2QU5A

Crystal structure of the vegfr2 kinase domain in complex with a benzimidazole inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
305
structure length
292
Chain Sequence
HAERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLADARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title Design, Synthesis, and Evaluation of Orally Active Benzimidazoles and Benzoxazoles as Vascular Endothelial Growth Factor-2 Receptor Tyrosine Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 292
sequence length 305
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qu5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qu5A01
3Q9XA 3QTWA 4RJ4A 3R8UA 3NZ0A 3NX8A 1KV1A 2EB3A 4BBEA 1BL6A 4AACA 4UWYA 1PKDA 3KMUA 4R3CA 2VRXA 3C0GA 3C51A 3IOPA 4EONA 2V5QA 4U97A 3MYGA 1H00A 4GRBA 2R3OA 5ICPA 3EL8A 5ETIA 2P2HA 1K2PA 3BZ3A 2RL5A 4G6NA 2YJRA 2XK4A 1Q62A 4JG6A 2ZMDA 4RFZA 3EHAA 2A1AB 3ZC6A 1RQQA 4FNYA 3OZ6A 5DRBA 3O0GA 4DLJA 3A7FA 4ZZMA 2J51A 4MXAA 3A62A 5ETFA 4BKYA 2B1PA 5AFVA 4V0GB 4U43A 2WTJA 3V8SA 4XLVA 1CKIA 5CZHA 4WD5A 4FL2A 1XH7A 2R7BA 4QMMA 5CS6A 5AM7A 4FZ7A 3WF8A 1WAKA 1Y8GA 2VX0A 3LOKA 3BWJA 2YDKA 2PVFA 3OCGA 4NM3A 1S9JA 4AXAA 2YWVA 3IECA 3BKBA 2E9UA 4PDOA 4GL9A 2OJFE 2UZLA 3P78A 1J3HA 4ZMEA 3CP9A 3ODYX 1WBOA 4Q9ZA 3MI9A 4FK3A 4RX5A 3KREA 3SHEA 5AUTA 4JVGA 3Q2MA 2QHNA 3F5UA 5JFWA 4C37A 1IASA 5IF1A 4R7IA 3QA8A 1OITA 5JFXA 3KCFA 3EYGA 3MH3A 2W7XA 3DJ7A 3F2NA 3FMMA 3RGFA 4IBMA 4JR3A 4RIWA 1PF8A 3HLLA 3LFNA 4YJSA 2W1CA 2VWWA 4WBBB 1JKTA 4U3ZA 3E87A 2VX3A 5FRIA 4DFZE 4G6LA 5HVKA 3NDMA 1PXIA 4YC8A 4RJ8A 2QOQA 3WARA 5GZ9A 2PUPA 4CZTA 5L6WL 5ITAA 3UZRA 5GINE 3NUUA 3ANRA 3UQCA 2XEZA 4YO6A 5AA8A 2BZHB 2WAJA 1H4LA 4IAKA 4QMTA 3MIYA 4RSSA 3RP9A 4EK4A 3RNYA 3V51A 4KSQA 2WMXA 1WBPA 2WMRA 4FTRA 4U6RA 5LVPA 2B7AA 4QMSA 2OZAB 4YSMA 3JXWA 4EUTA 4IWOA 3VUKA 4C59A 3DK7A 3UNJA 4CKRA 2ZV9A 3DCVA 1PMVA 4DG0E 4WUNA 5HO7A 4XG8A 1ZLTA 2Z7QA 4Y5HA 4LOPA 1W0XC 4GFGA 2WQBA 2KULA 4JRVA 4PPBA 3OWLA 4QP3A 5GHVA 3ORNA 2PWLA 3S3IA 2DS1A 5HTBA 3F5GA 4S30A 5KHXA 3E62A 4F99A 4ZY4A 5KHWA 2OXXA 3EN9A 4JBOA 4D58A 4XG3A 2WOUA 4LRJA 1GNGA 4E8AA 3LQ3A 3N4UA 2XCKA 4IIRA 4PTCA 3MFSA 4HPTE 3OW3A 2QOKA 4ZSJA 4TYHB 4B0GA 4C3RA 2GFCA 4L00A 4BCNA 2YFXA 4WG3A 3GU7A 2ETMA 4CD0A 3CY3A 3DBQA 3HZTA 1T46A 4HPUE 3W2QA 2HWOA 1UU8A 3PZEA 4J53A 4F09A 3QRUA 4Z7GA 2X8EA 4B9DA 3DK6A 1UU3A 1Q8UA 5HI2A 3VS4A 4AW2A 2YWPA 4I41A 4IB3A 3NR9A 2I0EA 4ZY5A 3B2WA 2CKQA 3U6HA 1VEBA 4HVHA 4BBMA 5GZAA 4IQ6A 3JY0A 3Q4ZA 2YCQA 3D5WA 2G01A 4DFYA 1ZYJA 4EH8A 3MIAA 3BYUA 4LGGA 1CMKE 4RLLA 2BAKA 3KB7A 3QFVA 3F3ZA 5DVRA 3L8SA 5FTOA 3CKXA 1FINA 4DINA 4DFBA 4KA3A 2CN8A 3WF9A 3FUPA 1M2QA 4NZWB 5CY3A 2VTPA 5FM2A 3ZFXA 3LQ8A 3ORKA 5CEMA 3GFWA 5KMLA 2ETKA 2I1MA 2YABA 3F9NA 3H9OA 1J1BA 3NIZA 4L3JA 4TW9A 2Y7JA 3DK3A 4YJUA 5EM6A 5HX6A 1WBVA 3W8QA 3LXLA 3DGKA 4AGWA 4UXQA 3FMNA 4WG5A 3EKKA 3QC4A 5JFSA 4F9AA 4L44A 1J7IA 2QOHA 1OIUA 1KV2A 2C6EA 4W8DA 3MFRA 4AOTA 5KZ0A 4CFWA 3LJ0A 3CLYA 4MXOA 4DA5A 4GJ3A 3PPZA 3G5DA 3WE4A 2BAQA 4AT3A 2O2UA 3I60A 4PP7A 3KMMA 4M68A 3L9LA 4Y73A 5E8ZA 2AUHA 3ZXZA 4BZDA 2BCJA 4ZIMA 3W2CA 4DFNA 2PPQA 4ITIA 2YM5A 4ZTLA 2C3LA 4BHNA 3PJ3A 2JIIA 5AR5A 1XQZA 2PVYA 3KMWA 1MRVA 1V0BA 2F4JA 4OTDA 5H9BA 1ZMWA 3OBGA 3H9RA 4MQ2A 2X1NA 3HP2A 5BUIA 4RX8A 3OCTA 4BDKA 3HMIA 3EFKA 2O8YA 5CEOA 4R1YA 4HGLA 4D2WA 5FBNC 4DH1A 3BEAA 1E9HA 2O3PA 3DXNA 4GMYA 5E92A 2OZOA 4HVIA 4V04A 4FG9A 4H3QA 3KKVA 4YZBA 3ZZWA 3QKMA 3VW8A 3WOWA 2GDOA 1OKVA 4Y85A 3V01A 3ZUVA 2YDIA 4YUQA 5LARA 4YR8A 2FGIA 4UEUA 3NLBA 2WZJA 5T3QA 5CASA 1QPEA 3TTIA 3R71A 4YLKA 2J0LA 3PA5A 5HO8A 2XZSA 4ZSEA 2YM4A 2GSFA 3TUDA 2H34A 3NW6A 3UBDA 4QT1A 5EI8A 3BBTB 5A54A 2QOCA 3GOPA 4BZNA 3HX4A 3PJCA 4OTPA 4AZSA 5JRQA 2OIQA 4O0VA 1GZ8A 4DEAA 2I0VA 5EHLA 5CSVA 2QU5A 3DDQA 2OJIA 3GB2A 4EOPA 4D1SA 2WGJA 4B99A 4BTMA 3CEKA 3F3WA 5EYCA 2GFSA 1DS5A 5CI7A 1YXVA 4ZLOA 3CY2A 4ZMFA 3FMJA 4TWOA 3FKLA 3KQ7A 3LM0A 3Q6WA 5CF6A 2B4SB 1SMHA 5HLNA 3EQBA 4FNXA 3FQSA 3OHTA 4G3CA 4MWHA 3D5UA 4I6FA 4WNPA 3V8TA 4C4GA 4DGMA 3PRFA 2CCIA 4GT3A 3A7IA 5J9YA 5F20A 4DBNA 4G34A 3CD3A 1V1KA 3SA0A 3LCTA 4QP4A 5ANOA 3TI1A 4F0FA 2VTRA 1ZY4A 4UN0C 3MTFA 1STCE 5HKMA 4WT6A 3R7VA 1CM8A 4DN5A 2X9EA 3IW4A 3C4CA 2C5VA 3OCSA 2YM3A 4Q5HA 4YTFA 3LXNA 3MVMA 1PMNA 5IEVA 3FQHA 3D4QA 4L52A 4BTFA 3VUIA 2X7GA 2CLXA 3OXZA 4BCPA 3SKCA 4OUCA 3KEXA 2WTDA 3SV0A 3TNPC 3UIUA 2ITPA 1ZARA 3HV6A 3N51A 4BDDA 3E7OA 3KXGA 5BNJA 3TDWA 3VWAA 4EUUA 3PPJA 5IUGA 3OMVA 3MN3A 3QC9A 2W9ZB 3DOGA 4W9XA 1WBSA 4AW0A 1Z57A 2QU6A 2UZVA 3VQUA 4DBXA 4WHZA 4BGHA 4C3PA 4MF1A 5A4QA 4BI0A 1IAJA 3IGGA 4PL5A 3UO6A 4E5WA 3RZBA 4DEDA 4L68A 5C4KA 4KS7A 5C03A 1YI4A 4I24A 4NFMA 3QRTA 3QQJA 1PXJA 3EKNA 5CSHA 3S4QA 4D1XA 4DEHA 3PA3A 3Q4CA 4HCVA 3U54A 5ANEA 3QQUA 4UMTA 1JKLA 2YIRA 5TF9A 3BCEA 2VU3A 2JDVA 2B54A 3FYKX 3UC4A 5L2TA 2OI4X 2QOFA 4KIQA 1AD5A 2OF2A 4WUAA 3RCDA 3ULIA 4A06A 4KIOA 4BTKA 4F4PA 4C4HA 4FODA 2R3PA 4KBCA 3UP2A 3ZLXA 2J0JA 4U0IA 4U40A 2JIVA 2XBJA 4QNYA 4AZTA 4TYIA 5CU4A 5LVMA 4FYOA 4IX3A 4MD7E 4QPAA 3CGFA 3VBTA 2UZOA 4C33A 3RAHA 4FTLA 4EKLA 2QLUA 4FKVA 3K5UA 5LOHA 3BHUA 3ORTA 3I0OA 3O23A 5DEWA 2ITXA 4QQCA 4LYNA 4X3FC 4CRLA 5IDPA 4DT9A 4LG4A 2F2CB 3S1HA 5GJGA 3R9DA 4L45A 4RPVA 4E26A 3VC4A 3QAME 3Q04A 4U5JA 5FDXA 3RTPA 3CKWA 4BCJA 4DH8A 1YHWA 3AC3A 2UVYA 4AF3A 4LMNA 5HOAA 3R63A 3UIBA 4FSTA 2VNWA 5K5NA 2XNMA 3Q96A 3I0QA 3QGWA 4E20A 2I40A 3E5AA 4FKRA 2Z7LA 3A4OX 3JY9A 4O38A 5C8MA 3BPRA 5C26A 4BVUA 1XKKA 2WU6A 4PWNA 1J7LA 1OM1A 4NM0A 5C01A 4HVGA 4MD9E 3PDTA 2BROA 3AGLA 3R7GA 2HCKA 4FV0A 5H8GA 3VRZA 4E4MA 4C61A 2NP8A 1R39A 3R02A 3BYOA 2YCSA 4FZDB 2X8IA 3E93A 3UPXA 3AXWA 2R3HA 4ZZNA 3DT1A 3NAXA 5EOLA 4AW5A 3KFAA 3Q2JA 3RM6A 2WMTA 4XG9A 4Z9LA 4ZSLA 5J7BA 4LOOA 3BU3A 4G31A 3ID6C 1PHKA 4HGEA 3R6XA 5H3QA 2WU7A 5KKRC 4ONAA 2HAKA 4X2NA 3D5XA 4DTKA 4F08A 4JX7A 3PIZA 4L8MA 2X2LA 3W2SA 4FTIA 4RWJA 2O63A 4U42A 1PKGA 3VNTA 1JLUE 5BYZA 4YHTA 4CT2A 3HRCA 5IQHA 3U51A 3QGYA 4IAAA 3MGYA 3E92A 2Q0NA 3K5VA 3MVLA 2HK5A 4DCEA 4YTIA 2ZDUA 5CQUA 4O96A 3O7LD 5IMEA 4XV3A 2NRYA 4N6YA 1LR4A 2OG8A 1LEWA 2C6OA 1PRYA 3TNHA 4FKGA 4KBAA 4PTGA 5F4NA 4AAAA 5CAUA 3CSVA 5M44A 3EFLA 4B8MA 4QYYA 4FIFA 2Y4PA 3ZSIA 2OJJA 3MA3A 5M55A 5LMBA 4CV8A 2WEVA 3MDYA 4WNKA 5AM6A 5AP4A 5IUIA 4U8ZA 5I9ZA 4O0RA 4S2ZA 3ZMMA 2XIKA 5E9EA 2OJ9A 4EK3A 1L3RE 1JSUA 4X3JA 5DEYA 4AFJA 5BUEA 3H0ZA 5C27A 3GCUA 2IN6A 3AC8A 2W4KA 4RWKA 4L6QA 4RIWB 2RIOA 3HV4A 4HJOA 3D9VA 2XNOA 5HLPA 5J79A 3GENA 4FKOA 1KSWA 5J7HA 3QRJA 3CJFA 3C5UA 2XMYA 4MX9A 2QHMA 4RZWA 5DT4A 5G6VA 3QLFA 1PXOA 4EZ7A 3A8WA 3QD4A 4EC9A 4E4LA 4IFCA 4UZDA 4G9RA 3NCGA 5FLFA 3OS3A 3OXTA 4CFUA 5TT7A 1NT2A 4XP3A 3FXWA 4RC4A 4OT5A 1BUHA 4GIHA 4PX6A 3P7CA 3HMMA 5IDNA 2SRCA 1CSNA 1X8BA 2Y9QA 2YCRA 3BGPA 3ORXA 4MTAA 5IA5A 5AX3A 4C0TA 4Z55A 5K4JA 4IVCA 1FBNA 4F63A 3NNWA 3BEGA 4AN3A 1ZAOA 4NJDA 3FSKA 1H1QA 2PVNA 3Q32A 5DE2A 5KUPA 2X4FA 4MKCA 4CCUA 1M7NA 3G51A 1LEZA 3GFEA 4F9CA 4H05A 2UW8A 3FMDA 1DI8A 1MQ4A 4OR5A 1Q24A 2HYYA 3B8RA 3V3VA 1XWSA 1P5EA 5AP2A 3HV5A 2G2HA 3LFBA 1YDTE 5AADA 3MESA 3R7UA 2F2UA 3VQHA 5K9IA 3ZEPA 3IDBA 3H10A 4OTHA 5M4FA 1XH8A 4ITHA 4TPTA 2BVAA 3ZZEA 4P5ZA 3FLWA 3WIKA 5BMSA 4ZAUA 4J97A 4TNBA 4FEVA 3RAIA 5E4HA 5FTQA 2HXQA 3E8CA 3MB6A 4LUEA 4FKIA 4CNHA 3GCPA 2C6TA 4FTUA 4FV1A 2W1HA 3S95A 3SGCA 3LLTA 4YZDA 3D5VA 5KBQA 4UX9A 4OTIA 4YNOA 4FV6A 4N0SA 2EXMA 3G0FA 4BCGA 5AEPA 4PNIA 3FDNA 3DZQA 3PLSA 5AP3A 2YAKA 1PMEA 4RJ3A 3DQXA 2IZTA 3OCBA 3ZO2A 4YPSA 2ITQA 5CU2A 3ZM9A 3FXXA 1BI7A 1YOJA 3FMKA 5M4IA 4LM5A 3W8LA 4IJ9A 3QYWA 3HRFA 5AV0A 5IQFA 4XNEA 4I4FA 1M52A 3LIJA 5HG5A 4BL1A 3VBYA 2B53A 4FSZA 4JDIA 2JITA 5IEYA 5L2WA 1V0PA 4PQNA 4F9BA 4I21A 2JEDA 4F1TA 3ZO3A 1OZ1A 1UNLA 4JRNA 5EDPA 1GIIA 4KKGA 2PZYA 4G6OA 3TEIA 4FUYA 4YTCA 5IA0A 5CAPA 2VWBA 3QYZA 3TV6A 2W1DA 3FJQE 5E8TA 5EM8A 5HTIA 1E1VA 4PDYA 1MUOA 4BR3A 3TJCA 1I09A 3BYSA 5JN2A 2OIBA 5DR6A 2JKOA 4N6ZA 1Y6AA 4KNBA 3KXMA 3VS1A 4JAIA 2GQSA 2J5FA 5K0KA 4KBKA 4BYJA 5I9UA 2EWAA 1A9UA 4IHPA 3ZOSA 3ZRKA 2ITUA 2YM6A 2GHMA 4J7BA 3RALA 4MBIA 3BGZA 1YXXA 3BBWA 5ETCA 2VO0A 4O84A 4ZOGA 3QX4A 1FMKA 3TZ8A 4K6ZA 4YJRA 5CALA 2BZIB 4O83A 5FD2A 4BCFA 4ASZA 4AX8A 3ZSGA 3W2PA 2J5EA 4A9UA 4RX7A 3P86A 1B6CB 3DDPA 4FV8A 4EHGA 2BKKA 4E5BA 3ET7A 5E8UA 3FXZA 3TIZA 3TKIA 3CR0A 3A2CA 4M12A 3ZFYA 3NAYA 4YGAA 3QL8A 1P4OA 2XVDA 3FHIA 3FLQA 4XCUA 2Y6MA 2VTLA 3JVRA 4CSVA 2YZAA 4I0RA 4F9YA 2WTKC 4YC6A 1Q97A 4UMUA 5HBEA 3SAYA 2VTAA 2C5NA 5ANJA 4DGGA 5J9LA 1WVYA 4FVPA 3R1NA 2BDWA 5K0XA 3W16A 1U4DA 5CYIA 3IOKA 1H1RA 4CMOA 4O7TA 5DT3A 5E1SA 4FIJA 5I3OA 3WI6A 4C4FA 2CKPA 2XB7A 3M11A 4JLCA 4JL9A 1PY5A 3IW6A 2J0KA 4GT5A 3KVWA 4BF2A 4PP9A 2LAVA 1GY3A 1H0WA 4C38A 5JMSA 5KMOA 3GNIB 1ATPE 4YC3A 3ACKA 1NY3A 1OIYA 5BVNA 2X0GA 4KS8A 3FL4A 1RW8A 2PUUA 2XEYA 2XK7A 2HWPA 2W06A 1F3MC 2R4BA 3IW5A 3UVPA 3AG9A 3R9HA 4IX6A 2C5XA 3RHXA 3PP0A 1ZYCA 5J95A 2E2BA 5E7RA 3FV8A 1UVRA 3UP7A 3F69A 3PZHA 3AD4A 4USEA 3BHHA 4V05A 3U9NA 1K9AA 3CQWA 1LP4A 3SRVA 5DH3A 1ZXEA 1ZOGA 1W98A 4KABA 4M67A 4YP8A 5HHWA 3WF7A 1W82A 4YJPA 1JQHA 3HEGA 5IQBA 4F0IA 1P4FA 4FTTA 3K3IA 5IG1A 5KZIA 2VWXA 4CCBA 4AZEA 3PSCA 3W33A 1BX6A 3S2PA 5CAOA 4ZY6A 4EOLA 4NYEA 2GTNA 3SXRA 1J1CA 1KE6A 2G2FA 1QMZA 3T9TA 2C3JA 4QMVA 5L2IA 1H1WA 3QZGA 4ZTQA 4FGRA 3MH1A 3GU6A 4KWPA 4BIDA 4J8MA 5HZNA 1IRKA 1WBWA 2R3IA 4DFXE 3E3BX 3VUDA 2YEXA 3UOHA 1ZMUA 1OVEA 2VV9A 4AE6A 2XP2A 4E6AA 3QCQA 2QKWB 4I5CA 1A06A 3A7HA 1JPAA 2XK3A 4H1MA 4O27B 1OECA 3IDCA 3NUXA 5AUVA 2Y4IB 3PUPA 1URCA 4ANMA 4XLIA 5B2KA 3D15A 4F6WA 5JZNA 4BWPA 1OIRA 5LCKA 4UWCA 3G15A 3GU8A 1Q3WA 4MCVA 4CRSA 2CGVA 2R64A 4FSUA 4DFUA 5KMKA 1PYXA 3UYSA 3V6SA 3LCSA 2H6DA 3FQEA 3N4VA 3FL5A 4I4EA 2C0TA 5FEEA 1JNKA 3QZHA 3Q4UA 5L2SA 5LVOA 3M1SA 4NSTA 4QNAA 4W4WA 3ERKA 4NH1A 4EZ3A 2PL0A 4J52A 3HMOA 3I7CA 4YHJA 4ZK5A 3QX2A 4KINA 4BI2A 5JH6A 1B39A 1KE7A 3ATTA 3TDVA 3W32A 2XYNA 3LJ2A 2WD1A 5T68A 4EZ5A 1NVQA 4DCAA 4OAVB 1OPKA 4GIIA 3OG7A 2OWBA 2JAVA 4U3YA 4BN1A 2YIWA 3QD3A 5DNRA 1M14A 4AT4A 5I0BA 1FGKA 3DZOA 2XKFA 3DS6A 5JK3A 5GIPE 5HIDA 2WHBA 1U54A 5CU3A 2FYSA 2HELA 3G90X 4D4SA 4FV4A 1GZNA 5C4LA 2WNTA 5CXHA 4JNWA 2UW6A 5E8SA 3RPVA 4O82A 5EQYA 3GCVA 4NEUA 4I93A 3TXOA 4EOOA 2A19B 2R0IA 4QD6A 5GNKA 4D9UA 3R8LA 1WMKA 3G6HA 3VULA 4ZXTA 4ANLA 2XA4A 2R3FA 4TXCA 3EB0A 4A9TA 3HAMA 3LMHA 2C6KA 5CX9A 3II5A 4M97A 4HNIA 1TVOA 3WZUA 3LHJA 3PJ1A 5HE3A 3PG1A 2PUIA 4BTJA 2FSOX 2JDRA 4QMLA 1OL2A 2IW8A 1YVJA 4QP2A 3EZRA 4X6RA 5EI2A 2QC6A 3QQKA 5AUXA 4C34A 2YDJA 2FSMX 2REIA 3LCDA 3PVWA 2V0DA 2LGCA 3HP5A 3O8TA 4PL3A 3V5LA 2JKKA 2VWUA 4G1WA 5DHJA 3A60A 5HD4A 1GIHA 3QRKA 4QP1A 4UY9A 3C0IA 3CQUA 4UB7A 3AC2A 4W4XA 5FXRA 3GC9A 5TE0A 4B7TA 4MQ1A 5E8WA 3R22A 3WZJA 4Q9SA 2BUJA 4I3ZA 3TUBA 4ITJA 3POOA 4UWBA 5CANA 3B2TA 4AUAA 2Y6OA 5LVNA 4EOSA 4RMZA 3DAJA 3THBA 2C1AA 3PLAE 2YA9A 3Q3BA 5CAQA 5AAGA 3P0MA 4M14A 3PIXA 1OL7A 4Y83A 5AP0A 2QOBA 3R0TA 4AE9A 4C4EA 3RZFA 4C8BA 3M42A 4D2TA 5HNIX 4KSPA 5HQ0A 4R7BA 4XV2A 4FUXA 4CFNA 3OEZA 5AAFA 3Q4TA 3P7AA 4GFMA 4E6CA 4APCA 1WBNA 4PMSA 2R3NA 3I6UA 3H0YA 4QTBA 5J8IA 5LQFA 4MH7A 3RHKA 2B9IA 2QOOA 2VTMA 4QTAA 2XRUA 4I5PA 3BU6A 4GJ2A 4H39A 2Z7RA 3ZDIA 5FTGA 3KU2A 1GZKA 3I4BA 2IZUA 3IGOA 5C8KA 3FSFA 4EK5A 3NYXA 4JG7A 4FKUA 2PU8A 4H58A 2GS6A 2ZM1A 1XBAA 1TKIA 4OTRA 3RMFA 2VTJA 4DEEA 5L6OA 2J7TA 4I94A 1G8AA 4R7HA 4NK9A 2A0CX 2XUUA 2J9MA 3GCQA 1LPUA 4IH8A 4LL0A 4WIHA 5HCYA 2CGWA 1GJOA 2RKUA 4C58A 3UPZA 1IA8A 5HIBA 4QRCA 4IB1A 1PXLA 4IC7A 1FPUA 4CTBA 4AWIA 3GI3A 3V5QA 4K11A 2X9FA 1Q41A 3O7LB 4DLIA 4FTMA 3KN5A 5AP7A 2OFUA 3EN4A 3WE8A 4OGRA 4FZAB 4WA9A 3MVHA 3NNVA 4MHAA 5KMMA 3ZS5A 4CYJA 4IMYA 2J4ZA 4YJTA 2PZIA 2HZ4A 2CLQA 3G33A 4U79A 5EDRA 1NW1A 4TKSA 3IG7A 2OLCA 4FSRA 4IM0A 3UVQA 1ZWSA 3PXYA 2PTKA 3R1YA 4QMPA 2X4ZA 5FGKA 3I5NA 1IR3A 2XK6A 5AP5A 4RFYA 4TYJA 5HGIA 4JJRA 5HIEA 4LI5A 3QKLA 2IVVA 2QG7A 1PYEA 5A9UA 4JDKA 2WMUA 3VN9A 4NW5A 5KO1A 4WBOA 2UW4A 2UW0A 4ERWA 2JDTA 4ZP5A 5J1WA 2WTVA 3NUSA 2VTOA 1W84A 4FT0A 3ZONA 5EHOA 5EHYA 4BCQA 5M51A 2BRBA 5DA3A 2Y0AA 2XNPA 5KKRB 2O5KA 1R3CA 5M07A 4FSNA 3UMXA 5CF4A 3EQDA 4FGBA 5HD7A 1DAWA 5JKGA 5IKWA 3LZBA 5JSMA 2UZBA 5AV3A 3ELJA 4EHEA 4CEGA 1I44A 5EOBA 4JBQA 3ODZX 2IG7A 3CXWA 4F1MA 4AFEA 1UA2A 3COHA 3E8DA 4L42A 1RDQE 3KK9A 2PMLX 4RWIA 1NXKA 5AR2A 1ERKA 2BR1A 3ZSHA 1FVTA 3OC1A 1GIJA 2WMAA 3EMGA 4QP6A 4CT1A 4Z3VA 3LXKA 1FMOE 3VS2A 1JWHA 3DA6A 3H4JA 3IKAA 5AP6A 3SC1A 2OH4A 4J98A 5AR4A 4IE9A 3NNUA 3ZC5A 1NVRA 3UG1A 5L8JA 2HZIA 4IXPA 4QQTA 4JT3A 4MXZA 4BCHA 3DJ6A 3P9JA 4F70A 5HORA 5HG9A 3DNEA 2GNFA 3ETAA 3GT8A 2FA2A 2PE2A 3S00A 4HGTA 5CTPA 3UIMA 3ZTXA 4ORKA 4YBKA 2NRUA 3BI6A 4XUFA 3NW7A 4FV3A 4JIKA 5D11A 4DH7A 1YDSE 4ANSA 3EQFA 1PXPA 3DAKA 3LFFA 4OTQA 3QTSA 4FKWA 5HE1A 5EYKA 5J87A 2W5BA 3AC1A 3ORIA 4HGSA 2C69A 3U6JA 4D9TA 3BX5A 3QTXA 5IQAA 4QMQA 3RWQA 4J8NA 2OW3A 3BV2A 3C5IA 5FDPA 3BRBA 4PY1A 3E7VA 5CSXA 4GS6A 1FQ1B 4CKJA 5DG5A 3OWPA 2QI8A 3BV3A 4DTBA 5DIAA 4MWIA 5AR8A 4UALA 3ZM4A 4ACHA 2C5YA 3IS5A 4BCOA 2EVAA 4M84A 1G3NA 3BELA 3D2IA 3I5ZA 5KE0A 2P4IA 2CPKE 3PSBA 2BRMA 3I7BA 3KULA 4FEXA 5F94A 3MFUA 1JSVA 2XJ2A 1H1SA 3FZOA 3P23A 4BY9E 3GQIA 2QVSE 5TKDA 3KRWA 1BLXA 4TTHB 2IO6A 3SLSA 2ETRA 2QOIA 5KNJA 4NFNA 5CENA 2C6DA 2HW7A 1J91A 3NUPA 4G17A 2EUFB 3TTJA 2RFSA 4G3GA 4AQCA 3DQWA 4RVLA 4M0YA 4NJ3A 1OBDA 3ZCLA 2IPXA 3QHWA 1A48A 4F9WA 2BFYA 4RJ5A 4BFMA 3LKMA 3QQHA 4W9WA 4XG4A 4IWQA 3TZ9A 2WQMA 2W1EA 1CTPE 3PXFA 4O7YA 1VYZA 3MS9A 4XP2A 3TACA 3OD6X 5J5TA 4Q2AA 4Y5QA 3FI2A 4FKJA 3VBVA 1SVHA 4DF3A 3OF0A 3LM5A 2E9VA 4CG8A 4M69B 5HBHA 2CNQA 4RVTA 3LLAA 3TZ7A 4XP0A 3UC3A 3ZHPC 2UZUE 5HG8A 3BIZA 3QTZA 4X6QC 4BDCA 3BLRA 4ZTNA 4DH5A 4EI4A 4O7VA 5LVLA 3V5TA 3EZVA 3MB7A 4XG7A 2CGUA 2PY3A 3QU0A 4QYGA 4TYGA 4BI1A 2ZM4A 4L46A 2XK8A 3IDPA 1Z9XA 5T6KA 3TM0A 5DFPA 1E1XA 4RIOA 4CQEA 5EM7A 2UW7A 5TR6A 3R9OA 3NVKI 4PDPA 4AZVA 3QQLA 2B0QA 3HVCA 3SRVB 5HU3A 5E1EA 5HO6A 3R7YA 2IW6A 2V7OA 4LUDA 5IA4A 4C2VA 4F7NA 4QMYA 3UO5A 4UZHA 1SYKA 4FT5A 4IWPA 4IJPA 3PG3A 2J2IB 2XIYA 2XIRA 4ZZOA 5JQ5A 3U6IA 3EQRA 4A7CA 3KC3A 2XJ1A 2OU7A 4YPDA 4JG8A 4EBWA 5E8VA 2Z60A 3MH0A 4FNWA 4IDVA 4GG7A 5CEIA 3CCNA 3ORLA 3QD2B 2QO9A 5M4UA 2VGOA 4KB8A 3AGMA 3DLSA 4O7LA 2IW9A 2R3KA 3GU4A 1H25A 3TKHA 3VS0A 2BKZA 3NNXA 4DE4A 1VYWA 2UZDA 2HZ0A 1QPJA 3FI4A 2X2KA 3KCKA 3QCSA 4EH3A 4ASEA 2PULA 2OXDA 1Q5KA 3F2RA 4R5YA 4ZTSA 1R0PA 2RG6A 4M3QA 1PXMA 4PRJA 3G9LX 4ERKA 3EN7A 4HVSA 3RINA 5AUZA 4IZ5A 3VAPA 4F0GA 2DQ7X 2R3QA 1YDRE 2RSVA 3TWJA 4FKSA 3RI1A 4RVKA 2C3IB 2X39A 3BGQA 5CSPA 2W0JA 2C6LA 3EH9A 3HECA 3KY2A 1YOLA 4W8EA 5EH0A 2AC5A 3QTIA 3P7BA 3H30A 1ZYDA 3VBXA 4JQEA 3PY0A 1JKSA 5DR2A 3ULZA 3WZDA 4IACA 4R8QA 2W17A 5IQEA 3P79A 4O1PA 1H1PA 5D7VA 1FVRA 2AC3A 3FLSA 2C47A 5B0XA 3OEFX 2F49A 5ANKA 3OOGA 2FH9A 4WG4A 4FVQA 4USDA 3UYTA 5I5ZA 3HYHA 3Q53A 4E7WA 3LJ1A 2OICA 4FV5A 3RM7A 4Z16A 2UVXA 3QF9A 3NRMA 4O6EA 3R8ZA 4R78A 3UZPA 2XIXA 4L43A 1YOMA 4FKQA 2XIZA 2OBJA 2XCHA 4OT6A 3FZ1A 1TQPA 4CTCA 2VZ6A 3AD6A 3FAAA 4E4XA 1ZRZA 5E8YA 3UQGA 1Q99A 2YLFA 3FKNA 4AN2A 2XS0A 3BHTA 2Z8CA 3ZLYA 1U54B 3RK5A 4FTAA 3EQGA 3G2FA 2UZTA 5ANIA 3VHKA 4FKTA 3WBLA 3F3TA 4MBJA 2C30A 5E8XA 4NU1A 4CLJA 4C3FA 2O64A 4BWXA 1U5QA 5AV4A 2H9VA 2ZMCA 4X3FA 3PP1A 5AA9A 4L01A 3NYOA 3O8UA 5EK7A 4NW6A 3VVHA 3C4EA 5A4TA 3BLQA 4FIHA 3AT4A 2VO6A 4FSQA 3DY7A 4I6HA 4DTAA 4X2FA 2WQOA 1BKXA 3MJ1A 4DEGA 4GH2A 2VTIA 3QQGA 2AYPA 2R0UA 3ACJA 4IX5A 1YWNA 3ROYA 5IA2A 5BVEA 1URWA 2XKEA 2OFVA 3TT0A 1M7QA 1SM2A 2PSQA 4QMOA 4DGNA 4FSYA 1M2RA 4ZS0A 3L8PA 4NKSA 5BVFA 4LRMA 5DWRA 2ESMA 2JAMA 3QZFA 3SQQA 5BVKA 3ZDUA 4M15A 2XRWA 3B8QA 4FYNA 4JR7A 3DKOA 5TOZA 4CKIA 2ZYBA 3BHYA 3QBNA 3QQFA 2B52A 4IX4A 4TWCA 4EQUA 2DUVA 1RE8A 4IWDA 2W9FB 3F2AA 5EW9A 1H27A 2JBOA 3T9IA 4R77A 1AGWA 2GNLA 4QMUA 5C9CA 4N57A 3HNGA 3AC5A 1APME 3E64A 4IM3A 3O71A 4BDJA 5IA3A 4X0MA 4HZSA 3VO3A 4JXFA 4EOIA 3KXZA 2HY81 1YHSA 5CVGA 5L8LA 2VUWA 4FIEA 4H3BA 4BCIA 3HUCA 3DPKA 1WCCA 3GC8A 3UG2A 3ZXTA 5M53A 3R73A 3ZRMA 2WQNA 2I7QA 4BDBA 3EQIA 2UV2A 4A07A 4ZLYA 5D7AA 2JLDA 2VAGA 3F66A 4FMQA 4BDHA 2W1FA 5JFVA 3TCPA 1ZYLA 2F9GA 5CEQA 5A4LA 5CQWA 4LGHA 5D10A 1ZZLA 3PTGA 1U59A 3TJDA 2XKCA 2RF9A 4XYFA 4C02A 3V5JA 4AZFA 3VBQA 3ORZA 4D2VA 4BDFA 2C3KA 2YITA 1XH6A 3RAKA 4EH4A 4JX3A 4CMUA 3PXRA 1CKPA 4U44A 5CLPA 4R3PA 1OB3A 5EKOA 5A6NA 3DJ5A 3EQPA 3E8NA 2QONA 5DN3A 5ACKA 3T8OA 4CLIA 4GKIA 3R8PA 5LWMA 4DGOA 3G9NA 5HNGA 5M06A 4JQ7A 2BRHA 3R9NA 1SZMA 4XOZA 1OI9A 5EKNA 4QP7A 4IEBA 2PZPA 4DH3A 5LMKC 4O22A 5EW3A 4XOYA 3RWPA 4MF0A 4MVFA 3GCSA 2CDZA 2R3MA 3CIKA 1KE9A 1VZOA 3NWWA 4FOCA 4KKHA 5CI6A 4ANBA 3UDBA 3A61A 3O8PA 4IZYA 4NKAA 5AIKA 1WZYA 4OBQA 3E63A 3ZUTA 4P5QA 4ZS4A 5IQGA 1KWPA 3DFCB 2JFLA 3R7OA 2HZNA 4K0YA 4QO9A 3HGKA 1H07A 1ZY5A 5JGAA 4R1VA 3OW4A 3LXPA 2JKQA 4RC2A 4RA5A 2FSTX 3DBCA 4TRLA 4K18A 4RIXB 3CE3A 1OUYA 5BYLA 4MNEB 5E91A 4ZJJA 3SXSA 2ZM3A 5GIOE 1OPJA 2ITOA 2JC6A 4TN6A 4E1ZA 4FL1A 2GNGA 3KK8A 2IZRA 5LMAA 4AS0A 5EQPA 4EQCA 2BPMA 3MW1A 3CPCA 4GG5A 3D94A 3ORMA 4G5PA 4LV8A 4IVAA 4UBAA 4XJ0A 1ZZ2A 3ZFMA 4A9YA 5CT7A 3A8XA 2VO3A 4D2SA 2DYLA 4BCMA 2PHKA 3FLYA 2CKEA 4RVMA 2BZJA 1H28A 5IEXA 5KBRA 1U46A 1K3AA 4J99A 3R8VA 2PMIA 3VS5A 4D5HA 4XBUA 3JPVA 1OL6A 3PY3A 4TT7A 3VS6A 5KMJA 4X21A 4GU6A 5D41A 3PXQA 1ZOHA 3ITZA 3QCXA 1OGUA 3FMLA 2JDOA 4M69A 2UW5A 4L3LA 1V0OA 3NYNA 4U9AA 3UTOA 4IAYA 2YIYA 2ZB1A 3KRLA 5FM3A 4ACDA 4FT9A 4LOQA 3GGFA 3LFSA 3PYYA 5D9HA 5DRDA 3GC0A 4LGDA 1UNHA 5CNOA 4YZMA 4AT5A 4AU8A 2BRGA 4PPCA 4GEOA 4ENYA 3K3JA 4ANQA 4G3FA 3WZEA 3GUBA 3BE2A 3RAWA 4D1ZA 2Q0BA 2GS2A 2XBAA 3KXHA 3PPKA 5BVDA 3R7EA 4RX9A 4APPA 4FTKA 5IUHA 5L8KA 5B2MA 2R3GA 3TG1A 1R78A 4HW7A 3PJ2A 2GHGA 2ZV2A 3UNKA 2PYWA 1YWVA 3FLZA 4I0SA 2X8DA 3FPMA 2CNUA 4AOIA 4FV2A 2XNGA 4MAOA 5HX8A 5AJQA 3VUHA 4J1RA 4CFVA 2YM7A 4FTCA 4R5SA 4EH2A 3SOAA 2PVLA 3MWUA 5TO8A 1ND4A 1KE5A 1YHVA 5IH5A 2BDJA 3KULB 2W05A 3C7QA 2UZNA 2VNYA 1VR2A 1Q8ZA 3QTQA 4QOXA 1OL1A 5DBXA 5LMKA 2EB2A 3VBWA 4IZAA 2WO6A 5EDQA 4FSMA 4IW0A 4P4CA 2QO7A 4O0TA 4PUZA 3CJGA 3EWHA 5CNNA 3TNWA 3F5PA 2E9NA 1H26A 3Q6UA 5HTCA 2BILB 2ERZE 5KMNA 5K5XA 3CQEA 2G9XA 3DBFA 3WILA 4RRVA 5ETAA 2QKRA 1DAYA 1G5SA 3MVJA 4D0XA 2NNWB 3ZUUA 1OUKA 3HRBA 3TNQB 4O86A 3ZEWA 4AW1A 2W96B 1XH4A 5C1QB 4MXXA 4JQ8A 1O9UA 3F3UA 4IC8A 4OTGA 2HXLA 3KL8A 4R3RA 5AR3A 4U80A 3NIEA 4KRDA 3DV3A 2Y8OA 2OSCA 2EU9A 3KRJA 5L2QA 1CDKA 3V5PA 5FUTA 3QKKA 1QL6A 1ZMVA 3MPTA 5LXMA 4H3PA 5DGZA 1P2AA 4D28A 3SW7A 4O7RA 2VN9A 2FUMA 3PY1A 2VTNA 2PVHA 2I6LA 4II5A 1REKA 2C1BA 1Y8YA 3DBEA 5IH6A 1UWHA 2PZRA 3R83A 4RBLA 2V62A 4FA2A 5IQCA 3QA0A 5M4CA 3MBLA 3IW7A 4O81A 5E90A 4G3EA 3RPYA 4FR4A 4DEIA 3RNIA 3DB8A 2HOGA 4QPSA 4QTDA 5JT2A 3BLHA 3U4WA 4QMNA 4QQJA 3KN6A 2XNNA 1NA7A 3MH2A 4GW8A 4BWKA 4ACMA 3POZA 1HCKA 4XMOA 4C4JA 1B38A 1FVVA 2KTYA 3OT8A 3CTJA 2Z7SA 2WXVA 4YLJA 2BDFA 3RKBA 4F64A 2QCSA 4FX3A 5C8NA 4EL9A 4EJNA 4TWNA 2Z02A 3LPBA 4GVJA 5DI1A 3AD5A 3NUNA 5LCJA 4K77A 4UMPA 4YTHA 4YJVA 4GK2A 4YJQA 4BB4A 3SVVA 1KUTA 3HMPA 2JFMA 1Q4LA 2F57A 2J0IA 1BMKA 3CTQA 3ENMA 1WVXA 5F95A 3ZU7A 1IEPA 3V6RA 3VJNA 2W5AA 3W2RA 4CZUA 3O51A 2H8HA 1J7UA 2XNEA 3HUBA 4QMWA 3F61A 3BYMA 3PXZA 4IFGA 2C0OA 2UZEA 3HA8A 3Q60A 3OY1A 5FXQA 2OH0E 3O17A 2UW9A 5GZ8A 4WRSA 4JBVA 4BYIA 4D4VA 1Q8WA 4XS2A 1XR1A 1H01A 1RJBA 2WKMA 4E3CA 3Q9ZA 2X2MA 2VX1A 3E88A 4NCTC 3FYJX 4C7TA 3SD0A 3AQVA 3JVSA 3SG9A 3F5XA 3FMHA 4FICA 3IONA 4AG8A 4OW8A 4A9SA 4RZVA 4B6LA 3CGOA 4J95A 2JIUA 1YXTA 3MY0A 2ITZA 2ZDTA 4FKPA 4WSQA 3VW6A 4C4IA 1UKIA 2GS7A 3GC7A 3LMGA 2CNVA 3R01A 3SX9A 3L8XA 2R9SA 4U45A 1JSTA 5ACBC 3EFJA 4AP7A 4CFFA 2QURA 1LUFA 2JBPA 3ZBFA 4RGJA 1XO2B 3W10A 2CHLA 2QOLA 3EQHA 4FG8A 3AC4A 4A9RA 4ZJIA 4E5AX 3DKGA 4I1ZA 3ORPA 4GCJA 1OL5A 2PMOX 4JDJA 4D4YA 5HLWA 4TZRA 2OF4A 1KOAA 2V7AA 2P33A 3JUHA 3PVGA 4QQ5A 4E6QA 4EKKA 5BYYA 3EN5A 2P55A 3TIYA 3ZLSA 3MY5A 4ZTMA 4AGUA 4FOBA 2XNBA 4QTEA 5HVYA 4FEWA 4X3FB 3R2YA 3PA4A 4ZTRA 2CJMA 4EYJA 1QPDA 2I0YA 4YO4A 1GZOA 3HV3A 4QYFA 5I9WA 3JR1A 3DKCA 3L1SA 4AA4A 1P14A 2BAJA 5A4EA 3C4ZA 4ALVA 4NIFA 3L9MA 4YHFA 2C68A 2IVUA 2W4JA 4ANOA 5DOSA 3P5KA 5CEPA 5L4QA 3NW5A 3QUDA 4J96A 3LMIA 1WVWA 3VUTA 2YLEA 4FK6A 3CTHA 2P2IA 3FBVA 4KAOA 4ZSGA 3OWKA 2VWVA 2VTQA 3E3PA 3PE2A 2B9HA 2R3LA 2ZVAA 4GUBA 4XG6A 2ZV7A 4YZCA 5CVHA 2IJMA 4B4LA 4O7SA 2HENA 4RQVA 3D0EA 4U7ZA 2RFDA 3FMEA 3R04A 3TUCA 3PXKA 4E6DA 3EN6A 1TQMA 1YQJA 1JBPE 3L8VA 4F7SA 2X7OA 3FY2A 4ZJVA 3VUMA 2B9JA 2GU8A 3C1XA 4JBPA 4NM7A 1XHAA 4NWMA 3ZLWA 5IQIA 5A6OA 2BIKB 1O6LA 2J90A 5IPJA 4OAUC 1MRUA 4XX9A 3K54A 4PDSA 1PMUA 4ASXA 3ATSA 1TQIA 3EQCA 3FI8A 5CSWA 2H96A 2F7XE 4IANA 3LFCA 3PVBA 3S0OA 4H1JA 5H8BA 5F9EA 1NVSA 3D7TA 4RIXA 2RG5A 4LQMA 4FT7A 4W4YA 3P1AA 4MNEA 3U4UA 3DBDA 4NCTA 4TNDA 1H0VA 4KIKB 4IADA 2BRNA 5LJJA 4O21A 1ZYSA 2W5HA 5AAEA 3QALE 4F7LA 1ZOEA 3HDNA 4I6BA 4HYHA 5AUWA 3UOJA 2VWIA 4BGQA 3PE1A 2RGPA 3F82A 4EYMA 5AR7A 1HCLA 4ZTHA 3N9XA 1SVGA 4K33A 5I4NA 3DLZA 3NPCA 4XG2A 3R1SA 4OTWA 4DHFA 4Y95A 3WYXA 3ZYAA 2PE1A 4BKZA 2BHHA 4FSWA 3QUEA 3TL8A 1S9IA 2YISA 2F7EE 5M08A 2Y4IC 3FC1X 2BALA 5D1JA 4FNZA 1UWJA 1Q3DA 3UOLA 4X2KA 3QTUA 1QPCA 1SNUA 4BC6A 3NVMB 5IA1A 3MY1A 1O6YA 5IU2A 2PK9A 2ITYA 4O7NA 2VWZA 4MD8E 3MSSA 3FHRA 1EH4A 4N70A 3U87A 4YU2A 4PMMA 4RA4A 1UV5A 4F1OA 3SW4A 2OKRA 5EYDA 4H36A 4HYSA 4QYHA 3CC6A 3TN8A 3LFDA 3P4KA 4AN9A 2PE0A 5J1VA 2ZV8A 4BHZA 5CU0A 3NUAA 3JYAA 3ZRLA 1Y6BA 2ZJWA 4EC8A 5B2LA 4FIIA 3NCZA 2C4GA 4FZFB 4V01A 1JAMA 3TNIA 4L7FA 3LVPA 2OXYA 3HAVA 3F7ZA 5AV2A 4USFA 2ZOQA 4Z7HA 5A4CA 5I3RA 2E9OA 4CGAA 1GAGA 4ZLZA 1H8FA 3C4XA 3FZTA 3OTVA 1OKWA 1SNXA 2QG5A 3OFMA 4IB0A 4O0YA 1YKRA 4OTFA 3UNZA 2R5TA 2QD9A 4FL3A 5JGBA 3O2MA 3UODA 4XEYA 5BVOA 4ALUA 5BPYA 5M09A 4CG9A 1KE8A 2X7FA 4FTJA 4Y8DA 2PZ5A 4FT3A 2C0IA 4AA0A 4IVDA 2R2PA 4TWPA 2A2AA 2XM9A 3OVVA 1QCFA 3QRIA 5HESA 1BYGA 3LCKA 3OTUA 5KCVA 3R1QA 2ITTA 4BICA 4FV7A 2BZKB 4QTCA 2G1TA 2EXEA 3IO7A 2WEIA 1KOBA 3BWFA 4A4OA 1Q61A 3IK3A 2UZWE 4AGDA 4D2RA 1G8SA 4MYGA 4QMXA 3OBJA 3LCOA 1YRPA 2WMVA 3NMUF 2J6MA 4G5JA 2XYUA 4TY1A 4R6VA 2ACXA 4LV5A 4A4XA 2GCDA 2ITVA 3FEGA 4EBVA 4D0WA 2CSNA 2Z2WA 4MEDA 4N4SA 4O0WA 5EFQA 5CF5A 5AX9A 3V04A 3IPHA 4I20A 4P7EA 4BIEA 3KRRA 3FI3A 3LW0A 3QHRA 3QUPA 4GU9A 1BL7A 3MTLA 4L53A 4OLIA 3FWQA 3R8MA 4CFMA 2GHLA 5HBJA 5L6PA 3AT3A 4DC2A 3N4TA 3LFQA 3LE6A 5HE2A 3LFAA 3KF7A 5EI6A 1FGIA 3OUKA 4O0UA 4BGGA 3VUGA 4WKQA 2CCHA 4EHZA 4WRGA 3CBLA 4FI1A 1Q8YA 3W18A 4M0ZA 4IB5A 4RIYA 4GT4A 3K2LA 3VS3A 4K9YA 4UYNA 4G9CA 3UJGA 3HL7A 1GOLA 4PMTA 4YNEA 3ALOA 1XBBA 2QR8A 2F7ZE 3OOMA 2A27A 1L8TA 4DT8A 3QWKA 1R0EA 4EOQA 4S33A 2W4OA 4EWQA 5HG7A 4UMRA 3UOKA 5A14A 2XKDA 4P90A 1MP8A 3QXPA 5CZIA 2BTSA 3C0HA 5DLSA 4EH7A 4W4VA 3RK9A 4QPMA 4EOMA 3I1AA 3I79A 5I9VA 1R1WA 4RLKA 4S34A 5HCZA 3W55A 4G16A 3OXIA 3C13A 4XH6A 3UE4A 4DG3E 4XBRA 2ITWA 4RWLA 1DI9A 4PNKA 4JS8A 4YMJA 4V0GA 1CKJA 4CYIA 3PWDA 4HCUA 3I6WA 4UXLA 4EOKA 3DXQA 2EXCX 2X6EA 3FLNC 4MXCA 4MXYA 1WFCA 3DKFA 1YXSA 4FG7A 4DFLA 3C50A 4HCTA 4ENXA 3FC2A 4EWHA 2WTWA 4S32A 4F6UA 4L7SA 5ANGA 5IMXA 4B8LA 2RFEA 3KRXA 5JQ8A 2QO2A 2RFNA 4IVBA 2VWYA 4X2JA 4O0SA 5HCXA 1IAHA 3RPRA 3BU5A 3LFEA 2YZLA 2QR7A 4WSYA 5M56A 4K2RA 3QXOA 2XK9A 3PWYA 4O2PA 5FWKK 5AP1A 2R7IA 3TV7A 4EHVA 1SVEA 2FO0A 5FQDC 4BZOA 2ONLC 3NUYA 2G2IA 4IZ7A 3UIXA 5BX0A 2JKMA 1W83A 2WTKB 2CMWA 4RJ7A 2UW3A 3LQ5A 4X7QA 2O0UA 2WOTA 1BI8A 2PMNX 2W1GA 1MRYA 3MJ2A 2GNIA 3WF6A 3Q5IA 3FZSA 1OIQA 2BIYA 3JS2A 3Q52A 4GSBA 4Y72A 4CXAA 5K4IA 3SOCA 5AIRA 5IZFA 2WPAA 3A7GA 4GYGA 3VJOA 4C35A 5H8EA 1MQBA 2YCFA 4D5KA 4Y46A 4M66A 3D14A 2OJGA 5CT0A 4E93A 4O1OA 3PIYA 3G0EA 2UVZA 3L9NA 3WYYA 5KMIA 2OZAA 2GQGA 4G2FA 4XV9A 1Y57A 3DNDA 2J50A 1F5QA 3COIA 3EL7A 4O91A 4AOJA 2GQRA 1T45A 4GV1A 4UYAA 3C4WA 2R3JA 3C4FA 3H3CA 5BQ0A 3U9CA 2CGXA 2XJ0A 4JDHA 2PVJA 3I81A 5BMMA 3HV7A 2FB8A 3KVXA 4PPAA 4GFOA 3QCYA 1PJKA 5CVFA 4LL5A 4NTTA 3R00A 4NTSA 5FG8A 3GQLA 2WIPA 1JVPP 2YHVA 4GUEA 5HICA 5GJDA 3RK7A 4IAZA 5JZJA 1YW2A 2ERKA 3V5WA 4TYHA 4OBPA 3V8WA 3DTCA 2GNJA 2V22A 4BRXA 3IQ7A 4FEUA 3D83A 3UQFA 4ZEGA 3C9WA 4FTNA 2VTTA 3NYVA 2Q83A 3CD8A 3EIDA 3DFAA 4A4LA 4ALWA 3D2KA 5DYJA 5A46A 3GBZA 1W7HA 3EJ1A 3HMNA 4GYIA 4PL4A 3TKUA 3UZTA 3FY0A 3DU8A 2YJSA 5BVWA 4HVDA 5CXZA 4FEQA 2J0MB 3FKOA 4I6QA 1UU7A 4EOJA 4EH9A 4JAJA 3BE9A 4J71A 3EFWA 2VTSA 4ACCA 2C6MA 3AT2A 3MA6A 4I5MA 3NSZA 3LAUA 1PW2A 5GJFA 4YBJA 5FEQA 2JGZA 5A3XA 3QTRA 4M7IA 4QP8A 2A4LA 4AZWA 4YZ9A 1Y91A 2VTHA 3T3VA 4YSJA 2OGVA 4FIGA 4O2ZA 2BFXA 4I0TA 5HNBA 3DTWA 2FVDA 3AMYA 4BDIA 3U8WA 4ANNA 2WQEA 4TL0A 1Q8TA 2WFYA 5BUJA 1W8CA 3QZIA 4XHKB 4YJOA 5L3AA 2QLQA 4OBOA 3MV5A 1XBCA 2WIHA 3A7JA 2ONLA 4E73A 1REJA 2P3GX 4ASDA 1IG1A 4WNMA 3ZO1A 3D7ZA 2OIDA 3E8EA 2YERA 4M8TA 2B9FA 1DM2A 4KRCA 1H08A 4EK6A 5AMNA 3VF8A 4CV9A 4F6SA 2WMQA 4KIKA 4FE2A 4BBFA 5I9XA 5CAVA 2I0HA 4MBLA 1Z5MA 3VHEA 2W99B 5FBOA 2C5OA 2YAAA 3R28A 4CFXA 3FE3A 4KUJA 3QD0A 2XF0A 3GU5A 4QP9A 2PVMA 2CKOA 3CS9A 4C62A 4IAFA 2B55A 4AA5A 5IH4A 3KF4A 3COMA 4I92A 4TYEA 4NL0A 5HVJA 3VIDA 4WO5A 4YJNA 2NPQA 2R3RA 3PFQA 5HE0A 2G15A 4EH5A 4P2KA 4O6LA 2BTRA 4QYEA 4Q5EA 3KXXA 2DWBA 5IQDA 4YLLA 4NIFB 3R7IA 3WIGA 4AGCA 3P08A 4KKEA 5DMZA 4L3PA 3GXLA 3L9PA 3BHVA 4WNOA 4EK8A 4F7JA 3DXPA 4BDGA 3TZMA 1OPLA 3R9RA 2OK1A 5M57A 3A99A 4DEBA 3F6XA 2WB8A 3MFTA 2FSLX 4EH6A 3VF9A 2OO8X 4HOKA 3R2BA 4CVAA 4FTQA 4CZYB 3ALNA 3NS9A 3Q9WA 4NT4A 5EG3A 3ANQA 3WZKA 5H2UA 1OBGA 2JD5A 4IDTA 4FTOA 3OY3A 2ITNA 1O6KA 4ARKA 1XJDA 4HYIA 1F0QA 1XH5A 4ACGA 3RPOA 3QWJA 5I9YA 4D4RA 5B7VA 3VRYA 2PVKA 3O50A 3G6GA 4EJ7A 2YIQA 4GKHA 5JGDA 4HZRA 4DAWA 1XH9A 3OROA 4L67A 5JRSA 4D2PA 4CQGA 3PJ8A 2W1IA 2O65A 4LRKA 1YWRA 3F88A 4M13A 3REPA 1WBTA 3RCJA 2YIXA 2HY0A 3D7TB 3HDMA 4K1BA 3RBWA 2PVRA 3KXNA 1UU9A 3FPQA 3OUNB 3QLGA 4C57A 4U81A 2YN8A 1PXKA 2YM8A 4FF8A 5HEZA 5D12A 3IW8A 1YI6A 5K3YA 4C2WA 3DB6A 4DYMA 4BCKA 4IAIA 4NUSA 3W2OA 5CF8A 3RPSA 5EYMA 2ZAZA 3T3UA 4YURA 2P0CA 3PSDA 3WF5A 4C36A 2XH5A 2WELA 4O7WA 4O7ZA 5FXSA 4CMTA 3Q9YA 2QQ7A 3KA0A 4K8AA 4FZ6A 2WTIA 2XM8A 4BIBA 5KX8A 2VO7A 3R21A 4ID7A 4RC3A 3F7WA 4YZNA 2UUEA 2GMXA 3HA6A 2IVSA 4RG0A 3VS7A 3BQCA 5F1ZA 3SDJA 3PRIA 4DG2E 2NO3A 5ANDA 3DAEA 4XRJA 4EORA 4ZSAA 5FP5A 1FOTA 4BDEA 2PUNA 3FZPA 3AMAA 4KD1A 5J5SA 4GVAA 3EYHA 4MK0A 4PMPA 1U5RA 2W1ZA 2X6DA 3R30A 4XRLA 5FEDA 2E9PA 3UGCA 4PF4A 2VD5A 2GNHA 4HYUA 3M2WA 4JI9A 5CWZA 3ZH8A 3HKOA 3RJCA 3OT3A 4RJ6A 2WMSA 3OWJA 2BHEA 4I22A 5DPVA 3COKA 3MPMA 5EW8A 1UKHA 3PVUA 4I5HA 2WMWA 3ENHA 3UMWA 3ZBXA 4LFIA 2BMCA 2JDSA 1PXNA 4E4NA 3TV4A 1IA9A 4L9IA 2QODA 4FBXA 4IM2A 1JKKA 2VGPA 4RQKA 5EM5A 4DGLC 3SG8A 4I23A 1AQ1A 2WMBA 2C6IA 2IVTA 1YXUA 4EQMA 5EQEA 1M17A 5CU6A 1OKYA 5AV1A 5IISA 2GPHA 4FVRA 1H24A 3GVUA 3OP5A 4PV0A 3GP0A 4BKJA 4GK3A 1OKZA 4FC0A 5FP6A 4HNFA 1M2PA 4GK4A 4UV0A 1OMWA 3MPAA 2ZB0A 4NM5A 4WOVA 3GOKA 3ROCA 3SXFA 1VJYA 4QMZA 1UNGA 4G3DA 4RFMA 5DR9A 2HIWA 3UO4A 3BQRA 4LMUA 3F3VA 5AWMA 2QNJA 4BDAA 4MNFA 4U41A 5LWNA 5DT0A 4O0XA 3UVRA 2X81A 4RT7A 3O96A 3AOXA 4FKLA 3GEQA 3CPBA 2WTCA 1HOWA 3EOCA 2CN5A 2YACA 3KGAA 5AUUA 5CEKA 4FV9A 3NEWA 4X2GA 3RVGA 4D55A 2GTMA 3H9FA 3Q5ZA 4PTEA 3W1FA 4EEVA 3A4PA 5HU9A 4KIPA 3FZRA 2V55A 2IZSA 3BYVA 3U55A 3ZO4A 3NGAA 5J9ZA 4UMQA 2IWIA 1YI3A 5G1XA 4RIYB 4S31A 3AMBA 2HW6A 4F65A 4XV1A 5AUYA 5JEBA 4JOAA 4JIAA 1JOWB 4DITA
chains in the Genus database with same CATH superfamily
3Q9XA 3QTWA 4RJ4A 3R8UA 3NZ0A 3NX8A 1KV1A 2EB3A 4BBEA 1BL6A 4AACA 4UWYA 1PKDA 3KMUA 4R3CA 2VRXA 3C0GA 3C51A 3IOPA 4EONA 2V5QA 4U97A 3MYGA 1H00A 4GRBA 2R3OA 5ICPA 3EL8A 5ETIA 2P2HA 1K2PA 3BZ3A 2RL5A 4G6NA 2YJRA 2XK4A 1Q62A 4JG6A 2ZMDA 4RFZA 3EHAA 2A1AB 3ZC6A 1RQQA 4FNYA 3OZ6A 5DRBA 3O0GA 4DLJA 3A7FA 4ZZMA 2J51A 4MXAA 3A62A 5ETFA 4BKYA 2B1PA 5AFVA 4V0GB 4U43A 2WTJA 3V8SA 4XLVA 1CKIA 5CZHA 4WD5A 4FL2A 1XH7A 2R7BA 4QMMA 5CS6A 5AM7A 4FZ7A 3WF8A 1WAKA 1Y8GA 2VX0A 3LOKA 2XALA 3BWJA 2YDKA 2PVFA 3OCGA 4NM3A 1S9JA 4AXAA 2YWVA 3IECA 3BKBA 2E9UA 4PDOA 4GL9A 2OJFE 2UZLA 3P78A 1J3HA 4ZMEA 3CP9A 3ODYX 1WBOA 4Q9ZA 3MI9A 4FK3A 4RX5A 3KREA 3SHEA 5AUTA 4JVGA 3Q2MA 2QHNA 3F5UA 5JFWA 4C37A 1IASA 5IF1A 4R7IA 3QA8A 1OITA 5JFXA 3KCFA 3EYGA 3MH3A 2W7XA 3DJ7A 3F2NA 3FMMA 3RGFA 4IBMA 4JR3A 4RIWA 1PF8A 3HLLA 3LFNA 4YJSA 2W1CA 2VWWA 4WBBB 1JKTA 4U3ZA 3E87A 2VX3A 5FRIA 4DFZE 4G6LA 5HVKA 3NDMA 1PXIA 4YC8A 4RJ8A 2QOQA 3WARA 5GZ9A 2PUPA 4JMQA 4CZTA 5L6WL 5ITAA 3UZRA 5GINE 3NUUA 3ANRA 3UQCA 2XEZA 4YO6A 5AA8A 2BZHB 2WAJA 1H4LA 4IAKA 4QMTA 3MIYA 4RSSA 3RP9A 4EK4A 3RNYA 3V51A 4KSQA 2WMXA 1WBPA 2WMRA 4FTRA 4U6RA 5LVPA 2B7AA 4QMSA 2OZAB 4YSMA 3JXWA 4EUTA 4IWOA 3VUKA 4C59A 3DK7A 3UNJA 4CKRA 2ZV9A 3DCVA 1PMVA 4DG0E 4WUNA 5HO7A 4XG8A 1ZLTA 2Z7QA 4Y5HA 4LOPA 1W0XC 4GFGA 2WQBA 2KULA 4JRVA 4PPBA 3OWLA 4QP3A 5GHVA 3ORNA 2PWLA 3S3IA 2DS1A 5HTBA 3F5GA 4S30A 5KHXA 3E62A 4F99A 4ZY4A 5KHWA 2OXXA 3EN9A 4JBOA 4D58A 4XG3A 2WOUA 4LRJA 1GNGA 4E8AA 3LQ3A 3N4UA 2XCKA 4IIRA 4PTCA 3MFSA 4HPTE 3OW3A 2QOKA 4ZSJA 4TYHB 4B0GA 4C3RA 2GFCA 4L00A 4BCNA 2YFXA 4WG3A 3GU7A 2ETMA 4CD0A 3CY3A 3DBQA 3HZTA 1T46A 4HPUE 3W2QA 2HWOA 1UU8A 3PZEA 4J53A 4F09A 3QRUA 4Z7GA 2X8EA 4B9DA 3DK6A 1UU3A 1Q8UA 5HI2A 3VS4A 4AW2A 2YWPA 4I41A 4IB3A 3NR9A 2I0EA 4ZY5A 3B2WA 2CKQA 3U6HA 1VEBA 4HVHA 4BBMA 5GZAA 4IQ6A 3JY0A 3Q4ZA 2YCQA 3D5WA 2G01A 4DFYA 1ZYJA 4EH8A 3MIAA 3BYUA 4LGGA 1CMKE 4RLLA 2BAKA 3KB7A 3QFVA 3F3ZA 5DVRA 3L8SA 5FTOA 3CKXA 1FINA 4DINA 4DFBA 4KA3A 2CN8A 3WF9A 3FUPA 1M2QA 4NZWB 5CY3A 2VTPA 5FM2A 3ZFXA 3KIOC 3LQ8A 3ORKA 5CEMA 3GFWA 5KMLA 2ETKA 2I1MA 2YABA 3F9NA 3H9OA 1J1BA 3NIZA 4L3JA 4TW9A 2Y7JA 3DK3A 4YJUA 5EM6A 5HX6A 1WBVA 3W8QA 3LXLA 3DGKA 4AGWA 4UXQA 3FMNA 4WG5A 3W0NA 3EKKA 3QC4A 5JFSA 4F9AA 4L44A 1J7IA 2QOHA 1OIUA 1KV2A 2C6EA 4W8DA 3MFRA 4AOTA 5KZ0A 4CFWA 3LJ0A 3CLYA 4MXOA 4DA5A 4GJ3A 3PPZA 3G5DA 3WE4A 2BAQA 4AT3A 2O2UA 3I60A 4PP7A 3KMMA 4M68A 3L9LA 4Y73A 5E8ZA 2AUHA 3ZXZA 4BZDA 2BCJA 4ZIMA 3W2CA 4DFNA 2PPQA 4ITIA 2YM5A 4ZTLA 2C3LA 4BHNA 3PJ3A 2JIIA 5AR5A 1XQZA 2PVYA 3KMWA 1MRVA 1V0BA 2F4JA 4OTDA 5H9BA 1ZMWA 3OBGA 3H9RA 4MQ2A 2X1NA 3HP2A 5BUIA 4RX8A 3OCTA 4BDKA 3HMIA 3EFKA 2O8YA 5CEOA 4R1YA 4HGLA 4D2WA 5FBNC 4DH1A 3BEAA 1E9HA 2O3PA 3DXNA 4GMYA 5E92A 2OZOA 4HVIA 3UPZA 4V04A 4FG9A 4H3QA 3KKVA 4YZBA 3ZZWA 3QKMA 3VW8A 3WOWA 1W2CA 1OKVA 2GDOA 4Y85A 3V01A 3ZUVA 2YDIA 4YUQA 5LARA 4YR8A 2FGIA 4UEUA 3NLBA 2WZJA 5T3QA 5CASA 1QPEA 3TTIA 3R71A 4YLKA 2J0LA 3PA5A 5HO8A 2XZSA 4ZSEA 2YM4A 2GSFA 3TUDA 2H34A 3NW6A 3UBDA 4QT1A 5EI8A 3BBTB 5A54A 2QOCA 3GOPA 4BZNA 3HX4A 3PJCA 4OTPA 4AZSA 5JRQA 4DHZA 2OIQA 4O0VA 1GZ8A 4DEAA 2I0VA 5EHLA 5CSVA 2QU5A 3DDQA 2OJIA 3GB2A 4EOPA 4D1SA 2WGJA 4B99A 4BTMA 3CEKA 3F3WA 3AKKA 5EYCA 2GFSA 3UDSA 1DS5A 5CI7A 1YXVA 4ZLOA 3CY2A 4ZMFA 3FMJA 4TWOA 3FKLA 3KQ7A 3LM0A 3Q6WA 5CF6A 2B4SB 1SMHA 5HLNA 3EQBA 4FNXA 3FQSA 3OHTA 4G3CA 4MWHA 3D5UA 4I6FA 4WNPA 3V8TA 4C4GA 4DGMA 3PRFA 2CCIA 4GT3A 3A7IA 5J9YA 5F20A 4DBNA 4G34A 3CD3A 1V1KA 3SA0A 2A98A 3LCTA 4QP4A 5ANOA 3TI1A 4F0FA 2VTRA 1ZY4A 4UN0C 3MTFA 1STCE 5HKMA 4WT6A 3R7VA 1CM8A 4DN5A 2X9EA 3IW4A 3C4CA 2C5VA 3OCSA 2YM3A 4Q5HA 4YTFA 3LXNA 3MVMA 1PMNA 5IEVA 3FQHA 3D4QA 4L52A 4BTFA 3VUIA 2X7GA 2CLXA 3OXZA 4BCPA 3SKCA 4OUCA 3KEXA 2WTDA 3SV0A 3TNPC 3UIUA 1ST0A 2ITPA 2AEGA 1ZARA 3HV6A 3N51A 4BDDA 3E7OA 3KXGA 5BNJA 3TDWA 3VWAA 4EUUA 3PPJA 5IUGA 3OMVA 3MN3A 3QC9A 2W9ZB 3DOGA 4W9XA 1WBSA 4AW0A 1Z57A 2QU6A 2UZVA 3VQUA 4DBXA 4WHZA 4BGHA 4C3PA 4MF1A 5A4QA 4BI0A 1IAJA 3IGGA 4PL5A 3UO6A 4E5WA 3RZBA 4DEDA 4L68A 5C4KA 4KS7A 5C03A 1YI4A 4I24A 4NFMA 3QRTA 3QQJA 1PXJA 3EKNA 5CSHA 3S4QA 4D1XA 4DEHA 3PA3A 3Q4CA 4HCVA 3U54A 5ANEA 3QQUA 4UMTA 1JKLA 4BJJA 2YIRA 5TF9A 3BCEA 2VU3A 2JDVA 2B54A 3FYKX 3UC4A 3BL9A 5L2TA 2OI4X 2QOFA 4KIQA 1AD5A 2OF2A 4WUAA 3RCDA 3ULIA 4A06A 4KIOA 4BTKA 4F4PA 4C4HA 4FODA 2R3PA 4KBCA 3UP2A 3ZLXA 2J0JA 4U0IA 4U40A 3P5JC 3NFGB 2JIVA 2XBJA 4QNYA 4AZTA 4TYIA 5CU4A 5LVMA 4FYOA 4IX3A 4MD7E 4QPAA 3CGFA 3VBTA 2UZOA 4C33A 3RAHA 4FTLA 4EKLA 2QLUA 4FKVA 3K5UA 5LOHA 3BHUA 3ORTA 3I0OA 3O23A 5DEWA 2ITXA 4QQCA 4LYNA 4X3FC 4CRLA 5IDPA 4DT9A 4LG4A 2F2CB 3S1HA 5GJGA 3R9DA 4L45A 4RPVA 4E26A 3VC4A 3QAME 3Q04A 4U5JA 5FDXA 3RTPA 3CKWA 4BCJA 4DH8A 1YHWA 3AC3A 2UVYA 4AF3A 4LMNA 5HOAA 3R63A 3UIBA 4FSTA 2VNWA 5K5NA 3ML1A 2XNMA 3Q96A 3I0QA 3QGWA 4E20A 3VONA 2I40A 3E5AA 4FKRA 2Z7LA 3A4OX 3JY9A 4O38A 5C8MA 3BPRA 5C26A 4BVUA 1XKKA 2WU6A 4PWNA 1J7LA 3W0MA 1OM1A 4NM0A 5C01A 4HVGA 4MD9E 3PDTA 2BROA 3AGLA 3R7GA 2HCKA 4FV0A 5H8GA 3VRZA 4E4MA 4C61A 2NP8A 1R39A 3R02A 3BYOA 2YCSA 4FZDB 2X8IA 3E93A 3UPXA 3AXWA 2R3HA 4ZZNA 3DT1A 3NAXA 5EOLA 4AW5A 3KFAA 3Q2JA 3RM6A 2WMTA 4XG9A 4Z9LA 4ZSLA 5J7BA 2X0QA 4LOOA 3BU3A 4G31A 3ID6C 1PHKA 4HGEA 3R6XA 5H3QA 2WU7A 5KKRC 4ONAA 2HAKA 4X2NA 3D5XA 4DTKA 4F08A 4JX7A 3PIZA 4L8MA 2X2LA 3W2SA 4FTIA 4RWJA 2O63A 4U42A 1PKGA 3VNTA 1JLUE 5BYZA 4YHTA 4CT2A 3HRCA 5IQHA 3U51A 3QGYA 4IAAA 3MGYA 3E92A 2Q0NA 3K5VA 3MVLA 2HK5A 4DCEA 4YTIA 2ZDUA 5CQUA 4O96A 3O7LD 5IMEA 4XV3A 2NRYA 4N6YA 1LR4A 2OG8A 1LEWA 2C6OA 1PRYA 3TNHA 4FKGA 4KBAA 4PTGA 5F4NA 4AAAA 5CAUA 3CSVA 5M44A 3EFLA 4B8MA 4QYYA 4FIFA 2Y4PA 3ZSIA 2OJJA 3MA3A 5M55A 5LMBA 4CV8A 2WEVA 3MDYA 4WNKA 5AM6A 5AP4A 5IUIA 4U8ZA 5I9ZA 4O0RA 4S2ZA 3ZMMA 2XIKA 5E9EA 2OJ9A 4EK3A 1L3RE 1JSUA 4X3JA 5DEYA 4AFJA 5BUEA 3H0ZA 1XMLA 5C27A 3GCUA 2IN6A 3AC8A 4AQKA 2W4KA 4RWKA 4L6QA 4RIWB 2RIOA 3HV4A 4HJOA 3D9VA 2XNOA 5HLPA 5J79A 3GENA 4FKOA 1KSWA 5J7HA 3QRJA 3CJFA 3C5UA 2XMYA 4MX9A 2QHMA 4RZWA 5DT4A 5G6VA 3QLFA 1PXOA 4EZ7A 3A8WA 3QD4A 4EC9A 4E4LA 4IFCA 4UZDA 4G9RA 3NCGA 5FLFA 3OS3A 3OXTA 4CFUA 5TT7A 1NT2A 4XP3A 3FXWA 4RC4A 4OT5A 1BUHA 4GIHA 4PX6A 3P7CA 3HMMA 5IDNA 2SRCA 1CSNA 1X8BA 2Y9QA 2YCRA 3BGPA 3ORXA 4MTAA 5IA5A 5AX3A 4C0TA 4Z55A 5K4JA 4IVCA 1FBNA 4F63A 3NNWA 3BEGA 4AN3A 1ZAOA 4NJDA 3FSKA 1H1QA 2PVNA 3Q32A 5DE2A 5KUPA 2X4FA 4MKCA 4CCUA 1M7NA 3G51A 1LEZA 3GFEA 4F9CA 4H05A 2UW8A 3FMDA 1DI8A 1MQ4A 4OR5A 1Q24A 2HYYA 3B8RA 3V3VA 1XWSA 1P5EA 5AP2A 3HV5A 2G2HA 3LFBA 1YDTE 5AADA 3MESA 3R7UA 2F2UA 3VQHA 5K9IA 3ZEPA 3IDBA 3H10A 4OTHA 5M4FA 1XH8A 4ITHA 4TPTA 2BVAA 3ZZEA 4P5ZA 3FLWA 3WIKA 5BMSA 4ZAUA 4J97A 4TNBA 4FEVA 3RAIA 5E4HA 5FTQA 2HXQA 3E8CA 4QDEA 3MB6A 4LUEA 4FKIA 4CNHA 3GCPA 2C6TA 4FTUA 4FV1A 2W1HA 3S95A 3SGCA 3LLTA 4YZDA 3D5VA 5KBQA 4UX9A 4OTIA 4YNOA 4FV6A 4N0SA 2EXMA 3G0FA 4BCGA 5AEPA 4PNIA 3FDNA 3DZQA 3PLSA 5AP3A 2YAKA 1PMEA 4RJ3A 3DQXA 2IZTA 3OCBA 3ZO2A 4YPSA 2ITQA 5CU2A 3ZM9A 3FXXA 1BI7A 1YOJA 3FMKA 5M4IA 4LM5A 3W8LA 4IJ9A 3QYWA 3HRFA 5AV0A 5IQFA 4XNEA 4I4FA 1M52A 3LIJA 4O4FA 5HG5A 4BL1A 3VBYA 2B53A 4FSZA 4JDIA 2JITA 5IEYA 5L2WA 1V0PA 4PQNA 4F9BA 4I21A 2JEDA 4F1TA 3ZO3A 1OZ1A 1UNLA 4JRNA 5EDPA 1GIIA 4KKGA 2PZYA 4G6OA 3TEIA 4FUYA 4YTCA 5IA0A 5CAPA 2VWBA 3QYZA 3TV6A 2W1DA 3FJQE 5E8TA 5EM8A 5HTIA 1E1VA 4PDYA 1MUOA 4BR3A 3TJCA 1I09A 3BYSA 5JN2A 2OIBA 5DR6A 2JKOA 4N6ZA 1Y6AA 4KNBA 3KXMA 3VS1A 4JAIA 2GQSA 2J5FA 5K0KA 4KBKA 4BYJA 1W2FA 5I9UA 2EWAA 1A9UA 4IHPA 3ZOSA 3ZRKA 2ITUA 2YM6A 2GHMA 4J7BA 3RALA 4MBIA 3BGZA 1YXXA 3BBWA 5ETCA 2VO0A 4O84A 4ZOGA 3QX4A 1FMKA 3TZ8A 4K6ZA 4YJRA 5CALA 2BZIB 4O83A 5FD2A 4BCFA 4ASZA 4AX8A 3ZSGA 3W2PA 2J5EA 4A9UA 4RX7A 3P86A 1B6CB 3DDPA 4FV8A 4EHGA 2BKKA 4E5BA 3ET7A 5E8UA 3FXZA 3TIZA 3TKIA 3CR0A 3A2CA 4M12A 3ZFYA 3NAYA 4YGAA 3QL8A 1P4OA 2XVDA 3FHIA 3FLQA 3W0OA 4XCUA 2Y6MA 2VTLA 3JVRA 4CSVA 2YZAA 4I0RA 4F9YA 2WTKC 4YC6A 1Q97A 4UMUA 5HBEA 3SAYA 2VTAA 2C5NA 5ANJA 4DGGA 5J9LA 1WVYA 4FVPA 3R1NA 2BDWA 5K0XA 3W16A 1U4DA 4FRFA 3IOKA 5CYIA 1H1RA 4CMOA 4O7TA 5DT3A 5E1SA 4FIJA 5I3OA 3WI6A 4C4FA 2CKPA 2XB7A 4DDGA 3M11A 4JLCA 4JL9A 1PY5A 3IW6A 2J0KA 4GT5A 3KVWA 4BF2A 4PP9A 2LAVA 1GY3A 1H0WA 4C38A 5JMSA 5KMOA 3GNIB 1ATPE 4YC3A 3ACKA 1NY3A 1OIYA 5BVNA 2X0GA 4KS8A 3FL4A 1RW8A 2PUUA 2XEYA 2XK7A 2HWPA 2W06A 1F3MC 2R4BA 3IW5A 3UVPA 3AG9A 3R9HA 4IX6A 2C5XA 3RHXA 3PP0A 1ZYCA 5J95A 2E2BA 5E7RA 3FV8A 1UVRA 3UP7A 3F69A 3PZHA 3AD4A 4USEA 3BHHA 4V05A 3U9NA 1K9AA 3CQWA 1LP4A 3SRVA 5DH3A 1ZXEA 1ZOGA 1W98A 4KABA 4M67A 4YP8A 5HHWA 3WF7A 1W82A 4YJPA 1JQHA 3HEGA 5IQBA 4F0IA 1P4FA 4FTTA 3K3IA 5IG1A 5KZIA 2VWXA 4CCBA 4AZEA 3PSCA 3W33A 1BX6A 3S2PA 5CAOA 4ZY6A 4EOLA 4NYEA 2GTNA 3SXRA 1J1CA 1KE6A 2G2FA 1QMZA 3T9TA 2C3JA 4QMVA 5L2IA 1H1WA 3QZGA 4ZTQA 4FGRA 3MH1A 3GU6A 4KWPA 4BIDA 4J8MA 5HZNA 1IRKA 1WBWA 2R3IA 4DFXE 3E3BX 3VUDA 2YEXA 3UOHA 1ZMUA 1OVEA 2VV9A 4AE6A 2XP2A 4E6AA 3QCQA 2QKWB 4I5CA 1A06A 3A7HA 1JPAA 2XK3A 4H1MA 4O27B 1OECA 3IDCA 3NUXA 5AUVA 2Y4IB 3PUPA 4LV7A 1URCA 4ANMA 4XLIA 5B2KA 3D15A 4F6WA 5JZNA 4BWPA 1OIRA 5LCKA 4UWCA 3G15A 3GU8A 4BJJB 1Q3WA 4MCVA 4CRSA 2CGVA 2R64A 4FSUA 4DFUA 5KMKA 1PYXA 3UYSA 3V6SA 3LCSA 2H6DA 3FQEA 3N4VA 3FL5A 4I4EA 2C0TA 5FEEA 1JNKA 3QZHA 3Q4UA 5L2SA 5LVOA 3M1SA 4NSTA 4QNAA 4W4WA 3ERKA 4NH1A 4EZ3A 2PL0A 4J52A 3HMOA 3I7CA 4I6LA 4YHJA 4ZK5A 3QX2A 4KINA 4BI2A 5JH6A 1B39A 1KE7A 3ATTA 3TDVA 3W32A 2XYNA 3LJ2A 2WD1A 5T68A 4EZ5A 1NVQA 4DCAA 4OAVB 1OPKA 4GIIA 3OG7A 2OWBA 2JAVA 4U3YA 4BN1A 2YIWA 3QD3A 5DNRA 1M14A 4AT4A 5I0BA 1FGKA 3DZOA 2XKFA 3DS6A 5JK3A 5GIPE 5HIDA 2WHBA 1U54A 5CU3A 2FYSA 2HELA 3G90X 4D4SA 4FV4A 1GZNA 5C4LA 2WNTA 5CXHA 4JNWA 2UW6A 5E8SA 3RPVA 4O82A 5EQYA 3GCVA 4NEUA 4I93A 3TXOA 4EOOA 2A19B 2R0IA 4QD6A 5GNKA 4D9UA 3R8LA 1WMKA 3G6HA 3VULA 4DHJA 4ZXTA 4ANLA 2XA4A 2R3FA 4TXCA 3EB0A 4A9TA 3HAMA 3LMHA 2C6KA 5CX9A 3II5A 4M97A 4HNIA 1TVOA 3WZUA 3LHJA 3PJ1A 5HE3A 3PG1A 2PUIA 4BTJA 2FSOX 2JDRA 4QMLA 1OL2A 2IW8A 1YVJA 4QP2A 3EZRA 4X6RA 5EI2A 2QC6A 3QQKA 5AUXA 4C34A 2YDJA 2FSMX 2REIA 3LCDA 3PVWA 2V0DA 2LGCA 3HP5A 3O8TA 4PL3A 3V5LA 2JKKA 2VWUA 4G1WA 5DHJA 3A60A 5HD4A 1GIHA 3QRKA 4QP1A 4UY9A 3C0IA 3CQUA 4UB7A 3AC2A 4W4XA 5FXRA 3GC9A 5TE0A 4B7TA 4MQ1A 5E8WA 3R22A 3WZJA 4Q9SA 2BUJA 4I3ZA 3TUBA 4ITJA 3POOA 4UWBA 5CANA 2X0PA 3B2TA 4AUAA 2Y6OA 5LVNA 4EOSA 4RMZA 3DAJA 3BL7A 3THBA 2C1AA 3PLAE 2YA9A 3Q3BA 5CAQA 5AAGA 3P0MA 4M14A 3PIXA 1OL7A 4Y83A 5AP0A 2QOBA 3R0TA 4AE9A 4C4EA 3RZFA 4C8BA 3M42A 4D2TA 5HNIX 4KSPA 5HQ0A 4R7BA 4XV2A 4FUXA 4CFNA 3OEZA 5AAFA 3Q4TA 3P7AA 4GFMA 4E6CA 5BV3A 4APCA 1WBNA 4PMSA 2R3NA 3I6UA 3H0YA 4QTBA 5J8IA 5LQFA 4MH7A 3RHKA 2B9IA 2QOOA 2VTMA 4QTAA 2XRUA 4I5PA 3BU6A 4GJ2A 4H39A 2Z7RA 3ZDIA 5FTGA 3KU2A 1GZKA 3I4BA 2IZUA 3IGOA 5C8KA 3FSFA 4QEBA 3UDZA 4EK5A 3NYXA 4JG7A 4FKUA 2PU8A 4H58A 2GS6A 2ZM1A 1XBAA 1TKIA 4OTRA 3RMFA 2VTJA 4DEEA 5L6OA 2J7TA 4I94A 1G8AA 4R7HA 4FJVA 4NK9A 2A0CX 2XUUA 2J9MA 3GCQA 1LPUA 4IH8A 4LL0A 4WIHA 5HCYA 2CGWA 1GJOA 2RKUA 4C58A 2AQXA 3BLAA 1IA8A 5HIBA 4QRCA 4IB1A 1PXLA 4IC7A 1FPUA 4CTBA 4AWIA 3GI3A 3V5QA 4K11A 2X9FA 1Q41A 3O7LB 4DLIA 4FTMA 3KN5A 5AP7A 2OFUA 3EN4A 3WE8A 4OGRA 4FZAB 4WA9A 3MVHA 3NNVA 4MHAA 5KMMA 3ZS5A 4CYJA 4IMYA 2J4ZA 4YJTA 2PZIA 2HZ4A 2CLQA 3G33A 4U79A 5EDRA 1NW1A 1G8KA 4TKSA 3IG7A 2OLCA 4FSRA 4IM0A 3UVQA 1ZWSA 3PXYA 2PTKA 3R1YA 4QMPA 2X4ZA 5FGKA 3I5NA 1IR3A 2XK6A 5AP5A 4RFYA 4TYJA 5HGIA 4JJRA 5HIEA 4LI5A 3QKLA 2IVVA 2QG7A 1PYEA 5A9UA 4JDKA 2WMUA 3VN9A 4NW5A 5KO1A 4WBOA 2UW4A 2UW0A 4ERWA 2JDTA 4ZP5A 5J1WA 2WTVA 3NUSA 2VTOA 1W84A 4FT0A 3ZONA 5EHOA 5EHYA 4BCQA 5M51A 2BRBA 5DA3A 2Y0AA 2XNPA 5KKRB 2O5KA 1R3CA 5M07A 4FSNA 3UMXA 5CF4A 3EQDA 1TZDA 4FGBA 5HD7A 1DAWA 5JKGA 5IKWA 3LZBA 5JSMA 2UZBA 5AV3A 3ELJA 4EHEA 4CEGA 1I44A 5EOBA 4JBQA 3ODZX 2IG7A 3CXWA 4F1MA 4AFEA 1UA2A 3COHA 3E8DA 4L42A 1RDQE 3KK9A 2PMLX 4RWIA 1NXKA 5AR2A 1ERKA 2BR1A 3ZSHA 1FVTA 3OC1A 1GIJA 2WMAA 3EMGA 4QP6A 4CT1A 4Z3VA 3LXKA 1FMOE 3VS2A 1JWHA 3DA6A 3H4JA 3IKAA 5AP6A 3SC1A 2OH4A 4J98A 5AR4A 4IE9A 3NNUA 3ZC5A 1NVRA 3UG1A 5L8JA 2HZIA 4IXPA 4QQTA 4JT3A 4MXZA 4BCHA 3DJ6A 3P9JA 4F70A 5HORA 5HG9A 3DNEA 2GNFA 3ETAA 3GT8A 2FA2A 2PE2A 3S00A 4HGTA 5CTPA 3UIMA 3ZTXA 4ORKA 4YBKA 2NRUA 3BI6A 4XUFA 3NW7A 4FV3A 4JIKA 5D11A 4DH7A 1YDSE 4ANSA 3EQFA 1PXPA 3DAKA 3LFFA 4OTQA 3QTSA 4FKWA 5HE1A 5EYKA 5J87A 2W5BA 3AC1A 3ORIA 4HGSA 2C69A 3U6JA 4D9TA 3BX5A 3QTXA 5IQAA 4QMQA 3RWQA 4J8NA 2OW3A 3BV2A 3C5IA 5FDPA 4AAYA 3BRBA 4PY1A 3E7VA 5CSXA 4GS6A 1FQ1B 1G8JA 4CKJA 5DG5A 3OWPA 2QI8A 3BV3A 1XMMA 4DTBA 5DIAA 4MWIA 5AR8A 4UALA 3ZM4A 4ACHA 2C5YA 3IS5A 4BCOA 2EVAA 4M84A 1G3NA 3BELA 3D2IA 3I5ZA 5KE0A 2P4IA 2CPKE 3PSBA 2BRMA 3I7BA 3KULA 4FEXA 5F94A 3MFUA 1JSVA 2XJ2A 1H1SA 3FZOA 3P23A 4BY9E 3GQIA 2QVSE 5TKDA 3KRWA 1BLXA 4TTHB 2IO6A 3SLSA 2ETRA 2QOIA 5KNJA 3W0SA 4NFNA 5CENA 2C6DA 2HW7A 1J91A 3NUPA 4G17A 2EUFB 3TTJA 2RFSA 4G3GA 4AQCA 3PFYA 3DQWA 4RVLA 4M0YA 4NJ3A 1OBDA 3ZCLA 2IPXA 3QHWA 1A48A 4F9WA 4DDIA 2BFYA 4RJ5A 4BFMA 3LKMA 3QQHA 4W9WA 4XG4A 4IWQA 3TZ9A 2WQMA 2W1EA 1CTPE 3PXFA 4O7YA 1VYZA 3MS9A 4XP2A 3TACA 3OD6X 5J5TA 4Q2AA 4Y5QA 3FI2A 4FKJA 3VBVA 1SVHA 4DF3A 3OF0A 3LM5A 2E9VA 4CG8A 4M69B 5HBHA 2CNQA 4RVTA 3LLAA 3TZ7A 4XP0A 3UC3A 3ZHPC 2UZUE 5HG8A 3BIZA 3QTZA 4X6QC 4BDCA 3BLRA 4ZTNA 4DH5A 4EI4A 4O7VA 5LVLA 3V5TA 3EZVA 3MB7A 4XG7A 2CGUA 2PY3A 3QU0A 4QYGA 4TYGA 4BI1A 2ZM4A 4L46A 2XK8A 3IDPA 1Z9XA 5T6KA 3TM0A 5DFPA 1E1XA 4RIOA 4CQEA 5EM7A 2UW7A 5TR6A 3R9OA 3NVKI 2IEWA 4PDPA 4AZVA 3QQLA 2B0QA 3HVCA 3SRVB 5HU3A 5E1EA 5HO6A 3R7YA 2IW6A 2V7OA 4LUDA 5IA4A 4C2VA 4F7NA 4QMYA 3UO5A 4UZHA 1SYKA 4FT5A 4IWPA 4IJPA 3PG3A 2J2IB 2XIYA 2XIRA 4ZZOA 5JQ5A 3U6IA 3EQRA 4A7CA 3KC3A 2XJ1A 2OU7A 4YPDA 4JG8A 4EBWA 5E8VA 2Z60A 3MH0A 4FNWA 4IDVA 4GG7A 5CEIA 3CCNA 4LDTA 3ORLA 3QD2B 2QO9A 4O4EA 5M4UA 2VGOA 4KB8A 3AGMA 3DLSA 4