVA 2PMIA 2UZVA 3EIDA 3VUMA 4DN5A 5IDNA 2CN5A 4F0GA 4FTUA 3L8SA 3QWJA 3FEGA 3ACJA 5KZ0A 2PUPA 4WIHA 4UY9A 1WBVA 4K33A 5BX0A 2ITTA 3UZPA 3O7LD 1PXPA 2NRUA 2BAJA 3W8QA 3E87A 3WF8A 3R1YA 3G6GA 3KXNA 4I1ZA 4GKIA 4PDOA 5EDPA 3ZO1A 3OXIA 1R39A 4CFVA 5DN3A 4FEWA 2ERZE 3UPXA 4PP9A 4C8BA 3PXZA 1PXLA 3F3WA 3OCSA 4FKUA 5CEIA 3BRBA 4O7WA 3R9RA 3RWQA 4ZLZA 3QUDA 3PZEA 4XG2A 4O0VA 4OW8A 3LW0A 1CM8A 4RX7A 3D5XA 5CAQA 4EH4A 4DT8A 2VO7A 3R7IA 3TZMA 5T3QA 3Q9XA 1HCLA 2X8EA 1RW8A 3B8QA 4LL5A 4CV8A 4EOLA 3FMKA 3PP1A 3DA6A 4NW6A 2VX3A 2VTHA 3ODZX 1CMKE 4WSQA 2Q0BA 2X39A 1NVRA 2CJMA 4YJVA 4B8MA 2YWVA 2C6EA 4UALA 2C6OA 2V22A 4UBAA 4F6UA 5LVNA 5HCYA 3DBQA 4CT1A 4G17A 3BLRA 5TO8A 3AC8A 5JSMA 4NWMA 3ZS5A 2OJGA 4CD0A 4S32A 3ZONA 4FV8A 2VGOA 3FMLA 4RWKA 3AD5A 2QO2A 3CIKA 3WYXA 4D5HA 2ZM4A 3MFRA 1MUOA 1PKGA 3PVWA 1P5EA 1OPLA 1ZYJA 3OC1A 3BU5A 3P1AA 2XYUA 4F70A 4AGWA 3HRBA 4BTFA 3QUPA 4IANA 4WG4A 3FMEA 4YJQA 4AE6A 1NVQA 4IJ9A 4ZJJA 4FSWA 3TV4A 4FIGA 1HOWA 2BZHB 2R7IA 1JKLA 4G3DA 5AP4A 3QKKA 3OY1A 2B9FA 3NUPA 2J0MB 3BI6A 4IVBA 4AW1A 3W18A 3DT1A 3OMVA 3PXRA 1OKVA 3V6SA 5A6NA 2J0LA 3ETAA 4UB7A 5C26A 1QPJA 2J50A 4H3QA 3DNEA 4RWJA 3FI3A 5AA8A 5IA4A 1Q5KA 4NIFA 3TNWA 3QKLA 2BTSA 5K4JA 2J5FA 4A4XA 1SMHA 4ALVA 2XZSA 1PMVA 2YM5A 3NNVA 4AT4A 4NM7A 4ERKA 4HVGA 4USFA 3P4KA 2X8DA 2X6DA 3QLGA 2XVDA 3DTWA 3GC0A 1JAMA 4XG9A 4FNYA 1NVSA 4IZ5A 4RJ5A 2IW9A 1NY3A 1IA9A 5DMZA 3I5NA 3LFFA 4XEYA 2C5YA 3VUIA 4D0WA 4KABA 4D2RA 5IH5A 2J0IA 3P7BA 5BUEA 4YJOA 1O9UA 4OUCA 5HD4A 5JQ5A 4XBRA 3OW3A 5JRQA 2Z8CA 4Y83A 3U8WA 2W05A 3UIXA 2R3RA 2PZRA 3RAKA 3FKOA 4KINA 1FMKA 2XIKA 4M3QA 2BAKA 3R83A 4MEDA 4JX7A 4CRLA 4U43A 5KMIA 4D4RA 4C62A 4NFNA 4PWNA 3PPZA 3PSDA 4FYOA 4CCUA 2JDOA 1GAGA 4ONAA 4FV1A 1WVYA 2WIHA 3CEKA 3TZ7A 5IQGA 2QNJA 3S2PA 5CTPA 1V0OA 4Y85A 2GMXA 4GEOA 2XNMA 4QPAA 4UYNA 4D5KA 4EZ3A 4AN9A 4GUBA 3H3CA 4IAYA 2OG8A 3MA3A 3A7GA 4JBPA 3PPJA 4ZTLA 1J91A 2VV9A 1MQBA 3UO5A 3UOJA 3IS5A 3ZBXA 4OTGA 3C4WA 4JQEA 4DEBA 5HBEA 5CAOA 2W5HA 4I22A 5DEWA 3W8LA 2XK6A 3RWPA 3HV6A 5D10A 3VQHA 4C02A 1YOLA 4BDGA 3DK3A 5A4LA 3FC1X 4BDFA 1Q62A 3ELJA 4IMYA 4LGDA 5GJDA 4BWXA 2CDZA 2A1AB 4FR4A 3KCKA 3PVBA 3RZFA 4MH7A 2ZYBA 1R78A 3H9FA 3ORNA 2OF4A 4MTAA 5CI7A 3NUXA 1XKKA 3Q52A 3TDWA 4MWIA 4WKQA 3TV6A 5AUVA 5LVMA 2XIRA 3PFQA 5DR6A 1LUFA 2Z7LA 3RPOA 4WRGA 2GTMA 3JUHA 4V04A 5KMMA 3ZLXA 5IA5A 4BIBA 5CF5A 2QU5A 2WMAA 4R7IA 5ICPA 5DYJA 3QWKA 4DG3E 2ITUA 2VWXA 4CYIA 4FOCA 4BN1A 3MB7A 2YCFA 3NRMA 5K3YA 4AW5A 4EK8A 4IZAA 4M15A 4JT3A 4B99A 3VUDA 2HXLA 3GC8A 3EL7A 3KF7A 4IAZA 5GJFA 2HOGA 1ZOEA 2X2MA 5F94A 1M2PA 3LFDA 2WEIA 3LCDA 1YOJA 4KAOA 4ZSLA 4C4HA 5JEBA 4E4XA 4O0TA 4TL0A 2W96B 4FGBA 4HZSA 2HAKA 4CG9A 4MD9E 4Y95A 3U87A 1QPCA 4EHZA 3O8UA 1OL1A 2GU8A 3EQBA 4FSNA 3IW4A 4EOMA 4DTKA 3LFBA 4NFMA 4WG3A 3LMGA 3QUEA 3WE4A 5A9UA 4M84A 3MPMA 3Q4UA 5CS6A 2JIVA 3PRIA 3BWJA 4G6LA 5AUWA 3RAHA 2XK7A 1P4FA 4H39A 2XK8A 5LQFA 5CYIA 2OJFE 1WBPA 2VWVA 3OOGA 4GUEA 4I23A 3TJCA 2C5NA 4NKSA 5FD2A 4G16A 3D2KA 5L8JA 3TN8A 2BDJA 3WARA 3ORPA 3LQ8A 4EOPA 3LKMA 2UZNA 3SG9A 5ANGA 3RVGA 4CSVA 4IAFA 4QMVA 3S95A 4ZY4A 4S33A 5CSVA 4A9UA 3NUNA 4KUJA 3F5GA 4A4LA 3JVRA 3MJ2A 4HGSA 3FY2A 2LGCA 4L3PA 3P7AA 3UG2A 4QMNA 1JKSA 1ZARA 3PZHA 5DWRA 5CEQA 4JG8A 3TNQB 1W8CA 2Z60A 4I5HA 5LVPA 3HECA 2YM6A 4ITJA 2W17A 1PXNA 4UZDA 4A06A 4EJ7A 3CQUA 4J53A 3G2FA 2XNNA 2FSOX 4PL3A 4EHEA 2PU8A 3ZSGA 5ETIA 1U46A 2WQMA 3CLYA 4TNDA 3LXPA 1YRPA 2XNPA 3QHRA 5CZHA 3BGPA 3U6IA 4EC8A 3VRZA 4FEQA 3I6UA 3CQWA 2WHBA 3QYZA 3FL5A 5AP3A 3UNJA 4RIXB 3V8TA 4BY9E 4ASXA 5J7BA 3M2WA 2IZSA 3DLZA 2WAJA 2H8HA 2HZNA 4GT4A 4BBEA 4O7LA 3BX5A 4X2FA 5J5TA 5FEDA 2X0GA 4TNBA 2CNVA 2QO9A 2SRCA 4OTFA 4W9WA 3RALA 4PDPA 3LZBA 4FC0A 2CPKE 2WQNA 2JKMA 4K9YA 4V01A 5HE1A 4AAAA 3HRCA 4FVQA 5M4FA 3COIA 1SZMA 4U3YA 4FV3A 2O8YA 1ATPE 2VUWA 2ZOQA 1PXKA 4X2KA 4BCJA 3ENHA 4QRCA 4IFGA 3JY9A 4KIOA 3SAYA 5B0XA 2A0CX 3Q3BA 4OBPA 5AV2A 3NVKI 3KGAA 2R3OA 3MH1A 3PWDA 5CEKA 3FWQA 3FMMA 1V1KA 1G5SA 3BYMA 3GCSA 5CSHA 2VU3A 3KA0A 1B38A 4OBQA 5J1WA 4QYEA 4KIKA 2FB8A 3VS5A 4ASDA 4FKTA 3RPVA 3P78A 2I0HA 2RG5A 4IB3A 4MD8E 4J95A 5AR2A 1ZZLA 3RJCA 5HO8A 3VN9A 1Q3DA 2VTSA 5CVHA 4TRLA 4E5WA 2CKOA 3ET7A 5CXHA 2W1GA 5EM7A 2UZBA 5DE2A 3NVMB 2WTCA 3TL8A 1YI6A 3LCKA 3UO6A 2FYSA 3COMA 3VS4A 2YAAA 3F7ZA 4QMPA 2VTOA 1OUKA 4OTHA 4ZZMA 2ZV9A 4H1MA 4BCPA 4R5YA 4WUAA 4DC2A 4J52A 5JFSA 4I21A 4GRBA 5AV1A 4J8NA 2IVSA 5HD7A 5D9HA 5CENA 5T68A 2ITYA 4H3PA 5KMOA 2CKPA 1KE9A 2Q83A 2GS2A 4O91A 1U5RA 1IA8A 4U7ZA 3PPKA 2EUFB 2P0CA 4GFOA 4E6DA 2BPMA 4FKPA 3C7QA 3I5ZA 1PXJA 4LL0A 3HV3A 4X6RA 1NW1A 3QQJA 2VWWA 4YHJA 4YO4A 3SW7A 2YFXA 3AQVA 3HNGA 3G15A 4Z55A 5E4HA 1WZYA 4P90A 2VNWA 3LOKA 3NLBA 3DAJA 3QL8A 3F2AA 3KXHA 4O0XA 2RFEA 5AUTA 2A2AA 3AC5A 3G90X 1IASA 3FL4A 3LQ5A 3MV5A 2X9FA 3VUHA 1RE8A 4DG2E 4ERWA 2JEDA 4X7QA 3UMXA 5EH0A 3SLSA 4GVJA 3ZO3A 1V0BA 4D9TA 4F4PA 4YUQA 2EU9A 4BZOA 1OUYA 4MNEB 1SNUA 2Y7JA 2GSFA 2OKRA 3Q6UA 4TW9A 3PXKA 1R3CA 5F4NA 2HYYA 4C33A 3IO7A 5J9LA 1H1WA 4L7FA 3FPMA 3O2MA 1MRYA 3AXWA 1UWJA 5D1JA 3UC3A 3FSFA 4EL9A 3KMUA 3NYVA 4CXAA 3A61A 4FTIA 3VBYA 5HLNA 3R04A 1BI8A 4RIOA 5IQBA 4FSRA 4EK4A 5AP7A 4CFFA 3QTZA 1OIQA 3ZUTA 3T3VA 3AGLA 4R8QA 4C4FA 4DH8A 1O6LA 4IDTA 4I5PA 3R8LA 2W4OA 4JR7A 5KX8A 5JZJA 2C6MA 2Z02A 2YITA 2FA2A 3E93A 3Q5IA 3OCTA 4YGAA 2OBJA 3UQGA 4GK4A 3WF5A 5I0BA 5K5XA 3DK6A 3UTOA 3NW7A 3H0YA 2R3FA 4PF4A 1DI9A 4O21A 4XP0A 3IKAA 5JT2A 4GT3A 4OAUC 3GU8A 1PKDA 4GW8A 2YIYA 5HIDA 1KE6A 3MDYA 4TWPA 1YHWA 2UVYA 4NJDA 5ACBC 4FKRA 1IR3A 2VWBA 4IE9A 4R7HA 4FV4A 5HOAA 4YSMA 5K0KA 3W32A 3OWKA 4GCJA 3FMDA 4OAVB 3HZTA 3LCOA 3QALE 2UVZA 2Y0AA 4K1BA 2VWUA 4RLKA 3TWJA 2I40A 4UMPA 3U9NA 1JSUA 4EH7A 5LWNA 3FSKA 5HE0A 3ZTXA 3ERKA 4QP8A 3TIYA 1RDQE 2CKQA 4IB0A 2QR8A 2P3GX 5CANA 4G3EA 4I0RA 2EXCX 4FSTA 5IZFA 2QONA 4AQCA 2Z7RA 3GU6A 5DRBA 4UV0A 5DH3A 4OR5A 4RLLA 4CFWA 4ZTSA 1H00A 2JDSA 3I60A 4JNWA 4XNEA 5K0XA 5M56A 3R7EA 4DBXA 3R9OA 5IDPA 3BE2A 4L7SA 4IB1A 1W0XC 3VBXA 4YURA 4ZIMA 3RP9A 2JITA 5ANJA 5E92A 3LMIA 4S2ZA 4ZAUA 2F7ZE 3MH2A 4FG7A 5HG5A 5D11A 1UNHA 4U6RA 4C3PA 5E8YA 4NTSA 2G9XA 5EKNA 4DLIA 4N4SA 3E8NA 2X7OA 5AP0A 1ZMUA 4PMPA 2XM9A 4FKWA 3U55A 3QQKA 2C6KA 5E8VA 1GJOA 3DBDA 2H6DA 1T46A 4PNKA 3EQRA 4JVGA 3VUKA 1DAYA 4FSZA 4EKLA 5CEPA 4RSSA 3ALNA 2RKUA 4FTJA 3T3UA 4B7TA 1UKHA 3NDMA 5IKWA 1URWA 4F9WA 1OI9A 3NWWA 3KF4A 2DWBA 2W9ZB 3TTIA 3EYHA 4KBAA 4BDJA 2EB2A 4O1OA 4FT3A 5KHWA 3EQCA 4G3FA 4C0TA 4AGDA 4C34A 1OIRA 3BZ3A 5EK7A 1HCKA 2G1TA 3PSBA 5CZIA 5HGIA 2QKRA 4GIHA 5IUIA 3RBWA 4USEA 3WF6A 4A07A 2UZWE 2V7AA 4XOZA 3TNPC 1H25A 4ZMEA 2VTIA 2WMXA 3QA8A 3MY1A 3EKKA 3IG7A 3UJGA 4ZSEA 4AX8A 5C03A 1H01A 2JIUA 3BGZA 2BRBA 5DHJA 4D4VA 4JIAA 4LG4A 2PUIA 5EHLA 3QD2B 2V5QA 2IW6A 3F66A 4FK6A 4I92A 4YC3A 5CAPA 2YZLA 2R9SA 5AR7A 1FPUA 4YZNA 3HV5A 2CNUA 5L2TA 4OTWA 2W1HA 3KRLA 3OUKA 4IWPA 3KN5A 3DLSA 5HBHA 1BX6A 3E64A 4O7SA 3EQFA 2AUHA 4YLJA 4O7TA 3PJ8A 2OIQA 3MWUA 4TTHB 2QLUA 4QTBA 4X6QC 4EUUA 4DFBA 1LEWA 5LWMA 4I4FA 2R0IA 2ZJWA 3ZC5A 4L67A 5C4KA 3D15A 4BICA 3A8XA 4EBVA 3HAVA 3VS2A 4TYGA 5TKDA 3RZBA 3RKBA 4BGGA 4YSJA 4NW5A 1OKZA 3GENA 3MGYA 5FXRA 2KULA 3ROCA 2B0QA 3MVJA 2W9FB 4A9YA 1KUTA 3VS3A 2PZYA 4BF2A 4W4VA 1WVXA 2J4ZA 4W9XA 3U4WA 2OU7A 2VWYA 3KXZA 1ZMWA 3R7VA 3RPSA 4TXCA 3VO3A 4ZS4A 5HG8A 5LVOA 3BV3A 3C51A 3GBZA 3P79A 4AN2A 5IQHA 4RJ4A 4XG7A 1YQJA 3KRRA 2CMWA 4FTOA 4KKGA 4BDKA 2WMSA 4FKGA 5CWZA 3OY3A 3NIEA 5AM7A 3LCSA 3VS7A 2C0IA 3TKIA 1XQZA 4BKYA 4DGGA 3VJOA 3HGKA 1OBDA 2E9PA 4BC6A 5CU4A 4IAIA 3V51A 5LMAA 3UMWA 3OBGA 1G3NA 2OJIA 3E7OA 4M8TA 3E3PA 2O5KA 1M14A 2E9OA 4IVAA 4F6WA 4FTNA 4K0YA 4XLVA 4EH6A 3Q4TA 2IG7A 3QTXA 3Q9ZA 4G3CA 4ID7A 2YM7A 5M53A 4ORKA 3F5XA 3R8VA 5IEYA 2X2KA 4XP2A 1PXMA 2C5VA 4J96A 3K54A 2HK5A 4YJPA 3AD4A 2WTVA 3TUDA 3G9LX 5M4IA 3F2NA 5KBRA 4JQ8A 2BFYA 1Y6AA 4CCBA 3R6XA 2YWPA 5LMKA 3KULA 3FMHA 4P2KA 5KZIA 3F5PA 4IM2A 3SXRA 3TI1A 5FLFA 4Y5HA 1ZXEA 4YZ9A 4FODA 2ETKA 4QP7A 4XG6A 2XIXA 5HESA 4LQMA 3W16A 4O2ZA 3ZM9A 2BZIB 4B6LA 2C3IB 4QTCA 4CLJA 4N6ZA 5AUYA 2J5EA 3G6HA 5FXQA 3UIBA 2J9MA 3FMJA 1H07A 2PE0A 4FV2A 4YPSA 4D2VA 2HWOA 4JS8A 3MH0A 4LRJA 2VTJA 1ZOHA 2ZV8A 4O7VA 3GCQA 2RF9A 1W7HA 5EOBA 4CVAA 3B2TA 2XK3A 3NCZA 3EQPA 5H8EA 4GMYA 2QC6A 5BUJA 4XUFA 4EH3A 4FZAB 2BR1A 4M7IA 4PPCA 5KO1A 4E1ZA 3I7BA 4QMQA 4DH1A 5F9EA 4G9RA 4I41A 3FV8A 3R9DA 5IH6A 4ZLYA 3QCYA 3EJ1A 1BKXA 4GK3A 3SVVA 4XP3A 2IVUA 2VTAA 4G31A 3KMMA 5JQ8A 1OBGA 2GNIA 4M14A 3WI6A 4AT5A 3W33A 4BVUA 3IDBA 3TNHA 5JGBA 2BRMA 4OTQA 5BUIA 3M1SA 1TQIA 2WU7A 4FMQA 4FIJA 3TT0A 3SGCA 4QQTA 1R0PA 5IMXA 2GHMA 2OZAA 3MFSA 3NR9A 1WBSA 2ITNA 3NNXA 3ATTA 4I4EA 2WTKB 2PVRA 3N4VA 5TF9A 1PXIA 3SKCA 5KCVA 3F3ZA 3CGOA 5HX6A 4FTCA 2PVHA 3DKFA 1ZRZA 3TM0A 3C4ZA 4YZDA 4CEGA 2AC3A 4M69B 1O6YA 3I81A 4BDCA 4BTKA 2JC6A 1Y91A 2WTDA 5HE3A 3QTUA 4MWHA 4BR3A 4UMQA 3WILA 2YAKA 4BI0A 4C4EA 1TKIA 3PDTA 3BCEA 4K18A 2C68A 1WFCA 2YA9A 4IFCA 3ZO4A 4QMSA 3TV7A 5EW8A 3DJ7A 2OSCA 4U40A 3H30A 4YJSA 3FQEA 4AFEA 4IBMA 3WBLA 3BEGA 4CT2A 3R9HA 2YLEA 4JR3A 4ZLOA 2VGPA 5HORA 3MPAA 4FICA 1IRKA 3AT4A 3SDJA 4RJ3A 4ZZNA 2WB8A 2WNTA 1BMKA 2VWIA 3KRXA 5FM3A 3COHA 4ZK5A 4F9AA 4X3FC 3LCTA 3BHTA 4XCUA 3GUBA 4K77A 3VIDA 4BYIA 5LMBA 1E1XA 4EORA 1F0QA 1CKPA 3R00A 2PVKA 1Q8UA 2OFVA 2W1CA 3W1FA 2Y4IB 4U79A 3R01A 2QCSA 3VJNA 4ASZA 5L2IA 4MQ1A 3DQWA 4EOSA 4QPMA 2HZ4A 4ACCA 4JAIA 3QD4A 2F9GA 3VF9A 4RZVA 4IB5A 1BL7A 2J6MA 3CCNA 4R78A 3NS9A 2ZV2A 2PL0A 4RVKA 3SQQA 4I94A 4C59A 3QYWA 4UYAA 2ESMA 2I6LA 4LUEA 4OTDA 3V8WA 2XB7A 5I9VA 5L3AA 2UW3A 1PMNA 1JOWB 2YDJA 2C30A 1SVHA 3E63A 3U4UA 2BDWA 3PVUA 2OICA 4NUSA 3KREA 5AJQA 3REPA 3E5AA 5I9YA 4PDYA 3EFLA 3ORIA 3EZVA 2OH0E 3PLAE 4ZXTA 4DEEA 4EOKA 5M06A 3RNYA 3HUCA 4XX9A 1BUHA 3CGFA 2BKZA 5C8MA 4YTCA 5HTBA 3MESA 2O2UA 4RWIA 4PNIA 4YR8A 5GINE 5CLPA 4A9TA 2X7FA 3QLFA 3AC1A 3ZZWA 5BVNA 2GQSA 3CPCA 3FXWA 4ZSAA 3ZXTA 3R28A 3MY0A 3N51A 3N4TA 2YDKA 1P2AA 3BEAA 4ZTHA 1BL6A 2YEXA 3ZZEA 4Q5EA 2GPHA 2YCSA 2NO3A 2PVYA 3GCVA 1H0VA 4DA5A 3CTJA 1CKIA 1SM2A 3FLWA 2J0KA 4OGRA 4ENXA 3GGFA 4L52A 1DM2A 1Q8WA 1E9HA 4FKVA 4DFNA 3MVMA 4DFUA 3AC2A 4Y73A 3LFEA 1A06A 4BL1A 4YHTA 3Q4ZA 4WBOA 5L6WL 4S34A 3ZSIA 3CP9A 3S4QA 4ZJIA 2B1PA 4CGAA 3UC4A 2IVVA 4HYUA 3UYTA 4O7ZA 4YNOA 4DFZE 3DXPA 3VS0A 4JBOA 1R1WA 2BDFA 3TKHA 4HZRA 1RJBA 1MRUA 2ZAZA 3ULZA 5EI6A 3DNDA 4AOIA 2UW8A 3BBTB 5IU2A 3F82A 1DAWA 2GQGA 5K9IA 4B9DA 5FDXA 4XH6A 3MJ1A 4YBJA 3D5WA 4N6YA 2XRUA 3OT8A 4HOKA 5AAFA 5DT3A 5LMKC 3UVPA 4LI5A 5M55A 2R3PA 3HEGA 4KRCA 4U97A 4UN0C 5KNJA 3B2WA 3U51A 3V5PA 1M52A 2W1FA 1ZYSA 3MI9A 4MYGA 3WIGA 4CV9A 4DCAA 3OTVA 3R7GA 4HJOA 4NM0A 3ZXZA 4QTEA 4RJ8A 5J79A 3WZKA 1AQ1A 3NAYA 2YISA 5HG7A 3QD3A 2A27A 2YIWA 5ANOA 1LEZA 4TZRA 1Z5MA 4FZ6A 2UZUE 2G15A 3PE1A 2WTWA 2H96A 3GEQA 4OTIA 4W4YA 3DXQA 3A2CA 4Q5HA 1XBCA 4O1PA 3MB6A 5C8KA 4LOQA 5IMEA 4HGLA 5AR5A 4EOQA 2HIWA 3RK5A 4H36A 5BVWA 4ZTQA 4EWQA 4JDHA 3UDBA 5BMSA 3S00A 1YXSA 3MW1A 4V0GB 4O22A 3RCDA 3S3IA 2JKKA 2UW7A 4XV9A 1XH9A 1ZYDA 4KB8A 3W2RA 3EH9A 3ROYA 3RMFA 3TDVA 3ZEPA 1KE7A 4NKAA 3DZQA 3RPRA 4BCGA 4KSQA 5FBNC 4A7CA 4AZTA 4QMOA 5IG1A 4FK3A 1JLUE 5JMSA 5GIPE 4E4NA 3ORXA 4LGHA 2OFUA 5DPVA 3Q4CA 3ZO2A 5L8LA 3FZOA 3LFSA 3FYJX 4U8ZA 4X2NA 3IGOA 4AW0A 4DAWA 2VRXA 5FTGA 1UNGA 3SOCA 3RGFA 5CEOA 4FSQA 1YXUA 3HMNA 3PY1A 4QMYA 5EDQA 1UA2A 2W4JA 3DJ6A 4MXCA 5AV0A 5GJGA 2PUNA 3E92A 3I6WA 3QQGA 4FV6A 4I0TA 4DCEA 3B8RA 3OXTA 3IQ7A 2WMUA 3KU2A 4QP6A 2IW8A 2XA4A 2P4IA 3QXOA 4KS8A 4QP1A 4JJRA 3G0EA 2O3PA 2QG7A 4F64A 2F7XE 1PW2A 1J7LA 1XHAA 3LFQA 1U54B 3NCGA 5HHWA 4DLJA 4DTAA 3O71A 2JD5A 2VO0A 5HE2A 4BRXA 1QCFA 3MVLA 3IDCA 4FZDB 2C6TA 3EFWA 3CTHA 4Z7GA 2HY0A 4BWPA 3NZ0A 4DH3A 1XJDA 3ODYX 4S31A 4EK5A 4GSBA 2QLQA 4HPUE 5EI2A 4JRVA 4YU2A 3QTSA 4IDVA 4QYYA 2YM8A 1GZOA 3EKNA 4FUXA 4MAOA 3R8ZA 3FC2A 4FT7A 5J9ZA 2VTPA 3VBQA 1KE8A 2OK1A 2UZOA 3V5JA 4JOAA 3E62A 4KSPA 2W06A 5HCXA 3OW4A 3TKUA 4CKIA 5I3OA 2B53A 3OG7A 4M0YA 5H8BA 4EJNA 1OMWA 2E9NA 4GYGA 3UVRA 3A4OX 4RVTA 3VBWA 4TWNA 1H1SA 2HELA 4XG3A 1PMUA 3FHIA 3ZUUA 5ACKA 3SC1A 5D41A 4FV0A 2VTNA 4AA5A 4D0XA 4FA2A 3ZMMA 5DNRA 2BZKB 5IQCA 4WOVA 5E8ZA 1DI8A 3PP0A 3GQLA 2YM3A 4WUNA 4EK3A 5CVGA 3IPHA 3FHRA 3BYSA 5G6VA 4MNFA 1H1PA 2F57A 2X2LA 4MXXA 2OXXA 2OJJA 2V62A 5E8WA 4FNXA 3D7TA 4IZYA 4X3FA 4C4JA 2PZPA 2B9IA 3AG9A 3HV4A 3I0OA 4HPTE 3ZRMA 3DBCA 3PE2A 4O38A 3FY0A 3OTUA 4IXPA 3KL8A 3OS3A 2YERA 4WD5A 2EWAA 1W82A 3DB6A 2ITQA 2RGPA 2UW6A 3CPBA 1KV2A 3PUPA 4FV9A 2OWBA 3JY0A 5CT7A 5CSXA 1U54A 3TZ8A 2YDIA 5GZ8A 4X3JA 2NNWB 1WMKA 3DFCB 3CE3A 4JG7A 4YZBA 3PA5A 4GH2A 3LXKA 3RK7A 1XR1A 5I3RA 4M12A 4D2PA 3MFTA 3D5UA 4ITIA 2GS6A 5E90A 4P4CA 3WIKA 1NXKA 1FQ1B 1AD5A 2C1AA 3EQDA 4AA4A 2BIKB 4CZTA 3HYHA 4ANMA 2JDTA 4F7JA 4RIXA 1J1BA 1GIJA 2WQOA 1PYEA 1WBNA 2QU6A 3R73A 4L68A 2R0UA 3Q60A 5IQIA 3HDNA 3DDPA 4LUDA 3UQCA 3AT2A 4G6NA 4PDSA 1FMOE 1JPAA 5LJJA 3BBWA 4NCTC 1OM1A 2BCJA 3D4QA 4RFMA 3UGCA 5HICA 2JKOA 4EOJA 1MQ4A 3FLZA 4MVFA 4M13A 3OVVA 3VVHA 2ZDTA 2YIQA 4Z7HA 3E8DA 4PPBA 1FINA 2W1ZA 3VF8A 2Y6MA 2C5OA 2QOCA 4IEBA 2UZDA 4PTCA 3UODA 4EYJA 4FL1A 4XJ0A 5AP5A 3ITZA 4QYHA 5FTOA 4APCA 5A4EA 2HXQA 3NIZA 2HENA 5DT0A 4DE4A 4EOIA 3QQUA 2XK4A 2CKEA 4DF3A 1PF8A 3N4UA 2ONLA 3QKMA 3H0ZA 3LM0A 4RX9A 2UW9A 4EZ7A 4UWYA 4FT0A 4ACDA 5E91A 4J99A 3AGMA 3VUTA 3BHYA 5GHVA 4HYIA 5EQPA 2BVAA 1WCCA 1WBWA 4CNHA 4C61A 2W1EA 5IUHA 3PIXA 3BLHA 2B52A 1VJYA 2QOHA 2XKEA 5CALA 2R64A 2XJ1A 2G01A 2V7OA 2F49A 2ZMCA 3JS2A 2EB3A 2REIA 5DA3A 5JFVA 5EKOA 2WMBA 1E1VA 4KRDA 5L2QA 4AG8A 2WPAA 3ZLYA 2PHKA 2VD5A 4MF0A 4C36A 3FLSA 3ZOSA 2WMRA 4QMUA 2ACXA 4D2WA 5CNNA 3GCPA 4EQUA 4F7SA 3F9NA 1YDTE 3A7IA 1KV1A 1UU8A 4BBFA 2F2UA 3JXWA 3D0EA 4EH8A 4ZJVA 4XV3A 3V04A 2JDRA 3NPCA 2PWLA 2QD9A 1YI4A 4H58A 1XBAA 1Q24A 5C8NA 2RFDA 4O0SA 3UPZA 3COKA 3F5UA 1TQPA 5AP6A 5A54A 2OH4A 3A8WA 4RIYA 5JK3A 3O51A 4DEDA 5E1EA 5F20A 2YHVA 2ITWA 4FTTA 3WZUA 4G5PA 3UOKA 5HTCA 4QMTA 4TYHA 3NYOA 4F99A 2QQ7A 4HYHA 2PUUA 2XEZA 3EMGA 5FWKK 5HI2A 4QP4A 3HKOA 3VS6A 3QC9A 3ZFYA 4F7NA 4HW7A 4FKJA 4PMSA 4WT6A 3QCSA 3CY2A 4BKZA 3QAME 3R1QA 2YIXA 4CRSA 1GNGA 2QODA 3LAUA 4HCTA 4QMLA 4RC4A 4EH5A 3MY5A 2WZJA 4D9UA 1H27A 4RBLA 1NT2A 3CKXA 2WQEA 5CU2A 2VTTA 2W4KA 3O50A 3T9TA 3HMMA 2WD1A 3DBFA 4ANSA 2I0EA 4JG6A 4JAJA 3HX4A 5DVRA 2GNHA 5LARA 3DKCA 3LPBA 4P5QA 4WRSA 4BI2A 1ZZ2A 4QYFA 3TCPA 5JKGA 2HZIA 2BRGA 3L9MA 4BDHA 1Y57A 4IX6A 2BTRA 4AZFA 3KEXA 4W8EA 1GZNA 1KSWA 3FYKX 4TYJA 5LOHA 4FOBA 2OIDA 1P4OA 5DIAA 4K11A 3CD3A 3BGQA 1UNLA 2ITXA 4AS0A 4HGTA 4TN6A 5C27A 5AEPA 2F7EE 3O0GA 3W2PA 4QYGA 1YOMA 3PA4A 4IC7A 1Q8ZA 4UXLA 1OECA 4AUAA 5A4QA 3EQIA 4FSYA 4GL9A 4I5MA 4IX3A 4RGJA 3F61A 4FUYA 3UP2A 4C4IA 4CYJA 4QTDA 2FUMA 3ZEWA 3D2IA 3IW5A 3ZDUA 1JWHA 4BTMA 1LP4A 1YDRE 2OXYA 3Q9WA 1GIIA 3JVSA 3N9XA 2O64A 3NUUA 4YTHA 3WF9A 1FBNA 4LOPA 4IM3A 5KMLA 4F9BA 4FVRA 1SYKA 4JBQA 2W99B 4O0WA 2BILB 1IG1A 3DDQA 2ONLC 5FM2A 3UE4A 1PYXA 4O0RA 5M57A 5DI1A 2CCIA 3V5LA 1H26A 3L9LA 2BAQA 1REKA 1FGIA 5IQDA 2RFNA 4ZSJA 5HVYA 5JRSA 4XLIA 1PRYA 3QBNA 1M7NA 2FH9A 3K5UA 3QTQA 5EQYA 2XJ0A 2FGIA 3GC7A 5J9YA 4EH2A 4IWDA 1M2RA 3ZDIA 5DBXA 4AWIA 4XRJA 3GU4A 4AE9A 2BRHA 3Q6WA 2C69A 3QTWA 4CFMA 4QO9A 3W55A 4RFYA 2JBOA 3DOGA 2JFLA 4FTAA 4CLIA 5IH4A 4NK9A 3VW8A 5AUUA 2ETRA 2XIYA 5I5ZA 3QZIA 3NAXA 4AOTA 2QKWB 4QT1A 5L2SA 1KOBA 2CGWA 4NTTA 4MD7E 3BYOA 3DU8A 3U6JA 2Y9QA 4QQ5A 5HCZA 2GDOA 4PMMA 3QZGA 3ZCLA 1QPEA 4H3BA 2Z7SA 3OOMA 4LRMA 1GZ8A 4IH8A 3TIZA 2XBJA 3QZHA 4EOOA 4HVSA 4NEUA 4PMTA 4E20A 3FZ1A 5A4TA 3C0GA 1ERKA 3HVCA 1Z9XA 5FGKA 5EHYA 3VBVA 4BCQA 3FXXA 3FKNA 3A4PA 5LVLA 3CJGA 4DFYA 3KVXA 4M66A 2WOTA 4I6FA 4O27B 5E8TA 3LIJA 3VQUA 4II5A 4FT5A 4TYHB 4WG5A 2E9VA 3VBTA 4D4SA 2H9VA 4GJ3A 2YABA 3BV2A 4ITHA 3FDNA 3DKOA 2XKCA 1WBTA 3IW6A 3R2BA 4YMJA 3R7UA 5M51A 4CMTA 3IW8A 1CSNA 5AV3A 4AFJA 4Z9LA 2YZAA 5IPJA 3LFNA 3QX2A 4MBLA 4IZ7A 3HUBA 3BYUA 4TWCA 4R3CA 5CQWA 5AP1A 3HA8A 3BELA 1OL5A 3OROA 4IAKA 2NPQA 4CFUA 1OIUA 2BIYA 5EM6A 4OT5A 5F1ZA 1Y8GA 4MHAA 4E8AA 3ORZA 3NUSA 3PXFA 4L3JA 1JSTA 2W5BA 4L53A 4MF1A 5KE0A 2WU6A 4RA5A 5ETAA 2W5AA 3EHAA 2E2BA 3C50A 3K2LA 4F1OA 4GVAA 3MIYA 3FZSA 3FZPA 3DY7A 3OP5A 2QR7A 4U81A 4ZSGA 5CSPA 2JFMA 2I0VA 2OIBA 3R71A 1ZAOA 3KULB 2ZM1A 3UYSA 2HCKA 4PTGA 3POOA 2XNGA 4L42A 4WNOA 4FV5A 3DTCA 4GV1A 4KIQA 3RAIA 1BI7A 3NUAA 3JR1A 3ENMA 4KA3A 5KMNA 1OGUA 4YC8A 3SHEA 2QOFA 5AX3A 3T9IA 5JFWA 4G3GA 4DT9A 4BWKA 4YHFA 4JL9A 3H10A 2PPQA 3EFJA 1Q61A 3GU5A 1H1RA 5AADA 3H9RA 4U41A 4K2RA 3V8SA 4F0FA 2NRYA 4IVCA 5ITAA 5E9EA 2PVMA 4GK2A 4DG0E 4FIIA 3Q04A 4UMUA 3KCFA 3GT8A 4FKQA 4CG8A 1OPJA 2QI8A 3QC4A 4DGLC 4N57A 4QNYA 5CVFA 2WTKC 3ZBFA 4BIEA 3GOKA 4BKJA 2JKQA 3QTRA 4E93A 3V6RA 4YZCA 1ZMVA 3IGGA 4D1ZA 2R7BA 2R3QA 1X8BA 5FBOA 3LVPA 2VTMA 3GXLA 1JSVA 5EYDA 3R8UA 3VUGA 4BCKA 4ZTMA 5JGDA 2B55A 4I24A 4N70A 4EBWA 2UZTA 4ANBA 1OIYA 1CDKA 3LFCA 3MS9A 2W0JA 2PY3A 4RJ6A 5BVDA 2OXDA 3BHHA 5KBQA 3QFVA 5JGAA 3MN3A 4M69A 3C0IA 3EZRA 3ORMA 3UOLA 4ENYA 5EDRA 5CX9A 4WNPA 1L3RE 2GFSA 3RAWA 1H0WA 3BPRA 4CQEA 5CXZA 5HG9A 4PQNA 3GP0A 2PE2A 5AAEA 2LAVA 2JLDA 4ZY5A
chains in the Genus database with same CATH superfamily
2G2IA 5ETCA 1YWVA 3E3BX 4G9CA 2C6LA 1ZWSA 3K3JA 1GOLA 3DPKA 1JKKA 4FRFA 3MIAA 3UOHA 2I7QA 3FLNC 2O0UA 4DGNA 3FE3A 3E8EA 3UZRA 2QOQA 2CGUA 2QOLA 3C5UA 3KKVA 4LV5A 4M67A 3DK7A 4KWPA 1Q97A 5A46A 4CKRA 1OPKA 4FZ7A 4EI4A 4BDAA 3A7JA 4FIFA 4FIHA 4WO5A 3IDPA 4YTFA 3BKBA 3FJQE 5FEQA 3UBDA 4U80A 3W0SA 2XH5A 4GG5A 5C9CA 3F2RA 3DZOA 1SVEA 2QG5A 4OLIA 2RIOA 4D4YA 4RIWA 3QHWA 3W0NA 2Z7QA 3RM7A 4E7WA 2IVTA 2F4JA 4J98A 2DUVA 4L9IA 3ZRKA 2X6EA 4EEVA 3D7ZA 4GG7A 4U45A 5EW3A 2VTQA 3G51A 4J97A 2VX0A 3KY2A 2ITPA 5FEEA 4R77A 2FSLX 1G8AA 3P86A 4KNBA 3PY3A 3W2QA 2XJ2A 3CY3A 4JXFA 5H9BA 1O6KA 3DAKA 5AP2A 4EUTA 4DH5A 2P2HA 3Q32A 5KHXA 2GNJA 3LE6A 4WA9A 4ZMFA 4AF3A 1U59A 4Q9ZA 4O7YA 3PWYA 4C7TA 3K5VA 3PG1A 1ZLTA 3PSCA 4JDKA 4MQ2A 3AOXA 3LFAA 3BU3A 3DKGA 3PG3A 4ARKA 2RL5A 3POZA 5EYCA 4AZEA 4IHPA 2ETMA 4M97A 5HO7A 4NYEA 4ZP5A 3VS1A 4PL5A 3MSSA 1FOTA 2B7AA 5AMNA 4I6BA 3CTQA 2BFXA 3G33A 4QNAA 4R1YA 3OHTA 3PJ2A 5BVFA 1G8KA 2OZOA 4RQVA 2WMWA 4UXQA 4C2WA 4C58A 2WOUA 2WTJA 3HP5A 5AFVA 4JRNA 1RQQA 3QQHA 4J1RA 3IECA 3DGKA 5CI6A 3ORKA 2BRNA 2AYPA 1XWSA 2IN6A 2JGZA 3QRUA 3CS9A 4HNIA 4NT4A 4O81A 2QOIA 4MNEA 1SNXA 3SV0A 3MTLA 1JVPP 4OBOA 2HZ0A 3QQFA 2YJSA 3R1SA 4MCVA 2VAGA 4A9RA 3QU0A 2PE1A 5B2LA 2CCHA 5AA9A 1TVOA 2PVNA 3ZFXA 3S0OA 1SVGA 3IK3A 4ACHA 1A9UA 2O63A 1S9JA 4IWOA 4YC6A 2PK9A 3DCVA 3RINA 4EONA 4DTBA 3IW7A 4AA0A 5J87A 2XNEA 3NUYA 2R3MA 2H34A 3AC4A 4IADA 3CXWA 3KFAA 1PJKA 4GYIA 3GC9A 4FKIA 4L45A 1OL2A 4QP3A 2UZEA 4U3ZA 2RSVA 1YWNA 2EXEA 5HX8A 4BGHA 5H2UA 4FG9A 2IZRA 1H28A 5CY3A 5CAVA 3R22A 5IISA 5CEMA 4RA4A 5C4LA 2W1DA 3C4CA 2ERKA 3W2CA 3KN6A 2ZDUA 3D94A 3FZTA 4G2FA 4DGOA 1J3HA 1XO2B 4FGRA 1IAHA 4UX9A 3SXSA 4W4WA 4E5BA 4G34A 4UWBA 5CF4A 2XKFA 5EYMA 3P9JA 1PMEA 2G2FA 4CFXA 3NMUF 5EYKA 2X4ZA 2PVJA 1ZY5A 3CD8A 3BWFA 5J95A 4MKCA 4F63A 3ANRA 1VZOA 4JLCA 4V05A 4ZZOA 4OT6A 3TEIA 4UZHA 2R3LA 4YBKA 4A4OA 5HKMA 3ZHPC 3DS6A 4I20A 5BYZA 5L4QA 2IO6A 4UEUA 2VN9A 5AAGA 4H1JA 4IW0A 1YW2A 2UZLA 5GZ9A 4APPA 4LMUA 2BHEA 4FZFB 4HVHA 3PIYA 2C0TA 2R5TA 4C4GA 5TE0A 1KWPA 2UW4A 4RG0A 2X1NA 4O4BB 3ID6C 2R3NA 5DG5A 2WMQA 4FTQA 3RCJA 4NM3A 3MH3A 4FV7A 3NNWA 1XH5A 3OBJA 4NIFB 4R3PA 4BCMA 2R3IA 5ANKA 4C3FA 3E7VA 4LYNA 4P7EA 3DQXA 2UUEA 5IA0A 4EYMA 3C0HA 2Q0NA 4O7NA 4D2TA 3KXGA 2W7XA 1XH6A 5JN2A 5AUZA 3O17A 4RC3A 5B2KA 2C3JA 4U42A 4KS7A 4Z3VA 1GIHA 3LLTA 4ZEGA 4AP7A 1OKWA 3UQFA 4IQ6A 2PTKA 3C4FA 3NYXA 5BYLA 5HNIX 4TT7A 4LOOA 2NP8A 3NSZA 4XV2A 4GFMA 3PJ1A 4FEUA 4F6SA 4TPTA 3UNZA 4GKHA 4D1SA 2Z2WA 4O4EA 4BZNA 3GNIB 4MXYA 2WEVA 3R30A 1LPUA 4QP9A 4EHGA 4NL0A 3IOKA 3KK9A 4L43A 4BHZA 2YLFA 3LXLA 4WBBB 5A3XA 5K5NA 4MXZA 5EOLA 3WE8A 4LM5A 3RTPA 5L2WA 5FRIA 5I9WA 3G0FA 5IA2A 5DR9A 4XMOA 4D2SA 3EN7A 4R3RA 2ZB0A 4Y8DA 4ZTNA 2DQ7X 4XG8A 5J5SA 4BTJA 2PULA 4BB4A 1J7UA 2ZVAA 3PYYA 5F95A 4XHKB 5BVKA 4DGMA 4MK0A 1ZYLA 3E8CA 4BDIA 2JIIA 4QMZA 4U9AA 4HNFA 4G6OA 3SXFA 5HLPA 4FJVA 3LJ2A 3NW6A 4PP7A 2QOBA 3ORTA 5CAUA 3PJCA 3KC3A 3L9NA 3DFAA 2QO7A 2PSQA 3DAEA 2WMTA 2J7TA 1J7IA 4YJUA 4JQ7A 4EKKA 5BPYA 3I79A 2QHMA 4C2VA 3TTJA 1REJA 2PZIA 4FKOA 2FVDA 4EC9A 3NYNA 1DS5A 2VZ6A 1VEBA 1Q8TA 3BHUA 3MTFA 1OL7A 5M07A 1YHSA 4I6HA 5FDPA 4HGEA 4QMWA 2AQXA 5E7RA 3UNKA 2DYLA 2BROA 5CF6A 2XBAA 1Q41A 4ZS0A 2VX1A 4ANQA 5CQUA 4FNWA 1Q3WA 3LMHA 3RHKA 5BNJA 5EM8A 2QOKA 1KE5A 2WELA 4L6QA 4FE2A 3AMYA 4IC8A 2OZAB 4XOYA 3EB0A 1CKJA 4GIIA 3EN5A 4JI9A 3PVGA 3R1NA 3ZU7A 1Q8YA 1YKRA 4E5AX 3R02A 1EH4A 1F3MC 2HY81 4PX6A 5AR8A 5AUXA 4L01A 2WXVA 2C47A 2OLCA 3W2SA 3PFYA 4MXOA 3L8VA 1PY5A 3ZFMA 3HLLA 3O8PA 4MXAA 3HDMA 5DGZA 5LXMA 5FUTA 4E4MA 2G2HA 4UWCA 4ZTRA 4CFNA 3QZFA 5G1XA 2C6IA 2WFYA 4AU8A 1GY3A 3P0MA 3QA0A 5DLSA 5KMKA 3S1HA 4AOJA 5HNBA 2FSTX 4HCUA 3V3VA 4BDDA 4JDJA 3RHXA 3L8PA 4PTEA 3ZUVA 4QOXA 3F88A 4MX9A 4PUZA 2CN8A 4WSYA 3VW6A 3F69A 5CNOA 3WF7A 2C5XA 3FMNA 1L8TA 4LFIA 4I5CA 5JFXA 5GZAA 3FLYA 4DEGA 2GHLA 3PLSA 3PXYA 4U0IA 3R8PA 4B4LA 1OKYA 3QD0A 2A98A 5AIKA 4DBNA 3P7CA 5IEVA 4L00A 5KUPA 3UVQA 3CJFA 3QGWA 3SG8A 4M0ZA 4FEXA 2W1IA 4MBIA 1FGKA 2CNQA 3RNIA 4ACGA 4F09A 1OZ1A 2V0DA 1H1QA 4BZDA 4E6CA 4EQCA 3Q2JA 1ST4A 2YIRA 4Y72A 4O2PA 4E6AA 3BU6A 3CC6A 5HVKA 3ZH8A 1Q4LA 2R3HA 4JBVA 3HL7A 3HV7A 3AC3A 3W2OA 2BHHA 3WZEA 4FTLA 2Y6OA 4TYEA 4FEVA 2JAMA 4JIKA 5L8KA 2CHLA 4RZWA 3FLQA 3A7HA 2J0JA 3QCQA 5KKRB 3O7LB 3SRVB 3HMIA 4W8DA 1A48A 3VNTA 2ZMDA 3ZSHA 2C0OA 4B0GA 4MBJA 4BIDA 4YZMA 2B9HA 3Q5ZA 4FTMA 2QURA 4E26A 5TT7A 3VRYA 4IX4A 5IA1A 5L6OA 4O6EA 3VULA 3AT3A 4WNMA 3KRJA 3OEZA 3RM6A 3V01A 3QGYA 2X81A 3GOPA 2GQRA 5GIPE 2GHGA 1H8FA 5L6PA 2XAOA 4EQMA 3E88A 3UO4A 3JYAA 3OWPA 3V5QA 3EQGA 5H3QA 4E6QA 1R0EA 4I3ZA 1JBPE 4L44A 4WHZA 3ALOA 2WKMA 4YJNA 3UZTA 4LDTA 2IZUA 4I0SA 3IOPA 3SX9A 4O82A 5BQ0A 5M4UA 4FF8A 3VHKA 3F3UA 2EXMA 4FNZA 4O0UA 3KXMA 5GNKA 4CMOA 4KKEA 1H4LA 2IJMA 3UDZA 1T45A 5EG3A 5FQDC 3Q9YA 5AR3A 4KBCA 2QHNA 3MA6A 2X0OA 5ETFA 3P08A 3FI2A 5FP5A 5ANDA 4R5SA 4ASEA 4O86A 4Y5QA 5E8SA 5AX9A 5J1VA 3H4JA 4XBUA 2PVLA 4E73A 3D5VA 2YN8A 2XF0A 4DEHA 4YJRA 3TUBA 2R3JA 2ZM3A 3I7CA 2BKKA 3C4EA 4LV8A 5KMJA 1XH4A 1Z57A 4TYIA 3FZRA 4UMTA 4I6QA 4XYFA 3F6XA 4Q2AA 4KIKB 4BHNA 5A4CA 1M7QA 5T6KA 3UIMA 4BCFA 1ZOGA 2XK9A 5LCKA 3A62A 4PL4A 3O8TA 3D7TB 1YWRA 4O6LA 1S9IA 4X3FB 5A6OA 3OWLA 3Q96A 3RI1A 2X9EA 3ZLSA 1JNKA 3EOCA 3EWHA 2OW3A 3TUCA 3TNIA 3TACA 4J7BA 3WOWA 5K4IA 1XH7A 3CQEA 4N0SA 3H9OA 2Y4IC 2P2IA 3L1SA 5FP6A 3GFEA 5H8GA 4PV0A 4R6VA 2VNYA 3V5WA 3FQSA 4AGCA 4C37A 2C4GA 4PY1A 3PJ3A 4AGUA 3ZC6A 1QMZA 3EYGA 5D7VA 4QQJA 3HRFA 4DYMA 3PIZA 3M11A 2R3KA 5D7AA 5DR2A 4XS2A 2XUUA 4R7BA 4YO6A 4FI1A 2OJ9A 5D12A 5M09A 3WZDA 5E8XA 5HLWA 3LJ1A 4L8MA 3UP7A 1K2PA 5A14A 2R2PA 3EN6A 3LQ3A 4QQCA 4DHZA 4RMZA 1URCA 3DXNA 3QRJA 4S30A 4Y46A 2OI4X 1AGWA 1ND4A 4EHVA 1VR2A 3SW4A 2CSNA 1G8SA 1J1CA 2XCHA 5HU3A 3QRKA 4P5ZA 2BUJA 5J8IA 5C01A 4EZ5A 5CU6A 1XBBA 3MFUA 1OB3A 2B9JA 4O0YA 1FVRA 1H08A 3OF0A 4NH1A 4RJ7A 3TJDA 3AMAA 3C9WA 3CSVA 5EFQA 2OO8X 5EHOA 4X0MA 4RQKA 4CMUA 4C38A 4DHFA 2AEGA 4HCVA 4LMNA 4E3CA 2QVSE 2Y4PA 5BVEA 3C13A 4AZWA 2X4FA 1LR4A 3PTGA 5HEZA 4GFGA 1WAKA 2X8IA 4EK6A 2ITZA 3EN9A 4GT5A 5M4CA 3LXNA 3FKLA 4C3RA 2JBPA 1FVTA 3GU7A 3KMWA 5DOSA 4BCNA 4HVDA 5BV3A 2XMYA 3FBVA 4PRJA 1YHVA 3NEWA 4DFLA 3BE9A 3WYYA 4C57A 3SD0A 2J90A 3MVHA 3Q2MA 2PMLX 4FL3A 5E1SA 3BIZA 3R2YA 5IUGA 3RK9A 3A99A 3QQLA 2XNBA 3GB2A 2KTYA 4QP2A 3UG1A 4L3LA 4FSUA 2R3GA 2XEYA 2CGVA 3D9VA 5M08A 3BQCA 3C1XA 1W83A 4CQGA 5AIRA 4RVMA 4GU9A 4TY1A 4ACMA 1Y6BA 3I4BA 4F1MA 2GNLA 4IWQA 3JPVA 4TKSA 3KK8A 2O65A 2CGXA 4XRLA 5CU0A 1OVEA 4FTKA 3D14A 3L8XA 5EI8A 4QDVA 3NNUA 4YPDA 3MBLA 4RIWB 2C1BA 2PVFA 3EQHA 2OGVA 3HA6A 1U5QA 5CU3A 4J71A 5I9XA 5EQEA 3GCUA 5HNGA 2J51A 2C3LA 2GNFA 3NX8A 4KKHA 4AZSA 4F1TA 4YJTA 1V0PA 3QX4A 4Q9SA 1Y8YA 2XS0A 3M42A 4FT9A 4U44A 4FKLA 2VO3A 3R21A 4YP8A 4O7RA 1UV5A 4RIYB 3TXOA 4IACA 4NZWB 3THBA 4AXAA 4D28A 2BZJA 4FYNA 5CASA 2YACA 3IONA 4RPVA 2WGJA 5DEYA 2YJRA 3DBEA 4ZY6A 3EFKA 3HP2A 5I4NA 3DV3A 2VO6A 4FTRA 4ANLA 4AN3A 1UVRA 3CKWA 4FX3A 5EM5A 5IQFA 3U6HA 3WZJA 2XKDA 4NCTA 3OUNB 4RC2A 3UIUA 4DITA 3KRWA 4BCHA 3G5DA 3BLQA 2F2CB 3L9PA 3R8MA 4EH9A 2WO6A 2E9UA 4U5JA 3I1AA 4XV1A 5EW9A 3HMOA 4RT7A 5HIBA 5DT4A 2WQBA 4F65A 4X2GA 2UVXA 1WVWA 2EVAA 2OF2A 2DS1A 3TZ9A 4BDBA 5J7HA 1MP8A 4BCOA 3FUPA 3VC4A 4X2JA 3HAMA 4O84A 3OT3A 5BMMA 5FG8A 4K6ZA 5KKRC 1UKIA 1VYZA 4CZUA 5E8UA 4RX5A 2YCQA 3FI4A 1P14A 4FIEA 1PXOA 4LGGA 4RX8A 3OEFX 5ANEA 2ZV7A 2AC5A 4AW2A 1UU7A 4BGQA 3LLAA 1KOAA 4QDEA 3BYVA 1QPDA 2XIZA 2B4SB 2XNOA 4WNKA 5TR6A 3V5TA 4I6LA 5DFPA 3DB8A 2B54A 2R4BA 2YM4A 1I09A 4AZVA 5I9ZA 5AV4A 4AT3A 3SA0A 3W10A 3OZ6A 5HVJA 4IIRA 4EWHA 2UV2A 3OCGA 4HYSA 4D55A 1B39A 1K3AA 3VHEA 3GVUA 3C4XA 3BQRA 4IM0A 5CF8A 5AR4A 4W4XA 3FXZA 2I0YA 3QXPA 1JQHA 3GI3A 5HO6A 4GS6A 3SOAA 5HIEA 1JKTA 3G9NA 4IX5A 3F3VA 3PA3A 4H05A 4AACA 5IEXA 4DH7A 4USDA 4M68A 4YTIA 2ZB1A 4DINA 3F3TA 3ULIA 3R7OA 2XYNA 2P33A 5AWMA 2UW5A 3FI8A 4BI1A 2XRWA 1NA7A 4DEIA 5HTIA 2PYWA 4D1XA 1BYGA 1YXVA 3QTIA 4F08A 3TYKA 2CLXA 3II5A 3C5IA 3PXQA 2P55A 1QL6A 4CKJA 3QF9A 1OITA 1UU9A 1I44A 4E4LA 2QOOA 5B2MA 4G1WA 4JX3A 5FTQA 2XM8A 1W98A 4CTCA 3DJ5A 3A7FA 1M2QA 1ZY4A 1YXTA 4ANNA 2XP2A 4FKSA 4NM5A 5HU9A 5GIOE 4YNEA 4F9YA 4ALUA 1GZKA 1MRVA 2FSMX 5IF1A 2PMNX 2WIPA 3KQ7A 3MYGA 1YI3A 4V0GA 4UMRA 5DRDA 4BCIA 2WMVA 3P23A 5AM6A 2GNGA 4J8MA 3LHJA 4JDIA 2J2IB 3ACKA 3QRTA 4RFZA 3QRIA 4FBXA 2YCRA 3FPQA 4LV7A 3P5KA 3AD6A 2JAVA 3ZLWA 2C6DA 5C1QB 4FL2A 4IJPA 2C3KA 1OL6A 1TQMA 4I93A 4LRKA 1B6CB 3NGAA 1ZYCA 1UU3A 1STCE 1WBOA 3Q53A 3R7YA 2VTLA 3TG1A 5HZNA 3KIOC 3I0QA 3U54A 5BYYA 4NSTA 3PY0A 2GCDA 1K9AA 2I1MA 1IEPA 2X7GA 5LCJA 2IWIA 3KB7A 2HW7A 1UWHA 3EN4A 3GFWA 3OXZA 1PHKA 1M17A 2A19B 3FQHA 3K3IA 4O96A 4YLKA 5CT0A 3CR0A 3T8OA 4TWOA 4F0IA 4CZYB 3LJ0A 5B7VA 3F7WA 4NU1A 2BALA 5ANIA 4CTBA 4RVLA 2CLQA 2XCKA 4XG4A 2BMCA 2V55A 4ZOGA 4K8AA 5CSWA 3ZM4A 4BFMA 3LM5A 4KIPA 2HWPA 5FXSA 4QMMA 4GJ2A 3KVWA 3GQIA 2ITOA 1VYWA 1CTPE 4RWLA 3VAPA 4BDEA 4G5JA 4NJ3A 4B8LA 4PPAA 4D58A 3OFMA 3R9NA 3ZRLA 4Z16A 3W0MA 1YDSE 4BYJA 2A4LA 3ATSA 1W84A 2VTRA 3BL9A 5IQEA 3OCBA 3AMBA 4ALWA 3KXXA 3O96A 4BBMA 5JH6A 2GS7A 4AXEA 2JDVA 3OWJA 4JMQA 4DEAA 5HBJA 5TOZA 1YVJA 3QCXA 4YLLA 4O83A 1H24A 1YXXA 2IPXA 4OTRA 2GFCA 1Q99A 2VWZA 2WTIA 3A60A 3MPTA 4AXDA 2FO0A 3OD6X 4L46A 3U9CA 5BVOA 2PZ5A 2ITVA 3RPYA 2RFSA 3PRFA 2PMOX 4C35A 2HW6A 3ZYAA 3ANQA 4ANOA 5HQ0A 4IAAA 1F5QA 3HMPA 3R0TA 2Y8OA 4QD6A 1W2CA 4FVPA 4QMXA 5M44A 4F9CA 1APME 3BHVA 3D83A 4HVIA 3NFFB 4DFXE 4FSMA 4A9SA 4IVDA 4F7LA 1BLXA 3FAAA 4GU6A 5JZNA 4QPSA 3ORLA 2UW0A 4R1VA 3EL8A 5IQAA 4KD1A 2RG6A 1OGYA 2XAMA 4X21A 3CBLA 3NW5A 3SRVA 5IA3A 3VWAA 4OTPA 4QTAA 4KBKA 1XH8A 3R63A 4RRVA 2GTNA 4FG8A 3O23A 5I9UA 1IAJA 1U4DA 2IZTA 1FVVA 2PMIA 2UZVA 3EIDA 3VUMA 4DN5A 5IDNA 2CN5A 4F0GA 4FTUA 3L8SA 3QWJA 3FEGA 3ACJA 5KZ0A 2PUPA 4WIHA 4UY9A 1WBVA 4K33A 5BX0A 2ITTA 3UZPA 3O7LD 1PXPA 2NRUA 2BAJA 3W8QA 3E87A 3WF8A 3R1YA 3G6GA 3KXNA 4I1ZA 4GKIA 4PDOA 5EDPA 3ZO1A 3OXIA 1R39A 4CFVA 5DN3A 4FEWA 2ERZE 3UPXA 4PP9A 4AAYA 4C8BA 3PXZA 1PXLA 3F3WA 3OCSA 4FKUA 5CEIA 3BRBA 4O7WA 3R9RA 3RWQA 4ZLZA 3QUDA 3PZEA 4XG2A 4O0VA 4OW8A 3LW0A 1CM8A 4RX7A 3D5XA 5CAQA 4EH4A 4DT8A 2VO7A 3R7IA 3TZMA 5T3QA 3Q9XA 1HCLA 2X8EA 1RW8A 3B8QA 4LL5A 4CV8A 4EOLA 3FMKA 3PP1A 3DA6A 4NW6A 2VX3A 2VTHA 3ODZX 1CMKE 4WSQA 2Q0BA 2X39A 1NVRA 2CJMA 4YJVA 4B8MA 2YWVA 2C6EA 4UALA 2C6OA 2V22A 4UBAA 4F6UA 5LVNA 5HCYA 3DBQA 4CT1A 4G17A 3BLRA 5TO8A 3AC8A 5JSMA 4NWMA 3ZS5A 2OJGA 4CD0A 4S32A 3ZONA 4FV8A 2VGOA 3FMLA 4RWKA 4AXFA 3AD5A 2QO2A 3CIKA 3WYXA 4D5HA 2ZM4A 3MFRA 1MUOA 1PKGA 3PVWA 1P5EA 1OPLA 1ZYJA 3OC1A 3BU5A 3P1AA 2XYUA 4F70A 4AGWA 3HRBA 4BTFA 3QUPA 4IANA 4WG4A 3FMEA 4YJQA 4AE6A 1NVQA 4IJ9A 4ZJJA 4FSWA 3TV4A 4FIGA 1HOWA 2BZHB 2R7IA 1JKLA 4G3DA 5AP4A 3QKKA 3OY1A 2B9FA 3NUPA 2J0MB 3BI6A 4IVBA 4AW1A 3W18A 3DT1A 3OMVA 3PXRA 1OKVA 3V6SA 5A6NA 2J0LA 3ETAA 4UB7A 5C26A 1QPJA 2J50A 4H3QA 3DNEA 4RWJA 3FI3A 5AA8A 5IA4A 1Q5KA 4NIFA 3TNWA 3QKLA 2BTSA 5K4JA 2J5FA 4A4XA 1SMHA 4ALVA 2XZSA 1PMVA 2YM5A 3NNVA 4AT4A 4NM7A 4ERKA 4HVGA 4USFA 3P4KA 2X8DA 2X6DA 3QLGA 2XVDA 3DTWA 3GC0A 1JAMA 4BJJB 4XG9A 4DDIA 4FNYA 1NVSA 4IZ5A 4RJ5A 2IW9A 1NY3A 1IA9A 5DMZA 3I5NA 3LFFA 4XEYA 2C5YA 3VUIA 4D0WA 4KABA 2X0PA 4D2RA 5IH5A 2J0IA 3P7BA 5BUEA 4YJOA 1O9UA 4OUCA 5HD4A 5JQ5A 4XBRA 3OW3A 5JRQA 2Z8CA 4Y83A 3U8WA 2W05A 3UIXA 2R3RA 2PZRA 3RAKA 3FKOA 4KINA 1FMKA 2XIKA 4M3QA 2BAKA 3R83A 4MEDA 3P5JC 4JX7A 4CRLA 4U43A 5KMIA 4D4RA 4C62A 4NFNA 4PWNA 3PPZA 3PSDA 4FYOA 4CCUA 2JDOA 1GAGA 4ONAA 4FV1A 1WVYA 2WIHA 3CEKA 3TZ7A 5IQGA 1W2DA 2QNJA 3S2PA 5CTPA 1V0OA 4Y85A 2GMXA 4GEOA 2XNMA 4QPAA 4UYNA 4D5KA 4EZ3A 4AN9A 4GUBA 3H3CA 4IAYA 2OG8A 3MA3A 3A7GA 4JBPA 4DHJA 3PPJA 4ZTLA 1J91A 2VV9A 1MQBA 3UO5A 3UOJA 3IS5A 3ZBXA 4OTGA 3C4WA 4JQEA 2NYAA 4DEBA 5HBEA 5CAOA 2W5HA 4I22A 5DEWA 3W8LA 2XK6A 3RWPA 3HV6A 5D10A 3VQHA 4C02A 1YOLA 4DDGA 4BDGA 3DK3A 5A4LA 3FC1X 4BDFA 1Q62A 3ELJA 4IMYA 4LGDA 5GJDA 4BWXA 2CDZA 2A1AB 4FR4A 3KCKA 3PVBA 3RZFA 4MH7A 2ZYBA 1R78A 3H9FA 3ORNA 2OF4A 4MTAA 5CI7A 3NUXA 1XKKA 3Q52A 3TDWA 4MWIA 4WKQA 3TV6A 5AUVA 5LVMA 4MUQA 2XIRA 3PFQA 5DR6A 1LUFA 2Z7LA 3RPOA 4WRGA 2GTMA 3JUHA 4V04A 5KMMA 3ZLXA 5IA5A 4BIBA 5CF5A 2QU5A 2WMAA 4R7IA 5ICPA 5DYJA 3QWKA 4DG3E 2ITUA 2VWXA 4CYIA 4FOCA 4BN1A 3MB7A 2YCFA 3NRMA 5K3YA 4AW5A 4EK8A 4IZAA 4M15A 4JT3A 4B99A 3VUDA 2HXLA 3GC8A 3EL7A 3KF7A 4IAZA 5GJFA 2HOGA 1ZOEA 2X2MA 5F94A 1M2PA 3LFDA 2WEIA 3LCDA 1YOJA 4KAOA 4ZSLA 4C4HA 5JEBA 4E4XA 4O0TA 4TL0A 2W96B 4FGBA 4HZSA 2HAKA 4CG9A 4MD9E 4Y95A 3U87A 1QPCA 4EHZA 3O8UA 1OL1A 2GU8A 3EQBA 4FSNA 3IW4A 4EOMA 4DTKA 3AKLA 3LFBA 4NFMA 4WG3A 3LMGA 3QUEA 3WE4A 5A9UA 4M84A 3MPMA 3Q4UA 5CS6A 2JIVA 3PRIA 3BWJA 4G6LA 5AUWA 3RAHA 2XK7A 1P4FA 4H39A 2XK8A 5LQFA 5CYIA 2OJFE 1WBPA 2VWVA 3OOGA 4GUEA 4I23A 3TJCA 1W2FA 2C5NA 4NKSA 5FD2A 4G16A 3D2KA 5L8JA 3TN8A 2BDJA 3WARA 3ORPA 3LQ8A 4EOPA 3LKMA 1ST0A 2UZNA 3SG9A 5ANGA 3RVGA 4CSVA 2IF8A 4IAFA 4QMVA 3S95A 4ZY4A 4S33A 5CSVA 4A9UA 3NUNA 4KUJA 3F5GA 4A4LA 3JVRA 3MJ2A 4HGSA 3FY2A 2LGCA 4L3PA 3P7AA 3UG2A 4QMNA 1JKSA 1ZARA 3PZHA 5DWRA 5CEQA 4JG8A 3TNQB 1W8CA 2Z60A 4I5HA 5LVPA 3HECA 2YM6A 4ITJA 2W17A 1PXNA 4UZDA 4A06A 4EJ7A 3CQUA 4J53A 3G2FA 2XNNA 2FSOX 4PL3A 4EHEA 2PU8A 3ZSGA 5ETIA 1U46A 2WQMA 3CLYA 4TNDA 3LXPA 1YRPA 2XNPA 3QHRA 5CZHA 3BGPA 3U6IA 4EC8A 3VRZA 4FEQA 3I6UA 3CQWA 2WHBA 3QYZA 3FL5A 5AP3A 3UNJA 4RIXB 3V8TA 4BY9E 4ASXA 5J7BA 3M2WA 2IZSA 3DLZA 2WAJA 2H8HA 2HZNA 4GT4A 4BBEA 4O7LA 3BX5A 4X2FA 5J5TA 5FEDA 2X0GA 4TNBA 2CNVA 2QO9A 2SRCA 4OTFA 4W9WA 3RALA 4PDPA 3LZBA 4FC0A 2CPKE 2WQNA 2JKMA 4K9YA 4V01A 5HE1A 4AAAA 3HRCA 4FVQA 5M4FA 3COIA 1SZMA 4U3YA 4FV3A 2O8YA 1ATPE 2VUWA 2ZOQA 1PXKA 4X2KA 4BCJA 3ENHA 4QRCA 4IFGA 3JY9A 4KIOA 3SAYA 5B0XA 2A0CX 3Q3BA 4OBPA 5AV2A 3NVKI 3KGAA 2R3OA 3MH1A 3PWDA 5CEKA 3FWQA 3FMMA 1V1KA 1G5SA 3BYMA 3GCSA 5CSHA 2VU3A 3KA0A 1B38A 4OBQA 1TFFA