2QVAA

Crystal structure of drosophila melanogaster translin protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
182
structure length
182
Chain Sequence
VNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERSLNISHFIGDLNTGFRLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Drosophila mutant translin and characterization of translin variants reveal the structural plasticity of translin proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords GM27569p
total genus 69
structure length 182
sequence length 182
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2qvaA02
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 2qvaA01
1OVVA 2SPZA 2WMMA 1OVRA 2LR2A 4EYYQ 1EDKA 1OVUA 2K3RA 3QB5K 3PH0A 1Y47A 4K35A 3FXEA 2B87B 2KUBA 5K5GB 4NPEA 4IOIH 2LXBA 2B87A 2KZJA 2Q1KA 1EDJA 5EFWB 3PJAA 3RGUA 1KEYA 3QWOC 1JM0A 5CBOA 3MHVA 1LT1A 1SS1A 4GOFA 4WWIA 4CPGA 1H0TA 1X0TA 3AXJB 1H0TB 2QRXA 2P58A 4NPFX 3AXJA 1ZXGA 4MN4C 1JMBA 4WYVA 1EDLA 1J1JA 4JBZA 1EC5A 2M5AB 2I8DA 4K3AA 1EDIA 2R44A 4HB1A 2M5AA 1LP1B 2OTKE 1U7JA 5DJUB 4HKZH 1BDCA 1LP1A 3ZDMA 2KIKA 4ASVA 3FXDA 5C39A 2B88A 2UWJE 3MZWB 2KZIA 4ZMDA 2B89A 3QB5A 2LXCB 1ZW0A 1DEEG 4GODA 2QVAA 4ZNCA 1NVOA 1S3JA 2ZAEB 1U7MA 4HJGH 4ASWA 4NPDA 5DJTB 2JWDA 1BDDA 3S1KA 2HR3A 1Q2NA 3PJAJ 2M0BA 4GOEA 1FC2C 2KI7B 4KJMA 5CBNA 3RIUC 3RIUA 2RKLA 1MFTA 2KS1B 4BXLA
chains in the Genus database with same CATH superfamily
2RP4A 5HWXA 5HEOA 4U3CA 2HN2A 3OTOT 3I1AA 1L2PA 4H9RC 2OGUA 4U31A 1S5LH 2J1DG 4IHJE 4G63A 3AVRA 1XDOA 1USDA 3RH3A 1X79B 5FL0A 1PPJD 3VR9A 2BS2A 2Q7CA 3MIWA 2H43A 1NENA 1W9RA 1MIWA 3R4YA 5LP6E 2PFXA 2C0XA 4KBMB 2FJEA 1N34T 1SQPD 1L4AA 3H37A 2X9HA 2YXRB 2XM2A 4U3FJ 3CCQP 2Y0EA 2C5JA 1RQUA 1T2KD 2ZYDA 2CBJA 2I59A 4CXXA 1G1JA 4H63V 5GONE 1X9VA 3I0QA 4X1YE 4RKUJ 1CI6A 1RF1C 3AE8A 1SQVK 1SQVG 2MJZA 4UV8B 1JMBA 4JI2T 4IT4A 5AVXB 1NTMK 1YQ4C 3AA7B 4WY4B 2V5DA 3ZT7A 2P10A 4BWNA 3FZMB 1ZV4X 3OYZA 2LRKA 1L0LD 1BR4A 3TLVA 4D6TG 2OYHB 1RE3A 5FY0A 3I56P 3H1JD 2W62A 4YXWH 2P2UA 2BG9C 3UUBA 4B6XA 1BGYJ 3ZEFB 2D2CB 3H1LE 2FYNB 5C39A 2Q9QC 2BCCG 1YIJP 1OZHA 2FJDA 2LHNA 4F8HA 5FXZA 2E74B 2KZIA 4OYKA 5KAIE 2V6YA 2MKVA 4EV6A 1MIVA 1UURA 1HX1B 4UB6H 1FAVA 2DI4A 3PURA 5APWA 1HJBA 4O4HE 3H1IG 3I9WA 4TLFA 1KB9I 2KYVA 4TNVA 4LMLA 2FYUG 3RHWA 1FS0E 2LLYA 1HGVA 3CX8B 1U5PA 4DV3T 3AEDA 1HNWT 1J1DB 3KYQA 4BRYA 3K3OA 1BE3D 1SQBK 1KB9D 2X9XA 2X0HA 2ZM6T 3M06A 1DIPA 3NTNA 5FXXA 1VDFA 4PJ0E 2CE7A 1IK9A 3AEAA 3OVUA 2H7HA 1L4AC 2GA1A 2Z5IA 3GHGB 1JY3P 2P9BA 3HKCE 1IFJA 3P4QA 3P4SA 3MA9A 1SQXK 4M3LA 3AE9C 2BZBA 1Y8AA 1S35A 1VQ6P 3JAEA 2MOZA 1DD3A 2IYPA 2JR8A 2KUBA 2ZJSE 4NPEA 3ZJ2A 3GLMA 3CWBD 3AEBA 3AB3B 2FYUJ 3G3ZA 3L36A 2KNDA 1NTZE 2N1TB 1L0ND 3KV6A 1YJWP 3AE6A 2WZHA 4IL6X 4DBRA 3SWKA 3RIFA 3C9IA 5FL1A 4CPGA 2VL8A 2WQYA 3LIDA 2BKNA 3SWYA 5JDMA 2KZ7B 5JQGE 3L72G 1PIXA 5TISE 4IE6A 3AE5A 2NRGA 5ABFB 1OEDC 4GK5E 2ZLYA 4HFDA 3Q5DA 1E1HB 3UFEA 5HXSA 5JR9B 2N2NA 1MMGA 2X0LB 5F8PA 4TV9E 3L39A 3OKQA 5FP3A 4IFMA 3TGUD 1SQVJ 2BCCE 2FBWA 1XNQT 1U7JA 5H2FE 3T97B 4JEHB 4QMAA 3TLTA 2NPSA 1IAPA 5J2UE 1MZ9A 3NWIA 3H1LJ 2KNCB 2IC9A 5F3JA 2W83C 4RESB 5AQUB 2LE8A 4E7ZA 5EK2A 2XQ9A 4U7YA 3WMM0 2WDQA 4JI3T 4DMVA 5AW6B 1NAYA 3KV9A 3GHGC 3CCVP 1RE3C 2E9XB 4NPDA 3PUXF 2PBIA 1QUUA 3EHZA 1NYHA 3H3AA 3D6YA 5DJTB 3LBXA 4JEUB 3CKDA 1SFCA 1EZVE 1UUSA 1S4XA 1D1AA 2E9XD 4GKKT 1GTWA 3LW5J 1ZHCA 2PGDA 2EHOA 3HRNA 2R3SA 3D71A 1RF1A 3CCRP 1ZMEC 3R84B 3T8OA 4EAHA 3PV0F 1S5LX 3RQUA 2L91A 2R6GF 1EXJA 2DWGA 5AW1B 2LKGA 4QXCB 1NTZG 3LG7A 2W90A 1YJNP 1SQVD 3MGNA 3G06A 1AJ3A 3ESLA 3B5ND 3UT5E 3U1CA 2ODVA 4DBQA 4AQGA 2FKWB 3ETUA 5L2LA 3H1HE 2JO1A 1UGOA 1A02F 3O4XE 1KILC 2OARA 3PJAA 1QLBA 2WSSV 4ILBA 3QWOC 5BU5A 4I1LA 2R32A 4PAGA 4Y99C 4QH5A 5L3FB 4C7NA 4H9PC 4ZS2A 2IDOB 3H1JE 1BR0A 4DVDA 1VQ7P 2B9BA 1HVVA 3QH9A 5FXWA 2Y0DA 2JJLA 1GQEA 2LKHA 3CWBG 3O9XA 3L75E 5KLVJ 1VPCA 2ZT9C 1ZP0A 1ZN5A 3ZLIA 1PPJE 3NMDA 3KBTA 2WVRA 3J9X1 1HH0A 2HLOA 4KP3C 2FXMA 5JR9C 1SQQG 4K0UA 5LJMA 3H1IJ 3GWHA 3BQKA 2ITAA 3PHLA 2PJQA 1D0ZA 4HB1A 2DL1A 3AAEB 3A2AA 3OA7A 1KFYA 2MPKA 2XQ7A 1US7B 4H13C 4UB6E 1SQBE 4CI3B 1QVGO 4MALA 4HFHA 1JTHA 1CW5A 2IFNA 1SQXG 1ZR2A 2JEEA 3AEEC 5E79E 2FY8A 1S2EA 3F89A 2WMOA 3F57A 2XQ5A 4AKGA 4WBAA 1UIXA 1D7MA 4GKGA 2NOXA 4ZI3D 3CWZB 3PU3A 5F5WA 2V7QH 1HS7A 4WBOA 2Q9QD 1Q81Q 5AQLB 3L3PA 4DUZT 3H32A 3P4PA 1DD4A 1HGZA 2QM7A 4L5GA 3AEDC 5LYJE 2FBWC 2CMRA 3KVBA 5BU8B 2Z5HA 2HH7A 3CC4P 3P4RA 4WBNE 3O6QB 2KLVA 3H1KD 2QJYB 2CLYB 5FYMA 2QIWA 3Q5EA 1M8OB 2LKMA 4DO0A 3HD7B 2NZ2A 1H88A 3EDUA 1ZR4A 2XZRA 3VRAA 4DR2T 2AXCA 1KZUB 1IZNB 5AQHB 1SQBD 2LOSA 4AIUA 1T2KC 5J1GA 2D2CD 3TGUE 3WU2H 1FMWA 3LK2B 1HFAA 3QC9A 1VQMP 2Y9YA 3BQIA 5KXJA 4BAYB 4H0LC 5B66E 4B3MT 2CA5A 3UU8A 2CHNA 3ZN1B 3AEBC 2BASA 4FJOA 4K0KT 2HG5D 4Z8XA 2ZM2A 2C5KT 4YJ2E 4AKRB 4GOUA 3M3ZB 1W2EA 3AE6C 5AW5B 3RYFE 5A1LA 1FE6A 4HH2A 3PP5A 5APVA 2JQQA 2CEAA 1KYOH 1H0TA 3VKHA 2FYNC 3JSVC 3FZHB 2F4VT 4PNIA 5GTIH 4JI4T 3Q5PA 5JDFA 1M1JC 2WWVA 2UXNB 4L73A 4ZXLA 4H9QC 4LF9T 3GN5A 4TZ4C 1BCCG 3CWBE 2XM1A 4OH8B 2CHOA 3E1RA 3HI2A 3KHUA 1GK4A 1URQD 3PLNA 3CX7B 4DZOA 1JNMA 1UIIA 2YKQA 1Z56A 1WYCA 3WU2E 5JRCB 4V1Av 4CXWA 5HCJA 1T3UA 5LG4A 4A7PA 2KLUA 1G73A 4CXYA 3QOFA 4ZMDA 1VF5C 1SQXJ 2NR4A 4HKAA 1W09A 3CQXC 2N1TC 2QVAA 3EQ2A 3PU8A 1OXZA 3N9QA 2V5CA 2I1KA 4JQ0D 1D0XA 2WZIA 1L0NG 4I7ZB 2BEZF 2WPSA 4IL4A 1KNPA 4DNDA 4ZI2D 1HX8A 4LMJA 5LOVE 5JDQA 3L73E 1M1JA 2Q9QA 5AQKB 2BS4A 2WBLA 1N7SC 2FFDC 3L75D 5LXTE 4O9BA 1VCSA 1T3JA 1KORA 4I50E 1FZAA 3Q2YA 4YLHA 1URQB 2XAJB 2LM9A 5AQJB 5ADXL 4B86A 3TK1A 3L35A 2Y48B 1IFPA 1OVUA 3CVRA 5BVZA 2QE7H 4CI2B 4PK4A 3OJAA 4QXBB 2GM4A 3L71J 1KFNA 3UQ4A 4K35A 4MBQA 3VYIA 4X66T 1FJGT 1VQOP 4GYRA 2C9LY 1RE4A 1X79A 1ZKEA 4PV1D 2K5BB 5AVTB 2E42A 1QSDA 2VURA 3LW5H 1FZFA 3BK9A 4U2YA 3A0BH 3A3YB 4DV2T 5KLVK 1N7SD 2V7LA 1E79H 5DQVA 5KDMC 3RGLA 3L70J 4GOFA 2QG4A 3K8PC 5TISH 1BSHA 2D2CC 5CCGD 1AQ5A 1YBKA 2IX7C 2C5IT 2BVLA 3CXHH 2QA7A 2WMNA 1I94T 3N2OA 4EI2A 1P84E 4WB4A 2P58A 1MUUA 3N9OA 2V7QJ 1ZXGA 5AQPB 5AQFB 4IREA 4WY4C 4XA4A 4DIDB 4M1PA 1FZGA 4K3AA 2I8DA 4GYSA 3N2KE 4TUYE 1GDTA 3I9YA 3USSA 5AW4B 1VRBA 3ZJ1A 1LTGC 5KLIB 1WYBA 1YXRA 5CJ4A 2OTKE 5LMNT 1NU1E 3M9QA 4W7ZA 3F5HA 3BRTB 3I0OA 1YKHB 1O3XA 2E9XC 1PZQA 3CQCB 4UVAB 4JI1T 2RMZA 2WTYA 3AEEA 2NW7A 3EDVA 3MK7C 4YSYA 4D6TJ 4YHJA 4H13D 1LRZA 1GL2D 2H3RA 2ZYAA 2IW5B 1M57D 2LSIA 1KILE 2J58A 2MAWA 4B3RT 4UF0A 5H6QB 1SFCD 3HTKB 1HF8A 2V1DB 3PE0A 4PJ0H 3VTPC 4WNKA 4EXTA 3PUQA 5KTBA 2HPJA 4U2ZA 1T8ZA 2V26A 1LTTC 3B5MA 3RKGA 3RIAA 3RK3E 2HPCA 3BCCD 3EUHA 5APUA 4OFZA 1VQKP 3A8YC 2FUPA 4FI5A 3V2RA 2XASB 4W7YA 2KS1B 3Q3DA 1ZRTE 2SPZA 2ES0A 1IK7A 1LJ2A 3H1HJ 3P7KA 3PUSA 3BCCG 3AE4C 3MP7B 3MUDA 1VQLP 2SPCA 3GHGA 1LTJC 4PD4I 5EK4A 4U3FE 2CPTA 1FZCB 2A06D 3H1JJ 3GMIA 1JY3N 1BE3E 1L0NK 1WT6A 3RK3D 4QKNA 1KILB 2FYZA 4LF8T 4ADZA 1JY3O 3H1LG 4PD4D 1GL2C 2L3LA 1YTZI 5AVSB 2W63A 4XE5B 1VQ4P 3CWBJ 1DU2A 2ZVOB 2N1TA 1JM0A 1NGMB 2YO2A 2Y6XA 2DW3A 4OK0A 1QL2A 3LDQB 2IBZI 1SQPG 3HE5B 1JNRA 2A2FX 1KB9E 4EGWA 2J59M 5AW8B 3FZFB 3FWNA 4ERRA 1E7PA 5AFUL 4O2AE 1LWUC 5FKYA 2YDSA 2CXFA 2Q5UA 5FVKA 3SFDA 2OLTA 2YIUB 2YMKA 5ABFA 1SQXE 4PK5A 1IBMT 1AFOA 3RK3C 2W6AA 4IL6H 2E5VA 4KUMB 4CZZB 3RK3B 2Y9ZA 2OYIC 5AW3B 2DNXA 1W5CE 2N1GA 3U3IA 2WSSH 4IL9A 2PFVA 1KQGB 4A5XA 1S94A 4OHFA 4DV0T 2Q3IA 2QJPB 3ANWA 1OX3A 4TT3H 5TJHA 3TSIA 4Y28J 3T97A 2UWJE 1GW4A 1N73C 3E22E 3L70G 2KSJA 3K3NA 3U1AA 1E5WA 3EWKA 3O8ZA 3B8EB 2QSIA 1SQBJ 1R5LA 1U7MA 1IJDB 4X20E 1P84I 2YDRA 1NTKJ 2Q9IA 2H89C 2DLRA 3VHLA 4DV4T 1N8RQ 3ZPOA 2E9XA 1PL5A 3PUAA 4YJ3E 2FYUD 2CWYA 4A56A 4HE8A 4E7SA 5AVYB 1LTBC 2L9QA 2W66A 3KINB 2W67A 1UX5A 4NXMT 1LT9B 1IFIA 1RF1B 5HXRA 4H13B 4N6JA 3L75G 3ZKRA 5LGNB 3VKGA 4PJJA 2XQ8A 3L74G 3EFFK 3K5BA 5APQA 2IBZG 5LBMA 1SQQD 1NWMX 3Q1MA 1HG2A 3P32A 3FXEA 2NPSC 1N86A 1L0LG 5GTHE 2BG9A 3MACA 2B87B 4YTNA 4A98A 5K5GB 2W27A 1W2BO 1NU1G 3AE2C 2XPKA 5CA1E 5KJ7C 3CPZA 2YO3A 4EEDA 3X1DA 2ZM0A 3AA6B 1EZVG 2ZM8A 4KT0J 3Q5XA 3UU5A 4YPCA 1LTJA 3SS1A 3L37A 1X9BA 3U78A 2VKJA 3NVOA 5CGMA 3T1YT 1R8IA 3U59A 1IO4A 1LTSC 2PG8A 5AQVB 4EOTA 1SP4A 1PFIA 2H8PD 4ISSA 1QX8A 1VF5B 2KK7A 2BKPA 3V4WA 1YQ4A 3LIEA 5L3BB 4PV1B 4DR7T 2YMYA 3VMAA 3IR9A 3F2EA 2WSFH 1VOMA 5ABHA 4X62T 3SFEC 2G0UA 3HR0A 2PP6A 1L0VA 2WU5A 3RPUA 3CXHD 2ACXA 2WT7B 4H0LD 4ZKUA 2NWBA 1IFNA 3G71P 3MZWB 1ZEEA 1G2CA 3UUXB 1JB0J 4ZI7E 1SQPE 2LXCB 4HFEA 4COFA 4ILUA 4OGQB 3EFGA 1KQSO 2M6IA 4EB6E 4EYYR 2YKOA 3OW2O 1JUNA 2E75C 2ZAEB 2XDJA 1YHQP 2JJ9A 4IIJE 4AKLA 4HFIA 3RYIE 1M7KA 3RX6A 2FJBA 1XNRT 3P4WA 1R5SA 4I6MC 3S4RA 4O4IE 5KLVD 1SLQA 1L0NE 4YTPC 4BXLA 4YXDC 2UXDT 1MMNA 1USEA 2VB6A 4U74A 3L72E 4OGQD 3H1KG 2A72A 1KNZA 3OYXA 2N9BA 2NTYA 3JCFA 5JREA 1XTCC 2H88C 3N4XA 1OMIA 3TLSA 2ODUA 4KX6A 2H7OA 1VQ9P 2FFDB 3K1SA 3IN6A 3CX6B 1OEDB 1W0AA 3UUMA 4C46A 4IE7A 5KAFH 2JQHA 2KZJA 2VRSA 4O2BE 1IFMA 3HUSC 3B71A 2X51A 3L71E 4HN9A 3W67A 2YU2A 3KV5A 1QL1A 5JVDE 3G6EP 5LHGB 2AXDS 4TNWA 4EZ4A 1HUCA 1YQ3C 3L70E 1FBMA 1MMDA 3GMAA 2H7VC 3RQWA 4ILCA 1NAFA 2A06E 1JCCA 2QRXA 2GK9A 2FYUE 3SWFA 2E5TA 4NPFX 3SRZA 1HJ0A 5HEGA 4ASKA 1GMJA 4HEAA 1JY2O 2QGSA 1EDIA 3ZMZB 1LP1B 4YSXA 2FXPA 3JC22 2OYOA 3RKOA 2HFED 4L74A 2L8KA 5C2TA 4I4TE 2OTJP 3C4XA 3ZDMA 3ONJA 4I43B 5C8YE 1HBWA 4ASVA 3HA4A 3Q2MA 3H1IE 2YNYA 1IC2A 2XHEB 3PJSK 3KZIE 2IUBA 3H1HD 2V7JA 2V6YB 3FZKB 2QEXP 2NP9A 2K48A 3V5UA 1IFDA 3W68A 4P0BA 4TN7B 1KQFB 2Y8DA 1XZYA 3D0TA 2MYSA 2M3BA 5JDGA 1JY2N 4ZI3C 3EVYA 4TX5A 2ZXXA 4LF6T 2WWUA 2LT3A 4LGDE 1BDDA 3GG2A 2HR3A 1T98A 2BKOA 2IHR1 1FC2C 3ABVC 1U4QA 1QEXA 1LKXA 4XBFB 4DT0A 2Q9QB 2KWIB 1WMKA 2VK9A 4UR9A 1GL2A 5APXA 2AEJA 4EIWA 1OVRA 2WSCJ 3L09A 2V7MA 4NUVA 2E5YA 1RF0A 2OYHC 4AXPA 1PV3A 1W0BA 2UXXB 5HEHA 3HD7C 2KSEA 3AE1C 2XNXA 3H3MA 4IE5A 3CCJP 2E76D 4YHHT 3II6A 3TNUA 2UUAT 4U7JA 2KP8A 1M62A 1P84D 2W2UA 4IDPA 4B3ST 4JYBA 1RE4C 2L5GB 1N73A 1S5LE 3VMZA 1D0YA 3LFMA 4UVBB 1WCRA 5L3EB 3AE2A 1Y64B 2P67A 4A97A 3JCUE 5LJNA 3PDYA 1M7LA 1DX7A 1L0LE 1OFCX 1N2DC 2YXQB 5KAFE 5BR8T 4AISA 3WAJA 2H88A 5CHXA 3AVSA 1LNQA 2OA5A 3H1LD 2C9NY 2A45I 1J5WA 3C8VA 3CD6P 1A02J 3AXJB 3B5NC 3BQLA 1N7SA 1SQPK 1S9KD 3N2GE 3KXDA 2D5UA 3JC6D 4LFAT 1K05A 5FXVA 2IC6A 5CCHC 4AUWA 2FXOA 1IBLT 3H1JG 1JEKA 1T6AA 1PP9G 3IF4A 3VP9A 1MNEA 5AQSB 3HKBE 3L72D 4L76A 3KBUA 1BCCJ 1L0NJ 3P8CE 2DWKA 2XQ6A 1XMOT 3IBPA 1KFMA 3L72J 4HKZH 2ACZA 3V6IA 3KDSE 2KIKA 2ZT9B 3EABA 3FXDA 3H1KE 1URQC 2KB7P 1J2JB 2NPSB 5GTIE 2XSAA 4UB8E 2KNCA 1M90Q 3V2QA 1FDIA 2LRLA 4G2AA 1KK7A 1KNRA 5KX5E 3VN0A 3BATA 1HG5A 2W61A 3LJCA 3N9MA 4MLKA 3M9HA 4HWIB 4EZHA 3A0HE 3GA8A 2CBIA 3P50A 1SQQJ 3GF3A 2JRKA 1FZBA 2OYIA 1XMQT 1HTLC 2RPAA 1J1EB 3ZC0A 3HTKA 3ZMVB 2RA1A 3L70D 1NU1D 2ZT9D 4HFBA 3AAIA 1R8EA 3ZMUB 3ZCIA 5IYZE 1VQNP 1SFCB 3CXHI 2LSKA 3BVHA 3FWLA 3RL0B 1RH5B 2HPCB 2XKMA 3ONLC 4U3FG 4H63H 2A3DA 3UFGA 4JYCA 5DJQC 2KS1A 3M0AA 1EDKA 3JAFA 1ZOYC 2K9YA 3PRJA 3CMAP 4H9OC 2LEHA 3IF8B 5E0OA 2Z4EA 3QB5K 3SFEA 5IUXA 1Y47A 3RC3A 1BCCD 1FJKA 1FEWA 3E1IA 2W0GA 2R5DA 5L4HA 4QX7B 1FZCA 3KV4A 4TWFA 1L4AB 3AE7C 3H1ID 1KYOD 1NEKA 2IBZD 1RY3A 1I6ZA 1D1BA 4UB8H 2K9AA 2WY2A 2MTQA 1GU4A 3IA3A 2JP3A 2WP9A 1N33T 1KEYA 4IE0A 5FY7A 2N1TD 2VASA 5CBOA 1JNZA 2V7KA 5CJ0A 1J1DC 4HWHA 4WWIA 4O4JE 1Y9BA 2K9JA 4LLHA 4EIJA 3RI5A 2X0YA 1LWUB 3KDPB 5L4EA 2XSBA 1BGYG 3N9PA 4P09A 1EZVD 1NU1J 3SOLA 1CUNA 3TF5A 1ZRTD 1PGPA 3CCMP 4HFCA 4LF7T 1H7CA 1QLED 2YKPA 1WRGA 2E75B 2HYNA 1EDLA 1L0LK 4JBZA 3AEGA 3MKDA 1SQPJ 2C0WA 1RF0C 4OVNF 1BE3J 4GT1A 4OWFA 3NZPA 1BCCE 2M67A 4U3FD 2PAJA 3WI3A 4ZHQE 3HKEE 1AVOA 1YJ9P 1K9MQ 5KLVG 2ZXEB 2V8SV 1JTHB 1FZCC 3B13A 4EYUA 1KYOE 3KQGA 4YXDA 2W6BA 1FDMA 4YTPA 2D0UA 3A7MA 2K37A 2HODB 4JI7T 4X1IE 1K8AQ 3T1HT 2JQKA 2XTLA 4AQFA 4ASWA 5AQGB 1G1IA 2ZYGA 1S72P 2E74D 2N9YB 1NH4A 3H1HG 4AI6A 2XNDH 1SFCC 3PJAJ 3WUUA 5DQWA 4GOEA 1H8AA 2OV9A 2CPBA 3O1JA 2G3AA 3RIUC 2E43A 3AE7A 4P0AA 3QB5A 1KV4A 5J2TE 2IDBA 2K24A 4H9SE 1MNDA 1JMMA 3TGUG 3ZN0B 4JF7A 5HXHA 3L4FA 3HD7A 5FVLA 3ZSSA 5CA0E 3Q5SA 2AE9A 4MFRA 3L73J 4HYTB 3DTOA 3D6ZA 2V7IA 4RO0A 3CCLP 3MTUE 2LXBA 2B87A 3KZIH 2IPPA 3M91A 3ZYMA 4WY4D 1Q90D 4DR4T 2K3WA 1VF5D 3H1KJ 1Y01A 2E75D 3R2PA 3SSUA 4CN6A 1LT9C 3NRXA 1FMVA 4DV7T 5C3JA 2WSCH 5APTA 2DCFA 1X22A 2FYUK 4L75A 3CI9A 1VQ5P 4XFJA 2LOPA 3UU4A 5LBQB 1NTMJ 2E74C 3M65A 1H0TB 3AEFC 5HEJA 1SE7A 5J0ZA 2Y0CA 3QUJA 2X9WA 5AVRB 2WPRA 3G9RA 2CK3H 2BBHA 5JR9A 1AQTA 4XAXB 4GIWA 3OBVE 5HCMA 2XUEA 1J1JA 3UU3A 1HR0T 1VQPP 4EDFA 2XJ7A 2AEMA 4GKJT 5ABEA 1WLXA 5KKZB 3ZMTB 1MMAA 3QK6A 2IZ0A 1GU5A 4KHPT 4I55E 4W80A 3V5BA 3BCCE 4LF5T 3NRYA 1EXIA 5CJ5A 1BSNA 1NTKE 5JRCA 4ZEYA 2WT7A 3CX5D 4JI8T 1LGHB 2XU6A 5EZYE 4GODA 4UIGA 2BS3A 5LCYA 4JI6T 1HWTC 3UUNA 1M56D 1IJ5A 4CQIA 3AEGC 3L71D 4UV9B 1Q86Q 1OW7A 2M8RA 5JDNA 4DV5T 3GW6A 1NTZJ 2W8ZA 2A06G 3CLQA 3CX5I 1J5ET 3TLWA 2DHRA 4ZZCA 4DR6T 3C1LA 2YK0A 1FZEA 2M0BA 2WU2A 4CI1B 1KN7A 2WZ7A 1SUMB 2KLQA 4PD4E 1MFTA 1KD1Q 2J5UA 1LTIC 3MD0A 2X66A 1GZLA 4JBWF 5HEUA 2CCQA 1KQLA 4AQRD 4KHXA 4IFFA 1MV8A 3CXHE 2H89A 3M0DA 3CC7P 5CCGC 2WWWA 1LVKA 3AE3A 2LJLA 3AE9A 3CK6A 1SHZC 3RK2D 3AECA 2CM0A 1NKNA 3C98B 4H9NC 4H44D 1NHLA 2FFDA 3HUSB 4GDOA 2E8IA 4ISTA 3O1IA 2GUVA 3PUGA 5EK3A 3P7IA 5L3GB 3MZKB 3UTKA 2JMKA 2UXCT 4JPZB 3FB2A 1KF6A 2O01H 2W6JH 4AYCA 4DJGA 1AV1A 1SQQK 4OX9T 4LMKA 3LK3B 4QHOA 4IL6E 2I0MA 4PJNA 3WAKA 5AVWB 2K88A 3UIAA 3A0HH 3L73G 4Z1MH 4X5TA 1SQBG 2M5AB 2M6BA 1N36T 2VVNA 4YFSA 1XTGB 5JDHA 5ETWA 4R4LA 5AQRB 4TWHA 3B5NB 4ANJA 1SQQE 1BDCA 5BMVE 4YT0A 4C7RA 3ZT6A 3Q9DA 5JTGA 2E76B 2WM9A 3CMEP 2BVMA 1BR1A 2WCAA 4X65T 3HE4B 4OGQC 4Z91A 4ZKPA 1XWMA 5HWYA 4AKIA 5M4YA 4EOZB 3PTZA 4IDZA 1LTAC 1NTMG 5B5EH 2RH0A 2YIUC 2YINA 3ZMSB 2XV5A 4HWCA 5JH7E 4DUYT 3JC6C 4NUUA 4AQFC 4UELA 3NFQA 3RF1A 1YITP 3AA1B 2HHHT 1PP9E 5KLIC 2NPSD 3CCSP 3RLFF 1YI2P 1E2AA 3TYYA 2WSFJ 1L0LJ 3Q5RA 2I1JA 2GUSA 3O6QA 2R5BA 1OW8A 2P7JA 2P1JA 2XAGB 5M1BA 2KI7B 2PRRA 4IDQA 5CBNA 3MXZA 2BEQD 4U72A 4ZNCA 3S9OA 3NZQA 5LNKA 2VL0A 1D1CA 2WMMA 3N5LA 2LR2A 4D6TD 4EYYQ 1GL2B 2JPFA 1J1EC 1PP9J 2WB5A 5AVQB 2YEVC 1YQ3A 2VWAA 4Q25A 2W00A 1PP9D 3FZLB 3O1HA 5CB4E 3TLUA 4OYJA 3ZT5A 1VQ8P 1NTME 1OWAA 5CMZA 1NWQA 1HTJF 3L74E 5APSA 2Q1KA 3FBLA 3BCCJ 5APYA 3AA0B 5H6RB 1KILA 2IZ1A 3RGUA 3CMLA 2ZFCA 3P8CD 3BRVB 2E5LT 3MHVA 3RC8A 1KILD 3JADA 4LFBT 3A7OA 4H44B 2LSYA 3R6NA 1NJIQ 2KINB 3IEEA 1M1KQ 3KFWX 1CI6B 1X0TA 3HE5A 1IJ6A 2RN0A 4IFDK 3N9NA 3GN5B 4PW8A 5LHHB 2O1JA 3AXJA 3NKZA 2A45H 1N7SB 3PUZF 4WY4A 5B5EE 1HCIA 4D6TE 1DH3A 3ONXA 4N78E 2JQ9A 1JO5A 3V5SA 2OYHA 2R44A 2ZVNB 3HKDE 1HNZT 5L3CB 3V2NA 1EZ3A 1BGYD 2WS3A 4ZOLE 4PK6A 4CN1A 5HAXA 1SQVE 1SVFA 2BCCJ 2IMLA 3UQ7A 4BJMA 2WSEJ 2EHOD 5HYAA 5FMNA 2KXPB 1KTMA 3NXSA 3CL3D 3I55P 4GIFA 1AVYA 4B3TT 3FXDB 2B89A 3PUYF 1JCDA 2W4XA 1K73Q 4F6RC 5AW0B 2X9YA 2XQAA 3RRWA 4QXHB 3KPEA 4C91A 1BE3G 2QA4P 1PGJA 4BRYB 4HTEA 4ZS3A 2G8YA 1UK5A 1M1JB 2WPQA 2XQYA 2OYIB 2WQYC 3TGUJ 1Q2NA 2VKDA 3ZYLA 3VRBA 5LGTB 3IAOA 3E08A 5KJ7A 2WAUA 2Z6EA 4UVCB 2E76C 4JI0T 4IDNA 4DMWA 3ZSTA 4TV8E 5LG3A 1LVFA 2N9DA 2K1AA 3OJAB 1U57A 2FJAA 3VR8A 1LT9A 3E7KA 3RK2C 1V9DA 4JI5T 1KYOI 3CX5H 4LF4T 4H0LB 2LM2A 3KVAA 1YKEB 5JDLA 3WUVA 4NXNT 3RRCA 2EHOC 2QJPC 2BG9B 4MHCA 1EQ7A 5KLVE 3L75J 1FOSF 4O4LE 3UU6A 5EFWB 1NO4A 5AVVB 4XZCA 4AQYT 4DV1T 2XAQB 1RQVA 1B7TA 1FIOA 5KMGP 3N7NA 3J7Yq 3C51A 2XAHB 1LTJB 2NW8A 1HNXT 2KSRA 4X1KE 2K9JB 3F31A 3D70A 1LWUA 1MFZA 2QJKC 2WDRA 3AAAB 3S4UA 1NTKK 1UCUA 4GK0E 2YDQA 3V2PA 1VL2A 4ILAA 2KOGA 1EC5A 1ZV8A 1P84H 3OPCA 1NU1K 3K3QC 4IDOA 3A0BE 4Z90A 3ZYKA 3VOPA 1SA0E 4KHZF 4KMCA 2QYWA 2BG9E 5DJUB 2O3JA 4PJLA 5AW9B 5LB7B 2QJKB 3AEFA 1K04A 1YTZT 2YN6A 1OIPA 4DCKA 2MBGA 2NTXA 2XY8B 2IFMA 4CN4A 2E2AA 5TAOA 5FNVE 5CCHA 2O01J 5HXEA 2J47A 1ZW0A 5CFBA 1DEEG 3HD7D 4ZZBA 1G2CB 3SWHA 4UF0B 1CHUA 4DR5T 4KI0F 2V6XA 2YOEA 4QX8B 3AE4A 1S3JA 2AXTH 2HODA 4PJMA 1DEBA 1XDPA 5AQIB 3LBXB 3MJXA 3M0DC 3A5XA 1T7SA 2VQFT 4EEBA 4H44C 2IAKA 5H2FH 2EHOB 1BR2A 4BJNA 3N9LA 3L74D 3C64A 4PFPA 3ABVA 1NKZB 4KJMA 1CZQA 1YW0A 2I6HA 3Q5WA 2RKLA 4QH1A 3FGAD 4HWDA 1Q82Q 5HXCA 3L74J 4Y99B 2X68A 5AQMB 4HWFA 2OQQA 3CCUP 3PUWF 5KKZC 3TDKA 1TU3F 1KB9H 2VKHA 4LC1A 2IIUA 1OEDE 3PH0A 2BDEA 3QNUA 3AE1A 1T8BA 4HFVA 1KC8Q 4UEMA 2POHA 3RBXA 1X8YA 5AW2B 3B57A 4O8SA 1S9KE 2V4HA 1N32T 1MKMA 4L9IA 2BBJA 4DR3T 3L73D 1GD2E 4TWDA 5L47A 3UULA 3EI0A 1OEDA 3SFDC 2CXDA 4PD4H 1WR0A 4U33A 4C7NB 2AXTE 2LSJA 1YYCA 1HF9A 1ZOYA 3A5TA 3RBZA 1LT1A 2WSEH 1L4AD 2KWHA 4PV1C 2VKOA 5LHIB 3AE3C 5AQOB 4J2CA 2AEFA 1FOSE 5IWAT 2XQ3A 3V4QA 1G8XA 3W15B 1MIYA 3G4SP 1NTMD 2O1KA 5L3DB 1PGQA 4JV5T 3H6PA 2WITA 3RL0C 4I2LC 2M3EA 4QWNB 3JCUH 3RYCE 3LSVA 1PPJG 1NTKG 1GW3A 2JDIH 2UXBT 3RL0D 4DOJA 2D9DA 4I0UA 4LFCT 2PTFA 3ANWB 3CC2P 1LP1A 3OAKA 2HN1A 3LK42 4QH4A 5B66H 4AKHA 2B88A 3L8RA 2OTLP 4BA9A 1KMIZ 1H89A 2CPSA 5L8RJ 3VU7H 2JMHA 3GF7A 3H32B 1NVOA 4N78D 5KAIH 4DR1T 2ZMAA 4WVZA 3FBZA 2CRBA 3C50A 2QM8A 2JIWA 2JWDA 2A45G 3S1KA 2X67A 4NIQA 2YKSA 5LGUB 3M9BA 3AE5C 4YY3T 1OVVA 3CX5E 2XQ4A 3FX0A 1RHZB 4I7ZC 3RYHE 1SQXD 1BGYE 2J62A 2O01N 2XZEA 5DABA 3DJBA 2K3RA 3I5CA 2KMFA 3FXEB 5CCGA 2VQET 3NBXX 3CPWO 3B4SA 1NTKD 3BASA 3TNUB 3ZCJA 3VMYA 1Z0PA 4X64T 5E79H 3C4ZA 4IOIH 2R3CA 4DV6T 1WRDA 4JYAT 1N73B 1WFDA 3AE8C 1EDJA 2JKVA 2VVSA 2CWOA 3DP7A 4IGUA 3HUSA 1Z8UA 2D0TA 2B1EA 4YTMA 2UUBT 4N3YB 2BCCD 4UXNB 4U7IA 2A9UA 2LSGA 3ETVA 4WZXA 3H25A 3EAMA 1SS1A 5AVUB 1AJYA 2WPVB 3E0ZA 4YSZA 1GK6A 2YU1A 2NW9A 1JOCA 1NTZK 4MN4C 1YD8G 2UU9T 1N7LA 4R4MA 5AQTB 1AA0A 4WYVA 2IBZE 1T72A 4L0RA 3CIRA 1NTZD 1QGKB 1S1CX 3TKLB 3HL6A 3IHRA 5AQNB 3IFMA 3PTRB 2M5AA 2XAFB 4ZI2C 3RK2B 3VMXA 4C90A 2D2SA 1FJPA 3B5NA 5GTHH 2WDVA 2LHRA 1NOHA 4JLEA 3C4WA 1VCTA 1PGOA 1ZP0C 2JWAA 1QVFO 5FY1A 3VP8A 4NPPA 5ABGA 4HGAA 2UUCT 3AEAC 2KT9A 1OW6A 1WR6A 1EZVI 3HE4A 1UX4A 4JUYA 5AQQB 5KJ7D 3FHNA 5CCHD 2HPLA 1IBKT 2Q3EA 4P1NA 2Q6QA 3ITKA 2C0SA 3CQGB 3MUDC 1FU1A 2B76A 4HJGH 1ZLLA 3WUTA 2CXLA 3PUVF 1FDOA 5LA6E 3ZC1A 1CSBA 4RJTA 4WW0A 5IHYA 5AW7B 5LMUT 3RL0g 2QJYC 2CLYC 3AECC 3L71G 3P8MC 2J4GA 5AVZB 1URQA 4PFOA 1Q7YQ 1JY2P 3RIUA 2IYOA 3CCEP 4IE4A
chains in the Genus database with same CATH topology
1OVVA 2SPZA 2WMMA 1OVRA 2LR2A 4EYYQ 1EDKA 1OVUA 2K3RA 3QB5K 3PH0A 1Y47A 4K35A 3FXEA 2B87B 2KUBA 5K5GB 4NPEA 4IOIH 2LXBA 2B87A 2KZJA 2Q1KA 1EDJA 5EFWB 3PJAA 3RGUA 1KEYA 3QWOC 1JM0A 5CBOA 3MHVA 1LT1A 1SS1A 4GOFA 4WWIA 4CPGA 1H0TA 1X0TA 3AXJB 1H0TB 2QRXA 2P58A 4NPFX 3AXJA 1ZXGA 4MN4C 1JMBA 4WYVA 1EDLA 1J1JA 4JBZA 1EC5A 2M5AB 2I8DA 4K3AA 1EDIA 2R44A 4HB1A 2M5AA 1LP1B 2OTKE 1U7JA 5DJUB 4HKZH 1BDCA 1LP1A 3ZDMA 2KIKA 4ASVA 3FXDA 5C39A 2B88A 2UWJE 3MZWB 2KZIA 4ZMDA 2B89A 3QB5A 2LXCB 1ZW0A 1DEEG 4GODA 2QVAA 4ZNCA 1NVOA 1S3JA 2ZAEB 1U7MA 4HJGH 4ASWA 4NPDA 5DJTB 2JWDA 1BDDA 3S1KA 2HR3A 1Q2NA 3PJAJ 2M0BA 4GOEA 1FC2C 2KI7B 4KJMA 5CBNA 3RIUC 3RIUA 2RKLA 1MFTA 2KS1B 4BXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVV A;  2SPZ A;  2WMM A;  1OVR A;  2LR2 A;  4EYY Q;  1EDK A;  1OVU A;  2K3R A;  3QB5 K;  3PH0 A;  1Y47 A;  4K35 A;  3FXE A;  2B87 B;  2KUB A;  5K5G B;  4NPE A;  4IOI H;  2LXB A;  2B87 A;  2KZJ A;  2Q1K A;  1EDJ A;  5EFW B;  3PJA A;  3RGU A;  1KEY A;  3QWO C;  1JM0 A;  5CBO A;  3MHV A;  1LT1 A;  1SS1 A;  4GOF A;  4WWI A;  4CPG A;  1H0T A;  1X0T A;  3AXJ B;  1H0T B;  2QRX A;  2P58 A;  4NPF X;  3AXJ A;  1ZXG A;  4MN4 C;  1JMB A;  4WYV A;  1EDL A;  1J1J A;  4JBZ A;  1EC5 A;  2M5A B;  2I8D A;  4K3A A;  1EDI A;  2R44 A;  4HB1 A;  2M5A A;  1LP1 B;  2OTK E;  1U7J A;  5DJU B;  4HKZ H;  1BDC A;  1LP1 A;  3ZDM A;  2KIK A;  4ASV A;  3FXD A;  5C39 A;  2B88 A;  2UWJ E;  3MZW B;  2KZI A;  4ZMD A;  2B89 A;  3QB5 A;  2LXC B;  1ZW0 A;  1DEE G;  4GOD A;  2QVA A;  4ZNC A;  1NVO A;  1S3J A;  2ZAE B;  1U7M A;  4HJG H;  4ASW A;  4NPD A;  5DJT B;  2JWD A;  1BDD A;  3S1K A;  2HR3 A;  1Q2N A;  3PJA J;  2M0B A;  4GOE A;  1FC2 C;  2KI7 B;  4KJM A;  5CBN A;  3RIU C;  3RIU A;  2RKL A;  1MFT A;  2KS1 B;  4BXL A; 
#chains in the Genus database with same CATH topology
 2RP4 A;  5HWX A;  5HEO A;  4U3C A;  2HN2 A;  3OTO T;  3I1A A;  1L2P A;  4H9R C;  2OGU A;  4U31 A;  1S5L H;  2J1D G;  4IHJ E;  4G63 A;  3AVR A;  1XDO A;  1USD A;  3RH3 A;  1X79 B;  5FL0 A;  1PPJ D;  3VR9 A;  2BS2 A;  2Q7C A;  3MIW A;  2H43 A;  1NEN A;  1W9R A;  1MIW A;  3R4Y A;  5LP6 E;  2PFX A;  2C0X A;  4KBM B;  2FJE A;  1N34 T;  1SQP D;  1L4A A;  3H37 A;  2X9H A;  2YXR B;  2XM2 A;  4U3F J;  3CCQ P;  2Y0E A;  2C5J A;  1RQU A;  1T2K D;  2ZYD A;  2CBJ A;  2I59 A;  4CXX A;  1G1J A;  4H63 V;  5GON E;  1X9V A;  3I0Q A;  4X1Y E;  4RKU J;  1CI6 A;  1RF1 C;  3AE8 A;  1SQV K;  1SQV G;  2MJZ A;  4UV8 B;  1JMB A;  4JI2 T;  4IT4 A;  5AVX B;  1NTM K;  1YQ4 C;  3AA7 B;  4WY4 B;  2V5D A;  3ZT7 A;  2P10 A;  4BWN A;  3FZM B;  1ZV4 X;  3OYZ A;  2LRK A;  1L0L D;  1BR4 A;  3TLV A;  4D6T G;  2OYH B;  1RE3 A;  5FY0 A;  3I56 P;  3H1J D;  2W62 A;  4YXW H;  2P2U A;  2BG9 C;  3UUB A;  4B6X A;  1BGY J;  3ZEF B;  2D2C B;  3H1L E;  2FYN B;  5C39 A;  2Q9Q C;  2BCC G;  1YIJ P;  1OZH A;  2FJD A;  2LHN A;  4F8H A;  5FXZ A;  2E74 B;  2KZI A;  4OYK A;  5KAI E;  2V6Y A;  2MKV A;  4EV6 A;  1MIV A;  1UUR A;  1HX1 B;  4UB6 H;  1FAV A;  2DI4 A;  3PUR A;  5APW A;  1HJB A;  4O4H E;  3H1I G;  3I9W A;  4TLF A;  1KB9 I;  2KYV A;  4TNV A;  4LML A;  2FYU G;  3RHW A;  1FS0 E;  2LLY A;  1HGV A;  3CX8 B;  1U5P A;  4DV3 T;  3AED A;  1HNW T;  1J1D B;  3KYQ A;  4BRY A;  3K3O A;  1BE3 D;  1SQB K;  1KB9 D;  2X9X A;  2X0H A;  2ZM6 T;  3M06 A;  1DIP A;  3NTN A;  5FXX A;  1VDF A;  4PJ0 E;  2CE7 A;  1IK9 A;  3AEA A;  3OVU A;  2H7H A;  1L4A C;  2GA1 A;  2Z5I A;  3GHG B;  1JY3 P;  2P9B A;  3HKC E;  1IFJ A;  3P4Q A;  3P4S A;  3MA9 A;  1SQX K;  4M3L A;  3AE9 C;  2BZB A;  1Y8A A;  1S35 A;  1VQ6 P;  3JAE A;  2MOZ A;  1DD3 A;  2IYP A;  2JR8 A;  2KUB A;  2ZJS E;  4NPE A;  3ZJ2 A;  3GLM A;  3CWB D;  3AEB A;  3AB3 B;  2FYU J;  3G3Z A;  3L36 A;  2KND A;  1NTZ E;  2N1T B;  1L0N D;  3KV6 A;  1YJW P;  3AE6 A;  2WZH A;  4IL6 X;  4DBR A;  3SWK A;  3RIF A;  3C9I A;  5FL1 A;  4CPG A;  2VL8 A;  2WQY A;  3LID A;  2BKN A;  3SWY A;  5JDM A;  2KZ7 B;  5JQG E;  3L72 G;  1PIX A;  5TIS E;  4IE6 A;  3AE5 A;  2NRG A;  5ABF B;  1OED C;  4GK5 E;  2ZLY A;  4HFD A;  3Q5D A;  1E1H B;  3UFE A;  5HXS A;  5JR9 B;  2N2N A;  1MMG A;  2X0L B;  5F8P A;  4TV9 E;  3L39 A;  3OKQ A;  5FP3 A;  4IFM A;  3TGU D;  1SQV J;  2BCC E;  2FBW A;  1XNQ T;  1U7J A;  5H2F E;  3T97 B;  4JEH B;  4QMA A;  3TLT A;  2NPS A;  1IAP A;  5J2U E;  1MZ9 A;  3NWI A;  3H1L J;  2KNC B;  2IC9 A;  5F3J A;  2W83 C;  4RES B;  5AQU B;  2LE8 A;  4E7Z A;  5EK2 A;  2XQ9 A;  4U7Y A;  3WMM 0;  2WDQ A;  4JI3 T;  4DMV A;  5AW6 B;  1NAY A;  3KV9 A;  3GHG C;  3CCV P;  1RE3 C;  2E9X B;  4NPD A;  3PUX F;  2PBI A;  1QUU A;  3EHZ A;  1NYH A;  3H3A A;  3D6Y A;  5DJT B;  3LBX A;  4JEU B;  3CKD A;  1SFC A;  1EZV E;  1UUS A;  1S4X A;  1D1A A;  2E9X D;  4GKK T;  1GTW A;  3LW5 J;  1ZHC A;  2PGD A;  2EHO A;  3HRN A;  2R3S A;  3D71 A;  1RF1 A;  3CCR P;  1ZME C;  3R84 B;  3T8O A;  4EAH A;  3PV0 F;  1S5L X;  3RQU A;  2L91 A;  2R6G F;  1EXJ A;  2DWG A;  5AW1 B;  2LKG A;  4QXC B;  1NTZ G;  3LG7 A;  2W90 A;  1YJN P;  1SQV D;  3MGN A;  3G06 A;  1AJ3 A;  3ESL A;  3B5N D;  3UT5 E;  3U1C A;  2ODV A;  4DBQ A;  4AQG A;  2FKW B;  3ETU A;  5L2L A;  3H1H E;  2JO1 A;  1UGO A;  1A02 F;  3O4X E;  1KIL C;  2OAR A;  3PJA A;  1QLB A;  2WSS V;  4ILB A;  3QWO C;  5BU5 A;  4I1L A;  2R32 A;  4PAG A;  4Y99 C;  4QH5 A;  5L3F B;  4C7N A;  4H9P C;  4ZS2 A;  2IDO B;  3H1J E;  1BR0 A;  4DVD A;  1VQ7 P;  2B9B A;  1HVV A;  3QH9 A;  5FXW A;  2Y0D A;  2JJL A;  1GQE A;  2LKH A;  3CWB G;  3O9X A;  3L75 E;  5KLV J;  1VPC A;  2ZT9 C;  1ZP0 A;  1ZN5 A;  3ZLI A;  1PPJ E;  3NMD A;  3KBT A;  2WVR A;  3J9X 1;  1HH0 A;  2HLO A;  4KP3 C;  2FXM A;  5JR9 C;  1SQQ G;  4K0U A;  5LJM A;  3H1I J;  3GWH A;  3BQK A;  2ITA A;  3PHL A;  2PJQ A;  1D0Z A;  4HB1 A;  2DL1 A;  3AAE B;  3A2A A;  3OA7 A;  1KFY A;  2MPK A;  2XQ7 A;  1US7 B;  4H13 C;  4UB6 E;  1SQB E;  4CI3 B;  1QVG O;  4MAL A;  4HFH A;  1JTH A;  1CW5 A;  2IFN A;  1SQX G;  1ZR2 A;  2JEE A;  3AEE C;  5E79 E;  2FY8 A;  1S2E A;  3F89 A;  2WMO A;  3F57 A;  2XQ5 A;  4AKG A;  4WBA A;  1UIX A;  1D7M A;  4GKG A;  2NOX A;  4ZI3 D;  3CWZ B;  3PU3 A;  5F5W A;  2V7Q H;  1HS7 A;  4WBO A;  2Q9Q D;  1Q81 Q;  5AQL B;  3L3P A;  4DUZ T;  3H32 A;  3P4P A;  1DD4 A;  1HGZ A;  2QM7 A;  4L5G A;  3AED C;  5LYJ E;  2FBW C;  2CMR A;  3KVB A;  5BU8 B;  2Z5H A;  2HH7 A;  3CC4 P;  3P4R A;  4WBN E;  3O6Q B;  2KLV A;  3H1K D;  2QJY B;  2CLY B;  5FYM A;  2QIW A;  3Q5E A;  1M8O B;  2LKM A;  4DO0 A;  3HD7 B;  2NZ2 A;  1H88 A;  3EDU A;  1ZR4 A;  2XZR A;  3VRA A;  4DR2 T;  2AXC A;  1KZU B;  1IZN B;  5AQH B;  1SQB D;  2LOS A;  4AIU A;  1T2K C;  5J1G A;  2D2C D;  3TGU E;  3WU2 H;  1FMW A;  3LK2 B;  1HFA A;  3QC9 A;  1VQM P;  2Y9Y A;  3BQI A;  5KXJ A;  4BAY B;  4H0L C;  5B66 E;  4B3M T;  2CA5 A;  3UU8 A;  2CHN A;  3ZN1 B;  3AEB C;  2BAS A;  4FJO A;  4K0K T;  2HG5 D;  4Z8X A;  2ZM2 A;  2C5K T;  4YJ2 E;  4AKR B;  4GOU A;  3M3Z B;  1W2E A;  3AE6 C;  5AW5 B;  3RYF E;  5A1L A;  1FE6 A;  4HH2 A;  3PP5 A;  5APV A;  2JQQ A;  2CEA A;  1KYO H;  1H0T A;  3VKH A;  2FYN C;  3JSV C;  3FZH B;  2F4V T;  4PNI A;  5GTI H;  4JI4 T;  3Q5P A;  5JDF A;  1M1J C;  2WWV A;  2UXN B;  4L73 A;  4ZXL A;  4H9Q C;  4LF9 T;  3GN5 A;  4TZ4 C;  1BCC G;  3CWB E;  2XM1 A;  4OH8 B;  2CHO A;  3E1R A;  3HI2 A;  3KHU A;  1GK4 A;  1URQ D;  3PLN A;  3CX7 B;  4DZO A;  1JNM A;  1UII A;  2YKQ A;  1Z56 A;  1WYC A;  3WU2 E;  5JRC B;  4V1A v;  4CXW A;  5HCJ A;  1T3U A;  5LG4 A;  4A7P A;  2KLU A;  1G73 A;  4CXY A;  3QOF A;  4ZMD A;  1VF5 C;  1SQX J;  2NR4 A;  4HKA A;  1W09 A;  3CQX C;  2N1T C;  2QVA A;  3EQ2 A;  3PU8 A;  1OXZ A;  3N9Q A;  2V5C A;  2I1K A;  4JQ0 D;  1D0X A;  2WZI A;  1L0N G;  4I7Z B;  2BEZ F;  2WPS A;  4IL4 A;  1KNP A;  4DND A;  4ZI2 D;  1HX8 A;  4LMJ A;  5LOV E;  5JDQ A;  3L73 E;  1M1J A;  2Q9Q A;  5AQK B;  2BS4 A;  2WBL A;  1N7S C;  2FFD C;  3L75 D;  5LXT E;  4O9B A;  1VCS A;  1T3J A;  1KOR A;  4I50 E;  1FZA A;  3Q2Y A;  4YLH A;  1URQ B;  2XAJ B;  2LM9 A;  5AQJ B;  5ADX L;  4B86 A;  3TK1 A;  3L35 A;  2Y48 B;  1IFP A;  1OVU A;  3CVR A;  5BVZ A;  2QE7 H;  4CI2 B;  4PK4 A;  3OJA A;  4QXB B;  2GM4 A;  3L71 J;  1KFN A;  3UQ4 A;  4K35 A;  4MBQ A;  3VYI A;  4X66 T;  1FJG T;  1VQO P;  4GYR A;  2C9L Y;  1RE4 A;  1X79 A;  1ZKE A;  4PV1 D;  2K5B B;  5AVT B;  2E42 A;  1QSD A;  2VUR A;  3LW5 H;  1FZF A;  3BK9 A;  4U2Y A;  3A0B H;  3A3Y B;  4DV2 T;  5KLV K;  1N7S D;  2V7L A;  1E79 H;  5DQV A;  5KDM C;  3RGL A;  3L70 J;  4GOF A;  2QG4 A;  3K8P C;  5TIS H;  1BSH A;  2D2C C;  5CCG D;  1AQ5 A;  1YBK A;  2IX7 C;  2C5I T;  2BVL A;  3CXH H;  2QA7 A;  2WMN A;  1I94 T;  3N2O A;  4EI2 A;  1P84 E;  4WB4 A;  2P58 A;  1MUU A;  3N9O A;  2V7Q J;  1ZXG A;  5AQP B;  5AQF B;  4IRE A;  4WY4 C;  4XA4 A;  4DID B;  4M1P A;  1FZG A;  4K3A A;  2I8D A;  4GYS A;  3N2K E;  4TUY E;  1GDT A;  3I9Y A;  3USS A;  5AW4 B;  1VRB A;  3ZJ1 A;  1LTG C;  5KLI B;  1WYB A;  1YXR A;  5CJ4 A;  2OTK E;  5LMN T;  1NU1 E;  3M9Q A;  4W7Z A;  3F5H A;  3BRT B;  3I0O A;  1YKH B;  1O3X A;  2E9X C;  1PZQ A;  3CQC B;  4UVA B;  4JI1 T;  2RMZ A;  2WTY A;  3AEE A;  2NW7 A;  3EDV A;  3MK7 C;  4YSY A;  4D6T J;  4YHJ A;  4H13 D;  1LRZ A;  1GL2 D;  2H3R A;  2ZYA A;  2IW5 B;  1M57 D;  2LSI A;  1KIL E;  2J58 A;  2MAW A;  4B3R T;  4UF0 A;  5H6Q B;  1SFC D;  3HTK B;  1HF8 A;  2V1D B;  3PE0 A;  4PJ0 H;  3VTP C;  4WNK A;  4EXT A;  3PUQ A;  5KTB A;  2HPJ A;  4U2Z A;  1T8Z A;  2V26 A;  1LTT C;  3B5M A;  3RKG A;  3RIA A;  3RK3 E;  2HPC A;  3BCC D;  3EUH A;  5APU A;  4OFZ A;  1VQK P;  3A8Y C;  2FUP A;  4FI5 A;  3V2R A;  2XAS B;  4W7Y A;  2KS1 B;  3Q3D A;  1ZRT E;  2SPZ A;  2ES0 A;  1IK7 A;  1LJ2 A;  3H1H J;  3P7K A;  3PUS A;  3BCC G;  3AE4 C;  3MP7 B;  3MUD A;  1VQL P;  2SPC A;  3GHG A;  1LTJ C;  4PD4 I;  5EK4 A;  4U3F E;  2CPT A;  1FZC B;  2A06 D;  3H1J J;  3GMI A;  1JY3 N;  1BE3 E;  1L0N K;  1WT6 A;  3RK3 D;  4QKN A;  1KIL B;  2FYZ A;  4LF8 T;  4ADZ A;  1JY3 O;  3H1L G;  4PD4 D;  1GL2 C;  2L3L A;  1YTZ I;  5AVS B;  2W63 A;  4XE5 B;  1VQ4 P;  3CWB J;  1DU2 A;  2ZVO B;  2N1T A;  1JM0 A;  1NGM B;  2YO2 A;  2Y6X A;  2DW3 A;  4OK0 A;  1QL2 A;  3LDQ B;  2IBZ I;  1SQP G;  3HE5 B;  1JNR A;  2A2F X;  1KB9 E;  4EGW A;  2J59 M;  5AW8 B;  3FZF B;  3FWN A;  4ERR A;  1E7P A;  5AFU L;  4O2A E;  1LWU C;  5FKY A;  2YDS A;  2CXF A;  2Q5U A;  5FVK A;  3SFD A;  2OLT A;  2YIU B;  2YMK A;  5ABF A;  1SQX E;  4PK5 A;  1IBM T;  1AFO A;  3RK3 C;  2W6A A;  4IL6 H;  2E5V A;  4KUM B;  4CZZ B;  3RK3 B;  2Y9Z A;  2OYI C;  5AW3 B;  2DNX A;  1W5C E;  2N1G A;  3U3I A;  2WSS H;  4IL9 A;  2PFV A;  1KQG B;  4A5X A;  1S94 A;  4OHF A;  4DV0 T;  2Q3I A;  2QJP B;  3ANW A;  1OX3 A;  4TT3 H;  5TJH A;  3TSI A;  4Y28 J;  3T97 A;  2UWJ E;  1GW4 A;  1N73 C;  3E22 E;  3L70 G;  2KSJ A;  3K3N A;  3U1A A;  1E5W A;  3EWK A;  3O8Z A;  3B8E B;  2QSI A;  1SQB J;  1R5L A;  1U7M A;  1IJD B;  4X20 E;  1P84 I;  2YDR A;  1NTK J;  2Q9I A;  2H89 C;  2DLR A;  3VHL A;  4DV4 T;  1N8R Q;  3ZPO A;  2E9X A;  1PL5 A;  3PUA A;  4YJ3 E;  2FYU D;  2CWY A;  4A56 A;  4HE8 A;  4E7S A;  5AVY B;  1LTB C;  2L9Q A;  2W66 A;  3KIN B;  2W67 A;  1UX5 A;  4NXM T;  1LT9 B;  1IFI A;  1RF1 B;  5HXR A;  4H13 B;  4N6J A;  3L75 G;  3ZKR A;  5LGN B;  3VKG A;  4PJJ A;  2XQ8 A;  3L74 G;  3EFF K;  3K5B A;  5APQ A;  2IBZ G;  5LBM A;  1SQQ D;  1NWM X;  3Q1M A;  1HG2 A;  3P32 A;  3FXE A;  2NPS C;  1N86 A;  1L0L G;  5GTH E;  2BG9 A;  3MAC A;  2B87 B;  4YTN A;  4A98 A;  5K5G B;  2W27 A;  1W2B O;  1NU1 G;  3AE2 C;  2XPK A;  5CA1 E;  5KJ7 C;  3CPZ A;  2YO3 A;  4EED A;  3X1D A;  2ZM0 A;  3AA6 B;  1EZV G;  2ZM8 A;  4KT0 J;  3Q5X A;  3UU5 A;  4YPC A;  1LTJ A;  3SS1 A;  3L37 A;  1X9B A;  3U78 A;  2VKJ A;  3NVO A;  5CGM A;  3T1Y T;  1R8I A;  3U59 A;  1IO4 A;  1LTS C;  2PG8 A;  5AQV B;  4EOT A;  1SP4 A;  1PFI A;  2H8P D;  4ISS A;  1QX8 A;  1VF5 B;  2KK7 A;  2BKP A;  3V4W A;  1YQ4 A;  3LIE A;  5L3B B;  4PV1 B;  4DR7 T;  2YMY A;  3VMA A;  3IR9 A;  3F2E A;  2WSF H;  1VOM A;  5ABH A;  4X62 T;  3SFE C;  2G0U A;  3HR0 A;  2PP6 A;  1L0V A;  2WU5 A;  3RPU A;  3CXH D;  2ACX A;  2WT7 B;  4H0L D;  4ZKU A;  2NWB A;  1IFN A;  3G71 P;  3MZW B;  1ZEE A;  1G2C A;  3UUX B;  1JB0 J;  4ZI7 E;  1SQP E;  2LXC B;  4HFE A;  4COF A;  4ILU A;  4OGQ B;  3EFG A;  1KQS O;  2M6I A;  4EB6 E;  4EYY R;  2YKO A;  3OW2 O;  1JUN A;  2E75 C;  2ZAE B;  2XDJ A;  1YHQ P;  2JJ9 A;  4IIJ E;  4AKL A;  4HFI A;  3RYI E;  1M7K A;  3RX6 A;  2FJB A;  1XNR T;  3P4W A;  1R5S A;  4I6M C;  3S4R A;  4O4I E;  5KLV D;  1SLQ A;  1L0N E;  4YTP C;  4BXL A;  4YXD C;  2UXD T;  1MMN A;  1USE A;  2VB6 A;  4U74 A;  3L72 E;  4OGQ D;  3H1K G;  2A72 A;  1KNZ A;  3OYX A;  2N9B A;  2NTY A;  3JCF A;  5JRE A;  1XTC C;  2H88 C;  3N4X A;  1OMI A;  3TLS A;  2ODU A;  4KX6 A;  2H7O A;  1VQ9 P;  2FFD B;  3K1S A;  3IN6 A;  3CX6 B;  1OED B;  1W0A A;  3UUM A;  4C46 A;  4IE7 A;  5KAF H;  2JQH A;  2KZJ A;  2VRS A;  4O2B E;  1IFM A;  3HUS C;  3B71 A;  2X51 A;  3L71 E;  4HN9 A;  3W67 A;  2YU2 A;  3KV5 A;  1QL1 A;  5JVD E;  3G6E P;  5LHG B;  2AXD S;  4TNW A;  4EZ4 A;  1HUC A;  1YQ3 C;  3L70 E;  1FBM A;  1MMD A;  3GMA A;  2H7V C;  3RQW A;  4ILC A;  1NAF A;  2A06 E;  1JCC A;  2QRX A;  2GK9 A;  2FYU E;  3SWF A;  2E5T A;  4NPF X;  3SRZ A;  1HJ0 A;  5HEG A;  4ASK A;  1GMJ A;  4HEA A;  1JY2 O;  2QGS A;  1EDI A;  3ZMZ B;  1LP1 B;  4YSX A;  2FXP A;  3JC2 2;  2OYO A;  3RKO A;  2HFE D;  4L74 A;  2L8K A;  5C2T A;  4I4T E;  2OTJ P;  3C4X A;  3ZDM A;  3ONJ A;  4I43 B;  5C8Y E;  1HBW A;  4ASV A;  3HA4 A;  3Q2M A;  3H1I E;  2YNY A;  1IC2 A;  2XHE B;  3PJS K;  3KZI E;  2IUB A;  3H1H D;  2V7J A;  2V6Y B;  3FZK B;  2QEX P;  2NP9 A;  2K48 A;  3V5U A;  1IFD A;  3W68 A;  4P0B A;  4TN7 B;  1KQF B;  2Y8D A;  1XZY A;  3D0T A;  2MYS A;  2M3B A;  5JDG A;  1JY2 N;  4ZI3 C;  3EVY A;  4TX5 A;  2ZXX A;  4LF6 T;  2WWU A;  2LT3 A;  4LGD E;  1BDD A;  3GG2 A;  2HR3 A;  1T98 A;  2BKO A;  2IHR 1;  1FC2 C;  3ABV C;  1U4Q A;  1QEX A;  1LKX A;  4XBF B;  4DT0 A;  2Q9Q B;  2KWI B;  1WMK A;  2VK9 A;  4UR9 A;  1GL2 A;  5APX A;  2AEJ A;  4EIW A;  1OVR A;  2WSC J;  3L09 A;  2V7M A;  4NUV A;  2E5Y A;  1RF0 A;  2OYH C;  4AXP A;  1PV3 A;  1W0B A;  2UXX B;  5HEH A;  3HD7 C;  2KSE A;  3AE1 C;  2XNX A;  3H3M A;  4IE5 A;  3CCJ P;  2E76 D;  4YHH T;  3II6 A;  3TNU A;  2UUA T;  4U7J A;  2KP8 A;  1M62 A;  1P84 D;  2W2U A;  4IDP A;  4B3S T;  4JYB A;  1RE4 C;  2L5G B;  1N73 A;  1S5L E;  3VMZ A;  1D0Y A;  3LFM A;  4UVB B;  1WCR A;  5L3E B;  3AE2 A;  1Y64 B;  2P67 A;  4A97 A;  3JCU E;  5LJN A;  3PDY A;  1M7L A;  1DX7 A;  1L0L E;  1OFC X;  1N2D C;  2YXQ B;  5KAF E;  5BR8 T;  4AIS A;  3WAJ A;  2H88 A;  5CHX A;  3AVS A;  1LNQ A;  2OA5 A;  3H1L D;  2C9N Y;  2A45 I;  1J5W A;  3C8V A;  3CD6 P;  1A02 J;  3AXJ B;  3B5N C;  3BQL A;  1N7S A;  1SQP K;  1S9K D;  3N2G E;  3KXD A;  2D5U A;  3JC6 D;  4LFA T;  1K05 A;  5FXV A;  2IC6 A;  5CCH C;  4AUW A;  2FXO A;  1IBL T;  3H1J G;  1JEK A;  1T6A A;  1PP9 G;  3IF4 A;  3VP9 A;  1MNE A;  5AQS B;  3HKB E;  3L72 D;  4L76 A;  3KBU A;  1BCC J;  1L0N J;  3P8C E;  2DWK A;  2XQ6 A;  1XMO T;  3IBP A;  1KFM A;  3L72 J;  4HKZ H;  2ACZ A;  3V6I A;  3KDS E;  2KIK A;  2ZT9 B;  3EAB A;  3FXD A;  3H1K E;  1URQ C;  2KB7 P;  1J2J B;  2NPS B;  5GTI E;  2XSA A;  4UB8 E;  2KNC A;  1M90 Q;  3V2Q A;  1FDI A;  2LRL A;  4G2A A;  1KK7 A;  1KNR A;  5KX5 E;  3VN0 A;  3BAT A;  1HG5 A;  2W61 A;  3LJC A;  3N9M A;  4MLK A;  3M9H A;  4HWI B;  4EZH A;  3A0H E;  3GA8 A;  2CBI A;  3P50 A;  1SQQ J;  3GF3 A;  2JRK A;  1FZB A;  2OYI A;  1XMQ T;  1HTL C;  2RPA A;  1J1E B;  3ZC0 A;  3HTK A;  3ZMV B;  2RA1 A;  3L70 D;  1NU1 D;  2ZT9 D;  4HFB A;  3AAI A;  1R8E A;  3ZMU B;  3ZCI A;  5IYZ E;  1VQN P;  1SFC B;  3CXH I;  2LSK A;  3BVH A;  3FWL A;  3RL0 B;  1RH5 B;  2HPC B;  2XKM A;  3ONL C;  4U3F G;  4H63 H;  2A3D A;  3UFG A;  4JYC A;  5DJQ C;  2KS1 A;  3M0A A;  1EDK A;  3JAF A;  1ZOY C;  2K9Y A;  3PRJ A;  3CMA P;  4H9O C;  2LEH A;  3IF8 B;  5E0O A;  2Z4E A;  3QB5 K;  3SFE A;  5IUX A;  1Y47 A;  3RC3 A;  1BCC D;  1FJK A;  1FEW A;  3E1I A;  2W0G A;  2R5D A;  5L4H A;  4QX7 B;  1FZC A;  3KV4 A;  4TWF A;  1L4A B;  3AE7 C;  3H1I D;  1KYO D;  1NEK A;  2IBZ D;  1RY3 A;  1I6Z A;  1D1B A;  4UB8 H;  2K9A A;  2WY2 A;  2MTQ A;  1GU4 A;  3IA3 A;  2JP3 A;  2WP9 A;  1N33 T;  1KEY A;  4IE0 A;  5FY7 A;  2N1T D;  2VAS A;  5CBO A;  1JNZ A;  2V7K A;  5CJ0 A;  1J1D C;  4HWH A;  4WWI A;  4O4J E;  1Y9B A;  2K9J A;  4LLH A;  4EIJ A;  3RI5 A;  2X0Y A;  1LWU B;  3KDP B;  5L4E A;  2XSB A;  1BGY G;  3N9P A;  4P09 A;  1EZV D;  1NU1 J;  3SOL A;  1CUN A;  3TF5 A;  1ZRT D;  1PGP A;  3CCM P;  4HFC A;  4LF7 T;  1H7C A;  1QLE D;  2YKP A;  1WRG A;  2E75 B;  2HYN A;  1EDL A;  1L0L K;  4JBZ A;  3AEG A;  3MKD A;  1SQP J;  2C0W A;  1RF0 C;  4OVN F;  1BE3 J;  4GT1 A;  4OWF A;  3NZP A;  1BCC E;  2M67 A;  4U3F D;  2PAJ A;  3WI3 A;  4ZHQ E;  3HKE E;  1AVO A;  1YJ9 P;  1K9M Q;  5KLV G;  2ZXE B;  2V8S V;  1JTH B;  1FZC C;  3B13 A;  4EYU A;  1KYO E;  3KQG A;  4YXD A;  2W6B A;  1FDM A;  4YTP A;  2D0U A;  3A7M A;  2K37 A;  2HOD B;  4JI7 T;  4X1I E;  1K8A Q;  3T1H T;  2JQK A;  2XTL A;  4AQF A;  4ASW A;  5AQG B;  1G1I A;  2ZYG A;  1S72 P;  2E74 D;  2N9Y B;  1NH4 A;  3H1H G;  4AI6 A;  2XND H;  1SFC C;  3PJA J;  3WUU A;  5DQW A;  4GOE A;  1H8A A;  2OV9 A;  2CPB A;  3O1J A;  2G3A A;  3RIU C;  2E43 A;  3AE7 A;  4P0A A;  3QB5 A;  1KV4 A;  5J2T E;  2IDB A;  2K24 A;  4H9S E;  1MND A;  1JMM A;  3TGU G;  3ZN0 B;  4JF7 A;  5HXH A;  3L4F A;  3HD7 A;  5FVL A;  3ZSS A;  5CA0 E;  3Q5S A;  2AE9 A;  4MFR A;  3L73 J;  4HYT B;  3DTO A;  3D6Z A;  2V7I A;  4RO0 A;  3CCL P;  3MTU E;  2LXB A;  2B87 A;  3KZI H;  2IPP A;  3M91 A;  3ZYM A;  4WY4 D;  1Q90 D;  4DR4 T;  2K3W A;  1VF5 D;  3H1K J;  1Y01 A;  2E75 D;  3R2P A;  3SSU A;  4CN6 A;  1LT9 C;  3NRX A;  1FMV A;  4DV7 T;  5C3J A;  2WSC H;  5APT A;  2DCF A;  1X22 A;  2FYU K;  4L75 A;  3CI9 A;  1VQ5 P;  4XFJ A;  2LOP A;  3UU4 A;  5LBQ B;  1NTM J;  2E74 C;  3M65 A;  1H0T B;  3AEF C;  5HEJ A;  1SE7 A;  5J0Z A;  2Y0C A;  3QUJ A;  2X9W A;  5AVR B;  2WPR A;  3G9R A;  2CK3 H;  2BBH A;  5JR9 A;  1AQT A;  4XAX B;  4GIW A;  3OBV E;  5HCM A;  2XUE A;  1J1J A;  3UU3 A;  1HR0 T;  1VQP P;  4EDF A;  2XJ7 A;  2AEM A;  4GKJ T;  5ABE A;  1WLX A;  5KKZ B;  3ZMT B;  1MMA A;  3QK6 A;  2IZ0 A;  1GU5 A;  4KHP T;  4I55 E;  4W80 A;  3V5B A;  3BCC E;  4LF5 T;  3NRY A;  1EXI A;  5CJ5 A;  1BSN A;  1NTK E;  5JRC A;  4ZEY A;  2WT7 A;  3CX5 D;  4JI8 T;  1LGH B;  2XU6 A;  5EZY E;  4GOD A;  4UIG A;  2BS3 A;  5LCY A;  4JI6 T;  1HWT C;  3UUN A;  1M56 D;  1IJ5 A;  4CQI A;  3AEG C;  3L71 D;  4UV9 B;  1Q86 Q;  1OW7 A;  2M8R A;  5JDN A;  4DV5 T;  3GW6 A;  1NTZ J;  2W8Z A;  2A06 G;  3CLQ A;  3CX5 I;  1J5E T;  3TLW A;  2DHR A;  4ZZC A;  4DR6 T;  3C1L A;  2YK0 A;  1FZE A;  2M0B A;  2WU2 A;  4CI1 B;  1KN7 A;  2WZ7 A;  1SUM B;  2KLQ A;  4PD4 E;  1MFT A;  1KD1 Q;  2J5U A;  1LTI C;  3MD0 A;  2X66 A;  1GZL A;  4JBW F;  5HEU A;  2CCQ A;  1KQL A;  4AQR D;  4KHX A;  4IFF A;  1MV8 A;  3CXH E;  2H89 A;  3M0D A;  3CC7 P;  5CCG C;  2WWW A;  1LVK A;  3AE3 A;  2LJL A;  3AE9 A;  3CK6 A;  1SHZ C;  3RK2 D;  3AEC A;  2CM0 A;  1NKN A;  3C98 B;  4H9N C;  4H44 D;  1NHL A;  2FFD A;  3HUS B;  4GDO A;  2E8I A;  4IST A;  3O1I A;  2GUV A;  3PUG A;  5EK3 A;  3P7I A;  5L3G B;  3MZK B;  3UTK A;  2JMK A;  2UXC T;  4JPZ B;  3FB2 A;  1KF6 A;  2O01 H;  2W6J H;  4AYC A;  4DJG A;  1AV1 A;  1SQQ K;  4OX9 T;  4LMK A;  3LK3 B;  4QHO A;  4IL6 E;  2I0M A;  4PJN A;  3WAK A;  5AVW B;  2K88 A;  3UIA A;  3A0H H;  3L73 G;  4Z1M H;  4X5T A;  1SQB G;  2M5A B;  2M6B A;  1N36 T;  2VVN A;  4YFS A;  1XTG B;  5JDH A;  5ETW A;  4R4L A;  5AQR B;  4TWH A;  3B5N B;  4ANJ A;  1SQQ E;  1BDC A;  5BMV E;  4YT0 A;  4C7R A;  3ZT6 A;  3Q9D A;  5JTG A;  2E76 B;  2WM9 A;  3CME P;  2BVM A;  1BR1 A;  2WCA A;  4X65 T;  3HE4 B;  4OGQ C;  4Z91 A;  4ZKP A;  1XWM A;  5HWY A;  4AKI A;  5M4Y A;  4EOZ B;  3PTZ A;  4IDZ A;  1LTA C;  1NTM G;  5B5E H;  2RH0 A;  2YIU C;  2YIN A;  3ZMS B;  2XV5 A;  4HWC A;  5JH7 E;  4DUY T;  3JC6 C;  4NUU A;  4AQF C;  4UEL A;  3NFQ A;  3RF1 A;  1YIT P;  3AA1 B;  2HHH T;  1PP9 E;  5KLI C;  2NPS D;  3CCS P;  3RLF F;  1YI2 P;  1E2A A;  3TYY A;  2WSF J;  1L0L J;  3Q5R A;  2I1J A;  2GUS A;  3O6Q A;  2R5B A;  1OW8 A;  2P7J A;  2P1J A;  2XAG B;  5M1B A;  2KI7 B;  2PRR A;  4IDQ A;  5CBN A;  3MXZ A;  2BEQ D;  4U72 A;  4ZNC A;  3S9O A;  3NZQ A;  5LNK A;  2VL0 A;  1D1C A;  2WMM A;  3N5L A;  2LR2 A;  4D6T D;  4EYY Q;  1GL2 B;  2JPF A;  1J1E C;  1PP9 J;  2WB5 A;  5AVQ B;  2YEV C;  1YQ3 A;  2VWA A;  4Q25 A;  2W00 A;  1PP9 D;  3FZL B;  3O1H A;  5CB4 E;  3TLU A;  4OYJ A;  3ZT5 A;  1VQ8 P;  1NTM E;  1OWA A;  5CMZ A;  1NWQ A;  1HTJ F;  3L74 E;  5APS A;  2Q1K A;  3FBL A;  3BCC J;  5APY A;  3AA0 B;  5H6R B;  1KIL A;  2IZ1 A;  3RGU A;  3CML A;  2ZFC A;  3P8C D;  3BRV B;  2E5L T;  3MHV A;  3RC8 A;  1KIL D;  3JAD A;  4LFB T;  3A7O A;  4H44 B;  2LSY A;  3R6N A;  1NJI Q;  2KIN B;  3IEE A;  1M1K Q;  3KFW X;  1CI6 B;  1X0T A;  3HE5 A;  1IJ6 A;  2RN0 A;  4IFD K;  3N9N A;  3GN5 B;  4PW8 A;  5LHH B;  2O1J A;  3AXJ A;  3NKZ A;  2A45 H;  1N7S B;  3PUZ F;  4WY4 A;  5B5E E;  1HCI A;  4D6T E;  1DH3 A;  3ONX A;  4N78 E;  2JQ9 A;  1JO5 A;  3V5S A;  2OYH A;  2R44 A;  2ZVN B;  3HKD E;  1HNZ T;  5L3C B;  3V2N A;  1EZ3 A;  1BGY D;  2WS3 A;  4ZOL E;  4PK6 A;  4CN1 A;  5HAX A;  1SQV E;  1SVF A;  2BCC J;  2IML A;  3UQ7 A;  4BJM A;  2WSE J;  2EHO D;  5HYA A;  5FMN A;  2KXP B;  1KTM A;  3NXS A;  3CL3 D;  3I55 P;  4GIF A;  1AVY A;  4B3T T;  3FXD B;  2B89 A;  3PUY F;  1JCD A;  2W4X A;  1K73 Q;  4F6R C;  5AW0 B;  2X9Y A;  2XQA A;  3RRW A;  4QXH B;  3KPE A;  4C91 A;  1BE3 G;  2QA4 P;  1PGJ A;  4BRY B;  4HTE A;  4ZS3 A;  2G8Y A;  1UK5 A;  1M1J B;  2WPQ A;  2XQY A;  2OYI B;  2WQY C;  3TGU J;  1Q2N A;  2VKD A;  3ZYL A;  3VRB A;  5LGT B;  3IAO A;  3E08 A;  5KJ7 A;  2WAU A;  2Z6E A;  4UVC B;  2E76 C;  4JI0 T;  4IDN A;  4DMW A;  3ZST A;  4TV8 E;  5LG3 A;  1LVF A;  2N9D A;  2K1A A;  3OJA B;  1U57 A;  2FJA A;  3VR8 A;  1LT9 A;  3E7K A;  3RK2 C;  1V9D A;  4JI5 T;  1KYO I;  3CX5 H;  4LF4 T;  4H0L B;  2LM2 A;  3KVA A;  1YKE B;  5JDL A;  3WUV A;  4NXN T;  3RRC A;  2EHO C;  2QJP C;  2BG9 B;  4MHC A;  1EQ7 A;  5KLV E;  3L75 J;  1FOS F;  4O4L E;  3UU6 A;  5EFW B;  1NO4 A;  5AVV B;  4XZC A;  4AQY T;  4DV1 T;  2XAQ B;  1RQV A;  1B7T A;  1FIO A;  5KMG P;  3N7N A;  3J7Y q;  3C51 A;  2XAH B;  1LTJ B;  2NW8 A;  1HNX T;  2KSR A;  4X1K E;  2K9J B;  3F31 A;  3D70 A;  1LWU A;  1MFZ A;  2QJK C;  2WDR A;  3AAA B;  3S4U A;  1NTK K;  1UCU A;  4GK0 E;  2YDQ A;  3V2P A;  1VL2 A;  4ILA A;  2KOG A;  1EC5 A;  1ZV8 A;  1P84 H;  3OPC A;  1NU1 K;  3K3Q C;  4IDO A;  3A0B E;  4Z90 A;  3ZYK A;  3VOP A;  1SA0 E;  4KHZ F;  4KMC A;  2QYW A;  2BG9 E;  5DJU B;  2O3J A;  4PJL A;  5AW9 B;  5LB7 B;  2QJK B;  3AEF A;  1K04 A;  1YTZ T;  2YN6 A;  1OIP A;  4DCK A;  2MBG A;  2NTX A;  2XY8 B;  2IFM A;  4CN4 A;  2E2A A;  5TAO A;  5FNV E;  5CCH A;  2O01 J;  5HXE A;  2J47 A;  1ZW0 A;  5CFB A;  1DEE G;  3HD7 D;  4ZZB A;  1G2C B;  3SWH A;  4UF0 B;  1CHU A;  4DR5 T;  4KI0 F;  2V6X A;  2YOE A;  4QX8 B;  3AE4 A;  1S3J A;  2AXT H;  2HOD A;  4PJM A;  1DEB A;  1XDP A;  5AQI B;  3LBX B;  3MJX A;  3M0D C;  3A5X A;  1T7S A;  2VQF T;  4EEB A;  4H44 C;  2IAK A;  5H2F H;  2EHO B;  1BR2 A;  4BJN A;  3N9L A;  3L74 D;  3C64 A;  4PFP A;  3ABV A;  1NKZ B;  4KJM A;  1CZQ A;  1YW0 A;  2I6H A;  3Q5W A;  2RKL A;  4QH1 A;  3FGA D;  4HWD A;  1Q82 Q;  5HXC A;  3L74 J;  4Y99 B;  2X68 A;  5AQM B;  4HWF A;  2OQQ A;  3CCU P;  3PUW F;  5KKZ C;  3TDK A;  1TU3 F;  1KB9 H;  2VKH A;  4LC1 A;  2IIU A;  1OED E;  3PH0 A;  2BDE A;  3QNU A;  3AE1 A;  1T8B A;  4HFV A;  1KC8 Q;  4UEM A;  2POH A;  3RBX A;  1X8Y A;  5AW2 B;  3B57 A;  4O8S A;  1S9K E;  2V4H A;  1N32 T;  1MKM A;  4L9I A;  2BBJ A;  4DR3 T;  3L73 D;  1GD2 E;  4TWD A;  5L47 A;  3UUL A;  3EI0 A;  1OED A;  3SFD C;  2CXD A;  4PD4 H;  1WR0 A;  4U33 A;  4C7N B;  2AXT E;  2LSJ A;  1YYC A;  1HF9 A;  1ZOY A;  3A5T A;  3RBZ A;  1LT1 A;  2WSE H;  1L4A D;  2KWH A;  4PV1 C;  2VKO A;  5LHI B;  3AE3 C;  5AQO B;  4J2C A;  2AEF A;  1FOS E;  5IWA T;  2XQ3 A;  3V4Q A;  1G8X A;  3W15 B;  1MIY A;  3G4S P;  1NTM D;  2O1K A;  5L3D B;  1PGQ A;  4JV5 T;  3H6P A;  2WIT A;  3RL0 C;  4I2L C;  2M3E A;  4QWN B;  3JCU H;  3RYC E;  3LSV A;  1PPJ G;  1NTK G;  1GW3 A;  2JDI H;  2UXB T;  3RL0 D;  4DOJ A;  2D9D A;  4I0U A;  4LFC T;  2PTF A;  3ANW B;  3CC2 P;  1LP1 A;  3OAK A;  2HN1 A;  3LK4 2;  4QH4 A;  5B66 H;  4AKH A;  2B88 A;  3L8R A;  2OTL P;  4BA9 A;  1KMI Z;  1H89 A;  2CPS A;  5L8R J;  3VU7 H;  2JMH A;  3GF7 A;  3H32 B;  1NVO A;  4N78 D;  5KAI H;  4DR1 T;  2ZMA A;  4WVZ A;  3FBZ A;  2CRB A;  3C50 A;  2QM8 A;  2JIW A;  2JWD A;  2A45 G;  3S1K A;  2X67 A;  4NIQ A;  2YKS A;  5LGU B;  3M9B A;  3AE5 C;  4YY3 T;  1OVV A;  3CX5 E;  2XQ4 A;  3FX0 A;  1RHZ B;  4I7Z C;  3RYH E;  1SQX D;  1BGY E;  2J62 A;  2O01 N;  2XZE A;  5DAB A;  3DJB A;  2K3R A;  3I5C A;  2KMF A;  3FXE B;  5CCG A;  2VQE T;  3NBX X;  3CPW O;  3B4S A;  1NTK D;  3BAS A;  3TNU B;  3ZCJ A;  3VMY A;  1Z0P A;  4X64 T;  5E79 H;  3C4Z A;  4IOI H;  2R3C A;  4DV6 T;  1WRD A;  4JYA T;  1N73 B;  1WFD A;  3AE8 C;  1EDJ A;  2JKV A;  2VVS A;  2CWO A;  3DP7 A;  4IGU A;  3HUS A;  1Z8U A;  2D0T A;  2B1E A;  4YTM A;  2UUB T;  4N3Y B;  2BCC D;  4UXN B;  4U7I A;  2A9U A;  2LSG A;  3ETV A;  4WZX A;  3H25 A;  3EAM A;  1SS1 A;  5AVU B;  1AJY A;  2WPV B;  3E0Z A;  4YSZ A;  1GK6 A;  2YU1 A;  2NW9 A;  1JOC A;  1NTZ K;  4MN4 C;  1YD8 G;  2UU9 T;  1N7L A;  4R4M A;  5AQT B;  1AA0 A;  4WYV A;  2IBZ E;  1T72 A;  4L0R A;  3CIR A;  1NTZ D;  1QGK B;  1S1C X;  3TKL B;  3HL6 A;  3IHR A;  5AQN B;  3IFM A;  3PTR B;  2M5A A;  2XAF B;  4ZI2 C;  3RK2 B;  3VMX A;  4C90 A;  2D2S A;  1FJP A;  3B5N A;  5GTH H;  2WDV A;  2LHR A;  1NOH A;  4JLE A;  3C4W A;  1VCT A;  1PGO A;  1ZP0 C;  2JWA A;  1QVF O;  5FY1 A;  3VP8 A;  4NPP A;  5ABG A;  4HGA A;  2UUC T;  3AEA C;  2KT9 A;  1OW6 A;  1WR6 A;  1EZV I;  3HE4 A;  1UX4 A;  4JUY A;  5AQQ B;  5KJ7 D;  3FHN A;  5CCH D;  2HPL A;  1IBK T;  2Q3E A;  4P1N A;  2Q6Q A;  3ITK A;  2C0S A;  3CQG B;  3MUD C;  1FU1 A;  2B76 A;  4HJG H;  1ZLL A;  3WUT A;  2CXL A;  3PUV F;  1FDO A;  5LA6 E;  3ZC1 A;  1CSB A;  4RJT A;  4WW0 A;  5IHY A;  5AW7 B;  5LMU T;  3RL0 g;  2QJY C;  2CLY C;  3AEC C;  3L71 G;  3P8M C;  2J4G A;  5AVZ B;  1URQ A;  4PFO A;  1Q7Y Q;  1JY2 P;  3RIU A;  2IYO A;  3CCE P;  4IE4 A; 
#chains in the Genus database with same CATH homology
 1OVV A;  2SPZ A;  2WMM A;  1OVR A;  2LR2 A;  4EYY Q;  1EDK A;  1OVU A;  2K3R A;  3QB5 K;  3PH0 A;  1Y47 A;  4K35 A;  3FXE A;  2B87 B;  2KUB A;  5K5G B;  4NPE A;  4IOI H;  2LXB A;  2B87 A;  2KZJ A;  2Q1K A;  1EDJ A;  5EFW B;  3PJA A;  3RGU A;  1KEY A;  3QWO C;  1JM0 A;  5CBO A;  3MHV A;  1LT1 A;  1SS1 A;  4GOF A;  4WWI A;  4CPG A;  1H0T A;  1X0T A;  3AXJ B;  1H0T B;  2QRX A;  2P58 A;  4NPF X;  3AXJ A;  1ZXG A;  4MN4 C;  1JMB A;  4WYV A;  1EDL A;  1J1J A;  4JBZ A;  1EC5 A;  2M5A B;  2I8D A;  4K3A A;  1EDI A;  2R44 A;  4HB1 A;  2M5A A;  1LP1 B;  2OTK E;  1U7J A;  5DJU B;  4HKZ H;  1BDC A;  1LP1 A;  3ZDM A;  2KIK A;  4ASV A;  3FXD A;  5C39 A;  2B88 A;  2UWJ E;  3MZW B;  2KZI A;  4ZMD A;  2B89 A;  3QB5 A;  2LXC B;  1ZW0 A;  1DEE G;  4GOD A;  2QVA A;  4ZNC A;  1NVO A;  1S3J A;  2ZAE B;  1U7M A;  4HJG H;  4ASW A;  4NPD A;  5DJT B;  2JWD A;  1BDD A;  3S1K A;  2HR3 A;  1Q2N A;  3PJA J;  2M0B A;  4GOE A;  1FC2 C;  2KI7 B;  4KJM A;  5CBN A;  3RIU C;  3RIU A;  2RKL A;  1MFT A;  2KS1 B;  4BXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...