2QU5A

Crystal structure of the vegfr2 kinase domain in complex with a benzimidazole inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
305
structure length
292
Chain Sequence
b'HAERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLADARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title Design, Synthesis, and Evaluation of Orally Active Benzimidazoles and Benzoxazoles as Vascular Endothelial Growth Factor-2 Receptor Tyrosine Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 292
sequence length 305
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qu5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qu5A01
4HVHA 4AGCA 1MP8A 2QQ7A 4AT3A 4IM3A 4ALWA 4WG3A 5GNKA 3KRJA 4YJOA 5CU0A 4R7HA 2O2UA 4NM0A 1Y91A 2B7AA 2J90A 3PYYA 4G3DA 4AA4A 4AFJA 1CDKA 3QRUA 4H36A 4RIXB 3P7AA 2EUFB 4UWCA 1OB3A 4JDKA 5IMEA 2ZV7A 3A99A 3DDQA 3HRFA 3V6RA 1BMKA 2G15A 5F95A 3MESA 4C4EA 4EZ5A 3FLNC 1JAMA 2XRWA 3NGAA 4JVGA 3II5A 4GU6A 2X8DA 4DEHA 3KF4A 5CU3A 3D5XA 3SC1A 3GEQA 4YZCA 4E6CA 3HMIA 3JVSA 4LYNA 2ITTA 5LVPA 3BBTB 2BRMA 5L4QA 3AGLA 2YN8A 2HW7A 3ZEPA 3FL5A 5JFSA 5DT0A 5CU6A 1B6CB 5A4LA 3UIBA 4I5HA 4WNKA 3G33A 3AD5A 3OWJA 3QXPA 3UDBA 3ITZA 4QOXA 2C3LA 3TZ8A 3QTZA 4E1ZA 4FOCA 1YXTA 2QD9A 4I22A 5J5SA 1YI4A 2FVDA 3CKWA 3D7TB 3DK3A 4FC0A 5CZHA 1YWVA 2ETKA 2G2FA 2UVZA 1SNUA 1W0XC 3PSDA 4DF3A 2GFCA 4WHZA 4AZFA 5JH6A 4RJ4A 1WBTA 3DBEA 4CG8A 3VBWA 2QURA 3ENHA 1YDTE 4J7BA 4CNHA 4L9IA 1WCCA 5BX0A 5CANA 2YM7A 2ZV9A 3GC9A 3NIZA 3PXFA 5F4NA 3C5IA 3U4WA 1XH9A 5HE2A 4AOJA 2Z60A 3LXLA 4NL0A 4D2RA 3N51A 2OZAA 2X2KA 5C4KA 3MFRA 4LUEA 3TNPC 2BAKA 3DGKA 3EFWA 3RM6A 1FBNA 4J99A 5CNNA 4ASEA 2QO7A 1UVRA 5EK7A 4RWLA 1M52A 2WMQA 3HMPA 3PY3A 5T3QA 3DT1A 4WBOA 3CPCA 3BHTA 3RPYA 3VULA 4AXAA 4S31A 4KSQA 3LCSA 4CFNA 3O23A 4B9DA 1OKWA 3KMWA 4GVJA 3D2IA 1SVEA 3FKNA 4CYIA 5DYJA 4PY1A 4RFZA 1NXKA 3DPKA 5CEQA 4GFGA 3UOKA 4EL9A 4A7CA 3QALE 1YDRE 1OL5A 1M14A 3GP0A 5B2KA 5HBEA 1SMHA 1P2AA 1FOTA 1V1KA 4YNEA 3Q04A 4JJRA 4L68A 3VBYA 4OT6A 2IJMA 2JKQA 3ET7A 5CI7A 3VS7A 2ITYA 3G0EA 3R2YA 5FD2A 3VS2A 4O7TA 4DCAA 3NYXA 3KULA 4MNFA 1J7LA 4S33A 1JVPP 4PPBA 5LARA 3UC3A 3U6HA 2YM3A 3NW5A 4NW6A 3FMHA 3ORIA 5HVYA 3WF6A 4I6HA 4UALA 5KZ0A 5IQEA 3QCQA 4OTRA 4FTMA 5DR9A 5AMNA 3NX8A 3DFCB 4AOIA 3ACJA 2NO3A 1LEZA 2VX1A 4FSYA 5JFVA 2BILB 3TTIA 4K0YA 1JSUA 5E8XA 5H3QA 4EBWA 3NUXA 3O8TA 4AZEA 4OUCA 3SD0A 5DEWA 3D9VA 2QU5A 2E9VA 2IZUA 4P2KA 3RHXA 2UW6A 1ZOEA 3UIXA 3OF0A 4A9UA 5E1SA 3SDJA 3IW7A 4A4LA 4FKRA 5A3XA 3LFDA 5AP6A 4O7YA 2HENA 1CMKE 1GZ8A 1OVEA 3GOKA 4FKGA 4FSNA 4R5SA 5HNBA 3UG1A 3TV7A 3ZFYA 2WGJA 4Z7GA 4MTAA 3QAME 4J8MA 3HA6A 1ZARA 5H8EA 3VHEA 4E4LA 4DFUA 5FQDC 1ERKA 2GHMA 2V22A 4FTLA 2UW9A 5E8YA 4EH7A 3QZIA 5IEYA 5IZFA 5DLSA 3BLRA 2VRXA 3B8RA 3KB7A 2PTKA 4FV3A 4JDIA 3ZCLA 3SXFA 1I44A 2I0VA 4OTHA 2F9GA 3P7CA 5AAEA 4N6YA 2ZAZA 4RWIA 5J87A 3CE3A 3ZZWA 3E3BX 4C62A 2OFVA 5HLWA 3PJCA 4NTTA 3AC3A 2A0CX 1Y8YA 2XIKA 4JG8A 2OZAB 3V8SA 3IS5A 1LEWA 3C4WA 5J1VA 2HCKA 5DA3A 4C59A 4WBBB 5FLFA 3WZJA 3QUPA 5D7AA 2UZUE 1NY3A 2XYUA 2CSNA 4I6BA 3SV0A 2EB2A 4EC8A 5IDPA 2W1GA 2JFLA 4WSQA 1A48A 3PDTA 3VBQA 5IA0A 4ORKA 3Q4TA 4BIEA 2YFXA 3FMMA 1R0PA 3KRLA 3NCGA 1KUTA 2XIXA 3MTLA 3I4BA 1F5QA 1ZYJA 1UU8A 1IA9A 4MK0A 3I0OA 4L53A 5D7VA 3WF9A 4E8AA 3LLTA 1U5RA 1XH4A 3KCKA 5HNGA 3BCEA 3OXTA 4CEGA 4C38A 2QU6A 3RK7A 3QHWA 5HE0A 1ZYLA 4PNIA 3HV6A 2PSQA 1JKLA 3AC8A 1YVJA 2J6MA 3L9LA 4HYHA 1H07A 4L3LA 3CR0A 1JKSA 3A7IA 3ACKA 3E88A 3GU7A 5DBXA 4Q5EA 4YPSA 3W2CA 2UZDA 4BTFA 3F6XA 4J53A 1BX6A 2RSVA 4PTGA 3H4JA 4F7NA 3KULB 2GFSA 3V5LA 3SHEA 5DNRA 2YERA 3PVWA 2VWWA 3DU8A 4JX7A 1NA7A 2UVYA 4GRBA 3BWJA 4MQ1A 3ORXA 2I6LA 4GFOA 3QD3A 5HQ0A 2BPMA 2WB8A 4FKJA 4FT3A 4LMUA 5C27A 3PIZA 2ONLA 2UZNA 3WI6A 4WIHA 3T8OA 4ANNA 4DEIA 4EH8A 4GKHA 5JK3A 3BHHA 4MQ2A 2B54A 3I0QA 4R5YA 3QZFA 2WFYA 1FMOE 3NYNA 4FZFB 4RWKA 4F64A 5M4CA 2HY81 4IWOA 4YTIA 4BCOA 1AGWA 1OUYA 3R9RA 2C0IA 5ETCA 3KK9A 3ZRKA 3ZO1A 4FODA 4M7IA 4QMPA 5AR3A 3NEWA 4YJRA 5JSMA 3LM5A 1TQPA 4QD6A 3W18A 4Y46A 3EHAA 4FT5A 3GCVA 4C3PA 2RKUA 4XUFA 4G5JA 4LG4A 2XK4A 3MWUA 4KD1A 3C7QA 4TYIA 3VN9A 1E1VA 3ALOA 4BCFA 3C4FA 3MH3A 4L6QA 4MX9A 4N4SA 5LMKC 3EN7A 4EUTA 3FAAA 3BU5A 4FSQA 4QP2A 2I40A 4ARKA 2YA9A 2YABA 3GQIA 4OW8A 4D55A 2W1DA 4U80A 3WOWA 4E3CA 1O6YA 5CASA 3V3VA 1XHAA 3L9NA 2PVKA 4F6WA 4LI5A 4O7LA 2P33A 2J0JA 3C0HA 4O21A 5AUYA 4CKJA 4ZS4A 3FSFA 4X6QC 4CMOA 5HNIX 4I24A 4DA5A 3OEFX 3W2PA 3JY0A 2PPQA 3I5ZA 2RL5A 4MHAA 5FEDA 1WVWA 3DBDA 4G6LA 4ENXA 3BQCA 5LVOA 4TYGA 2WMTA 2W1ZA 4YNOA 4ZOGA 3BWFA 4AE6A 1XQZA 4AZVA 4BKZA 4V05A 4DYMA 5I0BA 3P0MA 4C8BA 2B9FA 4RIWA 5IMXA 3DA6A 4IVDA 1KE9A 5C4LA 1PKDA 4YU2A 4I41A 2OXDA 5ANIA 4QMNA 3BKBA 1YW2A 3NPCA 2GU8A 3TIYA 4I4FA 3KVXA 3QXOA 4FV1A 4I21A 3QA8A 2CKOA 4O7VA 4F0IA 3G90X 4FICA 4FI1A 4JT3A 5J9YA 4D4RA 2JGZA 4GKIA 4YJNA 3EQPA 2J0MB 4QPMA 4Y73A 3KRWA 2WIHA 4MD7E 4GT3A 4IW0A 5LMKA 4XNEA 3HYHA 3AC1A 4AZSA 4NJDA 3Q4CA 4X3FA 5HE1A 3UP2A 4TTHB 4XV3A 3UE4A 1YXXA 3EFLA 3AT2A 3Q9ZA 4XRLA 3MI9A 4OGRA 3KEXA 4BGGA 2X1NA 5EYCA 2GHGA 3VIDA 2BZJA 2R64A 5AEPA 5BVNA 5IH4A 2P3GX 5KBQA 3A7FA 2QOCA 4GUEA 2CN8A 4PWNA 3P23A 3NZ0A 4U8ZA 3ZZEA 3ZO4A 1K2PA 3GB2A 3PWYA 3TL8A 5ANGA 1LPUA 2IW6A 2BDWA 1VEBA 3TKUA 2UZLA 4B99A 2PK9A 5M4UA 2B55A 2VTAA 3KK8A 3GCPA 3HRCA 4RJ7A 3T9IA 3TACA 2R3MA 4JR3A 4XS2A 5E90A 5I9WA 3O50A 4P90A 2PZPA 4XOYA 1JKKA 4FV8A 4ZLOA 3GOPA 5CY3A 5DG5A 3CXWA 4KINA 1OECA 3R7IA 3NIEA 3A61A 5HIBA 3OOMA 4JIKA 1YHVA 5EDQA 3W16A 2PZIA 1XR1A 2IO6A 4FIHA 4XP0A 2B9HA 2VZ6A 4RJ3A 4QMQA 4BRXA 2C68A 4FNZA 4FTCA 5KZIA 5AP5A 4IC8A 5LVMA 5C03A 1VJYA 4WUAA 3NVKI 3MB7A 4LRKA 2YWPA 4FNWA 3C4CA 4EWQA 1R39A 5EHYA 3TNQB 4QPAA 3I7BA 4J71A 3FMDA 4IVBA 5A9UA 4KKEA 4ZS0A 4YC6A 5M53A 3GGFA 4KBKA 5JEBA 4YZDA 4NKSA 2UUEA 2XBAA 5E8ZA 3BGPA 5EQPA 4CFXA 3CP9A 5JKGA 3PJ1A 4TXCA 2JDRA 4OT5A 4HGSA 3S0OA 5AX3A 1WFCA 2QOFA 3L8SA 4EYJA 2VO0A 4EQMA 1Q8ZA 2QLQA 4NK9A 5IPJA 4W4XA 4AG8A 1FVVA 2YIRA 5AP3A 4RIWB 2BZHB 2OGVA 5A6OA 5DOSA 3V04A 4F7JA 4YJPA 5AA9A 4PTEA 4GT5A 4I94A 4MCVA 3EQHA 5AP1A 3KREA 4OTDA 4RT7A 3DZOA 4KIQA 4U41A 2Y4IC 4XG7A 2JITA 3R7GA 3ZDIA 5LQFA 2BRHA 4YUQA 3QF9A 4P4CA 2WTDA 3BX5A 3VUKA 4EOKA 2B52A 3LMGA 4J52A 4AN3A 4M3QA 1BL7A 4U0IA 4PL3A 1Q8TA 2AUHA 4FIGA 4MF1A 4C61A 5J7HA 5AP2A 4JQEA 4BBFA 4PNKA 4KRCA 5IF1A 5TF9A 4Y95A 2H9VA 2ZV2A 2ZDTA 1K9AA 2R0UA 1OIUA 2W1EA 1Y57A 3E93A 3VQUA 2QHMA 2O0UA 5C01A 1BYGA 2YCFA 4ZLZA 4X3FB 4XV2A 2W99B 3H30A 2VTJA 2ZM4A 3R6XA 3SG9A 4DTAA 4GUBA 4E4NA 3UZPA 3CTJA 1TQIA 2J0LA 3R9DA 5CSXA 3QYWA 4BCHA 3PXYA 4DG2E 1FQ1B 4ITJA 5K5NA 4A4OA 4CG9A 3IDPA 4C58A 4IVAA 4IZYA 1OI9A 3P9JA 3FZPA 4I1ZA 1OKVA 2X4FA 3KXHA 4QMSA 2BTSA 5DFPA 5B2LA 4O7ZA 5CZIA 4XCUA 2R4BA 3KQ7A 5DEYA 5CEOA 3U4UA 4S34A 4IEBA 3THBA 2KULA 4YMJA 3QQLA 4USDA 3R83A 3WYYA 2RFDA 2Y7JA 5KHXA 1P5EA 4G9RA 2G9XA 4O0TA 3MB6A 1TKIA 2VWXA 3AC4A 4ONAA 5CX9A 3NNUA 1NVQA 1RDQE 5IUIA 3UOLA 4ASXA 3HMNA 4BYIA 5CF6A 1KE7A 4PQNA 3IDCA 1URWA 2C5XA 3MH2A 3IKAA 4KWPA 2ITWA 4XRJA 4XLVA 5EKOA 2IZTA 4G31A 3FMLA 4RVKA 3P7BA 2R3OA 5CYIA 3R8ZA 3F3TA 3QTXA 2GS6A 2HK5A 4XV9A 4NCTC 5E4HA 5HBHA 3HL7A 2XJ2A 1ZY5A 2BAJA 2XH5A 5LWNA 3NWWA 1TVOA 4H3QA 2H6DA 3F66A 2H34A 4FZ7A 4YC3A 2IW9A 4D2PA 3IW5A 4EBVA 3QD0A 4QYFA 2Q83A 2WNTA 5L2SA 2CN5A 3QHRA 2Q0BA 5E7RA 4DEGA 4G1WA 4FKVA 5BVWA 2W5BA 5J9LA 4M84A 4FUXA 3TJCA 3Q6WA 5ITAA 2X8IA 4FZDB 2VN9A 2VTOA 3ZC5A 4EYMA 4QMVA 4O0SA 4O0RA 1MRVA 3DNDA 4BR3A 2PE0A 4UMTA 4ASDA 2W1HA 4D0WA 3LIJA 4ACMA 1OL2A 3LM0A 1H8FA 2O63A 4JG7A 5FGKA 4C02A 4UMPA 4YHJA 3LKMA 4FE2A 2W9FB 4ITIA 4M66A 2A19B 4YTFA 3UQCA 2DS1A 1IAJA 3QCXA 3NAXA 4BCJA 2XA4A 4IAAA 4OTFA 4DITA 4QTCA 1H1RA 1UNGA 1YXUA 3F82A 4FSMA 5HLNA 3TUBA 1XH7A 2QCSA 4TZRA 3LQ8A 4F1MA 2QKWB 3EQCA 5ANKA 5F94A 2V62A 5J1WA 4ZJVA 2OXYA 3I1AA 4JAIA 5IA3A 3GFEA 1WAKA 2OKRA 2XP2A 2YEXA 4HPTE 4PP9A 4QPSA 5JGBA 2EU9A 3ERKA 3GT8A 5HTIA 5TE0A 4QQJA 2C4GA 5A6NA 4P5ZA 2JBOA 4NCTA 4CZTA 4UV0A 5KMJA 2BR1A 4I20A 5CEMA 1MUOA 3DBQA 2RGPA 2PZRA 4W4WA 3MVJA 5DRDA 3UYTA 4YBKA 3V01A 4EUUA 3LQ5A 4L7SA 4IX5A 3A62A 2Y6OA 5D10A 2E9NA 5DR2A 4ZTSA 3MVHA 3VVHA 5HD7A 2QC6A 4YO6A 4UXLA 3PA4A 2WMRA 4XH6A 1PXMA 3U51A 2BZKB 3QBNA 2C6EA 3QCSA 5FEEA 4WNOA 4F70A 3PA5A 4FV6A 5BVKA 2OIDA 3FPMA 4BYJA 4EQCA 1O6KA 4TWCA 2Y4IB 4QMMA 3QC4A 2R3GA 4FTQA 4D28A 5EQYA 3BYMA 3FKLA 4MNEA 2XJ0A 4LGGA 4ZY5A 2XNMA 2UV2A 3DKOA 4MBJA 3VUTA 3SA0A 3QKMA 4JR7A 3D2KA 5D41A 3KRXA 3RAHA 5BNJA 4FEUA 3RPSA 3AQVA 5K3YA 2CNUA 5FWKK 5HD4A 4NH1A 2EB3A 4D1SA 3E8EA 2QHNA 3GU8A 3LXKA 4NM3A 2X4ZA 5AM7A 5JGDA 5AP4A 4MH7A 4CKRA 1L8TA 1BKXA 1STCE 1YXVA 2W06A 4HGEA 2GTMA 4K11A 1H25A 5E8VA 5J8IA 3VF8A 1FGIA 3TUDA 4ANMA 4RJ6A 3W1FA 3S3IA 2QVSE 4DINA 4QP3A 4U79A 5ETAA 1GOLA 1EH4A 4FK3A 3L8VA 1PW2A 2ESMA 4U43A 5BUIA 5KMLA 3LJ0A 3MPMA 4FEWA 1KSWA 3LFFA 4A9SA 4F9AA 1WVYA 3REPA 4JXFA 3T3VA 2I1MA 3V51A 1UNHA 4LRMA 4DFZE 2R3PA 2HWOA 4KA3A 3VBXA 1W98A 2ZMDA 1M2RA 4LMNA 2W1IA 2WTCA 2HZIA 3LFQA 5DGZA 3C9WA 4ZY6A 4KIKA 5HKMA 2QKRA 3ODZX 4DCEA 3U6IA 2IW8A 4I5MA 3P08A 4O91A 1WBWA 3LE6A 4CRLA 4FEQA 3DJ7A 4U6RA 4GL9A 3K54A 4C2WA 4EQUA 3PA3A 4YZ9A 2UW8A 4OR5A 1XBAA 5HO6A 2QG7A 2IN6A 4CCUA 3ETAA 5E1EA 2XNNA 4EOSA 2JDTA 3UQGA 2XMYA 5GJFA 3DLSA 4O6EA 4YJSA 3R8PA 4BCKA 4IFCA 2X9EA 4AP7A 4PV0A 4E5WA 1PYXA 4IACA 3MYGA 3QTRA 4HGLA 3Q3BA 1FMKA 5CF4A 5BMSA 3QTSA 3ZEWA 3VC4A 3Q9YA 3BI6A 4BB4A 5L2TA 2NRUA 2V55A 1T46A 1OIYA 3KXXA 3WZDA 1Q8WA 3ROCA 5CVHA 3BEAA 4YZBA 3UPZA 3PUPA 5D11A 1JWHA 1ZMWA 3QRJA 3F5GA 3KVWA 4ZP5A 1H01A 4AZWA 5L8KA 1Q62A 4ZMEA 2YZAA 4PDSA 3LW0A 2OF4A 3CLYA 4BBEA 2UVXA 2CLXA 3C1XA 4JIAA 4HNFA 3FXXA 2BTRA 4JDJA 5ANJA 1Y8GA 4D9TA 5HORA 2F2UA 1WZYA 3FMNA 3D5UA 3KY2A 4QYHA 5BVDA 5I9YA 3P5KA 2BALA 5J5TA 4FV9A 5IEVA 3PP1A 1PXPA 4FKUA 2A2AA 2C47A 2GNGA 3C4ZA 4PMSA 1XKKA 4LOPA 1Q3DA 4L42A 2JKMA 4MNEB 4W4VA 5AR8A 1V0BA 2ITPA 2YJSA 1YOMA 4BCQA 2JBPA 2WAJA 3FJQE 3ZHPC 1OL1A 3EKNA 4ZXTA 4DTKA 1H1PA 2X81A 2WMVA 2PZYA 2XNOA 5LCKA 3OY1A 4QQCA 4KKHA 4CZUA 4DC2A 5FDPA 5HU9A 3I79A 4XP3A 4HCUA 5EI2A 5HI2A 5KO1A 3FMKA 1M7QA 5IH6A 1U59A 4ZJIA 5EYKA 3VS1A 3EYGA 4FKOA 1YQJA 4FTJA 4GEOA 2GNIA 2Y6MA 3ZXZA 3ZUTA 2Z7RA 4NUSA 5JQ8A 2FSLX 5KKRC 1NVRA 3TG1A 4KBCA 3FZRA 3S00A 4EOQA 4R78A 3V5JA 2V0DA 2RF9A 5KUPA 1ZYDA 3QRTA 2ZB0A 4A06A 4GVAA 4G17A 2YAKA 4TWPA 3R7YA 3UOHA 3MIAA 2CKEA 4GSBA 2RFEA 4ERWA 5J7BA 4WNMA 2UZOA 3AC2A 3EZRA 4IB0A 3E64A 3KXZA 3CPBA 5AM6A 3LXPA 3RK5A 2JKOA 4A9TA 4KIKB 2JDSA 3WZEA 2W4JA 4G6NA 3MV5A 5FP5A 4FL2A 3BE2A 3RPOA 3F2RA 4O86A 3O2MA 1PMNA 4ANQA 2C0OA 5FDXA 4U44A 4EOOA 4MBIA 3LJ1A 1UV5A 3POOA 4ENYA 2YM8A 3QD4A 4FTKA 2UW3A 3QC9A 4GYIA 5F1ZA 4FKLA 4N70A 3PLSA 5H8BA 3EFJA 4K33A 3R04A 3ZDUA 4FV4A 3DZQA 4RC4A 5FBOA 3TM0A 3EYHA 4WSYA 3UZRA 2WOUA 4JQ8A 4YSMA 3AMAA 3A8WA 4GFMA 5AUZA 3VJNA 2OLCA 2Y8OA 3FUPA 1OL6A 2C3KA 2QOQA 3D5WA 4NFMA 3MIYA 4IX4A 4XP2A 5E8UA 3N4VA 3ATSA 3T3UA 1KOBA 5FBNC 2X7GA 5JRQA 4N57A 3LZBA 2QOBA 4MD9E 5EM6A 4X2JA 4GS6A 1CTPE 2C6MA 4II5A 4D2WA 2FSTX 2XIZA 5EFQA 4E4XA 4EI4A 4F08A 4IC7A 2CJMA 2B53A 3M11A 3UNKA 1Q3WA 4A07A 1M7NA 1X8BA 3LHJA 3Q53A 5IQGA 2VWZA 1M2PA 2UW7A 3EQRA 3UPXA 2PMNX 4PDPA 4BI0A 3BELA 2XB7A 3MVMA 3UVPA 2CKPA 1OUKA 1BL6A 3HECA 5IUHA 3FQEA 5IA5A 3R28A 4IZ5A 2ZYBA 1B39A 2YM6A 4P5QA 3AXWA 4UEUA 4FV0A 1VYWA 2F4JA 3BU3A 3GC8A 4B0GA 3A7HA 3OTVA 4I6QA 4YZNA 5FM2A 5BYZA 3U9NA 4ANBA 4OBQA 3E7VA 4U9AA 4ZTMA 2PUIA 3N4UA 3I6WA 4ZLYA 3ZH8A 3G6GA 4WG5A 2OIBA 4RSSA 2Y4PA 3OT8A 4ZTQA 2HXQA 4UYAA 4F65A 3GQLA 5FEQA 4JNWA 3R02A 3ZONA 5BPYA 5EHLA 3VO3A 3BYOA 3F7ZA 3ZOSA 1XO2B 2A27A 3MFUA 3OUNB 4RJ8A 3VUGA 3PZHA 1ZLTA 2DUVA 4BDGA 1PMEA 3DTCA 2YITA 4V0GA 3DLZA 1ZRZA 3AGMA 3L8XA 4IQ6A 4CVAA 1UU3A 3COKA 2RG5A 3ORZA 3TUCA 5J9ZA 3DQWA 4FSWA 4J97A 3V5QA 3G9LX 1AD5A 5LVLA 3MGYA 2ITNA 2UZBA 3AMYA 3OXIA 3FXWA 5DRBA 4BCMA 4JX3A 3R7OA 2OBJA 3D83A 2WU7A 3N9XA 4D5HA 2YCRA 4NKAA 4DH7A 2AC3A 1W8CA 3LFSA 4ACHA 4QNYA 4EK8A 3WIGA 4F6UA 1OBDA 2PMIA 3BYVA 4EH6A 3EL7A 3K2LA 3FQSA 4XG8A 4HW7A 4DGOA 4GIHA 4RIOA 4O1PA 4IADA 5EW8A 4E26A 5AWMA 1DM2A 3QGWA 2HXLA 3FC1X 1OPJA 2ZVAA 4FEVA 4FZAB 5EHOA 3ZBFA 3U87A 3FYKX 4QTBA 1OIQA 3LFBA 1YRPA 3QX2A 3TZ9A 4QMLA 4EH5A 1PXIA 2CMWA 3QCYA 5CQWA 3NUAA 5A4CA 3ZFMA 4K9YA 5HESA 2FO0A 3ORNA 3H9FA 2ETRA 4Y72A 4E6DA 1FINA 2ACXA 3KGAA 4OBPA 4ZZOA 4OAVB 3ZSGA 3GCQA 1R1WA 2Z7LA 2R9SA 3NDMA 5CSWA 2G2HA 4FYNA 3Q32A 3TEIA 5L2WA 1IA8A 3C4XA 3OP5A 4M69A 3SOCA 3UC4A 3OWKA 1UKIA 3RBWA 4DFBA 4FR4A 3AT3A 3LPBA 2OH4A 1HCKA 4OTIA 5EDPA 2QODA 5JZNA 4DEDA 3QUDA 5KKRB 3U54A 3KXMA 2C69A 3OOGA 4IXPA 5AV1A 4AA0A 2J9MA 3FDNA 4RG0A 4RVTA 3DFAA 4IZ7A 4BZOA 2VTQA 3FHRA 4ZMFA 3H10A 4RLLA 3ZU7A 2GCDA 5E8WA 1P14A 1T45A 3PLAE 3ZLXA 1LP4A 3E63A 1H0WA 3K5VA 1F3MC 4MAOA 3EQFA 4HOKA 5BVFA 3OROA 3MS9A 2WTIA 4CSVA 2GQRA 4AW1A 4WUNA 4XLIA 4E6QA 4I23A 5CAOA 3MVLA 2V7OA 2XKDA 5B7VA 2XCKA 4JI9A 3Q6UA 3TWJA 2XK7A 3D0EA 2WEVA 2VO3A 4MEDA 4FUYA 4X2NA 4K6ZA 5K5XA 3H0YA 5ACKA 1GAGA 4FG7A 3WBLA 3CS9A 3HEGA 5AR2A 4DFNA 4APPA 4C4FA 4BDCA 3ZO3A 4EKKA 1FVTA 4R7BA 3FY0A 4KSPA 4AQCA 4FZ6A 3UP7A 4CGAA 5K9IA 5AADA 4RZWA 3FV8A 4UMQA 1ZYCA 3EJ1A 4F7LA 1YWNA 2WQNA 4V0GB 1RJBA 4DG0E 2Y9QA 4QMTA 2JEDA 3LCKA 4AAAA 2VX0A 1Z5MA 3AD4A 2R7IA 4C0TA 2IVSA 4AGWA 1YI3A 5C26A 5FXSA 3KKVA 4AN2A 4A9YA 3EQIA 1JOWB 3G0FA 3F3WA 3HUBA 4CRSA 5K4IA 3QGYA 3ID6C 1B38A 4B7TA 2VWYA 5EI6A 4D9UA 3V5PA 3JY9A 3KN5A 2PHKA 5CU4A 4AT5A 4F63A 5E92A 1CSNA 4CFWA 3HGKA 1XH6A 4F1TA 2CGUA 2UW5A 1Q4LA 3ORTA 3GVUA 4NM5A 2P2HA 3R1NA 5DN3A 4Y5HA 4BGQA 1KE8A 2XK8A 4EOLA 1KWPA 3KA0A 4UBAA 3MA6A 2GS7A 2QR7A 4DH3A 3U8WA 2NP8A 2PL0A 4HPUE 5DI1A 4BI2A 5DMZA 1JSTA 5AUTA 5IA4A 1GY3A 3QTUA 4FGBA 3FLQA 4RJ5A 4CD0A 4IHPA 2HW6A 3BGQA 2HWPA 3LFCA 1DI8A 2HIWA 4TL0A 3DOGA 4F09A 1H00A 3RZBA 1Q61A 3QLGA 4TYEA 4GK4A 3PJ8A 3JR1A 3FLYA 3DS6A 3PVBA 3HA8A 3TN8A 1OBGA 4HVSA 2P4IA 2X9FA 4FNXA 1PY5A 4IB3A 2G2IA 4JAJA 4RC3A 3RALA 4F4PA 3HDMA 1KE6A 3JVRA 2FUMA 2FSMX 4EHGA 4TYHA 5CEKA 5JQ5A 5HG8A 4BKYA 4FKTA 1WVXA 3KRRA 1M17A 4RLKA 3RCJA 3PIXA 5BVEA 3FMEA 4IBMA 3WYXA 4O83A 2PE1A 5CXHA 5CAUA 2Y0AA 3F5XA 2VNWA 3ORKA 4PX6A 4O82A 3TNHA 2HZ0A 2VTIA 4FIFA 2C3IB 2PMLX 2DQ7X 5BUEA 2XK3A 3OHTA 5CU2A 3P4KA 1QPEA 4MD8E 3WF5A 2PYWA 3ZUVA 4AGUA 3DAJA 3VBTA 4EH4A 4QYGA 1ZZ2A 2JIUA 4CLIA 2YWVA 2OW3A 4BWPA 3RJCA 4QMUA 3UNZA 1R0EA 2W4OA 5B0XA 4FTIA 3GENA 3QKLA 4PDYA 1YKRA 5CENA 4BICA 4S30A 2IPXA 4S32A 1OKYA 3OXZA 3OD6X 3VS5A 4QRCA 2ITUA 3VWAA 2XK6A 4QP9A 4IM0A 4JQ7A 4XG4A 3MJ1A 4BIBA 3PTGA 4EKLA 3QFVA 2ZDUA 3RKBA 4H3BA 2J0IA 2E2BA 3NAYA 5C8MA 2BIYA 5AUVA 3QQUA 1R3CA 3DAEA 4QQ5A 3RAWA 3QTIA 3NR9A 4FKWA 3UTOA 4LOOA 4XG3A 3DTWA 2R3KA 2W9ZB 4K18A 3FXZA 3OZ6A 5T68A 4LRJA 5EOLA 3LMHA 3HVCA 1XBCA 4FA2A 3EN4A 4FOBA 4EORA 3MN3A 3UBDA 5M06A 2VO7A 2UW4A 4FTTA 2IVTA 5FUTA 4JBVA 2WELA 5IQDA 4P7EA 2Z7SA 5CSPA 4LOQA 5GJDA 4NM7A 1RQQA 3DB6A 3SRVA 4U45A 1IEPA 3PRFA 4FT0A 4V04A 5EH0A 2UZVA 3Q9XA 5JFWA 3UJGA 4NJ3A 1GIHA 1BUHA 2QOOA 4RQVA 5ICPA 1IG1A 2VU3A 2YHVA 3ZFXA 4D5KA 4AU8A 3ZYAA 4QP4A 2OFUA 3Q96A 3OMVA 2HOGA 1W7HA 2BHHA 2C6TA 5DVRA 1WBNA 3LMIA 4C4GA 5D9HA 1GZOA 5LMBA 4DBXA 3LCTA 5IQFA 4RC2A 4ZJJA 4QMZA 2W0JA 3QQFA 4TYHB 3P79A 3W2SA 2OG8A 5CSVA 2BROA 3EN6A 4XG9A 4BWXA 4HZSA 4PMMA 4DH1A 4L00A 3V5WA 2WTVA 4R77A 2WTKC 5HU3A 4YSJA 1CKPA 3A4OX 3PVGA 3ZM9A 3K3JA 4U7ZA 1PXLA 1VYZA 2W1FA 4NU1A 4FTAA 2QO9A 1IR3A 4RQKA 4OTWA 4GIIA 4TYJA 4WNPA 2AC5A 3RCDA 4CMUA 2F7XE 3KMUA 4RVLA 4ZZNA 1Y6BA 1REJA 2YLFA 3V8TA 3O0GA 3SW4A 3R22A 4EEVA 4O27B 4MXZA 3IK3A 4YPDA 3VS6A 3B8QA 4EH2A 4GG5A 3UO5A 3RNIA 1UWHA 3GFWA 5AR5A 5EOBA 3HMMA 3R8LA 4BCGA 3VW8A 5CNOA 2YIXA 3M1SA 3VF9A 3HV5A 4MXCA 1Q41A 2PU8A 4CFVA 1LUFA 3LOKA 3EQBA 5AAGA 3CTQA 5EW3A 4F9BA 2XKEA 3PJ3A 2XM8A 3OY3A 1P4FA 1JSVA 3DKFA 5TKDA 3TNWA 2F49A 3FKOA 5M56A 3MY0A 3H0ZA 3NSZA 3O7LB 4I6FA 3ZMMA 5KMKA 5GINE 4ZIMA 4E5AX 3NYVA 5CVGA 4FKIA 3MPAA 1CKJA 4ZTNA 2JIIA 3U6JA 1WBSA 4DH5A 4FV5A 1GZKA 5LOHA 1OGUA 1A06A 1H1QA 4G34A 4RPVA 2CPKE 3QTWA 3PIYA 3OBJA 5LXMA 3QWJA 5I9UA 5C8NA 3TDVA 2R3IA 3NW6A 2YJRA 3ZC6A 3UQFA 3SX9A 4MWHA 5HICA 2QNJA 3IG7A 4G3EA 3FBVA 3R8UA 3BV3A 1I09A 4YLJA 3V6SA 4MBLA 2PUNA 2IVUA 2VWUA 4XOZA 4HYSA 2I0EA 3WF8A 3CC6A 3F3UA 4FTOA 4Y5QA 3RP9A 3F3VA 4BDJA 3TJDA 4DLJA 1PYEA 4I0RA 1Q8YA 4AA5A 4HVIA 2PE2A 2UZWE 4AUAA 3L8PA 4UZHA 4ACCA 1SYKA 2VAGA 3CD8A 4D1XA 1U46A 3KL8A 4Y83A 3R7VA 5H8GA 5AR7A 4L3PA 4GYGA 2VWBA 4B8LA 2ITOA 2VTMA 4PTCA 3SRVB 1JLUE 2VTHA 4X6RA 4CTBA 5HBJA 3UMWA 3OVVA 3HDNA 5CF5A 3C13A 2OO8X 3PPJA 3NYOA 3RINA 3IW6A 4DFXE 5JN2A 4DEEA 3A60A 4YP8A 3IOKA 1JNKA 2WMWA 2YCSA 4L7FA 1FGKA 4FSRA 4UN0C 4ANOA 3CGOA 4D58A 5TO8A 5A54A 3R8VA 4M12A 3BZ3A 4DE4A 2BMCA 1G8SA 3BHVA 5JMSA 5AUUA 4DGMA 3DY7A 3UMXA 4O38A 4CMTA 2JDVA 4IVCA 5IH5A 5I3OA 3DJ5A 4JRNA 3ULIA 5M55A 4R3PA 3NW7A 2BKKA 4YR8A 2PVFA 4BTKA 3E3PA 3MA3A 3O17A 4FTUA 4TWNA 4DEAA 4Q2AA 4DH8A 3GNIB 1VZOA 3KF7A 3G15A 1APME 2WXVA 2YACA 3JS2A 3TI1A 3D4QA 4AZTA 3O71A 4L43A 5M44A 2C5VA 1H0VA 3LVPA 3VJOA 4Q9SA 4TT7A 2IWIA 2QR8A 3FLSA 5I3RA 4RFYA 4YBJA 4J95A 1KV1A 3VUIA 4G3CA 2R3FA 1KOAA 3R1YA 5H9BA 5M4FA 3BLHA 4ZTHA 5CLPA 4X2KA 2X0GA 5BYYA 2WQOA 5DHJA 2CGWA 3OCGA 5EM5A 4GK2A 3PE1A 4JBQA 3VW6A 2PY3A 3PZEA 4HVDA 1QMZA 4OTGA 3VUDA 4U3YA 4BHZA 3WF7A 3I5NA 2GNJA 3QKKA 3W8LA 3EOCA 4C37A 2C6DA 3CGFA 3Q52A 5EKNA 2HZNA 2JDOA 3COMA 5GZ8A 4RIXA 3W2QA 4Z9LA 4FVPA 2JLDA 4E7WA 2F2CB 4LGHA 3FZSA 2XIYA 2HAKA 1XH8A 4H05A 4UX9A 4LV5A 3AOXA 5DR6A 4DHFA 2GS2A 4X0MA 3HKOA 2BZIB 3ANQA 3L9PA 3RMFA 4FIJA 2P2IA 1ATPE 4CV8A 1XJDA 4LFIA 3EZVA 3O8UA 4Z16A 3R71A 3PXZA 3R2BA 1J1BA 2WU6A 5EDRA 4IAIA 3EQGA 3L1SA 1RW8A 3R30A 3MPTA 4I0SA 4MYGA 4R3CA 3UZTA 4MXYA 4I3ZA 5L8LA 1YHWA 4O22A 4XYFA 4I4EA 2YM4A 3MH0A 3PXKA 2C3JA 3QQGA 5C9CA 5FM3A 3FQHA 3RTPA 5CAPA 2IG7A 4C35A 4ANSA 5L2IA 4ALUA 2W05A 4H1MA 3GI3A 5TR6A 2BUJA 2BFYA 3DBFA 1U5QA 4AW5A 3Q60A 4BN1A 3TIZA 4TW9A 5ANEA 2A1AB 2P0CA 2VTPA 4M68A 4FT7A 3RAKA 4OLIA 1KV2A 2GMXA 4L46A 3IW4A 4TKSA 1O6LA 1SM2A 4IMYA 2P55A 4G3GA 1FVRA 4IAFA 4YC8A 4JOAA 5G1XA 3RWQA 5KX8A 3BRBA 5I4NA 5M09A 3W55A 2WQMA 2XNGA 4LL0A 4HJOA 4W4YA 3AC5A 2ERZE 2Q0NA 3ELJA 4I92A 1Q97A 3R1SA 3MFTA 4FNYA 2X6EA 2OK1A 3BHYA 4YJUA 4O7WA 3G5DA 4O84A 2X7OA 1Z57A 2C0TA 3K5UA 3C5UA 2HELA 3M2WA 1MQBA 5HVJA 3A4PA 1SVHA 5JGAA 1DAYA 3GC7A 3NMUF 5LCJA 3PPKA 1H1SA 3W2OA 3HV3A 4ANLA 3S2PA 2ERKA 2W7XA 4B8MA 5HIEA 4F9YA 2FSOX 2CNVA 3ROYA 2GNLA 4FL3A 2QO2A 3N4TA 4IX6A 2XUUA 5IU2A 4CQEA 2YZLA 3QWKA 4J96A 3KXGA 1CKIA 5DIAA 4N0SA 1ZOHA 3F88A 1QPCA 1GIIA 4KBAA 5EI8A 3OWLA 5GHVA 4F1OA 5I9ZA 5L8JA 3UODA 4BFMA 3C51A 2H96A 3C0IA 3JUHA 2F7EE 3NLBA 4ACDA 4RA5A 3Q2MA 4XEYA 3OW3A 1W84A 3QD2B 4K1BA 2Z02A 3OUKA 5GZAA 3CD3A 2CGXA 3VS0A 5CWZA 3R0TA 3O8PA 3IGGA 1NW1A 3FZOA 1U4DA 2REIA 2O5KA 4X2GA 4WO5A 2WMSA 4BHNA 2RFSA 3F69A 1S9JA 3E5AA 2IZRA 4PPCA 3JPVA 2DYLA 4X2FA 3PY0A 4IAKA 1ND4A 2YDIA 2YIQA 3IO7A 4IH8A 4O0VA 4APCA 5IA1A 4QTDA 4RX7A 3GBZA 4MXAA 4R1VA 3KCFA 5HEZA 4EK3A 4FKPA 2EXMA 3WZUA 2V7AA 2PULA 5ETFA 3SG8A 5EQEA 4BDIA 2NPQA 3BGZA 2WMBA 3ZRLA 1DS5A 3IONA 3LCOA 3LFAA 4KRDA 4C36A 4KIPA 3EH9A 4UWYA 4WOVA 2PVHA 3H9OA 3R1QA 3QRKA 2FA2A 3CQEA 4RBLA 4C7TA 4PP7A 3ENMA 2XZSA 3Q5IA 1Q8UA 2J0KA 3PXRA 1M2QA 1PXNA 5BMMA 3W32A 3R73A 4GJ3A 2YIYA 1KE5A 4DGNA 3DV3A 4DG3E 2XF0A 1REKA 4L44A 4ERKA 2ZB1A 3MSSA 4GG7A 1O9UA 3MFSA 3VAPA 4BDEA 5DT4A 4GT4A 2YCQA 3S95A 4BDBA 1V0OA 2J51A 3PP0A 2SRCA 2RG6A 3B2TA 4QTEA 4H58A 4FTRA 5LVNA 1OZ1A 5HG7A 3HAMA 5IKWA 4QO9A 5AV3A 5HTBA 3VNTA 5AV0A 2NNWB 4Z7HA 3DAKA 5I9VA 4NYEA 1W82A 3R00A 4JRVA 4QP8A 3TNIA 4DT8A 5EG3A 3MY5A 2QOKA 3ORLA 4PMPA 4OBOA 1H28A 3G51A 3QRIA 4DFYA 2X7FA 3ZSIA 1S9IA 3QQJA 4LV8A 4DFLA 5KNJA 1Z9XA 1OM1A 3MBLA 3UOJA 1L3RE 2CCHA 2WMAA 3R8MA 1PHKA 3VBVA 4EOIA 3ZLWA 1JKTA 3OC1A 3LLAA 4YTCA 3FI2A 1GIJA 5IA2A 4NZWB 2QOIA 3EKKA 1PRYA 2WOTA 3CKXA 4M8TA 2VWIA 2XCHA 4TPTA 5AUXA 2WZJA 4ZK5A 2QI8A 3R9NA 4EHVA 2I0YA 3D94A 2JKKA 1SVGA 5IDNA 3PSBA 4M13A 3OG7A 4U3ZA 4OAUC 1MQ4A 5HX8A 4AOTA 3QL8A 4BBMA 1MRUA 1GZNA 4UWBA 5A4TA 4IE9A 1R78A 2OWBA 3FYJX 4X21A 3JXWA 4KIOA 3ZBXA 1PXOA 2VD5A 3PFQA 4D2SA 1ZAOA 3KU2A 1QPJA 2O8YA 4LL5A 4KB8A 4PF4A 3OFMA 4M67A 4FG8A 4HNIA 4USFA 3WILA 3OWPA 5GZ9A 4QQTA 4KABA 3OTUA 3BU6A 4KS8A 4F0FA 3E7OA 4FTNA 5KMIA 2QONA 4FEXA 4O0YA 3JYAA 4FSUA 4HYUA 3SXSA 4WG4A 3GU4A 4E73A 3HLLA 1CM8A 4IAZA 3QU0A 3HX4A 4W8EA 3TT0A 1IASA 1PMVA 2PUUA 4IIRA 4FBXA 3KFAA 4HYIA 1OPKA 5IUGA 3H3CA 4AW0A 4PRJA 1JQHA 5BUJA 4EZ7A 4G9CA 4U40A 4CCBA 2BFXA 4W9WA 3K3IA 3RNYA 4PPAA 3RAIA 5CSHA 4QTAA 3OT3A 2X2MA 2BIKB 2QG5A 1P4OA 2ZMCA 3GCUA 5ANOA 4EC9A 1OL7A 4EK5A 4F6SA 2FYSA 4ZZMA 2W17A 2CGVA 5LJJA 1XH5A 4RWJA 4WKQA 4D0XA 2EXCX 4XMOA 5FTOA 5FTQA 2OJIA 4GK3A 4L8MA 3BYSA 2O3PA 5AIKA 3PVUA 3UYSA 3OS3A 3VS4A 4QMWA 4XBUA 3DK6A 4J98A 4FX3A 4XG6A 1BI7A 1WMKA 3AG9A 2ONLC 4R1YA 2C30A 3FZ1A 1HCLA 5CVFA 4BCNA 2OJ9A 5L6OA 5CT0A 4B4LA 4BC6A 2B9JA 2ITVA 3IDBA 4FVQA 3ZM4A 4BCIA 4E6AA 3Q4ZA 4X3JA 3UGCA 4EK6A 5AP0A 5IG1A 1JPAA 2XJ1A 3AMBA 2ZJWA 3IECA 2W1CA 4JBOA 4ZTRA 2CNQA 4N6ZA 4AWIA 3ODYX 3BE9A 5ETIA 2QOHA 2EWAA 5HCZA 1RE8A 4DGGA 3ATTA 5IEXA 2CCIA 2GNHA 2R3HA 3CTHA 4AF3A 3EWHA 2UZEA 3DCVA 4AT4A 1IAHA 2KTYA 3F5PA 5HE3A 3ORMA 1PMUA 3LFEA 4BL1A 2XNPA 2E9OA 4O7RA 3GCSA 3EN5A 2GPHA 1BI8A 2GTNA 2LGCA 3D15A 4ZSLA 2J2IB 4ZTLA 3RK9A 4YJQA 1UWJA 2YDJA 2VTNA 1ZMVA 4GH2A 3IQ7A 4FT9A 4Z3VA 5TOZA 1QCFA 2YAAA 5AAFA 2WPAA 4UZDA 3RVGA 4JDHA 5A46A 4AS0A 3UIUA 5DWRA 4XV1A 5EYMA 1J7UA 3FWQA 2BAQA 3PXQA 2BDFA 3AT4A 5CEPA 3FI3A 3Q4UA 4FYOA 5IQHA 4U97A 1AQ1A 3OCTA 4FSZA 4MXXA 1A9UA 1K3AA 1Q5KA 2VUWA 2ZM3A 5BVOA 4MF0A 4IX3A 1OPLA 2VGPA 4R3RA 3RPVA 4EHEA 3Q2JA 5M08A 4O7SA 4Y8DA 2OXXA 4FKQA 3F2NA 3I60A 5C1QB 4YLKA 3E92A 4BDDA 2JIVA 3L9MA 4BF2A 5FXRA 5I9XA 2EVAA 4CFFA 2C6LA 3R21A 4V01A 3DXPA 4GJ2A 3AD6A 1PXKA 3OEZA 2C6OA 4CQGA 2RIOA 4MXOA 1J1CA 3NS9A 3NUYA 5KMMA 3NUUA 3ZO2A 3FE3A 5L6WL 2C6KA 4IJPA 3CQUA 4AW2A 4BTMA 4BZDA 1H08A 2ITQA 2PZ5A 2R3QA 4F7SA 3P86A 4O96A 4PL4A 4EH9A 4YURA 3HRBA 3SKCA 4X3FC 1URCA 4M15A 3CCNA 3DKCA 5AP7A 2PVRA 5EYDA 5TT7A 5IQIA 3HP5A 2R0IA 4H39A 3RHKA 2I0HA 3E8NA 3WE8A 1UU7A 3MJ2A 5IQAA 3O7LD 4ZEGA 4CV9A 2GSFA 4WT6A 3LXNA 3E62A 3I6UA 2HYYA 3TV4A 1BLXA 4G16A 4OTPA 1J7IA 1DAWA 4QP7A 2XEYA 3QX4A 4RX5A 4QYYA 4QP6A 4D1ZA 4GV1A 5E8SA 4FL1A 1G3NA 4YHFA 4EOJA 5FRIA 3UO4A 3DXNA 4BDAA 4FIIA 3NUPA 4FGRA 1UA2A 2BRBA 3QYZA 3KN6A 3D14A 4IJ9A 4B6LA 4BDHA 2BHEA 4M69B 4BDFA 5GIPE 2EXEA 4EOMA 4ACGA 2X2LA 3TCPA 4DLIA 4UB7A 1Y6AA 3FLZA 2PMOX 5K0XA 3HAVA 3PG1A 2J50A 5GJGA 1PF8A 1YXSA 5JT2A 1MRYA 3QQKA 3R9OA 3IPHA 4BTJA 2XRUA 5AA8A 5HO7A 5KMOA 3CSVA 4EOPA 2NRYA 1YWRA 3HV7A 4IWQA 4L3JA 3EN9A 4BKJA 3OW4A 4IB5A 1OMWA 3QUEA 3BYUA 5AIRA 4UXQA 2BRGA 3ZTXA 1W83A 3NUSA 4GW8A 3POZA 1G5SA 4D2TA 5CF8A 1QPDA 2ZOQA 3A7JA 5A14A 4G3FA 1YDSE 2OJFE 2YIWA 5HOAA 3SAYA 5FP6A 4ALVA 4D4SA 1H26A 2R3JA 3FPQA 2R3LA 5AV4A 3FL4A 3D5VA 4XX9A 4IWDA 2I7QA 4DGLC 2J5EA 4CLJA 4C3FA 3SGCA 3NNVA 4BI1A 4E4MA 4R6VA 1YOJA 3LFNA 3DQXA 1Q99A 3MH1A 4RFMA 4DTBA 3G2FA 4R7IA 3BQRA 2OJGA 4IAYA 1WBOA 4O2PA 3EL8A 2OIQA 4WD5A 1DI9A 5E91A 3WARA 3OCBA 5HHWA 4M0YA 3QTQA 3QA0A 4CZYB 2W4KA 5DT3A 3W8QA 5M07A 4NFNA 4L45A 3W10A 2R3RA 3BPRA 2R7BA 4M0ZA 3ZLSA 3ZLYA 5CTPA 4QMYA 2GQSA 3UVRA 1JBPE 3ZXTA 5HIDA 4BDKA 4EHZA 2E9UA 4FIEA 1J3HA 1XBBA 3COIA 3PG3A 5JRSA 4C2VA 5CAVA 4ID7A 2WMXA 4Z55A 4RZVA 5CEIA 3M42A 4IFGA 4QT1A 4BVUA 4O0WA 3A2CA 2HY0A 3R9HA 5CALA 1WBVA 3PRIA 5HO8A 4NW5A 4M14A 3FLWA 4QMOA 4NSTA 5KBRA 4H1JA 4L67A 2G1TA 4Y85A 3MDYA 4CXAA 4BCPA 4DBNA 1NVSA 3BHUA 3D7ZA 2JFMA 1ZXEA 5J79A 2ITZA 4JS8A 3W2RA 3SOAA 5C8KA 3S4QA 2VWVA 2R5TA 4FK6A 5FXQA 2JD5A 2FB8A 2O65A 3PE2A 4HCTA 2XIRA 4AGDA 2YM5A 1PJKA 3RZFA 4ZSGA 5IISA 4Q5HA 3ZS5A 3EMGA 2VTLA 4BWKA 5LWMA 1OKZA 2CHLA 3CBLA 1ZWSA 3WE4A 5EM8A 4M97A 4JG6A 4RX8A 4RA4A 2YISA 5I5ZA 3Q9WA 3PWDA 4IM2A 3F2AA 3FEGA 2OU7A 4AX8A 2PVMA 4YJVA 1H4LA 4C34A 4IZAA 5B2MA 3W33A 4H3PA 4EK4A 2F7ZE 5M57A 4I5CA 4RMZA 5BQ0A 2X39A 4QMXA 4U42A 3DK7A 4CYJA 5M4IA 3R7UA 3BBWA 3PPZA 5T6KA 3F5UA 4EZ3A 4O2ZA 1V0PA 2G01A 4G5PA 4J8NA 4PUZA 3TZMA 4ZSEA 3HNGA 4D2VA 1ZYSA 4F99A 2OSCA 2XYNA 3RI1A 3G9NA 4FMQA 1FPUA 2JAVA 2XEZA 3F9NA 4LQMA 3I7CA 2C6IA 3C4EA 3NVMB 3TTJA 2WHBA 4JBPA 3TZ7A 4IDVA 5AX9A 4CTCA 4DN5A 2VV9A 3LQ3A 3A8XA 5HG5A 2WTJA 2WQEA 4I5PA 5LMAA 2LAVA 5M51A 5FTGA 3Q5ZA 2XNBA 2XK9A 5CS6A 2J5FA 2JAMA 5JFXA 4NT4A 4FV7A 2IVVA 4L52A 3PY1A 3E8DA 2WIPA 3WIKA 3VS3A 1E1XA 4WRSA 2XKFA 4LM5A 4O1OA 3NNWA 3GXLA 4C4HA 4DAWA 4DEBA 4ZSAA 3CIKA 3MY1A 4IB1A 4NIFA 4O0XA 2OH0E 4EONA 5E8TA 2WD1A 3HV4A 3BIZA 3FHIA 3A7GA 3FZTA 5EW9A 3V8WA 2GDOA 3P1AA 4GMYA 3OCSA 4TNDA 3SVVA 3RGFA 3KC3A 2H8HA 2VTTA 3BV2A 3GC0A 3DKGA 3IOPA 3NUNA 4GCJA 5KE0A 5HTCA 3C50A 3QLFA 3FMJA 3F61A 4KUJA 5A4EA 3CQWA 4PMTA 3FI4A 5F9EA 4NEUA 2UW0A 4DT9A 2UZTA 4C4JA 1G8AA 4EH3A 2ZV8A 3E87A 2V5QA 3F3ZA 4UMRA 1TQMA 2GNFA 4PL5A 5E9EA 4FSTA 4D4YA 2PVNA 3ALNA 5HGIA 3FI8A 3DDPA 5AFVA 1SNXA 4U81A 2BCJA 3QQHA 3CY2A 4KS7A 4WRGA 3RM7A 4FVRA 3COHA 4ITHA 3IGOA 4FF8A 4K77A 3HP2A 5H2UA 4BIDA 1YI6A 3E8CA 5GIOE 2O64A 4YGAA 4O81A 5F20A 4O6LA 4RRVA 4JLCA 3CJFA 4XJ0A 4XBRA 3EFKA 1PKGA 2XBJA 2ZM1A 3MTFA 4J1RA 5HG9A 5KMNA 4QYEA 3S1HA 4I93A 4XHKB 3ZRMA 4NWMA 1ZY4A 2HZ4A 5DE2A 2A4LA 4MVFA 2Z2WA 3H9RA 5CQUA 3EQDA 3TV6A 3DB8A 5HLPA 4E93A 3DNEA 3SW7A 4A9RA 4F9CA 2FGIA 5BYLA 2YLEA 2CKQA 1U54A 1PXJA 5AR4A 3KMMA 3UVQA 3V5TA 5IQCA 4RGJA 4F0GA 4AN9A 1OIRA 3HZTA 5CI6A 3GU5A 4MKCA 3QZGA 4EJ7A 1Q24A 2VTSA 2BDJA 2BKZA 4BZNA 3IW8A 4G6OA 4XG2A 2B1PA 2R2PA 1LR4A 3ORPA 5EM7A 3VUHA 3EIDA 4E5BA 4OTQA 3P78A 3FSKA 5ANDA 3VUMA 2PVLA 4YZMA 4AFEA 2FH9A 3G6HA 4PDOA 2B4SB 3UG2A 4C4IA 3SLSA 2W5HA 1H27A 1YHSA 4WA9A 4O7NA 2YDKA 4IDTA 3O51A 5JZJA 2RFNA 5HVKA 2VX3A 2X8EA 1VR2A 2J7TA 3R01A 5J95A 3O96A 5HX6A 4I0TA 5D1JA 5L2QA 4CKIA 3NNXA 4K8AA 4R8QA 2OF2A 3DXQA 4HZRA 1SZMA 4K2RA 4KNBA 4RIYA 3OBGA 4CT1A 3U55A 5AV2A 2C1BA 5KHWA 4U5JA 3R7EA 4RX9A 2Z8CA 2Z7QA 4Q9ZA 3NRMA 4W9XA 1H1WA 4NIFB 5IQBA 4TN6A 4C57A 3UO6A 1IRKA 1J91A 5L6PA 2C5OA 5AJQA 4X7QA 4JL9A 4E20A 5DPVA 3ZUUA 3VQHA 4USEA 2C5YA 1F0QA 1QL6A 2BVAA 1GJOA 3TXOA 2ETMA 3F7WA 4HVGA 4BY9E 3I81A 3PSCA 4G2FA 3TKIA 4EWHA 2AYPA 2CLQA 2WKMA 2WTWA 2GHLA 5KCVA 3QZHA 3HMOA 2W5AA 3TDWA 2XNEA 2ITXA 2DWBA 2WMUA 5K4JA 3CY3A 3TKHA 2QLUA 2XS0A 4LUDA 3HUCA 4TNBA 2XM9A 4AE9A 2IZSA 5CAQA 2BRNA 2R3NA 3VHKA 2WTKB 4HGTA 3ULZA 4YHTA 5L3AA 3LAUA 4ASZA 2PUPA 4FKSA 1YOLA 4TY1A 2JC6A 3C0GA 4F9WA 2GQGA 4QP1A 4UY9A 4W8DA 5A4QA 2F57A 3SXRA 2X6DA 3T9TA 1ZZLA 4HCVA 1ZMUA 2C5NA 3BEGA 3U9CA 2WO6A 3DBCA 4YLLA 1H24A 4L01A 1OITA 4YO4A 4UMUA 2VGOA 2OZOA 3KXNA 2WEIA 2PVJA 1UU9A 3ANRA 3D7TA 4GU9A 3GUBA 4TWOA 4UYNA 5G6VA 2OJJA 4FV2A 3RPRA 3ZSHA 3R63A 3EB0A 5HCXA 5DH3A 4CFMA 1E9HA 3PJ2A 4LGDA 5K0KA 3CJGA 4ZAUA 1U54B 2OICA 4RVMA 3LCDA 4ZSJA 2W96B 4ZY4A 1HOWA 4KKGA 5ACBC 3NCZA 3BLQA 3SQQA 2B9IA 2VNYA 4IWPA 3RWPA 4BGHA 4O0UA 1GNGA 4S2ZA 2WQBA 5HZNA 4QNAA 4CT2A 2OI4X 5CT7A 3B2WA 4AACA 4YTHA 5HCYA 1ZOGA 5AUWA 3VRZA 4CFUA 2E9PA 1UNLA 5D12A 3MW1A 4NTSA 4D4VA 3FC2A 2XVDA 2VTRA 3CEKA 2PWLA 3GU6A 4A4XA 5CXZA 2B0QA 4FG9A 2PVYA 2QOLA 1UKHA 3LJ2A 1XWSA 2CDZA 4C33A 4MWIA 3WZKA 2XKCA 4C3RA 2VO6A 3VRYA 3DJ6A 3UIMA 4YJTA 4EJNA 2J4ZA 4RIYB 3UNJA 1NT2A 1WBPA 5FG8A 4KAOA 2C1AA 4TRLA 4IANA 3FY2A
chains in the Genus database with same CATH superfamily
4HVHA 4AGCA 1MP8A 2QQ7A 4AT3A 4IM3A 4ALWA 4WG3A 5GNKA 3KRJA 4YJOA 5CU0A 4R7HA 2O2UA 4NM0A 1Y91A 2B7AA 2J90A 3PYYA 4G3DA 4AA4A 4AFJA 1CDKA 3QRUA 4H36A 4RIXB 3P7AA 2EUFB 4UWCA 1OB3A 4JDKA 5IMEA 2ZV7A 3A99A 3DDQA 3HRFA 3V6RA 1BMKA 2G15A 5F95A 3MESA 4C4EA 4EZ5A 3FLNC 1JAMA 2XRWA 3NGAA 4JVGA 3II5A 4GU6A 2X8DA 4DEHA 3KF4A 5CU3A 3D5XA 3SC1A 3GEQA 4YZCA 4E6CA 3HMIA 3JVSA 4LYNA 2ITTA 5LVPA 3BBTB 2BRMA 5L4QA 3AGLA 2YN8A 2HW7A 3ZEPA 3FL5A 5JFSA 5DT0A 5CU6A 1B6CB 5A4LA 3UIBA 4I5HA 4WNKA 3G33A 3AD5A 3OWJA 3QXPA 3UDBA 3ITZA 4QOXA 2C3LA 3TZ8A 3QTZA 4E1ZA 4FOCA 1YXTA 2QD9A 4I22A 5J5SA 1YI4A 2FVDA 3CKWA 3D7TB 3DK3A 4FC0A 5CZHA 1YWVA 2ETKA 2G2FA 2UVZA 1SNUA 1W0XC 3PSDA 4DF3A 2GFCA 4WHZA 4AZFA 5JH6A 4RJ4A 1WBTA 3DBEA 4CG8A 3VBWA 2QURA 3ENHA 1YDTE 4J7BA 4CNHA 4L9IA 1WCCA 5BX0A 5CANA 2YM7A 2ZV9A 3GC9A 3NIZA 3PXFA 5F4NA 3C5IA 3U4WA 1XH9A 5HE2A 4AOJA 2Z60A 3LXLA 4NL0A 4D2RA 3N51A 2OZAA 2X2KA 5C4KA 3MFRA 4LUEA 3TNPC 2BAKA 3DGKA 3EFWA 3RM6A 1FBNA 4J99A 5CNNA 4ASEA 2QO7A 1UVRA 5EK7A 4RWLA 1M52A 2WMQA 3HMPA 3PY3A 5T3QA 3DT1A 4WBOA 3CPCA 3BHTA 3RPYA 3VULA 4AXAA 4S31A 4KSQA 3LCSA 4CFNA 3O23A 4B9DA 1OKWA 1W2CA 3KMWA 3D2IA 1SVEA 3FKNA 4GVJA 4CYIA 5DYJA 4PY1A 4RFZA 1NXKA 3DPKA 5CEQA 4AXCA 4GFGA 3UOKA 4EL9A 4A7CA 3QALE 1YDRE 1OL5A 1M14A 3GP0A 5B2KA 5HBEA 1SMHA 1P2AA 3AKKA 1FOTA 1V1KA 4YNEA 3Q04A 4JJRA 4L68A 3VBYA 4OT6A 2IJMA 2JKQA 3ET7A 5CI7A 3VS7A 2ITYA 3G0EA 3R2YA 5FD2A 3VS2A 4O7TA 4DCAA 3NYXA 3KULA 4MNFA 1J7LA 4S33A 1JVPP 4PPBA 5LARA 3UC3A 3U6HA 2YM3A 3NW5A 4NW6A 3FMHA 3ORIA 5HVYA 3WF6A 4I6HA 4UALA 5KZ0A 5IQEA 3QCQA 4OTRA 4FTMA 5DR9A 5AMNA 3NX8A 3DFCB 4AOIA 3ACJA 2NO3A 1LEZA 2VX1A 4FSYA 5JFVA 2BILB 3TTIA 4K0YA 1JSUA 5E8XA 5H3QA 4EBWA 3NUXA 3O8TA 4AZEA 4OUCA 3SD0A 5DEWA 3D9VA 2QU5A 2E9VA 2IZUA 4P2KA 3RHXA 2UW6A 1ZOEA 3UIXA 3OF0A 4A9UA 5E1SA 3SDJA 3IW7A 4A4LA 4FKRA 5A3XA 3LFDA 5AP6A 4O7YA 2HENA 1CMKE 1GZ8A 1OVEA 3GOKA 4FKGA 4FSNA 4R5SA 5HNBA 3UG1A 3TV7A 3ZFYA 2WGJA 4Z7GA 4MTAA 3QAME 4J8MA 3HA6A 1ZARA 5H8EA 3VHEA 4E4LA 4DFUA 5FQDC 1ERKA 2GHMA 2V22A 4FTLA 2UW9A 5E8YA 4EH7A 3QZIA 5IEYA 5IZFA 5DLSA 3BLRA 2VRXA 3B8RA 3KB7A 2PTKA 4FV3A 4JDIA 3ZCLA 3SXFA 1I44A 2I0VA 4OTHA 2F9GA 3P7CA 5AAEA 4N6YA 2ZAZA 4RWIA 5J87A 3CE3A 3ZZWA 3E3BX 4C62A 2OFVA 5HLWA 3PJCA 4NTTA 3AC3A 2A0CX 1Y8YA 2XIKA 4JG8A 2OZAB 3V8SA 3IS5A 1LEWA 3C4WA 5J1VA 2HCKA 5DA3A 4C59A 4WBBB 5FLFA 3WZJA 3QUPA 5D7AA 2UZUE 1NY3A 2XYUA 2CSNA 4I6BA 3SV0A 2EB2A 4EC8A 5IDPA 2W1GA 2JFLA 4WSQA 1A48A 3PDTA 3VBQA 5IA0A 4ORKA 3Q4TA 4BIEA 2YFXA 3FMMA 1R0PA 3KRLA 3NCGA 1KUTA 4DDGA 2XIXA 3MTLA 3I4BA 1F5QA 1ZYJA 1UU8A 1IA9A 4MK0A 3I0OA 4L53A 5D7VA 3WF9A 4E8AA 3LLTA 1U5RA 1XH4A 3KCKA 5HNGA 3BCEA 3OXTA 4CEGA 4C38A 2QU6A 3RK7A 3QHWA 5HE0A 1ZYLA 4PNIA 3HV6A 2PSQA 1JKLA 3AC8A 1YVJA 2J6MA 3L9LA 4HYHA 1H07A 4L3LA 3CR0A 1JKSA 3A7IA 3ACKA 3E88A 3GU7A 5DBXA 4Q5EA 4YPSA 3W2CA 2UZDA 4BTFA 3F6XA 4J53A 1BX6A 2RSVA 4PTGA 3H4JA 4F7NA 3KULB 2GFSA 3V5LA 3SHEA 5DNRA 2YERA 3PVWA 2VWWA 1W2FA 3DU8A 4JX7A 1NA7A 2UVYA 4GRBA 3BWJA 4MQ1A 3ORXA 2I6LA 4GFOA 3QD3A 5HQ0A 2BPMA 2WB8A 4FKJA 4FT3A 4LMUA 5C27A 3PIZA 2ONLA 2UZNA 3WI6A 4WIHA 3T8OA 4ANNA 4DEIA 4EH8A 4GKHA 5JK3A 3BHHA 4MQ2A 2B54A 3I0QA 4R5YA 3QZFA 2WFYA 1FMOE 3NYNA 4FZFB 4RWKA 4F64A 5M4CA 2HY81 4IWOA 4YTIA 3P5JC 4BCOA 1AGWA 1OUYA 3R9RA 2C0IA 5ETCA 3KK9A 3ZRKA 3ZO1A 4FODA 4M7IA 4QMPA 5AR3A 3NEWA 4YJRA 5JSMA 3LM5A 1TQPA 4QD6A 3W18A 4Y46A 3EHAA 4FT5A 3GCVA 4C3PA 2RKUA 4XUFA 4G5JA 4LG4A 2XK4A 3MWUA 4KD1A 3C7QA 4TYIA 3VN9A 1E1VA 3ALOA 4BCFA 3C4FA 3MH3A 4L6QA 4MX9A 4N4SA 5LMKC 3EN7A 4EUTA 3FAAA 3BU5A 4FSQA 4QP2A 2I40A 4ARKA 2YA9A 2YABA 3GQIA 4OW8A 4D55A 2W1DA 4U80A 3WOWA 4E3CA 1O6YA 5CASA 3V3VA 1XHAA 3L9NA 2PVKA 4F6WA 4LI5A 4O7LA 2P33A 2J0JA 3C0HA 4O21A 5AUYA 4CKJA 4FJVA 4ZS4A 3FSFA 4X6QC 4CMOA 5HNIX 4I24A 4DA5A 3OEFX 3W2PA 3JY0A 2PPQA 3I5ZA 2RL5A 4MHAA 5FEDA 1WVWA 3DBDA 4G6LA 4ENXA 3BQCA 5LVOA 4TYGA 2WMTA 2W1ZA 4YNOA 4ZOGA 3BWFA 4AE6A 1XQZA 4AZVA 4BKZA 4V05A 4DYMA 5I0BA 3P0MA 4C8BA 2B9FA 4RIWA 5IMXA 3DA6A 4IVDA 4O4EA 1KE9A 5C4LA 1PKDA 4YU2A 4I41A 2IF8A 2OXDA 5ANIA 4QMNA 3BKBA 1YW2A 3NPCA 2GU8A 3TIYA 4I4FA 3KVXA 3QXOA 4FV1A 4I21A 3QA8A 2CKOA 4O7VA 4F0IA 3G90X 4FICA 4FI1A 4JT3A 5J9YA 4QDEA 4D4RA 2JGZA 4GKIA 4YJNA 3EQPA 2J0MB 4QPMA 4Y73A 3KRWA 2WIHA 4MD7E 4GT3A 4IW0A 5LMKA 4XNEA 3HYHA 3AC1A 4AZSA 4NJDA 3Q4CA 4X3FA 5HE1A 3UP2A 4TTHB 4XV3A 3UE4A 1YXXA 3EFLA 3AT2A 3Q9ZA 4XRLA 3MI9A 4OGRA 3KEXA 4BGGA 2X1NA 5EYCA 2GHGA 3VIDA 2BZJA 2R64A 5AEPA 5BVNA 5IH4A 2P3GX 5KBQA 3A7FA 2QOCA 4GUEA 2CN8A 4PWNA 3P23A 3NZ0A 4U8ZA 3ZZEA 3ZO4A 1K2PA 3GB2A 3PWYA 3TL8A 5ANGA 1LPUA 2IW6A 2BDWA 1VEBA 3TKUA 2UZLA 4B99A 2PK9A 5M4UA 2B55A 2VTAA 3KK8A 3GCPA 3HRCA 4RJ7A 3T9IA 3TACA 2R3MA 4JR3A 4XS2A 5E90A 5I9WA 3O50A 3UDTA 4P90A 2PZPA 4XOYA 1JKKA 4FV8A 4ZLOA 3GOPA 5CY3A 5DG5A 3CXWA 4KINA 1OECA 3R7IA 3NIEA 3A61A 5HIBA 3OOMA 4JIKA 1YHVA 5EDQA 3W16A 2PZIA 1XR1A 1TFFA 1G8JA 2IO6A 4FIHA 4XP0A 2B9HA 2VZ6A 4RJ3A 4QMQA 4BRXA 2C68A 4FNZA 4FTCA 5KZIA 5AP5A 4IC8A 5LVMA 5C03A 1VJYA 4WUAA 3NVKI 3MB7A 4LRKA 2YWPA 1G8KA 4FNWA 3C4CA 4EWQA 1R39A 5EHYA 3TNQB 4QPAA 1ST4A 3I7BA 2NYAA 4J71A 3FMDA 4IVBA 5A9UA 4KKEA 4ZS0A 4YC6A 5M53A 3GGFA 4KBKA 5JEBA 4YZDA 4NKSA 2UUEA 2XBAA 5E8ZA 3BGPA 5EQPA 4CFXA 3CP9A 5JKGA 3PJ1A 4TXCA 2JDRA 3W0PA 4OT5A 4HGSA 3S0OA 5AX3A 1WFCA 2QOFA 3L8SA 4EYJA 2VO0A 4EQMA 1Q8ZA 2QLQA 4NK9A 5IPJA 4W4XA 4AG8A 1FVVA 2YIRA 5AP3A 4RIWB 2BZHB 2OGVA 5A6OA 5DOSA 3V04A 4F7JA 4YJPA 5AA9A 4PTEA 4GT5A 4I94A 4MCVA 3EQHA 5AP1A 3KREA 4OTDA 3TMOA 4RT7A 3DZOA 4KIQA 4U41A 2Y4IC 4XG7A 2JITA 3R7GA 3ZDIA 5LQFA 2BRHA 4YUQA 3QF9A 4P4CA 2WTDA 3BX5A 3VUKA 4EOKA 2B52A 3LMGA 4J52A 4AN3A 4M3QA 1BL7A 4U0IA 4PL3A 1Q8TA 2AUHA 4FIGA 4MF1A 4C61A 5J7HA 5AP2A 4JQEA 4BBFA 4PNKA 4KRCA 5IF1A 5TF9A 4Y95A 2H9VA 2ZV2A 2ZDTA 1K9AA 2R0UA 1OIUA 2W1EA 1Y57A 3E93A 3VQUA 2QHMA 2O0UA 5C01A 1BYGA 2YCFA 4ZLZA 4X3FB 4XV2A 2W99B 3H30A 2VTJA 2ZM4A 3R6XA 3SG9A 4DTAA 4GUBA 4E4NA 3UZPA 3CTJA 1TQIA 2J0LA 3R9DA 5CSXA 3QYWA 4BCHA 3PXYA 4DG2E 1FQ1B 4ITJA 5K5NA 4A4OA 4CG9A 3IDPA 4C58A 4IVAA 4IZYA 1OI9A 3P9JA 3FZPA 4I1ZA 1OKVA 2X4FA 3KXHA 4QMSA 2BTSA 5DFPA 5B2LA 4O7ZA 5CZIA 4XCUA 2R4BA 3KQ7A 5DEYA 5CEOA 3U4UA 4S34A 4IEBA 3THBA 2KULA 4YMJA 4MUQA 3QQLA 4USDA 3R83A 3WYYA 2RFDA 2Y7JA 5KHXA 1P5EA 4G9RA 2G9XA 4O0TA 3MB6A 1TKIA 2VWXA 3AC4A 4ONAA 5CX9A 3NNUA 1NVQA 1RDQE 5IUIA 3UOLA 4ASXA 3HMNA 4BYIA 5CF6A 1KE7A 4PQNA 3IDCA 1URWA 2C5XA 3MH2A 3IKAA 4KWPA 2ITWA 4XRJA 4XLVA 5EKOA 2IZTA 4G31A 3FMLA 4RVKA 3P7BA 2R3OA 5CYIA 3R8ZA 3F3TA 3QTXA 2GS6A 2HK5A 4XV9A 4NCTC 5E4HA 5HBHA 3HL7A 2XJ2A 1ZY5A 2BAJA 2XH5A 5LWNA 3NWWA 1TVOA 4H3QA 2H6DA 3F66A 2H34A 4FZ7A 4YC3A 2IW9A 4D2PA 3IW5A 4EBVA 3QD0A 4QYFA 2Q83A 2WNTA 5L2SA 2CN5A 3QHRA 2Q0BA 5E7RA 4DEGA 4G1WA 4FKVA 5BVWA 2W5BA 5J9LA 4M84A 4FUXA 3TJCA 3Q6WA 5ITAA 2X8IA 4FZDB 2VN9A 2VTOA 3ZC5A 4EYMA 4QMVA 4O0SA 4O0RA 3AKLA 1MRVA 3DNDA 4BR3A 2PE0A 4UMTA 4ASDA 2W1HA 4D0WA 3LIJA 4ACMA 1OL2A 3LM0A 1H8FA 2O63A 4JG7A 5FGKA 4C02A 4UMPA 4YHJA 3LKMA 4FE2A 2W9FB 4ITIA 4M66A 2A19B 4YTFA 3UQCA 2DS1A 1IAJA 3QCXA 3NAXA 4BCJA 2XA4A 4IAAA 4OTFA 4DITA 4QTCA 1H1RA 1UNGA 1YXUA 3F82A 4FSMA 5HLNA 3TUBA 1XH7A 2QCSA 4TZRA 3LQ8A 4F1MA 2QKWB 3EQCA 5ANKA 5F94A 2V62A 5J1WA 4ZJVA 3KIOC 2OXYA 3I1AA 4JAIA 5IA3A 2XARA 3GFEA 1WAKA 2OKRA 2XP2A 2YEXA 4HPTE 4PP9A 4QPSA 5JGBA 2EU9A 3ERKA 3GT8A 5HTIA 5TE0A 4QQJA 2C4GA 5A6NA 4QEBA 4P5ZA 2JBOA 3W0MA 4NCTA 4CZTA 4UV0A 5KMJA 2BR1A 4I20A 5CEMA 1MUOA 3DBQA 2RGPA 2PZRA 4W4WA 3MVJA 5DRDA 3UYTA 4YBKA 3V01A 4EUUA 3LQ5A 4L7SA 4IX5A 3A62A 2Y6OA 5D10A 2E9NA 5DR2A 4ZTSA 3MVHA 3VVHA 5HD7A 2QC6A 4YO6A 4UXLA 3PA4A 2WMRA 4XH6A 1PXMA 3U51A 2XALA 2BZKB 3QBNA 2C6EA 3QCSA 5FEEA 4WNOA 4F70A 3PA5A 4FV6A 5BVKA 2OIDA 3FPMA 4BYJA 4EQCA 1O6KA 4TWCA 2Y4IB 4QMMA 3QC4A 2R3GA 4FTQA 4D28A 5EQYA 3BYMA 3FKLA 4MNEA 2XJ0A 4LGGA 4ZY5A 2XNMA 2UV2A 3DKOA 4MBJA 3VUTA 3SA0A 3QKMA 4JR7A 3D2KA 5D41A 3KRXA 3RAHA 5BNJA 4FEUA 3RPSA 3AQVA 5K3YA 2CNUA 5FWKK 5HD4A 4NH1A 2EB3A 4D1SA 3E8EA 2QHNA 3GU8A 3LXKA 4NM3A 2X4ZA 5AM7A 5JGDA 5AP4A 4MH7A 4CKRA 1L8TA 1BKXA 1STCE 1YXVA 2W06A 4HGEA 2GTMA 4K11A 3BL7A 1H25A 5E8VA 5J8IA 3VF8A 1FGIA 3TUDA 4ANMA 4RJ6A 3W1FA 3S3IA 2QVSE 4DINA 4QP3A 4U79A 5ETAA 1GOLA 1EH4A 4FK3A 3L8VA 1PW2A 2ESMA 4U43A 5BUIA 5KMLA 3LJ0A 3MPMA 4FEWA 1KSWA 3LFFA 4A9SA 4F9AA 1WVYA 3REPA 4JXFA 3T3VA 2I1MA 3V51A 1UNHA 4LRMA 4DFZE 2R3PA 2HWOA 4KA3A 3VBXA 1W98A 2ZMDA 4F78A 1M2RA 4LMNA 2W1IA 2WTCA 2HZIA 3LFQA 5DGZA 3C9WA 4ZY6A 4KIKA 5HKMA 2QKRA 3ODZX 4DCEA 3U6IA 2IW8A 4I5MA 3P08A 4O91A 1WBWA 3LE6A 4CRLA 4FEQA 3DJ7A 4U6RA 4GL9A 3K54A 4C2WA 4EQUA 3PA3A 4YZ9A 2UW8A 4OR5A 1XBAA 5HO6A 2QG7A 2IN6A 4CCUA 3ETAA 5E1EA 2XNNA 4EOSA 2JDTA 3UQGA 2XMYA 5GJFA 3DLSA 4O6EA 4YJSA 3R8PA 4BCKA 4IFCA 2X9EA 4AP7A 4PV0A 4E5WA 1PYXA 4IACA 3MYGA 3QTRA 4I6LA 4HGLA 3Q3BA 1FMKA 5CF4A 5BMSA 3W0SA 3QTSA 3ZEWA 3VC4A 3Q9YA 3BI6A 4BB4A 5L2TA 2NRUA 2V55A 1T46A 1OIYA 3KXXA 3WZDA 1Q8WA 3ROCA 5CVHA 3BEAA 4YZBA 3UPZA 3PUPA 5D11A 1JWHA 1ZMWA 3QRJA 3F5GA 3KVWA 4ZP5A 1H01A 4AZWA 5L8KA 1Q62A 4ZMEA 2YZAA 4PDSA 3LW0A 2OF4A 3CLYA 4BBEA 2UVXA 2CLXA 3C1XA 4JIAA 4HNFA 3FXXA 2BTRA 4JDJA 5ANJA 1Y8GA 4D9TA 5HORA 2F2UA 1WZYA 3FMNA 3D5UA 3KY2A 4QYHA 5BVDA 5I9YA 3P5KA 2BALA 5J5TA 4FV9A 5IEVA 3PP1A 1PXPA 4FKUA 2A2AA 2C47A 2GNGA 3C4ZA 4PMSA 1XKKA 4LOPA 1Q3DA 4L42A 2JKMA 4MNEB 4W4VA 5AR8A 1V0BA 2ITPA 2YJSA 1YOMA 4BCQA 2JBPA 2WAJA 3FJQE 3ZHPC 1OL1A 3EKNA 4ZXTA 4DTKA 1H1PA 2X81A 2WMVA 2PZYA 2XNOA 5LCKA 3OY1A 4QQCA 4KKHA 4CZUA 4DC2A 5FDPA 5HU9A 3I79A 4XP3A 4HCUA 5EI2A 5HI2A 4BJJA 5KO1A 3FMKA 1M7QA 5IH6A 1U59A 4ZJIA 5EYKA 3VS1A 3EYGA 4FKOA 1YQJA 4FTJA 4GEOA 2GNIA 2Y6MA 3ZXZA 3ZUTA 2Z7RA 4NUSA 5JQ8A 2FSLX 5KKRC 1NVRA 3TG1A 4KBCA 3FZRA 3S00A 4EOQA 4R78A 3V5JA 4O4DA 2V0DA 2RF9A 5KUPA 1ZYDA 3QRTA 2ZB0A 4A06A 4GVAA 4G17A 2YAKA 4TWPA 3R7YA 3UOHA 3MIAA 2CKEA 4GSBA 2RFEA 4ERWA 5J7BA 4WNMA 2UZOA 3AC2A 3EZRA 4IB0A 3E64A 3KXZA 3CPBA 5AM6A 3LXPA 3RK5A 2JKOA 4A9TA 4KIKB 2JDSA 3WZEA 2W4JA 4G6NA 3MV5A 5FP5A 4FL2A 3BE2A 3RPOA 3F2RA 4O86A 3O2MA 1PMNA 2A98A 4ANQA 2C0OA 5FDXA 4U44A 4EOOA 4MBIA 3LJ1A 1UV5A 3POOA 4ENYA 2YM8A 3QD4A 4FTKA 2UW3A 3QC9A 4GYIA 5F1ZA 4FKLA 4N70A 3PLSA 5H8BA 3EFJA 4K33A 3R04A 3ZDUA 4FV4A 3DZQA 4RC4A 5FBOA 3TM0A 3EYHA 4WSYA 3UZRA 2WOUA 4JQ8A 4YSMA 3AMAA 3A8WA 4GFMA 5AUZA 3VJNA 2OLCA 2Y8OA 3FUPA 1OL6A 2C3KA 2QOQA 3D5WA 4NFMA 3MIYA 4IX4A 4XP2A 5E8UA 3N4VA 3ATSA 3T3UA 1KOBA 5FBNC 2X7GA 5JRQA 4N57A 3LZBA 2QOBA 4MD9E 5EM6A 4X2JA 4GS6A 1CTPE 2C6MA 4II5A 4D2WA 2FSTX 2XIZA 5EFQA 4E4XA 4EI4A 4F08A 4IC7A 2CJMA 2B53A 3PFYA 3M11A 3UNKA 1Q3WA 4A07A 1M7NA 1X8BA 3LHJA 3Q53A 5IQGA 2VWZA 1M2PA 2UW7A 3EQRA 3UPXA 2PMNX 4PDPA 4BI0A 3BELA 2XB7A 3MVMA 3UVPA 3ML1A 2CKPA 1OUKA 1BL6A 3HECA 5IUHA 3FQEA 5IA5A 3R28A 4IZ5A 2ZYBA 1B39A 2YM6A 4P5QA 3AXWA 4UEUA 4FV0A 1VYWA 2F4JA 3BU3A 3GC8A 4B0GA 3A7HA 3OTVA 4I6QA 4YZNA 5FM2A 5BYZA 3U9NA 4ANBA 4OBQA 3E7VA 4U9AA 4ZTMA 2PUIA 3N4UA 3I6WA 4ZLYA 4BJJB 3ZH8A 3G6GA 4WG5A 2OIBA 4RSSA 2Y4PA 3OT8A 4ZTQA 2HXQA 4UYAA 4F65A 3GQLA 5FEQA 4JNWA 3R02A 3ZONA 5BPYA 5EHLA 2AQXA 4FRFA 3BYOA 3F7ZA 3VO3A 3ZOSA 1XO2B 2A27A 3MFUA 3OUNB 4RJ8A 3VUGA 3PZHA 1ZLTA 2DUVA 4BDGA 1PMEA 3DTCA 2YITA 4V0GA 3DLZA 1ZRZA 3AGMA 3L8XA 4IQ6A 4CVAA 1UU3A 3COKA 2RG5A 2X0PA 3ORZA 3TUCA 5J9ZA 3DQWA 4FSWA 4J97A 3V5QA 3G9LX 1AD5A 5LVLA 3MGYA 2ITNA 2UZBA 3AMYA 3OXIA 3FXWA 5DRBA 4BCMA 4JX3A 3R7OA 2OBJA 3D83A 2WU7A 3N9XA 4D5HA 2YCRA 4NKAA 4DH7A 2AC3A 1W8CA 3LFSA 4ACHA 4QNYA 4EK8A 3WIGA 4F6UA 1OBDA 2PMIA 3BYVA 4EH6A 3EL7A 3K2LA 3FQSA 4XG8A 4HW7A 4DGOA 4GIHA 4RIOA 4O1PA 4IADA 5EW8A 4E26A 5AWMA 1DM2A 3QGWA 2HXLA 3FC1X 1OPJA 2ZVAA 4FEVA 4FZAB 5EHOA 3ZBFA 3U87A 3FYKX 4QTBA 1OIQA 3LFBA 1YRPA 3QX2A 3TZ9A 4QMLA 4EH5A 1PXIA 2CMWA 3QCYA 5CQWA 3NUAA 5A4CA 3ZFMA 4K9YA 5HESA 2FO0A 3ORNA 3H9FA 2ETRA 4Y72A 4E6DA 1FINA 2ACXA 3KGAA 4OBPA 4ZZOA 4OAVB 3ZSGA 3GCQA 1R1WA 2Z7LA 2R9SA 3NDMA 5CSWA 2G2HA 4FYNA 3Q32A 3TEIA 5L2WA 1IA8A 3C4XA 3OP5A 4M69A 3SOCA 3UC4A 3OWKA 1UKIA 3RBWA 4DFBA 4FR4A 3AT3A 3LPBA 2OH4A 1HCKA 4OTIA 5EDPA 2QODA 5JZNA 4DEDA 3QUDA 5KKRB 3U54A 3KXMA 2C69A 3OOGA 4IXPA 5AV1A 4AA0A 2J9MA 3FDNA 4RG0A 4RVTA 3DFAA 4IZ7A 4BZOA 2VTQA 3FHRA 4ZMFA 3H10A 4RLLA 3ZU7A 2XAMA 2GCDA 5E8WA 1P14A 1T45A 3PLAE 3ZLXA 1LP4A 3E63A 1H0WA 3K5VA 1F3MC 4MAOA 3EQFA 4HOKA 5BVFA 3OROA 3MS9A 2WTIA 4CSVA 2GQRA 4AW1A 4WUNA 4XLIA 4E6QA 4I23A 5CAOA 3MVLA 2V7OA 2XKDA 5B7VA 2XCKA 4JI9A 3Q6UA 3TWJA 2XK7A 3D0EA 2WEVA 2VO3A 4MEDA 4FUYA 4X2NA 4K6ZA 5K5XA 3H0YA 5ACKA 1GAGA 4FG7A 3WBLA 3CS9A 3HEGA 5AR2A 4DFNA 4APPA 4C4FA 4BDCA 3ZO3A 4EKKA 1FVTA 4R7BA 3FY0A 4KSPA 4AQCA 4FZ6A 3UP7A 4CGAA 5K9IA 5AADA 4RZWA 3FV8A 4UMQA 1ZYCA 3EJ1A 4F7LA 1YWNA 2WQNA 4V0GB 3W0OA 1RJBA 4DG0E 2Y9QA 4QMTA 2JEDA 3LCKA 4AAAA 2VX0A 1Z5MA 3AD4A 2R7IA 4C0TA 2IVSA 4AGWA 1YI3A 5C26A 5FXSA 3KKVA 4AN2A 4A9YA 3EQIA 1JOWB 3G0FA 3F3WA 3HUBA 4CRSA 5K4IA 3QGYA 3ID6C 3TYKA 3W0QA 1B38A 4B7TA 2VWYA 5EI6A 4D9UA 3V5PA 3JY9A 3KN5A 2PHKA 5CU4A 4AT5A 4F63A 5E92A 1CSNA 4CFWA 3HGKA 1XH6A 4F1TA 2CGUA 2UW5A 1Q4LA 3ORTA 3GVUA 4NM5A 2P2HA 3R1NA 5DN3A 4Y5HA 4BGQA 1KE8A 2XK8A 4EOLA 1KWPA 3KA0A 4UBAA 3MA6A 2GS7A 2QR7A 4DH3A 3U8WA 2NP8A 2PL0A 4HPUE 5DI1A 4BI2A 5DMZA 1JSTA 5AUTA 5IA4A 1GY3A 3QTUA 4FGBA 3FLQA 4RJ5A 4CD0A 4IHPA 2HW6A 3BGQA 2HWPA 3LFCA 1DI8A 2HIWA 4TL0A 3DOGA 4F09A 1H00A 3RZBA 1Q61A 3QLGA 4TYEA 3NFFB 4GK4A 3NFGB 3PJ8A 3JR1A 3FLYA 3DS6A 3PVBA 3HA8A 3TN8A 1OBGA 4HVSA 2P4IA 2X9FA 4FNXA 1PY5A 4IB3A 2G2IA 4JAJA 4RC3A 3RALA 4F4PA 3HDMA 4DDIA 1KE6A 3JVRA 2FUMA 2FSMX 4EHGA 4TYHA 5CEKA 5JQ5A 5HG8A 4BKYA 4FKTA 1WVXA 3KRRA 1M17A 4RLKA 3RCJA 3PIXA 5BVEA 3FMEA 4IBMA 3WYXA 1W2DA 4O83A 2PE1A 5CXHA 5CAUA 2Y0AA 3F5XA 2VNWA 3ORKA 4PX6A 4O82A 3TNHA 2HZ0A 2VTIA 4FIFA 2C3IB 2PMLX 2DQ7X 5BUEA 2XK3A 3OHTA 5CU2A 3P4KA 1QPEA 4MD8E 3WF5A 2PYWA 3ZUVA 4AGUA 3DAJA 4DHZA