2QV0A

Crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
MKVIIVEDEFLAQQELSWLINTHSQMEIVGSFDDGLDVLKFLQHNKVDAIFLDINIPSLDGVLLAQNISQFAHKPFIVFITAWKEHAVEAFELEAFDYILKPYQESRIINMLQKLTTAWEQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein mrkE
publication title Crystal structure of the response regulatory domain of protein mrkE from Klebsiella pneumoniae.
rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription
total genus 39
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qv0A00
1QKKA 2E4WA 2IPLA 2L19A 3OO0A 5DCLA 5EWJA 3DBIA 1F51E 3QX9A 1KGSA 3MMNA 1D4ZA 3TO5A 2PUCA 4O1IA 2NZVG 3F6CA 1Z16A 4MR9A 4MS1B 4N03A 3T95A 4N76A 3CZ5A 5IUJC 1JLKA 2MSKA 5DLEA 3JY6A 4PZ0A 2VUHB 2VK2A 1E2BA 3E3MA 2MSWA 1GUDA 3K4HA 4KPYA 4F06A 3QLTA 4MGEA 4N41A 3ROFA 1LBHA 1QO0A 3H5LA 4RWEA 3SM9A 4G0OA 3Q9SA 2QVGA 4G0MA 1VRVA 3OMWA 4KRFA 1JYEA 1JHZA 1TMYA 1DCFA 4MS4B 3MYYA 3Q41A 2MYUA 1D2AA 5KQLA 4W5TA 1KMIY 4Q7EA 2N9UA 3OQNA 1M5UA 2OQRA 3HCWA 2WMYA 1GCGA 2GKGA 1AB6A 1MVOA 3SY8A 2B1JA 5CHYA 3IPAA 5KQGA 3I5AA 3BREA 3IP9A 4OTZA 3ILYA 5EWLB 1QP0A 5D2CA 4NCAA 1USIA 4JASB 5CNMA 5F64A 2PUFA 1W25A 1Z2EA 2V0NA 4KVFA 3GBPA 1MIHA 1WETA 4RDCA 4MRMA 1DBPA 2L18A 1APBA 4WWHA 4RXMA 4EUKA 1OXKB 2QVCA 5JS1A 3LUFA 1EFAA 1AB5A 2X7XA 4EYGA 4IF4A 1TJYA 2JBAA 4RV5A 1VKRA 7ABPA 3LUJA 3A0RB 5KI6A 4JOQA 5E3JA 4JA2A 1Z18A 3GWGA 4ETIA 2FTKE 3LUGA 1M2EA 4XAQA 3QELB 5PNTA 4S04A 3HZHA 4KREA 4HNSA 4IILA 1ZAYA 1U0SY 3P9YA 3T6KA 3NHMA 1FFSA 2GX6A 3HV2A 4NQRA 3MA0A 2IKSA 4RSMA 4EYQA 1U2QA 2FSPA 1FFWA 3D02A 3FMVA 5IEBA 5TPZA 4TLLB 4WZZA 4N0QA 2PUAA 4RU1A 5TPWA 2PUEA 1H9CA 3H1GA 2L2QA 4RXUA 3LUKA 1JYFA 4G86A 4WXEA 3KG2A 3CG4A 3FGZA 4MQFA 4W5QA 3EDCA 4RK1A 4EVQA 4EYKA 2FLKA 4RKQA 3KSMA 9ABPA 3EULA 4PYRA 3RVNA 4ML3A 3KHTA 1L5ZA 5IC5A 1C4WA 5C5CA 3IP5A 1MAVA 4KV7A 1D5WA 4RK7A 3GBVA 4G0QA 3EQZA 1Z26A 2HQRA 4UHKA 3LOPA 2RGYA 3RVOA 4TMYA 4H3KB 2QSJA 1W9HA 4MS1A 3VNAA 4NV3A 3GYBA 5TQ0B 2PE5A 3OQOA 3CZCA 4P98A 3BBLA 4TN5A 1HEYA 2HQBA 5KC8A 1VPWA 4YRZA 1M2FA 3DGEC 4MLCA 4QICA 2P4UA 3RVKA 2QU7A 4RZSA 1KRWA 4MR7A 3F6PA 3OMXA 3H5VA 3Q7SA 1YTUA 4XLTA 3HUTA 4UHJA 4MQEA 2JK1A 1YMVA 2E4ZA 4WT7A 4W5OA 5TQ2B 1QP7A 3HK2A 3C97A 4RY9A 4Z4HA 4RK4A 5TE9A 1CHNA 3H5OA 5FWXA 1A2OA 3OM0A 4RS3A 2H3HA 5IX8A 4Z4FA 2LPMA 3FFXA 4ETMA 4ZJPA 1QO0D 3B2NA 3LFTA 5B3JC 1TLFA 4MS3B 2FEKA 3RVQA 2PMCA 1SXGA 1BDJA 3UUGA 1EWVA 1NXXA 3L49A 2NT4A 4G0ZA 1QNLA 5CNJA 1A0OA 1JDPA 1YVUA 1Z13A 2IPAB 2LP4Y 1DJMA 2E4UA 2ID9A 3M6MD 5EWLA 1EHCA 3CFYA 4EYOA 1BDIA 3HJFA 1XWWA 2HSGA 2XDYA 3BRSA 3A3KA 3LKBA 3O2SB 3BRQA 1PNTA 2RDMA 3LTEA 2GBPA 1GCAA 4Z0NA 3MM4A 5FWYB 3CLKA 1E6LA 3H5TA 3O21A 3C3WA 3W9SA 1BDHA 1Y1LA 1QPZA 3GV0A 4HYEA 1D1QA 4FE7A 1RZRA 1JF8A 2FVYA 5HM6A 3LMKA 4HNQA 2YHBA 4ZYLA 1ZN2A 4JAVC 3NHZA 1JDNA 2QV0A 1DZ3A 2TMYA 3CHYA 2A9RA 3HDVA 3KLNA 2RJOA 4IMIB 3IP6A 2DRIA 1YS7A 2LBPA 1ZVVA 4CBVA 4MR8B 4NICA 5BRJA 2GI4A 5HKOA 4KFCA 3QEMB 2F8SA 4MPTA 1ZH2A 1ZGZA 2FEPA 3GL9A 5IULC 1NATA 5BR1A 1JWLA 2QXYA 2IDMA 4D6XA 4GPAA 5ABPA 4MR9B 3HSYA 4YGXB 4RY0A 4Z9AA 1RPJA 4LRQA 1PUXA 1CEYA 2FN8A 1RNLA 4EVRA 3KJXA 2Q5CA 1Z15A 2BGGA 3EJWA 3JS5A 1E6KA 1Z2DA 1ZDMA 2MSLA 2W42A 4WUTA 4JB0A 4RK6A 4S05A 4HNRA 4IGAA 1DCKA 1GLGA 4H3HB 2AYZA 3CU5A 1KRXA 5B3JA 2FMHA 1P8AA 1ZITA 4F11A 5JNSA 5FBHA 1YS6A 2YHAA 4OLAA 1ZY2A 2L17A 3FDFA 3N53A 2CHEA 2OENG 2FMIA 1DC7A 3EGCA 4ZMRA 2R47A 4XFKA 4LDZA 3E61A 4L4UA 2PLNA 4Z4IA 2IYNA 3KYIB 1D1PA 3HVRA 4E7PA 4F3TA 1ABEA 4IMJB 3I45A 4FB4A 2FMFA 1DP4A 3MF4A 3DLBA 1SXIA 2A9PA 3JTEA 2CD7A 2R48A 3F7NA 2LIVA 1YMUA 5CNIA 3RVSA 5C5EA 1ZESA 2FW0A 3O1JC 2PUDA 5EWMB 3JPWA 1P2FA 1DRKA 1ZHHA 1L5YA 1LK0A 2IPNA 3Q7TA 4WXMA 2FN9A 3I42A 3N75A 2QR3A 1Z25A 3EQ2A 3QX8A 4KMRA 1ABFA 1BAPA 2PL1A 2FEWB 3JVIA 3OLZA 4KZKA 1RXIA 4LZLA 1UDRA 3H6HA 2R4QA 2WB4A 2PUGA 3IP7A 4LE0A 5IUNC 4PICA 3SAJA 4EY3A 4YS6A 8ABPA 5TQJA 1URPA 1J56A 3KS9A 2JVIA 3OLVA 1B00A 5DTEA 1DRJA 2FQXA 2JBAB 3KLOA 4MYRA 1RXEA 2MYTA 4MS3A 3CS3A 4RXTA 4O5AA 4P1ZA 1TVMA 3JPYA 4EVSA 4ZMSA 1E6MA 1DG9A 1EAYA 4RKRA 1T34A 3A0UA 3NNNA 4Z4CA 2VYCA 3N6VA 3A10A 4Y9TA 4W5RA 4YWHA 1VLZA 2PL9A 4XASA 1LJUA 5HSGA 2FMKA 3CRNA 1GUBA 3DGFC 2F8TA 5JNUA 1A04A 2O20A 4LDAA 5FWYA 1NXPA 1NXOA 2ZAYA 3EODA 3H75A 3LUDA 3QLVC 3SG0A 1LBIA 2ID7A 3GT7A 3C6QA 4MS4A 2MYNA 3FFTA 2JVJA 1XHEA 4XARA 3RVPA 1USGA 3M9XA 1FSPA 3URMA 2WY2D 1BA2A 2A9OA 1NTRA 1NXTA 2A9QA 1Z17A 1I3CA 2E4XA 3R0JA 3H6GA 4MQFB 2M1ZA 2QZJA 3CNBA 2E4VA 1ISRA 2JVKA 4OATA 3KKEA 1RZRD 2PAFA 3QK7A 4KK3A 1SD5A 2JCGA 4IRXA 4MR8A 3QEMA 3NBMA 5HQJA 4G0XA 1M5TA 3QLUC 2NT3A 2KYRA 3H1FA 3HDGA 3HUUA 2HPHA 3LKVA 4XXHA 4YV7A 5BQ3A 1YIOA 3O75A 4LE1A 2P9HA 3K9CA 4TLMB 3VNBA 6ABPA 3CKMA 3HEBA 4ETNA 2WWVD 3UKJA 3IDOA 3HXMA 1DBWA 4DADA 3S99A 3DZDA 3L6UA 3BILA 3FFWA 1OXBB 2PUBA 3RVJA 4O1HA 4MR7B 1FFGA 3ILHA 4MQEB 1ZGGA 2FLWA 3O74A 4H60A 3O2JA 1DCMA 5I4CA 2PJUA 1QMPA 3H1EA 3QELA 4D6YA 5T7BA 2NZUG 3OQMA 4YCSA 3HS3A 5EWJB 5T3YA 5FWXB 3TB6A 3ROTA 4M88A 4LE2A 2HQOA 1QP4A 3OLWA 4OBBA 3RVRA 3O1HB 4MAAA 4B09A 4Q6WA 4YP9A 2M98A 2HJ9A 4G97A 4QYMA 4DQDA 5IBQA 4JB2A 3C3KA 5IEJA 2I6FA 2ZWMA 4Z9BA 1JH9A 4E7OA 1JL3A 3MIZA 3QLVA 3SNKA 2WJWA 4OLBA 3OO1A 2IPMA 4NCBA 3KTOA 1CYEA 5EWMA 5TPZD 1F4VA 4RK0A 4MLDA 4Z99A 3O1IC 1MB3A 4QYWA 4KQCA 1P6UA 2WJAA 1JFVA 5JNTA 1NXSA 3LUHA 3N0XA 4KNYA 4YO7A 3RH0A 1JFTA 5FBKA 1DBQA 1JX6A 1SRRA 1USKA 3N0WA 3OLYA 2R25B 3HO1A 3RVLA 3JVDA 5JS2A 3G85A 3I09A 2J48A 5TQ0A 3KYJB 1U2PA 1XHFA 3QLUA 4L85A 3D8UA 3OLXA 4RY8A 1YK0A 3TMYA 2MYPA 4QPJC 3HM9A 5CNKA 4G0PA 2PKXA 4LX8A 1YK1A 2H0AA 3GRCA 1IIBA 3Q7RA 4PEVA 4KQ9A 4RK5A 3TX6A 1U8TA 1NXWA 5KQMA 3G1WA 4JP1A 3H5WA 2NUBA 5TQ2A 3MQ4A 2VUIB 4ZPJA 2JB9A 4F8JA 4GNRA 1EWTA 4G0YA 5GQSA 4N47A 4MRMB 4EGSA 1S8NA 2JRLA 5JNVA 4PE5B 1BVHA 1K66A 1PEYA 1NY5A 1Z12A 3GA5A 5JNWA 3T38A 3Q15C 4F12A 3CTPA 1LJLA 6CHYA 2CWDA 3SQNA 3H5IA 3NNSA 4OG2A 5DGCA 5DKFA 2RJNA 2FQWA 3LUAA 3RQIA 3N0RA 2CHFA 4W5NA 1R8JA 3CG0A 3N8IA 3O2QB 4YR7A 3QEKA 1ISSA 4N0PA 4DN6A 3EAFA 1SXHA 1JBEA 3IPCA 4Z4EA 1P6QA 3RVMA 3KCNA 1JFSA 5IUKC 2AYXA 5JNRA 5KC9A 3UK0A 5KWSA 2FKAA 1MB0A 1PEAA 1TM2A 2GWRA 1QQAA 1DC8A 4KK4A 1ZH4A 5TPWB 2B4AA 2E4YA 1K68A 1EWKA 3TD9A 3LUCA 5GOTA 2WRZA 2QW1A 4D74A 1PNRA 3T8YA 3C3MA 2LUOA 1NXVA 4Z4GA 1FQWA 1U04A 4YLEA 1QQBA 3NNDA 3OM1A 5BRAA 1PHRA 2FXIA 5ED4A 2FQYA 5KQPA 4Q6BA 4FE4A 3F73A 3M9WA 3DLHA 1C0EA 2IOYA
chains in the Genus database with same CATH superfamily
1E98A 2AC2A 2E5WA 2X2EA 1SBHA 4OGGA 1ENZA 1S89A 3B7GA 3QX9A 1RWVA 3GRVA 3OPNA 4UAVA 1OLXB 2RHDA 4B3SB 4QPNA 1GQOA 5LL6P 3ABQB 2BW0A 3DBLA 4WVLA 4CFYA 2JD2A 4UTZA 1BXZA 4Y6GB 1SBTA 3A2LA 4X1IA 5FPYA 3IMCA 4M86A 3KTDA 3NWPA 1IXSB 4E70A 1RLTA 4B6SA 4GKKB 2EKZA 4GM4A 4IOJA 3HP4A 1J24A 2XMBA 1X7XB 3KQYA 1J9GA 4CM8A 5EJ6A 5IDWA 1AZTA 4LNUB 5E4YA 3HVUA 4AJEA 2ST1A 5I01A 1GZ6A 3RC3A 3FUXA 4CV0A 4ER3A 1NBMA 1PQYA 2GS9A 2CEAA 2OZVA 2YJ4A 4G0OA 1HT1E 1V0JA 4PZLA 4TKZA 4U2GA 2P27A 3WMXA 5KOHB 1Z5OA 2OV1A 4G0WA 3TKYA 3N8DA 3HMKA 2ODWA 1PWEA 1KI9A 2AG6A 5DBOA 4HWGA 3TOZA 2NQ2C 1VG0B 2C29D 3DXFA 4M9XA 5JLAA 4QEZA 3NRCA 3I1IA 2NMVA 3ED5A 1P0MA 4Q1DA 3RHFA 5B36A 4WKNA 3ZDCA 4JC0A 3ZLBA 4GE0A 3Q7IA 1P2UA 4K6CA 3ZLUA 5CA0B 4Q05A 3IBFA 4YMSA 5CRIA 3VNRA 4D82A 1SA0A 1LWNA 4MX8A 2QLBA 2X23A 4JIGA 1IXYA 1TX4B 2C61A 1OFUX 4EA9A 3U7EB 1JHDA 3SF8A 4HB4A 4BO4A 2I2AA 1LRKA 2C2HA 3UBMA 3OEWA 3DTYA 1DBPA 1P73A 2D06A 3BEDA 3GUHA 1T9AA 2WJYA 4N5DA 5KX5B 3SQMA 1YDFA 1W34A 5K4HA 4CN8A 1DJNA 3NEAA 4Y2RA 3IX7A 3LUFA 4ZA2A 1HG0A 1DEXA 3DHNA 5HE9A 3AMVA 4DYDA 4BXOA 2PGDA 3ZU3A 2M6RA 2DPMA 1W76A 5LWHA 1E1QD 2O3TA 3W9YA 5IT5A 2WYUA 1JIVA 2HYDA 4JJ4A 4CG3A 4YV0A 3SR0A 2A94A 2C5EA 1NYLA 3UJ9A 3UFXA 5E7MA 4R2WA 5FFFA 2VCEA 2HRZA 2RGWA 3FYUB 1PK8A 2X9QA 3JATB 3PFNA 4IXWA 3VDRA 1GV0A 2L82A 5HCUA 3RUIA 2GX6A 1ZA1A 3FIJA 4OJYA 1W1IA 4G26A 2IYVA 4HVTA 3RCBA 2OO3A 3A9WA 3U7JA 4A0QA 1FDWA 3FAZA 3HABA 1T0JB 4LAFA 4BJ5A 3SJ7A 4HS4A 1NC1A 4ZAVA 3O8BA 4CT0A 4JJKA 1LPPA 3DULA 2D13A 1UMCA 1TJ5A 4G89A 4BQIA 5BYKA 4KDFA 1PT6A 2Y4NA 3IBGA 5A3RA 1X7YA 4U7HA 5CPBA 3UHPA 4ZVTA 3AERA 4E5PA 1XTTA 5AM2A 3LUKA 2XQJA 3DV9A 3E70C 2XEDA 3BB3A 3L8CA 4JQSA 4L7VA 3ENKA 3D7KA 5LSAA 5ENVA 3CUUA 3AR4A 2AXEA 1OAKA 4AJIA 4XIFA 4W5QA 4WY5A 4OJKA 2HTFA 3PZBA 4JENA 3MPUA 1L8OA 4YO8A 5KQSA 2QLTA 3KHTA 4B73A 5KOJA 2V6IA 1G8FA 1Y8QA 2W22A 4HLUC 4FFDA 4I08A 1Z06A 2QRHA 1QOQB 4JBLA 1D2RA 2IGBA 1E62A 2HLDA 3KQLA 2WC1A 2WSIA 3X1XA 3RJTA 5E7IA 1WUKS 3KOMA 1JZSA 2CHUA 5FX2A 1FVFA 3H8WA 1MJ5A 3OQOA 2OK8A 3HN6A 4N0MA 4AG5A 5ICCA 1QHFA 1XKLA 4TQ9A 3LHFA 2ZJ0A 5AJWA 5E2BA 2VBGA 1M2FA 1QNFA 3AOEA 3K5PA 2GNAA 4MR7A 1HZJA 3S2FA 4CTNA 3QUAA 1KO5A 4BP8A 1YCHA 3D6VA 4CMGA 1A98A 1QHEA 1CFJA 1ZS9A 4W5OA 1FOEB 4FZVA 1O6CA 4W7SA 4I5DA 1JU3A 1UKBA 1MQ9A 1J8QA 2PX3A 3FHLA 3C97A 4X3PA 3PHGA 4U2KA 1GR1A 4EQ6A 1WQ4A 1CHNA 3H5OA 4JL6A 4W8GA 3FCOA 3KKPA 3TSCA 3USCS 5KB3A 3IOYA 4E31A 4QQKA 4ZPXA 1H3FA 4JJAA 2IBMA 1NBHA 2OT3B 3FR8A 1K97A 4OSOA 3TCNA 4X71A 1AD2A 4HLCA 1ZLYA 1F48A 1PJ8A 2H1RA 3S8YA 2OK7A 1T6XA 1UK7A 4HLQB 3RVBA 2B83A 2XZDA 2W6JD 5AQ1A 4RELA 1PP4A 1VCOA 1GGNA 2BUAA 4JZYA 1A0OA 1YVUA 1T2NA 4MYHA 4PZPA 4R1TA 5FR1A 3WQSB 3ZXYA 1SK8A 4EYOA 1O95D 5C81A 4HB0A 5IBPA 3T3NA 2EX4A 5JQGB 2FR1A 1KEEA 4GPTA 1ACJA 3H2JA 2QAGB 5EE0A 3QBDA 3LTEA 4N5HX 2ISQA 3KO8A 3PC6A 4REOA 5AM1A 2EL7A 2PXAA 3ND8A 3THOA 4C06A 4O4LB 2H92A 3TRHA 4DXHA 4LF8B 3FPSA 2JLAA 2AB0A 1WXQA 4MI1A 1TM3E 1KO8A 4UREA 5ALHA 5IC6A 1QGAA 3GV0A 1VDZA 2VJPA 621PA 4R5MA 4B3IA 1H22A 1OH8A 3DAOA 4YCLA 3AI7A 1DAOA 4LJ8A 4HCJA 2BI8A 2HCBA 2BGKA 4OFXA 1ZI8A 3JVUA 2QXUA 4FCVA 4EJFA 2IT1A 1ISJA 3EEQA 4LW8A 4QLOA 3SXUA 4J7AA 1Z4LA 3LIPA 4E13A 4I5GA 2V1XA 3NC1C 4ZV9A 1UM9A 4Y2TA 4BVFA 3DMTA 4NARA 3L0DA 2OP0A 3QU7A 2WWYA 3OIVA 4C3ZA 3DYBA 2IYEA 2Q5LA 3EQ8A 3K6SB 1VHLA 2JI9A 5D00A 4UEKA 2FEPA 1ZGZA 1YMQA 3A04A 4YH1A 4Y9RA 1B26A 3TSYA 2UYGA 4AZ0B 5IULC 4QVIA 1SBIA 5JH7A 3GPLA 2CFOA 4KBFA 5GONF 4Z9AA 2Z3VA 4BEWA 2XWPA 3KTAB 1NE2A 3TZEA 4OXIA 3F7OA 1PUXA 1E3TA 1RNLA 2BL4A 1GLVA 1UJCA 5JHGB 3R8FA 2QAGC 5LZ8A 1YR8A 3OIUA 3I0ZA 1HTTA 4DHWA 1VLVA 1XX6A 1H2BA 1XXHE 3MWDB 5DT2A 1TF7A 1IM2A 4EJSA 4RTKA 3PK0A 1RLMA 3QBJA 4P4SA 4Q9NA 3IESA 3IOEA 4Z3DA 4FFOA 2OD9A 4F6LA 4JUAA 3BWYA 2BIFA 5FUVA 3SIXA 3TLAA 2ZITA 4O3FA 3HCDA 1IK4A 2YHAA 3JAKB 3FSRA 4TMZA 2UUPA 2OENG 4FKMA 4PLFA 2FMIA 3EGXA 5T67A 1HYHA 4HTFA 2WLSA 1U0HC 5C3MA 4R0MA 4FYVA 2XVAA 2PLNA 2QTVA 2G1KA 3A3PA 1PVOA 4IMJB 2CXSA 4HS9A 2XW6A 4FB4A 4PGHA 2P2GA 3QM1A 1KEWA 2P6PA 4LHYA 3EVCA 1X8JA 3DTVD 1TW3A 2GO1A 2QPOA 3D64A 1GN8A 1Q6YA 1CUCA 1S2IA 2BE9A 3E7DA 3ER6A 4H1VA 1WMAA 2FSSA 1J97A 1PZNA 3G0BA 1QONA 3KD3A 1DRKA 4KRYA 1HK7A 4WXYB 3V8MA 4B3BA 2GSWA 4KDCA 4BQFA 4DA7A 2H1VA 3RIEA 1I2BA 3R40A 1B73A 2G82A 3GARA 2PUGA 2X1LA 1T9GR 3PX2A 5BXQC 4BYMA 3CMCO 5JBQA 3RADC 2NZYA 1RYYA 3BWVA 3PIRA 4UEOA 4JVMA 1C7JA 4Q3OA 3BL6A 1Y9AA 4JHXA 3WLTA 5BMVF 1J06A 4FDLA 4UXHA 5K6RA 2HFJA 3R5JA 1UPCA 5G1NA 1RXEA 2BKUA 4IIYA 4PBRA 1G6OA 3JWEA 3SYRA 4P1ZA 2WD7B 5EIHA 3ME5A 5IYZA 4B3DA 1CY4A 1N5OX 3V8RA 3DP7A 1CR1A 1P1RA 2AJ8A 3L7MA 3NBKA 4ZOLB 3KOOA 1KZ6A 3UFBA 2P41A 1PD0A 4Y9TA 4W5RA 3H8SA 2KBEA 1I33A 1T91A 3DGFC 1AN9A 1JR2A 3G0IA 3HFGA 5EXXA 5FOVA 1C7EA 1WWKA 3H2KA 2O20A 1ZXBA 1WHTA 5BSWA 2O1WA 1A3CA 4L8LA 1LBIA 1ZUNA 3MWYW 1I0IA 2P6NA 3G7SA 3P0JA 4EUFA 3AZPA 2DPHA 1TCVA 4XARA 2EERA 4NYMR 1DJQA 3KRTA 3UXYA 2ISCA 4N8SA 1J90A 2ONZA 1G20A 4EJ6A 5SYNA 4IV5A 4C2AA 4WLFA 1S4MA 5ALKA 3VM6A 4CM1A 5AW8A 4ZO7A 3O9VA 2AJLI 3WHKA 5BV0A 4BNIA 4ZQBA 1PFYA 2GMWA 3VNSA 2ODAA 3L7YA 3VUEA 3FMIA 3TMAA 2KB0A 3IV9A 4IJ5A 4C2TA 3AYZB 1N33B 1CNMA 1NRWA 4P81A 1YIAA 3NHLA 4FDVA 3YASA 1ZW6A 1VHWA 3NIFB 5IKMA 2HLNA 4MITA 5DLYA 3V1MA 4YV7A 3KK0A 4I1OA 1EK2A 1DIBA 4TT8A 4CMHA 5THKA 4EO9A 4JI6B 5JFTA 1L5QA 2IEYA 1TUIA 3DXZA 4XEHA 2J41A 4J29A 2V74B 4Q93A 1LI7A 1PKXA 3DFMA 4D0RA 4DADA 3IXLA 2HYIC 1VIYA 2PVSA 4EGJA 3IMKA 3HDJA 4HEQA 2BFEA 4O1HA 1JAYA 3L04A 4X24A 3B1VA 5T8KA 5BN4A 3GMIA 4E30A 1E8DA 2P91A 3B60A 3F5FA 2BEWA 2PRKA 2EZ9A 3CW8X 2H1SA 4K1LA 4D6YA 2QBYB 1ZBQA 4BNVA 3H05A 4D9MA 5FL7D 5LYJF 1B0PA 4K46A 5HG0A 3VU1A 2EARA 3TB6A 3ROTA 4BYGA 2W6JA 2ZYWX 4TKVA 1C30B 5BN3B 2CN1A 1FSZA 1UT8A 2Z0MA 4RCZA 5AJYA 2COKA 1O95A 3MTJA 2I6TA 1Q44A 4HGYA 5LQUA 5A3QA 3KXLA 1Y5RA 1XUOA 1E79D 3U7FB 1J09A 2EG5A 2UV8A 3OFVA 2FAXA 2AV6A 3IA2A 2D2IA 1H4SA 1HYGA 1S01A 1RWBA 1SC9A 1Y0BA 1WCWA 2I34A 1ZM9A 4QU5A 4U6QA 5CB4B 4K6OA 4DLNA 3KTOA 4YYEA 2VDWB 1O08A 1FP7A 7AT1A 3KWFA 4IRMA 1IZYA 4N4AA 1BGWA 3W0LB 3L06A 4DNFA 3OTHA 4EYEA 4N1AA 4FJ1A 2E21A 1OQAA 4EYSA 3EIOA 4NOLA 3M4NA 4U7GA 4DV5B 3SYKA 1XVLA 5B6IA 2V1UA 1EVZA 4YO7A 3IB6A 2WINI 5AKYA 4PYMA 3IURA 2QX7A 1VZ3A 1QHGA 4R84A 4S0ZA 2I80A 2PU5A 4O6VA 5LQAA 2VP5A 3AONB 3TMYA 3D8UA 2VH2A 4HDCA 2BLNA 4J1TA 4XVCA 5JATA 5CNKA 2I29A 3H9GA 1WL8A 4MK4A 5AESA 2EDCA 4KX3A 1KI6B 1PZMA 3BC1A 3LH5A 1U0GA 3F5SA 5JYCA 2JG3A 1KMHA 2VTEA 1NV9A 3W3ZB 1QIJA 5K0SA 2HBQA 2ZB3A 3DW3X 4KQ6A 1QF6A 4A26A 2QA5A 5IBRA 4EMSA 3SSNA 4IHAA 5CFLA 4RZUA 3KQSA 5K3AA 4BX0A 3ZYZA 2QYOA 3BJMA 3EMDA 3GZNB 4GNRA 5TY0A 1EWTA 1OT3A 4O25A 4B47A 3G79A 4F72A 4AJJA 3C7CB 1XCBA 4GOOD 1O9BA 4CTOA 2OBXA 1PR3A 2V9CA 2GBLA 2NP7A 3JRNA 4MB6A 2NO7A 2BJHA 3LNCA 3TSWA 4OG2A 1I30A 1T5IA 2QRNA 3RQIA 3HL4A 3TRDA 1P7CA 2ICAA 1IVYA 2XODA 4JWTA 4QXMA 4HRVA 5JZMA 1WA5A 2ZBVA 3SQXA 4DN6A 4X3OA 3C6ZA 4WE3A 1P7ZA 1ZRHA 2DTDA 1DV1A 1JBEA 1PO7A 2DTEA 1GITA 3AM5A 4NABA 4S1NA 4RESA 5KOIA 2JFOA 2R85A 4OIMA 4LXTA 5KPJA 2WFAA 3KCNA 2B8NA 3SOPA 5LKRA 1WZIA 1Y5NA 1RQNA 2FWMX 2HK9A 3M2PA 2GFQA 3DFFA 1OC4A 3ZD6A 1Q20A 1AJEA 2QWXA 2D5BA 2QTWB 3DTVA 2UUAB 4CR7A 3WA6A 4RHFA 1U4NA 3QPWA 3G0HA 3ETDA 4A16A 1EESA 4JJZA 5L51A 5G53C 1GTVA 4MPRA 2Y77A 4UXIA 4BLUA 1TQ6A 4TMTA 4RFVA 5L40A 4GSKA 5EPOA 1X2BA 2P9EA 1BOOA 1U8EA 1UZNA 1SC1A 3LQRA 2WV9A 4GBMA 2OOSA 2D0DA 5HS6A 1THTA 2WYVA 3DHEA 1WP9A 4L5CA 3NNDA 3H3JA 3ETJA 1V7PC 1NDUA 3HWWA 5THQA 1U3GA 4E5MA 1JHUA 2AMFA 1RCTE 1TAHA 3M6WA 2VR1A 2YJ6A 1ZW1A 3OQPA 3PICA 2HC9A 4QYXA 2PYDA 2ATIA 1EA5A 3HJCA 3SR3A 3LUBA 1X80A 1R3DA 4GFDA 3RS8A 1D4ZA 1KMMA 4QOFA 4NJOA 1JHYA 1PJQA 1F6WA 2EG9A 1M1YA 4LZJA 1Y1TA 4TTIA 2V7XA 2ZTHA 1TUBB 4HUQB 3T95A 5K5EA 3GN1A 4HMOA 1HDOA 1CZUA 5AXAA 3B9QA 4PZ0A 2W2KB 1RWQA 2P68A 1XRPA 3E3MA 3IE1A 3RFUA 2R9VA 2ZCJA 1REQA 3CF4G 4O2BF 3R7DA 3WZLA 5AUPB 4H7JA 3GT0A 1LDEA 2QPAA 3VZPA 3D6HA 1O54A 2CUNA 2DFNA 3PQFA 2JW5A 2VK1A 5LLTA 4LYAA 2HJVA 1VMDA 5A05A 3ZDXB 2A1UB 4X1YA 1LKZA 1RBMA 4KRFA 1BHSA 4U39A 5E1BA 2O7QA 4AU1A 4BCDA 3C8UA 1GXSB 1KVSA 1M6VA 4M8LA 2CW5A 2DJIA 1FNSA 1T9CA 2XZPA 3LBFA 3GO4A 3CVYA 3Q41A 3D4PA 3UANA 3CRW1 1U02A 2IIPA 2VJLA 2OQRA 3H5AA 3FUCA 1ODJA 3CEAA 3JYHA 3IJPA 1FFAA 3AUTA 3Q3CA 1E1RD 4ZGWA 4MWDA 4CT4B 2AFHB 4JL8A 1ORWA 2VSYA 3ELWA 3MW8A 4BP3A 3I9V6 2GB4A 5ADVA 2PQ2A 1VBMA 2B1RA 3IAHA 3JQ9A 3CT4A 4MRNA 3NTOA 4K5QA 4HNGA 4ZVVA 2YVQA 4Q5IA 2GETA 3H7IA 3V55A 2XX3A 4QREA 1F0YA 4O8CA 7REQA 1WVMA 1C5KA 5G3ZA 2FETA 3CR3C 3PEEA 3ELUA 2ZB7A 5JO9A 3HCCA 3B5EA 2WYIA 3LJKA 1PYGA 2VZLA 2IVFA 2Q6LA 2A3NA 2KSQA 2C5BA 3HLTA 2JFQA 3V7WA 5E3IA 1UXHA 1H2AS 4J0CA 5C53B 5FL7A 1CEQA 1OTHA 4A1FA 2BSQA 2B2CA 3FVVA 1L4HA 1RWXA 1JJIA 2PX0A 1G3RA 3L8ZA 1OZ0A 4LSZA 4N54A 5FQOA 1EKXA 3TL2A 1AURA 3PNVA 2J9YB 1FCJA 1UP6A 4I1VA 4LNHA 2A67A 1X1AA 2QPLA 4MLZA 4RPHA 4UHFA 4ZQEA 3B1JA 1SUAA 3OICA 2KBFA 2XUDA 2J0QA 3BH0A 2GR9A 3I72A 2WWFA 3WYCA 2IHYA 3U0BA 4FONA 2H2DA 3NGLA 3ZTYA 4HGQA 4D8WA 5JADA 1MIOA 3V5NA 4ID9A 2D00A 4TUYA 5ALXA 3ZZTA 1SKUA 1RMQA 3OX3A 3PNPA 2ZIEA 1FMCA 2AXPA 3R0IA 1L7EA 4LYHA 3FMVA 1C9EA 1ORIA 821PA 3BE4A 1NQTA 1NVFA 3ZVLA 1H6AA 4BAGA 3V2IA 4UD2A 2H1CA 2JCYA 4I8IA 3OU7A 1PL8A 3NRJA 1II8A 4X1KB 1AV6A 2VN8A 3LC2O 3L41A 1T4BA 3NW9A 3Q0EA 1NZJA 2XQVA 2Z98A 1CRWG 2P6OA 3LC1O 4J0DA 2DWPA 5C3UA 2A14A 1N2HA 2VJOA 5TVGA 3CLRD 4UUBA 3T9AA 3HY6A 3ZWWA 3R5FA 4H35A 3WLOA 4FSDA 1BTOA 4PLZA 4XGNA 3MMSA 4O4JB 2QUKA 3AHFA 2HMSA 4OX9Y 1M9NA 1FX0B 2QVYX 3OETA 4KV7A 4L75A 2XMPA 4AY3A 1EVIA 1BS9A 3FMGA 3WQRA 2BTEA 2PVCA 5DN6A 4TMYA 3VI3B 3E5NA 1W9HA 1IRXA 1HDRA 2BEJA 2B35A 3MUNA 4MS1A 1M1XB 2R65A 4YAEA 3M3PA 221PA 3PA8A 3GCGA 3BA6A 3Q87B 4PNHA 3T0IA 3OC0A 4D3XA 4R8KA 1XD2A 3QFFA 3PPVA 4RGBA 3WRXA 4EP1A 1CK4A 3NZEA 1D6SA 1DIGA 3A05A 4ZRMA 5EZ6B 2JLUA 4DIKA 1EU1A 2E6UX 3HMQA 3DNPA 1XG5A 4GPEA 3IPXA 4HEHA 4UASA 5G1PA 2OYCA 2DEUA 4WZBB 1CUFA 1DQZA 2P3SA 3MELA 3FTPA 2BFFB 5TE9A 2PNJA 1YZNA 1GADO 2GAOA 2SCUA 13PKA 1E4YA 3ESRA 1WR8A 2VHUA 2H9AA 4I4IA 3SIRA 4WKCA 4MKIA 2WAYA 1GPAA 1KTVA 1QX4A 1XZMA 3QI2A 3SXPA 1SQ0A 4LC9A 2VATA 4PO8A 5AVXA 3TG8A 2CV1A 3DEJA 5J2TF 4AYXA 1ADCA 3PRYA 4KMOA 4A73A 1N2IA 2RKWA 4Y1GA 1VHQA 1E2NA 1SC3A 3QE4A 1YA6A 5JSZB 1IDN1 1M33A 3EOBI 3BWEA 3WL4A 3WMWA 4O4HF 2BP7B 3NH6A 3IR5A 3NEYA 4EB6A 2O8DB 2OZLA 4P3KA 3VJMA 1V25A 3BXGA 4HVAA 2XDYA 3DS8A 1OGJA 1GGMA 4D4IA 3LCJA 3PTZA 1JSCA 5FF9A 1VE1A 3ZY5A 2NPFA 1KJIA 3A4NA 3ZWNA 2R8ZA 1JG2A 2PWAA 3PTAA 5LMUB 2YS7A 3AX6A 4GICA 4H7HA 4OBWA 1RTTA 3QXCA 2KW5A 2QTHA 3Q12A 4YAFA 2CYAA 3GDFA 2QGZA 1DHRA 4CQMD 2XE4A 4A0RA 4B4VA 4DDMA 2HU7A 4HZGA 4KO2S 5CEFA 4ECAA 3CH7A 1A9PA 2C00A 4J7XA 1YS7A 3AP1A 5FA6A 2DWOA 4MR8B 5B1DA 1LF0A 1SCBA 4Q4JA 4M8KA 3EZYA 1UEJA 1JXMA 4YI3A 3LQFA 3KB1A 1AXGA 1A69A 1E0KA 3TEMA 2VOJA 5BR1A 1ZGBA 4WOBA 3TQRA 1R9MA 1XKQA 2EJUA 3ASYA 3F7TA 3MTIA 4XWTA 1JLMA 1CNEA 3ID6C 3NFRA 2BMVA 4WY2A 1HY3A 3VU9A 4DANA 4B3JA 4GO1A 4QJ4A 3V97A 1QGOA 1KU6A 2VAVA 4IUCS 2H2AA 2NUPB 4IKPA 3DZJA 3HTXA 2HMWA 5DT9A 1XZBA 3A1DA 4QATA 3UPUA 3MCTA 2VDVE 4A8JA 5CLFA 5EJGA 3OX4A 3AJEA 1JSLA 2AJBA 2CVPA 1GU7A 3AKZA 2GOYA 2CDNA 4UUOA 4YDQA 1UEXC 2I5PO 3QMMA 4RV9A 4LJSA 4LMAA 3U3XA 2P4EA 2YHSA 3DW1X 4E46A 1UM8A 1XVAA 2JGMA 2POCA 3E3AA 1VJGA 1M1NA 1B7GO 4CGYA 2PSEA 4U8HA 3NWEA 1XRQA 3G2LA 1K9SA 2ERCA 2WP0A 4BVEA 2V9ZA 3LX4A 4ZZ3A 2Q3HA 3KPUA 1ABEA 3WMGA 3C6MA 2JAXA 2O7VA 2W5UA 3NM6B 2P9TA 3OZCA 5DE3A 2PSJA 4TQGA 1IQUA 5FR2A 1RI5A 1L4LA 3JQRA 2B0CA 3DUFB 1MC4A 4AZSA 4F86A 1QGUB 5C32A 4UZSA 1IPEA 2DHDA 1N9GA 1IY2A 3OT1A 5F2KA 3I42A 4OX9B 2ZCVA 2FF5A 2V54A 3I9MA 5K03A 2YWCA 1EUCB 3B53X 1ABFA 1UBHS 3BERA 3L1HA 4DABA 1JFFB 4R1UA 4GMGA 4MW2A 2QMUA 5CBPA 3G02A 4PICA 2JL1A 3X1JA 2YY6A 2B8WA 3M4JA 4JSRA 1TFUA 4WN3A 1DBRA 3ICCA 8AT1A 1E3JA 1OFGA 1B00A 2JVIA 2WA2A 3OLVA 2QSUA 3EXFB 1KZ7B 3OLQA 5EUQB 5A71A 1L8QA 1GKUB 4D96A 3CVUA 1VA4A 1WXDA 4O5AA 1TVMA 3W04A 4N9WA 2I1LA 2B4KA 5K7SA 2ZROA 1FNNA 2BEKA 3IBYA 4UM5A 2J0VA 2VS1A 1HQCA 1I4OA 3CZRA 4GYKA 3JZMA 3UAVA 1QBGA 1QRDA 3IUSA 1RFLA 3WRVA 3QEJA 1PUIA 4YWHA 2GN8A 3HO8A 4UOZA 3PA6A 2GN4A 3VMMA 3OWHA 2OYRA 3OQHA 1S02A 5AJTA 5ALWA 4BFLA 1DZIA 1UPUA 4YVFA 3W79A 2ODEA 5A0FA 5INTA 1PJRA 4B3HA 2NG1A 4LGVA 4EB3A 3V7UA 3QV1A 4NJEB 4PCVA 2IUTA 2J09A 3TCKA 4DA0A 2Z8YM 1V43A 2QRQA 5DM0A 3RVPA 1AMNA 2RHCA 3GJ3A 2ZE6A 2ZRFA 2ZYUX 4DMUB 4Z5XA 2AOUB 2R6ZA 3LYUA 1NTRA 3LVQE 1XVUA 3PSHA 1W6UA 1GTMA 3R5KA 2FDCA 2E82A 4LSWA 2X5JO 3CVXA 1FMJA 4IW3B 5KSYA 2ZZMA 5SV2A 1KZYC 3BAFA 4K26A 1GL7A 1HYQA 3FNQA 4MIYA 5L7WA 1Q95A 4Z4EA 3A6KA 3LKZA 3P45A 3E5MA 3PYXA 1V2GA 4IRXA 1NXQA 1PJAA 5L3QA 4WOPA 4B9EA 5EJ8A 3MRTA 2F64A 1OILA 3AFMA 4I5FA 3ZVRA 4DSOA 2DOKA 2ID4A 3HUUA 3VOBA 3L0CA 5CDGA 1KYXA 3UWMA 1AKQA 2O5VA 1JAHA 4DBZA 4AYTA 5BQ3A 1OBOA 2CDCA 2EFGA 2NAFA 1LV8A 4ARCA 2GNOA 3RS9A 2I6XA 1YHYA 1MDBA 2H7VA 2XWSA 1YJBA 5CVEA 1CERA 4NU6A 5I8WA 1I6MA 4J9VA 1SXJE 1SIWA 2ZYRA 1IH8A 2D0OB 5HKKD 3SK0A 3K5HA 4KYIB 2X4IA 3BILA 4BAZA 3TYXA 1NNI1 2BCEA 3GZJA 3VU8A 3BGIA 3C70A 5EJIA 4HEA6 4A7PA 3OLCX 3U4CA 3USZA 4BGDA 1WE2A 1IZ0A 4I6JA 4C7MA 1L5SA 1N5DA 3I37X 3TXYA 4P3XA 2WU4A 2NZUG 2QN3A 1F2UB 1Y4DE 2XBLA 3CIFA 5CT4A 2YMMA 5T3YA 2QPTA 3ZCQA 1VI2A 1A95A 2XAUA 5AJXA 2PNFA 3QU5A 5EA2A 3KSRA 4LE2A 3UOAB 5KSZA 2HW8A 3MOGA 2QQEA 1U5BB 4K6KA 2H5JA 3ZZNA 1LLDA 1XU4A 3O91A 4RYDA 3RAJA 1RZVA 2FR8C 4RQTA 1XNQB 1ZVJA 2P5SA 4LDJA 2FP4B 1FTWA 1T0PA 3HGMA 3X2SA 4JJFA 3ORHA 2R8EA 2WM9B 3BN3A 1UCFA 6PFKA 5LB2A 1CBUA 1WBDA 1I7QB 5CM9C 3KUUA 2A84A 3EXIA 3ELBA 3AL3A 2W2OA 3OG9A 4R1MA 5A5EA 4P35A 3RSFA 3V4RA 1O6GA 5EQTA 3L4SO 3K70B 4RD4A 4YFYA 3WIDA 4KPFC 4X20A 2I3DA 4CQMA 4RCVA 5G4LA 4ZHQA 1AZWA 1HNNA 1WXGA 1B6GA 1P0IA 2PZEA 2UYOA 2B98A 4S0XA 2D4AA 4ZVNA 1HE1C 5ELMA 1HNZB 3QA9A 2Q1XA 2A0YA 4ILKA 5F1KA 1N2SA 3UXHA 2P2CA 5E0OA 2R00A 2ZIZA 3RC1A 4CCYA 4X97A 3SKYA 2WJGA 3ASVA 1XTJA 4NCIA 2F43B 3HM9A 2CK3A 1BMFD 5JY1A 3PD0A 4HFRA 3ZVNA 3CF6R 4UOEA 4F7WA 3ZJ4A 5TMBA 5B3LA 3BF8A 3DWEX 1NFRA 4P84A 5L4SA 1S2GA 2HO4A 4RQBA 4B6GA 2X8JB 3HDTA 3OEHD 4LPSA 1BKYA 3COJA 3I39X 1NSFA 2WW8A 3UAYA 4E22A 4AICA 1AK9A 1VE3A 2GCEA 3F6YA 1IEVA 4RIEA 1L1EA 2ZJFA 2ZKLA 3ZI7A 1TKRA 1PEYA 2IE8A 3RIHA 4ZTUB 1MV5A 1KYVA 4KN8A 1JEQB 3HO6A 2AZDA 4L27A 2A57A 4J0JA 4AQDA 3ZHVA 2I66A 3A25A 4HQ0A 4PSDA 5DWDA 1ESNA 4HG2A 4LYJA 1E2LA 5EMJA 1R8JA 5F3RA 1VP9A 2PKCA 3L4BA 2ZZNA 1YB1A 3GJXC 1ISSA 1PGNA 1NQ5A 3HUEA 4JYZA 4P32A 3M81A 2PZAA 4GSYA 4A5OA 3S29A 1B1AA 1GPWB 3H18A 5ALSA 3QMVA 4D4HA 2BFBB 1UXOA 1W85B 3KPWA 3T9EA 3ER8A 1XTIA 1DTWA 4OFBA 3K30A 3PWSA 1TM2A 1L6IA 2GWRA 3DYVA 1LDNA 2VXCA 3L7DA 3PFCA 1NF2A 2AQHA 1BX1A 2FUG1 4YC7A 1LV7A 2W8BA 4MV5A 3TQIA 4IHJB 2J5QA 1QLHA 1X0VA 3GGCA 3HKDB 4ZVPA 3IELA 1AUXA 3GOHA 3HG7A 1PGPA 3QKRB 4TYWA 4M0DA 4LXYA 4QA9A 5IJZA 1A1SA 4MCIA 4A82A 3J7AC 1BH6A 1X1QA 2QD1A 3NAMA 3EPLA 4MSUA 5K8UA 2BFPA 2QM8A 3MERA 2QUJA 3ESZA 2LUOA 1NXVA 1ZONA 3V1TC 5GAJA 1ZEJA 1E1LA 2G9QA 3EZ6A 4R83A 4L02A 5DHQA 4GVXA 5KQPA 1LUAA 4Q6BA 5ED4A 1RYMA 2DR2A 3RHTA 3FNRA 2YMQA 3R9XB 2G40A 1KYWA 1P29A 2A0FA 2QI9C 4PG5A 1SIUA 1U1EA 3O82A 2JJ8A 3IAM6 3A6JA 4A92A 5DTJA 2Q7OE 1FUIA 3UC5A 5TS2A 4A5SA 4CR6A 3AHGA 3K92A 4Z7JA 2P69A 2O06A 1YRLA 3OUTA 1GNRA 5EE5B 3ZDYB 4DEYA 5ITZA 3PT5A 2W2VA 4PGAA 2P0EA 3OHMA 3IT3A 1F5NA 3JRXA 1NQVA 4M54A 5K3SA 4G37A 1VKZA 2UXCB 2DPGA 4RADA 4R7TA 3WMEA 2Z30A 3DV2A 5ECWA 3Q0IA 4NBUA 3N05A 2WT9A 1OWLA 4FKBA 4I2NA 4L4YA 3ZLTA 4A9AA 3RV3A 4A03A 1PR1A 3W6OA 1GTG1 3OM8A 4HXYA 2JIMA 1JTFA 3ZEAA 2MCFA 3NHAA 3B52X 4GOKA 3BJZA 2O8EB 3R23A 3OJXA 1LZLA 1V8BA 1VMAA 2A88A 2JATA 2MU1A 3O73A 3RRMA 1PJ2A 4MGEA 3IFSA 5PGMA 1L5HA 2Y0PA 3STVA 3VDQA 2XUPA 4TVKA 4QJ3A 5FEUA 2XHEA 4MW4A 2C7RA 3DAFA 1JYEA 4QHSA 1QDEA 2WA1A 3KR1A 3KP1A 4JUBA 1LY1A 4I55B 2F1KA 2XB9A 3W8DA 4MS4B 1VJ5A 2EEPA 2ZKIA 5DX8A 3KBBA 3KWMA 3S7TA 3MYYA 4LSMA 1PDOA 4B34A 3UK6A 2O57A 2ZP1A 4IUBS 4GWKA 4LOIA 1K4KA 1M5UA 2W2LA 4O3MA 5K1ZA 1PNOA 1PBNA 1EXNA 2FU5C 1E63A 4AJNA 4YRTA 1SQGA 2B4YA 4KVZA 5EP3A 2R1ZA 2ES4A 2PSSA 3RB8A 1SVNA 2NX2A 2YHIB 4CZ2A 3HB5X 3UT0A 2FPGB 4I9FA 4BTVA 3GJ7A 1GO2A 1U2EA 1DQNA 3DFUA 5HDQA 1QGED 4AMZA 2CZGA 2V0CA 4YCBA 3VJLA 3SSAA 4DIFA 5CA1F 2VT6A 3OA2A 1Z2EA 4ENRA 1P1FA 4ND8A 3P52A 1CUIA 2PD6A 4RDCA 3WC4A 3B9BA 2L18A 4HDKA 3D6FA 3TPFA 1VYHA 3DBRA 2QVCA 4U7JA 2VTBA 4CEIB 4NDNE 1AB5A 4I1UA 4CKCB 2O6LA 1TOAA 2V45A 5FPHA 4X63A 4CW7A 5JWHA 2YW9A 3ZDEA 1BO6A 4F2PA 4YACA 1DAIA 3ONEA 2WT4A 4C4AA 1Z6QA 3COPA 4U3JB 4XPIA 4YMTA 1LPAB 2G80A 1CJCA 3OQIA 1JKMA 2FTKE 2M1XA 1PFGA 2XNCA 2EZUA 1RI4A 5TGDA 5IVHA 2ECKA 3QELB 4HWPA 1FJHA 5L9AA 4V2IA 1O3YA 2B37A 3E1GA 2CVFA 4BQRA 1XJCA 1J9EA 1HWYA 4LSGA 4OHVA 3HV2A 3OZUA 3STXA 4FCTA 4NL4H 1LBEA 3QKIA 4HGNA 2DBYA 1WOMA 5EMMA 2C59A 2KWIA 2Q3CA 1ULBA 4P83A 3ADOA 4PSKA 5SYMA 5IYZF 3VHXB 2A5FA 4WZZA 5AM3A 5H4HA 5DNCA 1L4FA 4ESEA 2G9VA 3FG9A 1XZGA 2PUEA 1CZRA 1WCXA 2EC5A 2L2QA 3RJZA 1MTOA 1XE3A 3KE8A 4QNRA 4EMUA 2ZUFA 3TLZA 2F1JA 5JTTA 3L93A 4MRPA 3T94A 4XRGA 3IBCA 4MNTA 5FLEX 4FD3A 2B9VA 4MV6A 2OHOA 4URUR 4AY5A 3IMEA 1EX6A 1RHQA 4R9VA 3EPHA 1MOZA 5M2QA 4S24A 1WMFA 3LBIA 1H1LA 3KYCA 4LXQA 4IUDS 5HF9A 4W6ZA 5E6RB 1QGDA 2GN9A 2ZSIA 4TXHA 2CWWA 1BMFA 3CWZA 3GJYA 1IHOA 4H3KB 4ZCQA 1YO6A 3K8ZA 1Y33E 2PQ0A 4LYEA 4C3OB 4M37A 1OFIA 1SWVA 5ITSA 5FLXA 1N6HA 3CGWA 3HCOA 2JFPA 3LPAA 3OEHA 5JJ5A 3DOOA 4P98A 4CUZA 5KU1A 1FW6A 3T7AA 4N7BA 1KMCA 5ER6A 1UK9A 4Y1RB 5F78A 2V9PA 2B99A 1P61B 1YTUA 4OMCA 3UJHA 3HUTA 1BQ4A 5LP6A 2ERYA 2YBEA 2R6R1 3M83A 2WVHA 1UOPA 3OBIA 1EXVA 2Z6AA 2MSNA 4MVJF 1N4AA 4RX1A 1MXFA 1NWCA 1PWXA 2P9ZA 1R0CA 4KSBA 1MU0A 1VJTA 4IP0A 2F59A 1G2OA 3FXAA 4IGEA 5FWXA 1TL7C 2HSDA 3ND9A 3X1ZA 1IMOA 2FPPB 5CVDA 4X3CA 4YCCA 1GU1A 3IIEA 3KEQA 4KIFA 5DZSA 2VRWA 2WF9A 1GNTA 2YZGA 5CB8A 3M4ZA 3Q10A 3LLSA 2AOTA 2ZU6A 4F9GA 4PLWA 1QO0D 3PUWA 5FAXA 4DCPA 1MAUA 2R11A 5BNFA 2FEKA 4LN1A 3NU1A 4UBMA 4LQCA 4ME6A 1Y5MA 1ZD9A 4D9CA 4ZKDA 2FW1A 1UAAA 1Q1NA 4Z4QA 4UJ5A 2IYFA 3IL2A 3VX4A 2O2EA 1T3SA 2PSDA 2ECQA 1GGEA 5D5HA 2PRYA 3H2ZA 2WWWA 4NP6A 1RAFA 4KTVE 3F5MA 3B1FA 3RK0A 5C46F 1OIXA 4G01B 4NTZA 1IDOA 4RLSA 1BC5A 3SDSA 4Q7QA 2HIMA 1KZ9A 2O2IA 4B4UA 4JQOA 1EX1A 3ZE0B 4LFCB 3WLMA 4C87A 3V4PB 5EIXA 3OOJA 3R8CA 4QBHA 4QASA 2AZ4A 1VHTA 4MUBA 2EHJA 4TYPA 1DXQA 1DQPA 4J9UE 4R16A 4X00A 5E2IA 1TO6A 3T5DA 4R0NA 3SS9X 2E7ZA 2WU3A 5AMXA 1YAJA 4KUGA 3L1JA 2CJYA 1XIVA 3HCEA 2OHIA 1RCFA 1RHJA 1ZVVA 1J5PA 1E1CA 1QE5A 2AI3A 2HCJB 3OT4A 1VBKA 3JQ6A 4RMGA 5EXPA 4KFCA 3H13A 3B85A 2N42A 3VHRA 1A8PA 1WNTA 4FIZA 3AUAA 4MUKA 4MJXA 2YHUA 3EA4A 1A71A 1FXSA 5DNYB 3OIFA 2FWPA 3ZE8A 1YE3A 5GIOE 2Q50A 1X8XA 3SX2A 4CLOB 2NU7B 5CVTA 1RHUA 3WB9A 4IBOA 2ZAIA 2C2ZA 1W5TA 6REQA 2Q5CA 1BJTA 3AXSA 4J0KA 5I9NA 5JAZA 3CUYA 3P9KA 4NS1A 2WF8A 2IU3A 1MF7A 4BVLA 3GQBB 1U7PA 3AY3A 3MB5A 2Q6OA 3NT2A 1U8CB 1U81A 1QF7A 4XKJA 5A9RA 1KRHA 1U11A 4NHOA 3BKXA 5MHTA 5A1TA 2QD3A 2P2LA 4F11A 1UQUA 1AOXA 1RKVA 2L69A 3R7FA 3J7TA 3RFTA 2JIBA 2HU5A 3ZIUA 3MWEA 4K8OA 4QPCA 2WP8J 4MVJI 4RORA 4WV3A 3A70A 1YXMA 2G1UA 2YWFA 1FXWA 2YJTD 3OF3A 4KQXA 3OJFA 4LDZA 1KAOA 1NVBA 4X66B 2XOEA 3LBHA 4AKTA 2WZDA 1PYDA 3A8TA 3FFBA 2FPKA 2FUNB 3LHKA 2QVZX 1XTKA 3NYWA 2UUBB 4OIFA 5EXTA 1IN7A 3RYIA 4US2R 1L5OA 3GLQA 2PS9A 3NAZA 3QVKA 3T3HA 3HI6A 1P5RA 3GCZA 3QVUA 1JA9A 4I4LA 4KXUA 3V1UA 3ZZUA 1A77A 4B79A 5JUWA 4NMMA 2OBNA 4YRQA 1ZHHA 4DKJA 1L5YA 4XYLA 1J33A 1GFIA 2W6NA 2BFDA 3GFFA 3C74A 2X42A 3EQ2A 1U5AA 1XRSB 2PRSA 2RIRA 1IHYA 3JVIA 3KQWA 2JBWA 4TSFD 3SE0A 1LRJA 4IJWA 1YB5A 4C30A 1YFZA 3DE6X 1VC2A 4I1RA 4PAWA 4IOKA 4WZAB 3SAJA 4I5IA 5TQJA 4AKHA 3CX6A 2FWJA 3DTTA 4QUGA 2HL6A 4TROA 1FMFA 1K8XB 1RQRA 4C78A 1J8VA 4F46A 2Z58A 4EHIA 4UPEA 3BRWD 4IWXA 2FXVA 3CS3A 4JVSB 1NUAA 3AEYA 3P97A 1XZIA 1LK7A 3N2GA 2TSYB 1I7PA 1D0VA 2PG3A 2PGAA 2XIQA 3N8HA 4C08A 3DAYA 3K2EA 4LZNA 1ULZA 1B2LA 1L5WA 2FSHA 3EVFA 5AVUA 3NBUA 4L6CA 4C01A 4LJAA 1DX4A 4WAUA 2YJ3A 1NMZA 1P1IA 3Q8KA 3RFCA 1DRVA 1DPFA 1FK8A 3REQA 4H1WA 5MGNA 1RMTA 3B89A 3WYNA 4YJ3B 1PK9A 2C83A 4K88A 1DIHA 3EODA 2C1ZA 1XPUA 3IULA 4MCJA 1YHZA 1Q84A 1XLVA 1JJVA 2QRLA 1CUAA 2REOA 3B8HA 3UMBA 4CCAA 3PEWA 4GOXA 3ROEA 1ISGA 1QB7A 3LP8A 4FEEA 1OXTA 4AJHA 4E2XA 1WF6A 2C94A 1GSAA 1TPZA 1ZINA 4TWRA 3P19A 2QJWA 1T2FA 5TF4A 3O7MA 4N01A 2ILVA 4LC1A 4EB8A 5JCJD 1RXWA 1BN6A 3V42A 4MO2A 2M32A 5F5LA 5KJ1A 4WLUA 3QEAZ 1I6LA 2BKEA 5A04A 2Q21A 3TWOA 5AVQA 1QIFA 5HQJA 1B93A 2Q0QA 4ZRNA 1GZSA 5A4KA 5JISA 3VZDA 2WVGA 1HT3A 3FPAA 3TW6A 1KPGA 5I9LA 5KTNA 2YUTA 4P0QB 3F5DA 4V38A 1J8MF 1N7GA 4PBTA 2W43A 2V7VA 5T4FA 4N6OA 2OYSA 4I50B 2ZJOA 4C4XA 2GPWA 1MVLA 3H1AA 4OKIA 3HXMA 2WFZA 3E5HA 3R6LA 4FFBA 5FFNA 3EZ7A 3R5TA 1SHJA 4XVHA 4JNKA 3ZHTA 5FQNA 2ONJA 4UTXA 3PGA1 3ILHA 1ZGGA 2FLWA 4ID3A 5ALEA 5CNIA 2AVDA 1I4LD 3K15A 3PL1A 4EI8A 1NY6A 4EAAA 1ISIA 1V16B 1LVUA 3THWB 2K6GA 1P5HA 1WXXA 1TCBA 1OTYA 1R8SA 3LWBA 1P4SA 4IDFA 3V7FA 1A7UA 5FOWA 1ESEA 3C1TA 1BFUA 3TQCA 1FEZA 4OLHA 1K3FA 1FW8A 2RAPA 3GFGA 4QGFA 3DB1A 4DBLE 1GTL1 4K6FA 2GQ0A 4CQLB 1Y1RA 2GZ3A 3R7WB 2VYVD 4DC9A 4J2HA 2NN3C 3B48A 5SZHB 1IOZA 1KEUA 3U39A 3ER9A 4MKRA 2WJ3A 4M8IA 2H51A 2IX3A 4KQ2A 2NYAA 3CF0A 4KG7A 1DO8A 2JBHA 4DT1A 1EFKA 4OLBA 4NXMB 2RD2A 5LPNA 5KCMA 5U9CA 4TUYF 5A7HA 4G9EA 2TYSB 4KQMA 1UDBA 1KI3A 3WL6A 1N6NA 4F3KA 5CB6A 1MRNA 3GUUA 2QTNA 2XE7A 4LHXA 2XOKA 2M6KA 3AVQA 2CHVA 5AI8A 1RYEA 4AURA 1LW6E 1M2GA 6NULA 4EW1A 4RL6A 4C5CA 1N2GA 1BS1A 1OYWA 1D7OA 1QZZA 1VLLA 2ERXA 1G2IA 2G28A 2JF0A 2RCNA 4OGKA 4TTRA 3WRYC 5REQB 3RVLA 5JS2A 3O4FA 3ROPA 4RV4A 1BX3A 1F2TB 5IJAA 3C4VA 1TTQB 1T5OA 2GKOA 1E5QA 3IO3A 3ENZA 1N5LA 4XUEA 5BRNA 5C8DA 1Y7TA 1PI3A 3WL5A 2ZYSA 4EKDA 1KY5A 3GD7A 4RY2A 1AKTA 5TIIA 4X7MA 3A6FA 3L0SA 2M9MA 1UWVA 1W0CA 4FGZA 1JT9A 3G1WA 4RA9A 3Q3HA 1EGQA 4LQLA 2Q99A 1EDEA 3L82B 4YWJA 3MJEA 1H23A 3PJGA 6LDHA 1PYOA 2QUBA 1SAYA 3JW8A 3PLAE 4TWZA 4DR5B 1B23P 3D5QA 3BTSA 4ZYXA 1Q57A 1R8YA 1BU5A 2WTBA 1A9SA 4FX5A 4YT8A 2OFWA 2FVXA 2JRLA 2NWQA 1VFNA 3HZZA 1JG7A 1Z12A 3BDVA 3G13A 1L7DA 4OFWA 5E7QA 2P3QA 5BSHA 1M8PA 5HF5A 3A3OA 4E4TA 4UU1A 4HX9A 4R2HA 1SVMA 2HCRA 2ZWIA 1QHHA 3N0RA 1JJBA 2FGJA 1XXLA 1LBQA 1AU9A 4NDZA 3HH8A 3WL8A 4EPXA 4YX9A 1MHTA 1KFEB 2JJQA 3CUEF 3QLEA 3AQIA 3EUFA 4PTZA 5B1IA 5IN5A 3UOWA 4AK9A 3IPCA 4AZWA 5D5PA 1Y5LA 2DQZA 3N8KA 5HDBB 3PIIA 3QTBA 1OX6A 2XT0A 5BYJA 5JNRA 1C3OB 2W2PA 4ARSA 3Q98A 1GT6A 1DADA 1S9HA 2AFIE 3C3XA 2AS0A 2OCXA 2XADA 1YR9A 3ESBA 3IVGA 3L01A 2QL5A 2Q3MA 4IG9A 4D97A 4TXNA 3GFTA 3ZHBA 1X1RA 4JBHA 1C8KA 3W2FA 1KSFX 2P35A 1U2GA 3FWZA 1XLTA 5FUBA 4DHEA 2W6OA 3TQOA 5DGDA 4TSFA 1ZK4A 2ZI4A 3CUKA 3GVHA 3UH0A 2I8AA 3QI7A 4HGPA 3NQ41 3Q40A 3RUPA 3UJCA 1U04A 4DTCA 1IXZA 2P1RA 1UXKA 1JR3D 1EQ2A 3QPUA 2CZCA 5U4XA 5ICMA 1TA9A 1YS2X 4XB2A 1U0TA 4UCFA 3BRWA 1IJEA 2P2ZA 4J4HA 4ON9A 1WABA 2G5CA 4HZUB 3PI6A 5FPKA 3EEBA 2C2XA 4DJAA 2WKSA 5CXQA 1L7NA 2F55A 3GPIA 5HPYB 2GZDA 5HUHA 5AKZA 1SQFA 5KYGA 1CQIA 3BSSA 3UY4A 2WM8A 3SC2A 1E3WB 2Z95A 3CN9A 4I4NA 1JLKA 1WQ1R 1G3MA 3A1FA 3N8NA 1UDCA 1AA9A 3QEBZ 3N58A 3EF1A 4L74A 1J21A 3UENA 3LI2A 1Q0ZA 4WGGA 2OMEA 3ZWMA 3NALA 3ZBTA 1WSBA 4BV2A 1L9XA 1IN6A 1ZC3A 2X0KA 3K32A 3LPCA 3K4HA 5G0VA 2H4FA 3HKEA 4OJTA 3UT5A 2E4AA 4KPYA 4BB0A 1P5JA 2VQSA 2CXXA 2HZBA 3EEYA 1SCNE 1H2HA 1YZLA 1RC1A 2J4CA 4N41A 3W2TA 4GH5A 5DHFA 2QF7A 3QTLA 4ZEVA 3PFFA 2PFGA 4DIBA 3GUCA 3I8XA 3ZE6A 3BGDA 1XMIA 3ACBA 4FDTA 4TZKA 5LBIA 3HNOA 3N7AA 4GNKA 4C0SA 5I48A 1GAXA 2QLMA 2PH3A 3KETA 5JCJA 2JGJA 4HD8A 2CB0A 1G3QA 3F4BA 2NOAA 4DNXA 1JE0A 1V4BA 2VHEA 4YLYA 2MYUA 2NXJA 3IOMA 1ZR2A 2FZLA 4JBGA 1BE0A 2CLFB 3HB9A 5HR5A 4J0FA 1KFKB 2P9QA 3H1BA 4FYKA 4M9CA 4JXJA 4LVCA 3SYMA 5JPCA 2HXGA 5IKXA 2ZLBA 1MO2A 4TLBA 2GKGA 3HP1A 5LA6B 4S3MA 4MCAA 1QFMA 1WW8A 1P91A 2ZSHA 3HDYA 5CHYA 2DLCX 5FBWB 4GWGA 3SEQA 2Y0BA 2JJ2D 4WNYA 1ESCA 5AKKA 4ZAYA 3R3SA 4KVAA 2C31A 4YONB 1MOPA 4DY4A 2WU8A 3WWEA 1L5KA 3KFVA 4GBGA 3DO8A 2AEJA 2I2CA 3P4YA 4NYIR 4DNOA 1APBA 2YCBA 1T9GS 4OHFA 3TZCA 4WWHA 2HMVA 4Y6RA 1UFKA 4KIGA 1EGAA 6ADHA 1O94C 2M6LA 3V4FA 1O6BA 4PFJA 4RV5A 3A3YA 3BJRA 1D4OA 3OPYA 4JEMA 1NASA 3O8RA 1RHRA 4KWCA 4W82A 4TKMA 2IH5A 3GWGA 4ETIA 1OBCA 4DILA 4IIJB 3VAYA 2ZSAA 5FV7A 5PNTA 4CFZA 4LJ9A 3WSTA 3K0EA 3VJRA 4OU4A 4RF3A 4XVUA 4S1PA 2CJFA 1TE2A 3HY4A 4M7PA 4NQRA 4YJ2B 3IEMA 3TE6A 2XJ9A 4PPFA 1MO4A 2FFQA 1MDFA 1T4CA 4H4EA 1SWWA 4JGBA 5DI3B 4F5EA 4CETA 5T5QA 2WSBA 4FR2A 3ZCSA 2X3UA 1OR8A 4ND1A 2PPVA 1JU4A 1L5LA 3GPBA 2FEXA 3NOVA 3DL7A 4Q4HB 2ZIAA 4US1R 1KYTA 1Z68A 3VPXA 5JEDA 1V11A 3HU1A 2KPOA 1UFRA 1M83A 3N2EA 4D26A 5KNDH 1EFPB 5K09A 1EVJA 1F38A 3PE4A 1O0SA 4QYIB 2E87A 1Y9EA 2NU9A 3EULA 3HB7A 3UN1A 2BCGY 3GAFA 3GRYA 1L5ZA 3H65A 1H5UA 3PG5A 2K7ZA 1DEKA 4PYOA 1MAVA 3WYAA 3B6ZA 1P74A 3LG2A 1E7SA 1PKEA 1T2CA 1WUHS 1Z2PX 2EJBA 2PX4A 3LGXA 1G4HA 3QUQA 1DNPA 4FLEA 4H0NA 1YBAA 3C3DA 4C43A 1OLXA 1MO3A 4UUPA 2LDXA 1E1NA 3L2OB 5AIBA 4FKZA 4PZ9A 1GKLA 3CR7A 4PLPA 3G8YA 1J1UA 4GOND 3FTDA 4GI2A 1NULA 3X2FA 4BOYA 1HEYA 1N3LA 3IP8A 4MGKR 1A50B 1X9IA 3MRSA 2ZCUA 2YINC 3AUFA 4RZSA 2EGGA 4KQJA 4MKFA 3RVKA 4NPCA 4YRGA 1Z4IA 5TJHA 2ZBQA 3G0GA 4LNUA 3F7MA 2UU9B 4ZAFA 3DR3A 4Z8XA 3A9CA 3C48A 3G0DA 3QOFA 2RGCA 4LV5B 4L9WA 4AJ2A 2PS1A 3B1WA 1NDQA 3IAEA 2BGUA 2UVQA 3CISA 4KAFA 4ADSG 5AW1A 3FCEA 2LCQA 4YT2A 1Y3CE 1ZX1A 3NYQA 4W1PA 1A2OA 4L8GA 2QM3A 5TMPA 3JQAB 4PFSA 4G63A 2J85A 1R10A 4Y7DA 4ZICA 5FUXA 2QSYA 1E2IA 4OLJA 4HWKA 4P4TA 1N0WA 2Z9DA 1L4KA 1BOFA 2XVZA 4MS3B 4Q4AB 5CA0A 3RO7A 3I4LA 5CVVA 3BCSA 1YVEI 1QZ3A 3GLHB 2W6QA 3RSOA 2NT4A 1PDVA 2DJ5A 3G89A 1LS6A 1TLLA 3INYA 3BCUA 4QL3A 4V3BA 1C9JA 4MYDA 5A3VA 3I9JA 1G8KA 1LZKA 2QR5A 1PQ4A 5DLDA 2ROQA 2HSGA 1TU4A 8ADHA 4GRIA 3DHVA 3U2QA 5JD4A 2JH8A 1OV6A 3D1VA 3UW3A 1GCAA 3LV8A 3NG1A 3MTGA 1FUKA 2HEGA 3W1WA 4TVSA 2X86A 3A58B 5KX5A 3WK4A 1N2BA 1Z33A 2NTYC 5BW5A 2WHRA 3QXXA 1CRPA 3UJNA 2IUFA 1RYDA 3NDIA 2P4HX 1JF8A 1XN4A 4HLUA 4MGIR 1I2AA 2X41A 4FW8A 4MDEA 2Q7DA 4MQMA 3CKYA 2PXCA 1VL2A 2ZR0A 4EW2A 3STUA 3WLNA 1L1QA 5DYGA 3HB1A 4DMMA 4PLHA 4XM0A 1U7XA 3K9LA 3U5TA 1OJLA 1D2NA 3BE5A 3CMMA 5A0VA 5HILA 3QFCA 2EZ4A 2RJOA 2FZGA 5B58T 3FI9A 4CE6A 5JSHA 2XNJA 2AL7A 3F5QA 4S12A 4E51A 1GCIA 3DMHA 1NX9A 2GEFA 5JQWA 4MPTA 1YJQA 4MOWA 1LX6A 2FUKA 1L5MA 3CLUC 5IG2A 3E35A 5DTRA 2QORA 2I3GA 5DM1A 4L8WB 2CFSA 2I6QA 4YBZA 2VF8A 3TD2A 3M8KA 1XXHB 3DBLB 4M9SA 3RRJA 5J4KA 1OB2A 3VYVA 5GJVC 3IT1A 3VRHA 4CF5A 1YNSA 1T9ZA 2F9FA 4FJ0A 3NUQA 5DPMA 3VBCA 2QAJA 1XDBA 1LSSA 1P0CA 1JWAB 1U0FA 2B8EA 2ZIUB 3KJXA 3ORYA 4MTLA 2O3SA 3VOTA 1QFJA 3RNLA 2EKPA 4CM8B 1UPXA 1NJ6A 4PW0A 4F6CA 3W77A 2AMJA 2H0RA 2JKVA 1Y1SA 3ZUGA 3AU9A 1RTKA 1JIKA 2XB8A 1A2QA 3Q72A 3S40A 3EASA 3NYRA 1U1IA 2XY4A 4J94A 3G17A 4YXFA 1UAGA 2PN1A 3NJRA 5F2EA 4QGBA 1D7AA 5HUQA 3ZN2A 1IM8A 2JJ2A 2C0CA 4D0LB 2F6RA 3U1BA 1NF8A 2GASA 2CE7A 5TS3A 2P3OA 2EGUA 1A9ZA 4WJZA 3TR0A 4HNVA 1I4WA 3AR8A 2H9YA 4FI3F 1Z36A 3OOEA 1VFPA 1KJ8A 2ZBEA 1O1YA 3G8DA 3Q9UA 2FW0A 3O1JC 2IEBA 1JIXA 1JDJA 3V1LA 1C50A 2QDXA 3VDMA 4BQEA 4JKOA 3SF8B 1MENA 4HI0E 5CFMA 2HJRA 5IT0A 1H2FA 1Z25A 4E1AA 1BAPA 4DCMA 4O2AA 5GZ1A 1SBZA 1DAKA 1JBQA 3QXGA 2IZ7A 3ZE1B 3IP7A 1QIHA 1V3TA 5A2QA 3ST7A 1NAIA 3P0HA 3UZUA 2Z04A 2DWQA 2RHBA 1CVRA 3LZCA 1QP8A 3MWJA 2W58A 2AF3C 4J4TA 4AF7A 3AB3A 4R3WA 2J30A 4XX0A 3OQVA 5M04A 4JVNA 4YHHB 1LB1B 2BHRA 1SHLA 3TCXB 1H3EA 3JRWA 2GEVA 1M2HA 4DUZB 3FYTA 1V37A 3BWMA 5AP9A 2UZIR 3DWGA 1I3NA 3H3FA 1M2KA 2NXCA 3AFNA 4EVSA 4DUGD 1XGKA 2CLMB 4KH0A 4RPKA 1YZTA 5THXA 5GPBA 5JJKA 4IR7A 3UFXB 1T34A 2CXPA 1D04A 1QIIA 3C4QA 3N6VA 3A10A 2MWMA 4IO0A 4RSHA 2B3DA 2DUJA 2QAGA 2FMKA 1V1RA 4JDPA 3BICA 4GZ3A 3IUNA 2WK1A 2MIIA 3K2QA 4KQFA 4UNSA 3UM9A 1FRFS 2ZSJA 1DX6A 3IQDB 5D87A 4O4LA 4G4SO 3EGVA 3OSZA 4HWRA 2AHOA 1MAWA 2RGUA 1BVYF 3H75A 3QLVC 1OA1A 4PVDA 3RUHA 2GN0A 3U09A 1VSTA 5P21A 1NLFA 1OFVA 1UMCB 1XJWA 2VSFA 3E9DA 4B35A 1GSIA 1CULC 1X7YB 5C8VA 3AERB 3ON5A 4R71A 4LC0A 2KI5A 4LDRA 2Z57A 5IFLA 1N32B 2ZIGA 1W0JD 4KX5A 2A9QA 4BZPA 4EO4A 4QBKA 2HD4A 4CEJA 5SZIA 4DWOA 1S8FA 3IQEA 4PXSA 1GQQA 2CXNA 3CX3A 2XNHA 4HBGA 4MWZA 4V0MA 4J43A 3RSCA 3SOZA 4C0XA 3AXTA 3RFVA 1CUJA 3K6SA 3IUBA 1NN1A 5HE8A 1RM0A 4YDRA 2RG7A 4YRDA 2B21A 1LBTA 1Z56C 2ZJ5A 4AMVA 5ARBA 2OEPA 3VPBA 2ZAMA 2ZTMA 3LKVA 2PUJA 4PRLA 1JNYA 4NE9A 2Z1NA 1FYWA 1R66A 3CGGA 2H2WA 4FT4A 3VNBA 3QFTA 4ETNA 4IJQA 1M6HA 3PVSA 6GPBA 1R9GA 1PT9A 5DBIA 5EQJB 4BMPB 3WHIA 3ZJUA 3UMGA 3IQIX 3MWDA 4MR7B 1QVZA 2X9GA 1IM5A 2O0KA 3UATA 1EWRA 4YUYA 2H6EA 1CZNA 1BDMA 4XB1A 4GC9A 1VGQA 4PTLA 1ZKMA 4FIDA 3MAJA 5DGTA 3SU8A 3A9UA 4U6SA 2QY9A 3M6FA 1X8LA 4MWBA 2AJCA 3RD5A 3L0OA 2ESRA 4N9QA 5EKDA 3RUAA 4D44A 3MCZA 4OHKA 1P1HA 2ACWA 2E1RA 1UIRA 3KD2A 3TGWA 1FU7A 1E3LA 1JQ5A 3FWYA 4BEJA 2WUDA 3FHCB 4BO1A 4BZWA 1IRIA 4TLCA 4CUJA 1KOLA 4BN0A 1PNQA 3Q8XB 5EHNA 2Q3JA 2RB5A 3BG5A 3C5VA 5JFGA 5CFPA 2X14A 2EP5A 5IEJA 1TUEA 5KJ6A 3SQOA 1F17A 4BWYA 3WKAA 3CW9A 5B7PA 4DC1A 1TU0A 4C4OA 1AZLA 4HH1A 4M9QA 4CDRA 4MVJE 4U2CA 3TVTA 3AVVA 2HA0A 3NS7A 3SZGA 4IHQA 3PHLA 5JJCA 1BKSB 3CV3A 4PLTA 4JI7B 2UYHA 4ZCPA 4B8YA 1N2EA 1Y7HA 4FYYA 4O8ZA 4OMDA 2NQTA 3NTVA 1Q2UA 5E2AA 2HDOA 1KPHA 3LDHA 4XWKA 4K28A 2BY4A 2I4IA 1HE8B 4TS1A 2E5FA 1F0PA 1IONA 4K9OA 1DQYA 4II7A 4NZPA 5DO9A 4DIMA 5JYEA 2AQIA 1DBQA 4Q03A 4J16A 1HYEA 1YU9A 5ALDA 5HBRA 3ZHSA 4DCCA 3OLYA 3EGWA 2XYPA 1IIRA 2GTIA 2ADFA 4TL7A 4V03A 3G85A 4RFLA 1V4VA 1U7ZA 3DCJA 4B5LA 5IKEA 3BXHA 1KAGA 5J4LA 1SIBE 4L85A 5IVPA 1W88B 2IS1A 4XH9B 1N5IA 1H8HD 3C6KA 2YASA 1DJLA 2YMPA 1L4GA 4UM8B 4HB2A 1C8LA 2WD7A 3SXUB 1NBIA 1YFJA 3JQPA 3Q6IA 4IZOA 4Z2YA 3C15C 4QEDA 4WINA 3FR7A 1UM9B 2QZSA 2WHQA 2XCQA 2XDWA 4GIBA 5DSZA 3W1VA 4EGAA 2NVUA 4KIWA 1XKTA 1TDJA 1BSVA 1EJ2A 1XZQA 4WECA 2VT3A 2VUIB 1E7RA 2H29A 2HO5A 4ZPJA 4ZZ2A 1N0VC 4CM7A 4DARA 3C3AA 2OKGA 5I9TA 3P4XA 2C4WA 1K98A 3FNFA 3UGKA 2UUOA 5JH7B 2PEYA 3CONA 3L8HA 4U2DA 1OH7A 3BEOA 1QQ6A 2EBWA 4JXKA 3T7IA 3A9TA 1NUSA 1JAXA 1YUMA 4ZWNA 4RJ2A 1CB7A 5E9QA 5KHOC 3CE6A 1ANKA 4GX2A 2VK8A 4UZFA 2FZKA 2QUIA 1BW9A 2VRBA 3CZAA 3TIFA 3A4MA 4QSHA 3WOHA 5BSEA 1NP7A 2B1GA 3RS5A 3LUPA 4EJSB 1N6OA 1RRPA 1DXYA 4Z0PA 2AN9A 4GXRA 1RJEA 3EDRA 2DC1A 4RTPA 1VJDA 2CBXA 1MRSA 1EM8B 1T8UA 1A8SA 1AN0A 1EE1A 1XZPA 5H3CA 5COAA 1HFJA 4N39A 3SR4A 4BLPA 3I9NA 1NVDA 5KC9A 5E1DA 4D9NA 1RLUA 1WPGA 4GMHA 5KMGB 2Y1GA 3E27A 4YAOA 3RU2A 3SC6A 2D7CA 3JD2A 4OAOA 2PPLA 3Q3IA 1E9RA 1L8AA 1T1IA 2QTVB 2V7BA 4ARVA 5BSVA 5I4KA 4IKEA 4IFIA 1NRJB 4KPEC 2GJKA 3NVKI 2ZRQA 1AK1A 5KVVA 3RV4A 4BUZA 2G71A 1KFJB 4D0NA 5CJPA 1U94A 2G4VA 2CXQA 1HMYA 3AEZA 3LD9A 5EXSA 1IC6A 1ZEMA 2QN2A 1U0JA 2VPIA 1QE3A 3HJTA 4QUIA 1MG0A 5JSYA 1GNSA 4OL0A 2X4GA 1GEGA 2PUTA 2QBYA 2Q07A 3OZSA 1Q15A 2F90A 5KVAA 1JU9A 1OXUA 1EE2A 3LCRA 1HNWB 1VYVA 2V6FA 2EV9A 4QPZA 4KXXA 1YQ9A 4OHUA 1B76A 1G1MA 2GZ2A 2YDYA 4RE6A 3B70A 4DUGA 4K3UA 5HZKA 1SKBA 4K87A 2GZSA 4H08A 4TMXA 2NZVG 4PC1A 2OSBA 1QIGA 5ISMA 2J87A 2YZMA 1EVYA 3BULA 2I1WA 3GFBA 3V2HA 2CYBA 2SHKA 2JH3A 4PQFA 3B6JA 1XQWA 2PO7A 4D6PA 1YSCA 2NPIA 3PEUA 4Y0VA 3KVRA 5AJHA 5MN6A 4QFDA 1NMQA 4NZMA 3UO8B 3LECA 3WZMA 5CB4A 3RGWS 5A5DA 1MT3A 4FOTA 4HV4A 1ICIA 1Z4JA 3JAWA 2HXSA 1UKYA 4AKIA 2WHEA 1VLQA 1CY7A 1O8CA 3RUDA 3FNEA 5U1PA 5JPIA 3EBPA 4UAUA 1BFDA 5EG5A 4KLNA 3AY6A 2IDJA 1W0JA 2IY8A 4BBZA 2QE7D 5JASA 3WDLA 4MUYA 3VR4H 4XOIA 4L07A 3MVEA 2GTHA 1ZUNB 3OURA 3KT0A 4XQEA 3D3EA 2QTAA 1TMGE 2DHCA 1IZZA 1ZK0A 3IVAA 3GLKA 3NHUA 1KSHA 4C6HA 2WMDA 1HM5A 5T4BA 2C5AA 5DCUA 3DL2A 1EWYA 4RULA 1AB6A 1KI6A 3QITA 2WQ7A 2X40A 1W2HA 2B1JA 1T9BA 3JZDA 3L0PA 4YUAA 5JARA 3IQXA 1FVXA 1QG4A 3F2VA 1QP0A 3PGXA 1TPYA 4Q24A 4GMXA 1T2VA 1XEWY 2J9RA 3NEPX 2GERA 3DVSX 4ZOCA 1XEAA 1E4EB 4BE4A 3GZNA 3LYLA 4R1NA 4DMHA 3HKCA 3RAPR 4RLHA 2CFCA 3KQQA 1DMSA 1Y4UA 3CNQS 3I6BA 3L0IB 3O47A 2PLWA 4Q4LA 5HM8A 3IMFA 4GM1A 4Y8VA 2PGLA 2FPOA 2RAUA 3RROA 3QVJA 5K0TA 3GMSA 3AUUA 4M1SA 5AJVB 5EYPB 5FAKA 2EYQA 2IYPA 4INZA 1TEHA 4QODA 2H54A 2GM5A 4HYYA 2BFEB 5E1OA 3A0RB 1YF3A 4R1OA 1OBHA 1DBSA 4R9UC 4QX6A 4ZEOA 1J2YA 4NMLA 2COUA 2YWHA 4FDMA 1SD2A 2BEWB 4PQGA 1E5XA 5E1MA 4RJJA 4KREA 1KA9H 1Z5GA 3MJFA 4MARA 1XTQA 2B6NA 2J3MA 3T5GA 3GR6A 3W4IA 3G9TA 1NNEA 3N8GA 1QH9A 1E0AA 1G21E 3INGA 5AK4A 5I3CA 1Z39A 2GBIA 2DU8A 4W7IA 1U2SA 1LDMA 4M36A 4NESA 2RHGB 3M1AA 1QO9A 5L95A 4OY3A 5FNVA 1TEXA 1B8PA 1NA5A 3JD4A 4YMIA 1N57A 3KUDA 3FNHA 2D54A 1YQQA 2PZGA 3GLGA 1K8ZB 1Z75A 2HBRA 2CSUA 3H9BA 5DWQA 4EYKA 3AETA 4A36A 2QGNA 3ZV7A 1JQEA 2ZATA 3UB4A 4I46A 3GRAA 3E7FA 4PYRA 2AOVA 5JAQA 4X8OA 2XUQA 5T64A 4Y0NA 1QCCA 2YS6A 1G5IA 1PVVA 3BMNB 1BEUB 2JLCA 4KITB 1FY2A 1H8HA 4KI0A 1I13A 1X38A 4MIKA 3VC2A 4ENWA 3HACA 1PJ3A 1ORHA 3BHIA 4UEQA 5CT5A 3WFZA 1WS6A 3RVOA 3KUKA 4I1SA 4LGMA 1K2VN 2R5FA 3L02A 4ZI5A 1KDOA 1T0UA 3PDWA 1MO5A 3RKUA 4FNMA 4B6QA 1YRWA 3B78A 5FA8A 2QRUA 2COEA 2ZWAA 1QG0A 1TJ3A 2W2KA 4TN5A 5H81A 1NU6A 2PR2A 4M83A 2G0TA 8ATCA 4O1MA 2RKBA 1YD7A 2Z4TA 1I1HA 1F12A 2JHPA 1XZNA 1CV2A 3E5RA 2O19A 1QRTA 1QPGA 1SVOA 1DDIA 1Y6JA 1GHTA 3V4SA 4BKPA 4F92B 1V6SA 2A1UA 2ZSBA 1P8JA 5FD8A 4FMDF 1GRQA 1M7HA 1ULHA 4RVFA 3RTAA 3EWIA 4F45A 2QMEA 1GXSA 1KQ3A 1MT0A 3PDIB 4U4AA 5B6JA 5IX8A 2NP6A 1EWQA 4MV1A 4CUKA 1N2XA 5BXYA 2C2OA 4PZYA 5K8JB 1QU3A 2EKDA 2O50A 1KKMA 4CMKA 2G7ZA 16PKA 1NV8A 1D0SA 2QHXA 2VWQA 2ET6A 1ADJA 3QXJA 3UUGA 3WR5A 3ZKWB 4F4CA 1JFSA 4HQKA 1JEYA 3E05A 2P75A 4QIHA 4DLPA 3HYRA 3PIDA 2D2FA 1Z5NA 4G5GA 3ZWCA 5K4GA 3M6MD 2VJAA 3IKMB 3GK3A 1ZCBA 2WJJA 3KXIA 5EHGA 1CYDA 4WXPA 3ML1A 3AUYA 2GBPA 2XEXA 1E69A 3O4GA 2XA2A 2Y0DA 4XOUA 4AXXA 1GPDG 1OZGA 2B20A 2W00A 4UVGA 3AF4A 3ONNA 3RF6A 3WBJA 2F3QA 4BUCA 4XM2A 5D1HA 3ILXA 3T9BA 4A6EA 2KE5A 4X5OA 5HVNA 3WBFA 3EIEA 1RZRA 3E7WA 1ZM7A 2G63A 2FVYA 3LKDA 4RHUA 1XPRA 1SOUA 1YDEA 3UAGA 4WX2B 3MXTA 3ORRA 4WFJA 4KJXA 5AXBA 5LJLA 2VHVA 4RAQA 1VJRA 4J0EA 1FRVA 2V4MA 4LHZA 5LZ9A 1SJ9A 3V1KA 4FYXA 3R8XA 3WE7A 1AGRA 1DTEA 2LBPA 2I7DA 3IE2A 3GLRA 1HEUA 1YZYA 3MCWA 1M6WA 1A4IA 1NW7A 5C18A 4F4UA 2XNKA 5LWQA 1X80B 3SKXA 1Y9JA 3B6EA 2CV0A 2PH7A 4GZMA 1UBMS 1XMOB 3KCQA 2G04A 4QG3A 4PLCA 1GAWA 5K3DA 2P40A 1VG8A 4H16A 4YGXB 1RCUA 2OV2A 3R0QA 4Q16A 1J49A 1Q22A 6YASA 4HFNA 4IFBA 4X1KA 3KIPA 4LK2A 1LLQA 2LXNA 4KQHA 4EHFA 4YECA 2WPDD 3WX0A 4EX6A 5DW3A 4Q12A 2QE7A 3LF1A 2EZ8A 4YT5A 3S3TA 2HPZA 1REQB 1IBSA 3W5VA 4B76A 4WKOA 4IS3A 5AICA 3P4UA 1I0ZA 1NW8A 5GY7A 4E1BA 5BWBA 4XDZA 4XJSA 3W7BA 1TYCA 3SLKA 2J33A 3SJAA 2JAHA 4O4JA 1N6IA 1J2RA 2QZZA 1PV4A 1FX0A 4R2XA 2J45A 2D1TA 4ZAGA 4COOA 3HLYA 4X1YB 2EBUA 2C3PA 4MDFA 5LB4A 3S4YA 1MX1A 1YUNA 3V4LA 3HZRA 4XUDA 1M6VB 2PMFA 1FJXA 5JANA 3RYCA 1AQIA 2DX7A