2QVAA

Crystal structure of drosophila melanogaster translin protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
182
structure length
182
Chain Sequence
b'VNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERSLNISHFIGDLNTGFRLLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GM27569p
publication title Crystal structures of Drosophila mutant translin and characterization of translin variants reveal the structural plasticity of translin proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 69
structure length 182
sequence length 182
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2qvaA02
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 2qvaA01
2HR3A 4MN4C 2LR2A 5CBNA 1H0TA 1EDKA 5DJUB 3MHVA 3QB5A 2M0BA 4HKZH 2M5AA 5C39A 2Q1KA 2WMMA 3AXJA 4ZMDA 1H0TB 1ZXGA 4NPEA 4HJGH 1LT1A 1U7MA 2B87A 2LXBA 2K3RA 2B88A 3FXDA 2R44A 2UWJE 4ASVA 4IOIH 4WYVA 5K5GB 1KEYA 1EDJA 1NVOA 2KZIA 1JM0A 3RIUA 4CPGA 1OVRA 2ZAEB 1SS1A 2M5AB 1Q2NA 2OTKE 2I8DA 1JMBA 2KZJA 2KI7B 3AXJB 3PJAJ 3ZDMA 2P58A 1DEEG 2KIKA 5CBOA 2B87B 1MFTA 4WWIA 4GODA 4EYYQ 1EDIA 2SPZA 2QRXA 4BXLA 4ASWA 1OVUA 3MZWB 4GOEA 3PJAA 1FC2C 1EDLA 2LXCB 2KUBA 3FXEA 4ZNCA 1BDCA 2QVAA 4NPDA 4GOFA 3S1KA 2RKLA 4NPFX 1S3JA 1U7JA 3RGUA 1EC5A 1OVVA 1J1JA 3QWOC 3QB5K 1Y47A 5DJTB 5EFWB 4K35A 3RIUC 1LP1A 4HB1A 1ZW0A 4JBZA 4K3AA 4KJMA 1LP1B 2JWDA 3PH0A 1X0TA 2KS1B 2B89A 1BDDA
chains in the Genus database with same CATH superfamily
1PP9J 2DI4A 3TGUJ 2FYUE 3UUXB 2DHRA 2CLYB 3Q3DA 3I9WA 3AE1A 3FX0A 1KILC 5JDFA 1JCDA 1D7MA 4UEMA 4ZS3A 1NAFA 5L2LA 1S5LE 3K8PC 4DO0A 2BS2A 1NTMK 1HNXT 1IFPA 1NTMJ 2LOPA 1IJDB 5C3JA 4AKLA 4WYVA 2Y6XA 3AE9C 2RPAA 2V7KA 5K5GB 1CW5A 4HTEA 1IK7A 3SFEA 1L0NJ 5ABEA 1ZV8A 2KNCA 2O01J 5CFBA 2M5AB 2OYIC 3G9RA 2JPFA 1N33T 4UVBB 2J1DG 4CN6A 2UXNB 4LF7T 2WSEH 3CIRA 5JR9B 2RA1A 1N73C 3ZDMA 2ZYGA 1LRZA 3HE5A 1GQEA 4IT4A 2HYNA 2ZMAA 4ANJA 3W68A 3OYXA 5FKYA 2E9XB 3RPUA 2UXBT 2SPZA 3AE8C 5FXXA 2QJPC 2KS1A 4ZZCA 2FFDA 2HPJA 3A0BH 4ILAA 2MBGA 3AE7C 4JI1T 1IC2A 3H1KJ 2YO3A 3L4FA 2YINA 3RLFF 3KVAA 2I1KA 3FGAD 3HKEE 2CK3H 2VWAA 2WQYC 1YIJP 1WFDA 1P84H 3HUSA 5LG4A 3MUDA 4I7ZB 3UFEA 5ETWA 1YJ9P 5FXWA 4N6JA 4PFPA 4K35A 1J2JB 2CXDA 5JDGA 3AEAA 4MBQA 3LBXA 2YXQB 3B5NC 2Q7CA 2CHNA 5KKZB 4H0LB 1IFNA 5LGTB 1M7KA 5HXHA 2M6IA 2O01N 3L70J 1LP1B 2HHHT 3ABVA 2VVSA 1NH4A 2J5UA 4HFDA 3BCCJ 5CBNA 2D2CB 4IREA 3NTNA 3ZJ1A 1Q86Q 1JMMA 2HG5D 2QM8A 2Q1KA 3CLQA 4U3FE 3V5UA 3NRXA 1ZP0A 2B76A 4U7IA 4HJGH 3L73D 1SQVK 2Q5UA 1D1BA 4PJ0H 4H9PC 1BE3E 2B87A 4LF8T 2NPSB 1QGKB 4GKJT 3CWBG 1UURA 3CX5I 4HWFA 1SQQK 2EHOA 1YQ3C 1I94T 2GA1A 3ETUA 2YIUC 1SE7A 4BRYA 4IFDK 1M56D 4EIJA 3H1IE 2XY8B 2IZ0A 2VASA 4HFEA 4JV5T 3H1JD 4Z1MH 3RC8A 1PP9E 3QOFA 2OTKE 3TGUE 3I0QA 2V1DB 4EOTA 3L72J 3NFQA 4DV4T 3O1JA 1M1JC 2DW3A 2PAJA 1HGVA 4OK0A 2ZT9B 5CCGC 5L4EA 1KFYA 4EYUA 2W63A 3JC22 2RH0A 2E2AA 1NTKK 3TLTA 3E1IA 3D6ZA 5HEHA 3PRJA 2W00A 5AW0B 1WRGA 1OVUA 1FZGA 1BSHA 2N1TB 2G0UA 3MZWB 4C91A 1AVOA 5LCYA 1NTME 5KLVK 1PPJD 1SQVD 1QX8A 3RYCE 3UULA 1NJIQ 2E76C 1SQPK 1V9DA 1HG2A 2BG9E 4AKIA 1OXZA 1D1AA 4ZZBA 4JI0T 1SQQD 2LM9A 4R4LA 1L0NE 3MJXA 3ZT6A 2FBWC 1OX3A 2YKQA 2IX7C 1LWUA 1NU1K 1EXIA 2HFED 2L8KA 3A5TA 3UU8A 3B8EB 4IIJE 4XAXB 1L4AD 3G3ZA 1QLED 3D71A 2LEHA 2Y8DA 3TSIA 4HFCA 1FOSF 4KX6A 3QK6A 4K3AA 1NHLA 3RYIE 4V1Av 5C2TA 3CK6A 4QWNB 1GL2B 3BQKA 3TLSA 5LHHB 3UQ7A 2JQ9A 1H0TA 1X9BA 5AVWB 3C51A 4I6MC 4C7NB 3CC2P 5AQUB 2LHRA 3DP7A 4BJNA 5AVUB 1RF1A 3SWFA 4CI3B 5FVLA 2YN6A 3GF7A 2MAWA 4QXHB 3T8OA 1ZN5A 3H1KE 3D70A 2M3BA 3WU2E 4YSZA 3ZLIA 4DR3T 2Q3EA 2NW8A 1U5PA 4QH5A 1A02J 2J4GA 4OHFA 5KLVD 2HLOA 3TKLB 2YXRB 3B71A 2VB6A 2Q9IA 4JEUB 4U7JA 1KK7A 4EXTA 1OW8A 3CI9A 2DNXA 3V6IA 3N2OA 1KEYA 1K04A 3TLWA 5L3CB 3ZMZB 1S35A 3L70E 3LK2B 5IUXA 1N7SA 1LTJA 3BCCE 5AQIB 2OYHB 2V7JA 4OH8B 4U3FG 1ZRTE 3UT5E 3L39A 1HCIA 4UR9A 2UUBT 1BE3G 1NKZB 3IEEA 2YOEA 3GHGA 3P8MC 2W27A 3EUHA 3CQCB 3P50A 5AW1B 1KYOE 4EYYQ 3V2NA 5CHXA 3LDQB 2B1EA 1LTBC 1FEWA 2QJKC 1IJ5A 3C4ZA 2I1JA 1S1CX 1BCCJ 4EEDA 4UV9B 3PUVF 3V2RA 4DR4T 5B5EH 2R5DA 3AEFC 3GN5A 2K5BB 1N32T 3H1IG 2WAUA 2J47A 3CXHE 2WDRA 4I4TE 2BZBA 1XNRT 4ISTA 2A72A 1EZVD 2L3LA 3BQIA 2ZT9D 4YXDA 4TWFA 1MIVA 5KLIB 2LJLA 1AFOA 1KFMA 3I5CA 3D6YA 2LLYA 5HXSA 3CX8B 1FZBA 5L4HA 3L72E 1GU4A 3FZLB 4CXYA 4YTPC 1NTZJ 3CCUP 4AQYT 5AVXB 2H8PD 5CA1E 2H88A 1HF8A 2AXCA 2IYPA 1NTMG 1HG5A 3AE3A 1J1EB 2BCCJ 3ANWB 3QB5A 2NP9A 4HKZH 4P0BA 4H13B 5M4YA 2V8SV 3L35A 3W15B 1LNQA 4DR7T 3L37A 4KHXA 3IAOA 1L0NG 2QJYB 5KMGP 3Q5DA 2FJDA 4KT0J 4X1YE 4HGAA 2IFMA 4Y99C 2CLYC 4AIUA 2X67A 5AQRB 2W0GA 3AEBA 3O8ZA 3FXDA 5LGUB 4AI6A 5ABFA 4DBRA 4ASVA 2VQFT 4HN9A 1VQ4P 5H2FE 2WY2A 2FUPA 4PK4A 1URQB 2OYOA 4X1KE 4BA9A 4ADZA 4BWNA 1OFCX 2E43A 5AQKB 4CI2B 1G8XA 2JDIH 3CX6B 2ZYDA 4X20E 2MYSA 1OVRA 3NXSA 4GK0E 2PFVA 3H1KG 2KZJA 3H6PA 5AVTB 1HX1B 4QXCB 3ESLA 3F31A 4DV5T 4PD4D 2MJZA 2XQ7A 2XQ3A 1SP4A 2X0YA 4Y28J 1DEBA 3CMEP 4YHJA 3JCUE 4KHPT 1AQTA 4IE6A 3U3IA 3EWKA 1K9MQ 4BXLA 4IDZA 2D0TA 3B5MA 5AQJB 3H37A 3ZSSA 4EYYR 2C5JA 1KILA 3RQWA 4OGQD 4GOEA 1T8BA 3H1JG 2KZ7B 5KDMC 5C8YE 1XNQT 2LXCB 1S4XA 3ZKRA 2P9BA 3L75G 3IBPA 2KSEA 2IBZE 3S1KA 2ZM0A 2CHOA 1MUUA 1FOSE 2GUSA 5AW6B 3QC9A 3J9X1 3BCCG 1IBKT 3ONJA 3K3OA 4HFVA 1L4AC 3VMYA 3G4SP 1R5LA 4RESB 2W8ZA 4I2LC 2HPCB 2YEVC 2KSJA 3H1LJ 2FYUK 4AUWA 3AE9A 4TLFA 2V6YB 4LF5T 3AEDC 3DJBA 5AW2B 2M6BA 1J5WA 2Z6EA 2XQYA 3HKCE 3H1HD 3RIFA 4TN7B 3RQUA 4A97A 2R3SA 4DUZT 4ZHQE 1CZQA 1PPJG 1M57D 2FXOA 1YQ4C 3RYFE 2OYIA 1Q81Q 1QSDA 1N86A 5TAOA 4IL9A 2KB7P 1L0LK 2VL8A 3CCSP 1G2CA 1N73A 1K05A 4X62T 4IL6H 3HD7B 3ZCIA 1BCCE 2YDQA 4O8SA 4DJGA 2P2UA 3OAKA 2E75B 2I59A 3AE8A 5APWA 2X0HA 2XV5A 2I6HA 3Q5PA 4GK5E 4U2ZA 1OW7A 2BKNA 5LBQB 1FZCB 3AE7A 2Y9YA 1G73A 4PJLA 4KMCA 3ZEFB 3CWBD 4WBOA 5ABGA 3A7MA 3H32B 2R32A 5HCJA 3RKOA 2WQYA 3L71J 3G06A 1LGHB 3KPEA 4IOIH 1XDPA 2CE7A 2VKHA 4ERRA 1ZKEA 4KHZF 4X64T 1NTZE 4JUYA 2L91A 5KXJA 1GK4A 3UU5A 4EV6A 1AJ3A 3RBZA 1NTKG 2XZRA 4UB6E 4TNWA 3JADA 4LGDE 2Z5HA 4AXPA 2VQET 3B5NA 1OMIA 4JYCA 1YKHB 2LT3A 3M3ZB 2BCCE 1U57A 3CCRP 3AXJB 5LB7B 5KLVG 2KNCB 2BEQD 3KDPB 1DEEG 1NWMX 2I0MA 3VMAA 4PD4H 3RIAA 3H3MA 2QYWA 3L74G 1SQPG 5GTIE 3CCQP 1URQD 3C4XA 2E74D 1Y64B 2A9UA 4MHCA 4JI7T 4KBMB 1MMGA 1R5SA 2AXDS 2C5IT 3LFMA 3HA4A 1NU1G 5AW3B 1VQ6P 5E79H 1MV8A 3R4YA 5AVRB 1MNDA 4GOFA 4NUVA 1PGJA 2D5UA 3Q5XA 2O1JA 3BVHA 2VKOA 1T6AA 1HNZT 2WDVA 4ILCA 3EAMA 3U59A 3MKDA 1YQ3A 3ZT7A 4A98A 3E08A 4TX5A 2OLTA 2KXPB 2KINB 3A0HH 5DJTB 2XQ9A 4PJJA 2D2SA 1XZYA 2K9YA 5IWAT 1GD2E 3FWLA 2Q9QD 1X8YA 4NXNT 5GTHH 1Q82Q 2JMHA 1MKMA 4KJMA 3GA8A 3LBXB 3AE4C 3IFMA 4G2AA 1S9KE 1RQVA 1W9RA 2LR2A 2WSFH 4H44B 1M1JA 3FXEB 3FB2A 3AA1B 5CCGA 2QIWA 1ZR4A 3AE5C 5AVYB 2H89C 3VOPA 3KQGA 2XAFB 1W09A 4XFJA 4CN1A 2QE7H 1H88A 1UX5A 4FJOA 1OZHA 1UCUA 1WYCA 2VKJA 1W0BA 2PRRA 2W61A 3O4XE 1JTHA 3C98B 5CMZA 1B7TA 3UU4A 3AA6B 2H43A 1J5ET 3H1LE 3T97A 1BR4A 2E5TA 2N9BA 4H9QC 2X0LB 4W7YA 4AISA 3OW2O 3VTPC 4Q25A 3G71P 5BR8T 4DV2T 5B66H 4W80A 4WY4B 2FBWA 3ZN0B 2EHOB 2K24A 2ZFCA 2KSRA 2BVMA 4DVDA 1QLBA 4CPGA 3VKGA 4IL4A 1LTIC 4BRYB 3PUSA 1D1CA 2W4XA 4X1IE 1M62A 2ZYAA 4U3FD 1L0LE 2K3WA 2ZXEB 1PGQA 4OYKA 1BE3D 1LT9B 4DCKA 3WMM0 4L9IA 4OGQC 3ZN1B 5JDQA 1KB9I 1KFNA 4HYTB 2UUAT 1S5LH 2J62A 5CGMA 4QKNA 3CVRA 1L0NK 1JY2O 2NTYA 2WPSA 2YU2A 3JAEA 3VHLA 2POHA 4C7RA 2IUBA 4YLHA 5TISE 4IL6X 3I1AA 5KX5E 2C0WA 2MTQA 3L71E 3H1ID 2NRGA 3KVBA 1Z0PA 1EC5A 1FU1A 4LLHA 2W67A 1WMKA 1SLQA 2Q3IA 2YMYA 2WDQA 2WWUA 3SOLA 4YT0A 2V7QJ 3TYYA 2N1GA 2VRSA 3ZJ2A 2V7MA 5H6RB 1GZLA 3MIWA 1XTCC 5AW5B 2ZM6T 3P8CD 1AJYA 5E0OA 1VQ9P 1LWUB 4ZEYA 5KAFE 1XDOA 5FL1A 5AQVB 1XMQT 3A3YB 2OARA 1FC2C 1N7LA 1LJ2A 2KLUA 1NTMD 3C64A 3PV0F 3C1LA 5FXZA 4ZXLA 2XNXA 1QVFO 1IBLT 1RF0C 3OJAB 1KORA 4HFIA 1VQLP 1JO5A 2XSBA 1H0TB 2A06G 3USSA 3H3AA 1P84E 2WU5A 1L0ND 3H1HG 1RF1B 2LXBA 1PIXA 4HE8A 3AEFA 2PFXA 2MPKA 3KV9A 3MGNA 5AW8B 4QH4A 4C90A 3SWKA 3ETVA 1QVGO 5GONE 1KQGB 2XAGB 1Q7YQ 2WSCH 3I9YA 2VKDA 2XQ5A 5FY1A 2JO1A 1NAYA 1VF5B 2IPPA 3PHLA 3M0AA 1GW3A 1SA0E 3MA9A 2UU9T 1GDTA 3A8YC 2ODVA 1N2DC 2ZLYA 3ITKA 3EHZA 3TNUB 3N9PA 1SS1A 1EZVI 1URQC 2E74C 1MMNA 3O1HA 4YTPA 1VQ7P 3H1KD 2YDSA 3BRTB 1KNZA 3HE4A 2HN2A 2E5VA 1LTJB 5CBOA 2C9NY 3TLVA 5J2UE 4EGWA 2FYNC 1LVFA 3S4RA 1RQUA 2BBHA 3O6QA 4WY4D 4H63H 4CQIA 3H1LG 3WUTA 4YJ2E 5APSA 3A2AA 2XQAA 5JDMA 5L3DB 3GHGB 2FYUG 4NUUA 3RK2B 2BASA 1X22A 3L75D 1QUUA 3CC7P 2CEAA 3RGLA 4JF7A 2LOSA 5FY0A 5LJNA 4YHHT 1S3JA 2K88A 5L3GB 3BCCD 4H9RC 3UFGA 2Q9QC 2VURA 1ZRTD 1L0LG 3H25A 2V5CA 3OBVE 5LGNB 1T7SA 3Q2MA 2FY8A 2M3EA 4PNIA 1FE6A 1SFCB 1KNRA 3PLNA 3KINB 1K8AQ 5JH7E 2P7JA 1NGMB 1WLXA 5HWYA 2A45G 4UVCB 1N34T 5JRCA 1H7CA 1DD4A 1D0ZA 1DX7A 1KF6A 3M9BA 2P10A 3G6EP 4HFBA 1IBMT 3F89A 4MN4C 3L3PA 1TU3F 5KAIH 4U74A 3HL6A 4L73A 3II6A 3CXHD 2XZEA 5JQGE 2E9XD 2M5AA 2CA5A 2WB5A 3PUXF 1S2EA 3PUWF 1HTLC 1NYHA 1JEKA 3HRNA 2X9XA 2E8IA 4PD4I 1KB9D 4AQFC 2WCAA 3NBXX 4YSXA 4B3MT 2W62A 3E22E 3RHWA 1UIIA 1USDA 1WRDA 3N9MA 4ILBA 4CI1B 3MACA 1KN7A 3NMDA 3VMXA 2WMOA 2IIUA 3K3NA 1FZCC 4ASKA 1L4AA 4A56A 3WUUA 3BASA 2CXLA 1HR0T 5ABFB 5APUA 2M8RA 2ODUA 1AA0A 4R4MA 2W2UA 2WS3A 1NTKD 3AEDA 3Q5EA 4H9OC 4H0LD 1JY2N 3FZHB 3AAAB 1YQ4A 3L8RA 4EIWA 4IE0A 2C0SA 2LHNA 2D2CD 3B13A 3RL0B 1HF9A 3L74D 1SQPD 4HEAA 3WU2H 3IN6A 3U78A 2YO2A 1GW4A 1FIOA 1DU2A 4EZHA 2QRXA 2W90A 3LIEA 5J0ZA 3N9LA 2LKHA 1NU1D 2ZM2A 2WPVB 4LFAT 4ZNCA 2NPSD 3N2GE 4LMLA 3PP5A 1WR0A 5LBMA 4L0RA 5AQNB 1E79H 3ZSTA 5HEUA 1Z56A 2JQQA 4HKAA 1OEDC 2LKGA 1YKEB 1VQMP 1JOCA 1RE4A 3VMZA 3UQ4A 3VRAA 1ZHCA 1OVVA 5APYA 3RH3A 1D0YA 3CQGB 1WR6A 3QB5K 4DMWA 4OVNF 4WB4A 3CQXC 3RIUC 4JI8T 2AXTE 2YDRA 2BVLA 3T1YT 2KT9A 3RK2D 5AQPB 3ZT5A 4CZZB 1H89A 3M0DC 4PFOA 1KTMA 3UUMA 2IDBA 3P4PA 5LP6E 5HYAA 1HS7A 2BG9C 1BDDA 4I55E 1E7PA 4DR6T 1PP9G 3KXDA 3TLUA 2C9LY 3TGUG 3V4WA 1I6ZA 5ADXL 1SFCD 2D0UA 1X79A 4AKHA 5L3FB 2D9DA 1JY3P 3CXHH 1G2CB 4OFZA 1N73B 4HWCA 2GM4A 1XMOT 1NTZK 2AEFA 2N1TD 4YXWH 1K73Q 5EK3A 1KB9H 2CM0A 3MTUE 4M3LA 1S72P 1J1DC 2NR4A 4L75A 2QJPB 4IE5A 2JQKA 3AE6C 3N4XA 3PJSK 1HFAA 2WVRA 1HX8A 3RK3E 4JI3T 4IDQA 4GYSA 5AQOB 3U1CA 2OV9A 3Q9DA 2FXPA 2RMZA 2PP6A 1YW0A 2ITAA 4DIDB 3N9QA 2I8DA 3B4SA 4WY4C 4IE7A 4OYJA 4YJ3E 4JI5T 3KZIH 4U72A 3RYHE 3AVRA 1GL2D 2K9JB 1RHZB 2P58A 3JC6D 4MFRA 2HODB 3AE4A 3B5NB 4D6TJ 2IAKA 1LTGC 3R6NA 4GOUA 5KTBA 4EEBA 4FI5A 1SQXJ 1FDMA 3KHUA 1EDIA 1Z8UA 4O4JE 4WW0A 2WBLA 3AE5A 1LT9C 2H89A 4TWDA 1HJBA 1NOHA 3VU7H 4GYRA 4YSYA 4C7NA 3ZPOA 2QVAA 5H2FH 4A7PA 2AEJA 2IC6A 1UGOA 4MLKA 1CI6A 1GU5A 4TV8E 3P4RA 3U1AA 1UX4A 4TUYE 3IF8B 1VQ5P 4NIQA 5HXRA 4EZ4A 4DBQA 2R3CA 3N9NA 5JR9C 2XPKA 3O9XA 2WU2A 2XAQB 4DR2T 5BVZA 2YK0A 4UELA 1MNEA 2XQ4A 4HWDA 2YIUB 1US7B 2PG8A 1JB0J 2E9XC 3TF5A 3L70G 2O1KA 1LKXA 1FMWA 2K9AA 2XAHB 3EABA 2WWWA 3PUYF 4UV8B 2VL0A 4H63V 1KV4A 1YYCA 4TT3H 2UXDT 2CPBA 2OTLP 5HEOA 4DR5T 4ZOLE 1BGYJ 1LTTC 4NPEA 3Q1MA 2A06D 5CCHD 1LT1A 4UB8E 2K48A 2W6JH 4DV1T 1DD3A 2ACXA 4DMVA 4OX9T 3OYZA 2ZVNB 5APQA 4C46A 2CMRA 4I7ZC 2V6XA 1HVVA 3CX5E 2CPTA 2WT7B 3EI0A 2WZHA 4I0UA 1NO4A 1X9VA 2GUVA 3TK1A 2R44A 5AW9B 5KKZC 3K5BA 4H0LC 5CCHA 2FYZA 2X51A 5JVDE 1LTSC 5AVVB 1JTHB 4HH2A 2E76B 1S9KD 1MFZA 1KQFB 4IL6E 2D2CC 3M06A 1E1HB 3AAIA 4K0KT 5HEGA 1NENA 2XKMA 2KLVA 2XDJA 3L72G 1IFJA 1RE4C 5LJMA 1OW6A 2PJQA 1ZMEC 2NPSC 4H13D 1RF0A 3EFFK 1HJ0A 1T3JA 3H1LD 1GTWA 3FBLA 3EQ2A 2N9DA 1VQPP 4N78E 2KMFA 2NZ2A 3I56P 2XM2A 2FYUD 2WSEJ 3MP7B 3ANWA 1FMVA 4Z8XA 2FJAA 2JP3A 4JEHB 1MIYA 1VDFA 2NTXA 2KK7A 4N3YB 5FY7A 1U4QA 3RGUA 4DV3T 5M1BA 4ZI3D 2J59M 1L0LD 3QWOC 5FXVA 1HGZA 4PV1B 1VQ8P 1GK6A 2M67A 2BKPA 3CPWO 4HB1A 4L76A 1R8IA 3HE5B 4JQ0D 1KILE 2K37A 3OTOT 3KDSE 2ZT9C 5AQFB 5GTIH 4D6TE 2C5KT 3GMIA 1SFCC 4BAYB 3C8VA 1URQA 1ZOYC 2G8YA 2DWKA 3NZPA 2CCQA 1HBWA 1SQXE 2IDOB 2KS1B 2JEEA 2B89A 4CXWA 2FFDB 3P4SA 4JLEA 2N1TC 5E79E 3M65A 3GG2A 2M0BA 2BDEA 4TNVA 4X5TA 1SQBJ 4TV9E 4UIGA 2Y0EA 3ZMUB 3HUSB 2KNDA 3A0HE 4LC1A 3RX6A 2CBJA 5AQLB 3NVOA 2IZ1A 3ZC0A 3RRCA 4KUMB 3LJCA 5BMVE 2WSCJ 4WVZA 3UUBA 4GKKT 4E7SA 4XA4A 4X65T 1UIXA 1FZEA 2IBZG 2Q9QA 5KJ7D 3PUQA 3CPZA 4GDOA 4YTNA 1OIPA 1Q90D 1WT6A 1GL2C 3JC6C 4GT1A 2A2FX 4U2YA 3NRYA 5HXCA 4LF9T 1JMBA 3TDKA 2N2NA 2H7OA 2FKWB 1VQNP 2V6YA 1N36T 1JCCA 4IGUA 1JUNA 1BGYE 2B87B 3HD7D 2FXMA 3LW5H 4GODA 2E76D 1GMJA 1KYOI 1VL2A 3UUNA 3HE4B 1L2PA 1Y8AA 2KWHA 1WCRA 4IDNA 2E75D 5L47A 4QX8B 3KBTA 4QMAA 4W7ZA 1PGPA 3PJAA 4AQFA 3N2KE 1BCCG 3VP9A 3AE2C 3KYQA 5B66E 2GK9A 4U33A 1JY3O 2Y0DA 3CXHI 4LMKA 1T2KD 3SFDA 1RH5B 3QH9A 5F5WA 2JJLA 1HWTC 2RP4A 5AQQB 3N5LA 3MZKB 2Y0CA 1QL2A 2OYHC 2AE9A 4Y99B 4ZS2A 1KC8Q 1FZCA 3VP8A 2PTFA 4O4HE 3BK9A 3PUAA 1PV3A 4PW8A 3H32A 1M1KQ 2LSGA 5EZYE 2WWVA 3V4QA 3ZYMA 2IMLA 1NTZG 2A45H 3F5HA 1WYBA 3KV5A 3CCLP 1IO4A 2K1AA 5LA6E 2BS3A 2KOGA 2FJBA 3K1SA 2R5BA 5JRCB 3M91A 1UK5A 4AQRD 4DZOA 1T3UA 3HTKA 1EDKA 3BATA 1PP9D 5CCHC 1DIPA 2BCCG 3TGUD 3PDYA 4RJTA 4PV1D 3D0TA 4KP3C 5TISH 1T72A 2WTYA 4RO0A 2WMMA 3AXJA 2JQHA 5BU5A 1ZXGA 3WUVA 2XASB 5FMNA 2UUCT 2NW9A 4EAHA 3L09A 2SPCA 1Y01A 4NPPA 2E5YA 5KLIC 2A3DA 4H9SE 1FAVA 5AVQB 2JMKA 3ZMSB 1HUCA 2P67A 3VN0A 1YHQP 3CWZB 3UU6A 2Z4EA 3B57A 3PU8A 3A0BE 4D6TG 1OEDA 3OA7A 4ILUA 4CXXA 4UF0A 3A7OA 3CMLA 1SQXG 4U3CA 2R6GF 5KAFH 1IFMA 2X9WA 4UXNB 5LMUT 2H7HA 4QHOA 3SWYA 3L73J 3AVSA 1YJWP 3PU3A 3KFWX 3RIUA 4JI6T 1J1EC 2CWYA 1L4AB 3RK3B 5CJ5A 5EK4A 3M9HA 2ZAEB 3FZMB 1Q2NA 2YNYA 1MZ9A 5TJHA 5AQGB 2UXXB 4H13C 3EFGA 3M0DA 4P1NA 4JI4T 2QSIA 3I55P 1SQBE 5JDNA 2X9YA 2QJYC 2BG9A 4H44D 2XTLA 2XM1A 3CCVP 1ZV4X 1AQ5A 5DQWA 1YITP 1FBMA 2LM2A 4ASWA 4U7YA 3H1JJ 2ZM8A 4B3TT 4ZI3C 3L75J 3FXEA 1BDCA 4ZI2D 3P7KA 4PJMA 2JWAA 1KQLA 3HKBE 2IBZI 4GIWA 3EVYA 2WZ7A 1N7SB 1U7JA 3AE6A 4X66T 4PJ0E 2XSAA 1NWQA 3F57A 1T98A 3PUZF 4AYCA 1YBKA 1KZUB 4IE4A 3AECC 4PK5A 5EFWB 2EHOD 2V5DA 3AEEC 3NWIA 3GWHA 1BGYG 1D0XA 2ZXXA 3FHNA 1XTGB 3FWNA 2X9HA 2W83C 1SQVJ 1IK9A 1JNMA 3ZYLA 1SHZC 1FJKA 4DV7T 4B3ST 4WY4A 3L70D 2HR3A 1MMAA 4ZKUA 1SQQJ 3IR9A 3JAFA 3GLMA 3LSVA 3GN5B 3OVUA 3BRVB 2HH7A 3FBZA 2XNDH 3IF4A 3IHRA 1RE3C 2J58A 3R84B 3Q5WA 5AQTB 1PGOA 1QL1A 5JDHA 2P1JA 3RF1A 1W2EA 2CRBA 1LT9A 4L5GA 1U7MA 1X79B 1KYOD 2IC9A 2NOXA 3GF3A 5HXEA 5KJ7C 3VKHA 5AQMB 4YY3T 4EI2A 5CJ4A 2IFNA 2V7IA 4RKUJ 4A5XA 1OEDE 2UWJE 4JYAT 1YXRA 1YJNP 3P8CE 3L71G 3E0ZA 2Y9ZA 2YMKA 2V26A 2XHEB 5HWXA 2WPRA 2V7LA 2LRKA 5HCMA 5BU8B 1NTKJ 2L9QA 5KAIE 2G3AA 5JR9A 3EDVA 3HD7C 5KLVJ 2XAJB 1DH3A 3SFDC 2E9XA 2OA5A 1R8EA 3BQLA 2O01H 1S5LX 2E75C 4DV6T 3L72D 1JY3N 4UVAB 3L74J 1SQPJ 5LHIB 1IZNB 1LTAC 3GMAA 1A02F 2XQ6A 2HN1A 3AE1C 4IFFA 4P09A 2ACZA 3ZMVB 3SS1A 3FXDB 1T2KC 3C50A 3CKDA 2YKOA 2V7QH 1NU1J 3AA0B 4CN4A 3RK3D 5DQVA 1O3XA 2YKPA 3ONXA 1VQOP 1IAPA 3LK42 3OJAA 5LXTE 3UIAA 5DJQC 1RY3A 1HNWT 3OKQA 1ZLLA 3HR0A 5LHGB 1E5WA 2LSIA 3L73E 3KBUA 1KQSO 2OTJP 5ABHA 1VF5D 4WZXA 1SQBG 1YI2P 4AQGA 1CI6B 4JPZB 3SFEC 1LP1A 4U31A 5CA0E 2HPLA 5IHYA 2JR8A 2NW7A 1CHUA 4JYBA 4PV1C 4XBFB 1SUMB 5LYJE 1N7SD 2IW5B 2JJ9A 1EXJA 5EK2A 1KILB 5DJUB 3MHVA 3K3QC 4GIFA 1SVFA 4ZKPA 2VK9A 3H1JE 3TNUA 3VR8A 5FYMA 4P0AA 5C39A 4QH1A 3L36A 2NPSA 3L75E 4NXMT 3SSUA 4LF6T 4ZMDA 2FFDC 2N9YB 4QX7B 3FZFB 4OGQB 4JI2T 1FS0E 4HWHA 3QNUA 2ZVOB 5J1GA 2E5LT 4ISSA 3P32A 1KYOH 3Q5RA 3V5BA 2QG4A 5AVZB 2AXTH 2Q6QA 1USEA 3SWHA 3IA3A 2RN0A 3OPCA 3HUSC 3RI5A 2X66A 3NKZA 5B5EE 1NKNA 3MUDC 2DLRA 2WSSH 1N8RQ 5CJ0A 4XE5B 2IBZD 2OYIB 4DOJA 1JNRA 2WITA 1PPJE 2DCFA 5AQHB 1SQVE 3AEAC 4AKGA 1EDJA 2KZIA 1MMDA 3DTOA 3T1HT 4H44C 3W67A 3FZKB 3NZQA 2LSJA 1SQQE 2ES0A 2CBIA 2KI7B 3ABVC 3ZCJA 2W66A 1SFCA 3R2PA 1ZOYA 3N7NA 3ZC1A 2BKOA 4DUYT 4JBWF 4Z91A 4OWFA 1KB9E 3LK3B 2N1TA 3UTKA 4WWIA 2A45I 1AVYA 3CX5D 4ZI2C 1JNZA 4DR1T 4KI0F 1ZP0C 2OQQA 4H9NC 5APVA 4IDPA 4TWHA 2YU1A 1BSNA 1Y9BA 2KUBA 2W6AA 3PTRB 1BCCD 2JKVA 1T8ZA 2WPQA 2KP8A 4L74A 2EHOC 5APXA 1IFDA 1JY2P 1SQXK 1NTKE 1VCSA 4O2BE 1OWAA 3KZIE 4EB6E 1Y47A 4DT0A 1ZW0A 1KD1Q 3N9OA 3AB3B 4PJNA 5KLVE 1GL2A 5FNVE 3WAKA 3KV4A 3PUGA 5AVSB 1YTZT 3AEGA 3L74E 1SQPE 3V2PA 1NTZD 2L5GB 4IFMA 2QA7A 2JWDA 1FJGT 4N78D 1X0TA 3Q5SA 1FJPA 3LG7A 4B3RT 5APTA 4K0UA 3CX7B 3RRWA 4PK6A 4XZCA 3RL0D 2LRLA 4ZI7E 1CUNA 3O1IA 3VR9A 5A1LA 1NU1E 3VYIA 2BCCD 5H6QB 2E74B 3M9QA 1VPCA 1YD8G 3KV6A 1QEXA 3CC4P 2LKMA 3QUJA 3L73G 3H1HJ 1P84I 2FYNB 3RL0g 2XUEA 2YKSA 3E1RA 3JCUH 3AE2A 2WSFJ 3LIDA 4WBAA 3RBXA 1UUSA 2K3RA 3J7Yq 1KILD 3V2QA 1VQKP 2MKVA 2Y48B 2WP9A 3CMAP 5AW7B 5JREA 4D6TD 3VRBA 1LWUC 1SQXD 2JRKA 2OYHA 1IFIA 3JSVC 2PBIA 3I0OA 2BS4A 2XQ8A 4G63A 2CWOA 1M1JB 2Q9QB 2NWBA 3HKDE 1EZVE 2QEXP 2Z5IA 3CWBJ 1MIWA 2AEMA 1FZFA 4M1PA 2LSYA 3JCFA 4DNDA 5JDLA 3LW5J 2MOZA 3AA7B 2CPSA 2KIKA 4E7ZA 3RK3C 4UB8H 1RF1C 2QM7A 3X1DA 1MFTA 2H3RA 3Q2YA 3C9IA 4B6XA 1BR1A 1E2AA 3CX5H 3E7KA 1W5CE 3T97B 5F8PA 2LE8A 2FYUJ 4WNKA 3CD6P 1SQVG 1VOMA 4Z90A 1EQ7A 5LOVE 1ZEEA 1M7LA 1VF5C 4O4IE 4GKGA 2RKLA 4EDFA 4O2AE 4NPFX 5LG3A 3PURA 1L0LJ 2B9BA 1PFIA 1J1JA 1SQQG 5LMNT 3F2EA 3S4UA 4QXBB 3UU3A 1VCTA 4JBZA 1FZAA 1N7SC 2O3JA 3CCEP 2CXFA 2W6BA 2BEZF 1BGYD 2FJEA 1LTJC 5HEJA 1XWMA 1G1IA 3ZYKA 4F8HA 1G1JA 2BBJA 1PL5A 2VVNA 4PAGA 3PH0A 2H7VC 3MD0A 4TZ4C 1FDIA 3B5ND 3GHGC 5AFUL 3MK7C 1H8AA 4O4LE 4LFCT 3PE0A 4HWIB 3RK2C 3CCJP 4UB6H 2DWGA 1KMIZ 1NEKA 4B86A 4YPCA 3CL3D 4BJMA 2XJ7A 4LF4T 4PD4E 3HTKB 2K9JA 2E42A 2HODA 4COFA 2JIWA 3RC3A 2KYVA 2DL1A 1YTZI 3A5XA 3P4WA 1IJ6A 4F6RC 1VRBA 4YTMA 4MALA 2B88A 1FDOA 5AW4B 2QGSA 1ZR2A 1BR2A 4YXDC 3EDUA 3V5SA 4WBNE 2KWIB 3SRZA 5JTGA 1SQBK 1LVKA 1BR0A 5L3BB 3L71D 1W0AA 1M90Q 2F4VT 1HTJF 1OEDB 1NVOA 3AECA 3AEEA 1JM0A 1EZ3A 4UF0B 5HAXA 4HFHA 4YFSA 4IHJE 1CSBA 1L0VA 4LMJA 1AV1A 2H88C 4I50E 4EOZB 1S94A 2WZIA 3PJAJ 5FP3A 5CB4E 3AE3C 2QJKB 2A06E 4J2CA 5GTHE 2PGDA 5FVKA 2KLQA 5LNKA 3H1HE 2V4HA 4DV0T 1W2BO 5IYZE 3RKGA 5F3JA 3S9OA 3P7IA 4I43B 1RE3A 2BG9B 2WM9A 5CCGD 2QA4P 1EDLA 3ZMTB 3AEGC 2X68A 3MXZA 4U3FJ 3CCMP 3C4WA 4NPDA 3P4QA 3AEBC 5FL0A 2HPCA 1HH0A 5KJ7A 3GW6A 2XU6A 3WAJA 1BE3J 1P84D 1EZVG 1PZQA 2WSSV 4IDOA 5DABA 4I1LA 5L3EB 2WMNA 3HI2A 1J1DB 2OGUA 1SQBD 2IYOA 2WT7A 3CWBE 1KNPA 3ONLC 2UXCT 5AQSB 3PTZA 2C0XA 4AKRB 3RL0C 3AAEB 5J2TE 3O6QB 2LSKA 3H1IJ 3HD7A 1M8OB 2IHR1 5L8RJ 4O9BA 4LFBT 2ZJSE 3WI3A
chains in the Genus database with same CATH topology
2HR3A 4MN4C 2LR2A 5CBNA 1H0TA 1EDKA 5DJUB 3MHVA 3QB5A 2M0BA 4HKZH 2M5AA 5C39A 2Q1KA 2WMMA 3AXJA 4ZMDA 1H0TB 1ZXGA 4NPEA 4HJGH 1LT1A 1U7MA 2B87A 2LXBA 2K3RA 2B88A 3FXDA 2R44A 2UWJE 4ASVA 4IOIH 4WYVA 5K5GB 1KEYA 1EDJA 1NVOA 2KZIA 1JM0A 3RIUA 4CPGA 1OVRA 2ZAEB 1SS1A 2M5AB 1Q2NA 2OTKE 2I8DA 1JMBA 2KZJA 2KI7B 3AXJB 3PJAJ 3ZDMA 2P58A 1DEEG 2KIKA 5CBOA 2B87B 1MFTA 4WWIA 4GODA 4EYYQ 1EDIA 2SPZA 2QRXA 4BXLA 4ASWA 1OVUA 3MZWB 4GOEA 3PJAA 1FC2C 1EDLA 2LXCB 2KUBA 3FXEA 4ZNCA 1BDCA 2QVAA 4NPDA 4GOFA 3S1KA 2RKLA 4NPFX 1S3JA 1U7JA 3RGUA 1EC5A 1OVVA 1J1JA 3QWOC 3QB5K 1Y47A 5DJTB 5EFWB 4K35A 3RIUC 1LP1A 4HB1A 1ZW0A 4JBZA 4K3AA 4KJMA 1LP1B 2JWDA 3PH0A 1X0TA 2KS1B 2B89A 1BDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HR3 A;  4MN4 C;  2LR2 A;  5CBN A;  1H0T A;  1EDK A;  5DJU B;  3MHV A;  3QB5 A;  2M0B A;  4HKZ H;  2M5A A;  5C39 A;  2Q1K A;  2WMM A;  3AXJ A;  4ZMD A;  1H0T B;  1ZXG A;  4NPE A;  4HJG H;  1LT1 A;  1U7M A;  2B87 A;  2LXB A;  2K3R A;  2B88 A;  3FXD A;  2R44 A;  2UWJ E;  4ASV A;  4IOI H;  4WYV A;  5K5G B;  1KEY A;  1EDJ A;  1NVO A;  2KZI A;  1JM0 A;  3RIU A;  4CPG A;  1OVR A;  2ZAE B;  1SS1 A;  2M5A B;  1Q2N A;  2OTK E;  2I8D A;  1JMB A;  2KZJ A;  2KI7 B;  3AXJ B;  3PJA J;  3ZDM A;  2P58 A;  1DEE G;  2KIK A;  5CBO A;  2B87 B;  1MFT A;  4WWI A;  4GOD A;  4EYY Q;  1EDI A;  2SPZ A;  2QRX A;  4BXL A;  4ASW A;  1OVU A;  3MZW B;  4GOE A;  3PJA A;  1FC2 C;  1EDL A;  2LXC B;  2KUB A;  3FXE A;  4ZNC A;  1BDC A;  2QVA A;  4NPD A;  4GOF A;  3S1K A;  2RKL A;  4NPF X;  1S3J A;  1U7J A;  3RGU A;  1EC5 A;  1OVV A;  1J1J A;  3QWO C;  3QB5 K;  1Y47 A;  5DJT B;  5EFW B;  4K35 A;  3RIU C;  1LP1 A;  4HB1 A;  1ZW0 A;  4JBZ A;  4K3A A;  4KJM A;  1LP1 B;  2JWD A;  3PH0 A;  1X0T A;  2KS1 B;  2B89 A;  1BDD A; 
#chains in the Genus database with same CATH topology
 1PP9 J;  2DI4 A;  3TGU J;  2FYU E;  3UUX B;  2DHR A;  2CLY B;  3Q3D A;  3I9W A;  3AE1 A;  3FX0 A;  1KIL C;  5JDF A;  1JCD A;  1D7M A;  4UEM A;  4ZS3 A;  1NAF A;  5L2L A;  1S5L E;  3K8P C;  4DO0 A;  2BS2 A;  1NTM K;  1HNX T;  1IFP A;  1NTM J;  2LOP A;  1IJD B;  5C3J A;  4AKL A;  4WYV A;  2Y6X A;  3AE9 C;  2RPA A;  2V7K A;  5K5G B;  1CW5 A;  4HTE A;  1IK7 A;  3SFE A;  1L0N J;  5ABE A;  1ZV8 A;  2KNC A;  2O01 J;  5CFB A;  2M5A B;  2OYI C;  3G9R A;  2JPF A;  1N33 T;  4UVB B;  2J1D G;  4CN6 A;  2UXN B;  4LF7 T;  2WSE H;  3CIR A;  5JR9 B;  2RA1 A;  1N73 C;  3ZDM A;  2ZYG A;  1LRZ A;  3HE5 A;  1GQE A;  4IT4 A;  2HYN A;  2ZMA A;  4ANJ A;  3W68 A;  3OYX A;  5FKY A;  2E9X B;  3RPU A;  2UXB T;  2SPZ A;  3AE8 C;  5FXX A;  2QJP C;  2KS1 A;  4ZZC A;  2FFD A;  2HPJ A;  3A0B H;  4ILA A;  2MBG A;  3AE7 C;  4JI1 T;  1IC2 A;  3H1K J;  2YO3 A;  3L4F A;  2YIN A;  3RLF F;  3KVA A;  2I1K A;  3FGA D;  3HKE E;  2CK3 H;  2VWA A;  2WQY C;  1YIJ P;  1WFD A;  1P84 H;  3HUS A;  5LG4 A;  3MUD A;  4I7Z B;  3UFE A;  5ETW A;  1YJ9 P;  5FXW A;  4N6J A;  4PFP A;  4K35 A;  1J2J B;  2CXD A;  5JDG A;  3AEA A;  4MBQ A;  3LBX A;  2YXQ B;  3B5N C;  2Q7C A;  2CHN A;  5KKZ B;  4H0L B;  1IFN A;  5LGT B;  1M7K A;  5HXH A;  2M6I A;  2O01 N;  3L70 J;  1LP1 B;  2HHH T;  3ABV A;  2VVS A;  1NH4 A;  2J5U A;  4HFD A;  3BCC J;  5CBN A;  2D2C B;  4IRE A;  3NTN A;  3ZJ1 A;  1Q86 Q;  1JMM A;  2HG5 D;  2QM8 A;  2Q1K A;  3CLQ A;  4U3F E;  3V5U A;  3NRX A;  1ZP0 A;  2B76 A;  4U7I A;  4HJG H;  3L73 D;  1SQV K;  2Q5U A;  1D1B A;  4PJ0 H;  4H9P C;  1BE3 E;  2B87 A;  4LF8 T;  2NPS B;  1QGK B;  4GKJ T;  3CWB G;  1UUR A;  3CX5 I;  4HWF A;  1SQQ K;  2EHO A;  1YQ3 C;  1I94 T;  2GA1 A;  3ETU A;  2YIU C;  1SE7 A;  4BRY A;  4IFD K;  1M56 D;  4EIJ A;  3H1I E;  2XY8 B;  2IZ0 A;  2VAS A;  4HFE A;  4JV5 T;  3H1J D;  4Z1M H;  3RC8 A;  1PP9 E;  3QOF A;  2OTK E;  3TGU E;  3I0Q A;  2V1D B;  4EOT A;  3L72 J;  3NFQ A;  4DV4 T;  3O1J A;  1M1J C;  2DW3 A;  2PAJ A;  1HGV A;  4OK0 A;  2ZT9 B;  5CCG C;  5L4E A;  1KFY A;  4EYU A;  2W63 A;  3JC2 2;  2RH0 A;  2E2A A;  1NTK K;  3TLT A;  3E1I A;  3D6Z A;  5HEH A;  3PRJ A;  2W00 A;  5AW0 B;  1WRG A;  1OVU A;  1FZG A;  1BSH A;  2N1T B;  2G0U A;  3MZW B;  4C91 A;  1AVO A;  5LCY A;  1NTM E;  5KLV K;  1PPJ D;  1SQV D;  1QX8 A;  3RYC E;  3UUL A;  1NJI Q;  2E76 C;  1SQP K;  1V9D A;  1HG2 A;  2BG9 E;  4AKI A;  1OXZ A;  1D1A A;  4ZZB A;  4JI0 T;  1SQQ D;  2LM9 A;  4R4L A;  1L0N E;  3MJX A;  3ZT6 A;  2FBW C;  1OX3 A;  2YKQ A;  2IX7 C;  1LWU A;  1NU1 K;  1EXI A;  2HFE D;  2L8K A;  3A5T A;  3UU8 A;  3B8E B;  4IIJ E;  4XAX B;  1L4A D;  3G3Z A;  1QLE D;  3D71 A;  2LEH A;  2Y8D A;  3TSI A;  4HFC A;  1FOS F;  4KX6 A;  3QK6 A;  4K3A A;  1NHL A;  3RYI E;  4V1A v;  5C2T A;  3CK6 A;  4QWN B;  1GL2 B;  3BQK A;  3TLS A;  5LHH B;  3UQ7 A;  2JQ9 A;  1H0T A;  1X9B A;  5AVW B;  3C51 A;  4I6M C;  4C7N B;  3CC2 P;  5AQU B;  2LHR A;  3DP7 A;  4BJN A;  5AVU B;  1RF1 A;  3SWF A;  4CI3 B;  5FVL A;  2YN6 A;  3GF7 A;  2MAW A;  4QXH B;  3T8O A;  1ZN5 A;  3H1K E;  3D70 A;  2M3B A;  3WU2 E;  4YSZ A;  3ZLI A;  4DR3 T;  2Q3E A;  2NW8 A;  1U5P A;  4QH5 A;  1A02 J;  2J4G A;  4OHF A;  5KLV D;  2HLO A;  3TKL B;  2YXR B;  3B71 A;  2VB6 A;  2Q9I A;  4JEU B;  4U7J A;  1KK7 A;  4EXT A;  1OW8 A;  3CI9 A;  2DNX A;  3V6I A;  3N2O A;  1KEY A;  1K04 A;  3TLW A;  5L3C B;  3ZMZ B;  1S35 A;  3L70 E;  3LK2 B;  5IUX A;  1N7S A;  1LTJ A;  3BCC E;  5AQI B;  2OYH B;  2V7J A;  4OH8 B;  4U3F G;  1ZRT E;  3UT5 E;  3L39 A;  1HCI A;  4UR9 A;  2UUB T;  1BE3 G;  1NKZ B;  3IEE A;  2YOE A;  3GHG A;  3P8M C;  2W27 A;  3EUH A;  3CQC B;  3P50 A;  5AW1 B;  1KYO E;  4EYY Q;  3V2N A;  5CHX A;  3LDQ B;  2B1E A;  1LTB C;  1FEW A;  2QJK C;  1IJ5 A;  3C4Z A;  2I1J A;  1S1C X;  1BCC J;  4EED A;  4UV9 B;  3PUV F;  3V2R A;  4DR4 T;  5B5E H;  2R5D A;  3AEF C;  3GN5 A;  2K5B B;  1N32 T;  3H1I G;  2WAU A;  2J47 A;  3CXH E;  2WDR A;  4I4T E;  2BZB A;  1XNR T;  4IST A;  2A72 A;  1EZV D;  2L3L A;  3BQI A;  2ZT9 D;  4YXD A;  4TWF A;  1MIV A;  5KLI B;  2LJL A;  1AFO A;  1KFM A;  3I5C A;  3D6Y A;  2LLY A;  5HXS A;  3CX8 B;  1FZB A;  5L4H A;  3L72 E;  1GU4 A;  3FZL B;  4CXY A;  4YTP C;  1NTZ J;  3CCU P;  4AQY T;  5AVX B;  2H8P D;  5CA1 E;  2H88 A;  1HF8 A;  2AXC A;  2IYP A;  1NTM G;  1HG5 A;  3AE3 A;  1J1E B;  2BCC J;  3ANW B;  3QB5 A;  2NP9 A;  4HKZ H;  4P0B A;  4H13 B;  5M4Y A;  2V8S V;  3L35 A;  3W15 B;  1LNQ A;  4DR7 T;  3L37 A;  4KHX A;  3IAO A;  1L0N G;  2QJY B;  5KMG P;  3Q5D A;  2FJD A;  4KT0 J;  4X1Y E;  4HGA A;  2IFM A;  4Y99 C;  2CLY C;  4AIU A;  2X67 A;  5AQR B;  2W0G A;  3AEB A;  3O8Z A;  3FXD A;  5LGU B;  4AI6 A;  5ABF A;  4DBR A;  4ASV A;  2VQF T;  4HN9 A;  1VQ4 P;  5H2F E;  2WY2 A;  2FUP A;  4PK4 A;  1URQ B;  2OYO A;  4X1K E;  4BA9 A;  4ADZ A;  4BWN A;  1OFC X;  2E43 A;  5AQK B;  4CI2 B;  1G8X A;  2JDI H;  3CX6 B;  2ZYD A;  4X20 E;  2MYS A;  1OVR A;  3NXS A;  4GK0 E;  2PFV A;  3H1K G;  2KZJ A;  3H6P A;  5AVT B;  1HX1 B;  4QXC B;  3ESL A;  3F31 A;  4DV5 T;  4PD4 D;  2MJZ A;  2XQ7 A;  2XQ3 A;  1SP4 A;  2X0Y A;  4Y28 J;  1DEB A;  3CME P;  4YHJ A;  3JCU E;  4KHP T;  1AQT A;  4IE6 A;  3U3I A;  3EWK A;  1K9M Q;  4BXL A;  4IDZ A;  2D0T A;  3B5M A;  5AQJ B;  3H37 A;  3ZSS A;  4EYY R;  2C5J A;  1KIL A;  3RQW A;  4OGQ D;  4GOE A;  1T8B A;  3H1J G;  2KZ7 B;  5KDM C;  5C8Y E;  1XNQ T;  2LXC B;  1S4X A;  3ZKR A;  2P9B A;  3L75 G;  3IBP A;  2KSE A;  2IBZ E;  3S1K A;  2ZM0 A;  2CHO A;  1MUU A;  1FOS E;  2GUS A;  5AW6 B;  3QC9 A;  3J9X 1;  3BCC G;  1IBK T;  3ONJ A;  3K3O A;  4HFV A;  1L4A C;  3VMY A;  3G4S P;  1R5L A;  4RES B;  2W8Z A;  4I2L C;  2HPC B;  2YEV C;  2KSJ A;  3H1L J;  2FYU K;  4AUW A;  3AE9 A;  4TLF A;  2V6Y B;  4LF5 T;  3AED C;  3DJB A;  5AW2 B;  2M6B A;  1J5W A;  2Z6E A;  2XQY A;  3HKC E;  3H1H D;  3RIF A;  4TN7 B;  3RQU A;  4A97 A;  2R3S A;  4DUZ T;  4ZHQ E;  1CZQ A;  1PPJ G;  1M57 D;  2FXO A;  1YQ4 C;  3RYF E;  2OYI A;  1Q81 Q;  1QSD A;  1N86 A;  5TAO A;  4IL9 A;  2KB7 P;  1L0L K;  2VL8 A;  3CCS P;  1G2C A;  1N73 A;  1K05 A;  4X62 T;  4IL6 H;  3HD7 B;  3ZCI A;  1BCC E;  2YDQ A;  4O8S A;  4DJG A;  2P2U A;  3OAK A;  2E75 B;  2I59 A;  3AE8 A;  5APW A;  2X0H A;  2XV5 A;  2I6H A;  3Q5P A;  4GK5 E;  4U2Z A;  1OW7 A;  2BKN A;  5LBQ B;  1FZC B;  3AE7 A;  2Y9Y A;  1G73 A;  4PJL A;  4KMC A;  3ZEF B;  3CWB D;  4WBO A;  5ABG A;  3A7M A;  3H32 B;  2R32 A;  5HCJ A;  3RKO A;  2WQY A;  3L71 J;  3G06 A;  1LGH B;  3KPE A;  4IOI H;  1XDP A;  2CE7 A;  2VKH A;  4ERR A;  1ZKE A;  4KHZ F;  4X64 T;  1NTZ E;  4JUY A;  2L91 A;  5KXJ A;  1GK4 A;  3UU5 A;  4EV6 A;  1AJ3 A;  3RBZ A;  1NTK G;  2XZR A;  4UB6 E;  4TNW A;  3JAD A;  4LGD E;  2Z5H A;  4AXP A;  2VQE T;  3B5N A;  1OMI A;  4JYC A;  1YKH B;  2LT3 A;  3M3Z B;  2BCC E;  1U57 A;  3CCR P;  3AXJ B;  5LB7 B;  5KLV G;  2KNC B;  2BEQ D;  3KDP B;  1DEE G;  1NWM X;  2I0M A;  3VMA A;  4PD4 H;  3RIA A;  3H3M A;  2QYW A;  3L74 G;  1SQP G;  5GTI E;  3CCQ P;  1URQ D;  3C4X A;  2E74 D;  1Y64 B;  2A9U A;  4MHC A;  4JI7 T;  4KBM B;  1MMG A;  1R5S A;  2AXD S;  2C5I T;  3LFM A;  3HA4 A;  1NU1 G;  5AW3 B;  1VQ6 P;  5E79 H;  1MV8 A;  3R4Y A;  5AVR B;  1MND A;  4GOF A;  4NUV A;  1PGJ A;  2D5U A;  3Q5X A;  2O1J A;  3BVH A;  2VKO A;  1T6A A;  1HNZ T;  2WDV A;  4ILC A;  3EAM A;  3U59 A;  3MKD A;  1YQ3 A;  3ZT7 A;  4A98 A;  3E08 A;  4TX5 A;  2OLT A;  2KXP B;  2KIN B;  3A0H H;  5DJT B;  2XQ9 A;  4PJJ A;  2D2S A;  1XZY A;  2K9Y A;  5IWA T;  1GD2 E;  3FWL A;  2Q9Q D;  1X8Y A;  4NXN T;  5GTH H;  1Q82 Q;  2JMH A;  1MKM A;  4KJM A;  3GA8 A;  3LBX B;  3AE4 C;  3IFM A;  4G2A A;  1S9K E;  1RQV A;  1W9R A;  2LR2 A;  2WSF H;  4H44 B;  1M1J A;  3FXE B;  3FB2 A;  3AA1 B;  5CCG A;  2QIW A;  1ZR4 A;  3AE5 C;  5AVY B;  2H89 C;  3VOP A;  3KQG A;  2XAF B;  1W09 A;  4XFJ A;  4CN1 A;  2QE7 H;  1H88 A;  1UX5 A;  4FJO A;  1OZH A;  1UCU A;  1WYC A;  2VKJ A;  1W0B A;  2PRR A;  2W61 A;  3O4X E;  1JTH A;  3C98 B;  5CMZ A;  1B7T A;  3UU4 A;  3AA6 B;  2H43 A;  1J5E T;  3H1L E;  3T97 A;  1BR4 A;  2E5T A;  2N9B A;  4H9Q C;  2X0L B;  4W7Y A;  4AIS A;  3OW2 O;  3VTP C;  4Q25 A;  3G71 P;  5BR8 T;  4DV2 T;  5B66 H;  4W80 A;  4WY4 B;  2FBW A;  3ZN0 B;  2EHO B;  2K24 A;  2ZFC A;  2KSR A;  2BVM A;  4DVD A;  1QLB A;  4CPG A;  3VKG A;  4IL4 A;  1LTI C;  4BRY B;  3PUS A;  1D1C A;  2W4X A;  4X1I E;  1M62 A;  2ZYA A;  4U3F D;  1L0L E;  2K3W A;  2ZXE B;  1PGQ A;  4OYK A;  1BE3 D;  1LT9 B;  4DCK A;  3WMM 0;  4L9I A;  4OGQ C;  3ZN1 B;  5JDQ A;  1KB9 I;  1KFN A;  4HYT B;  2UUA T;  1S5L H;  2J62 A;  5CGM A;  4QKN A;  3CVR A;  1L0N K;  1JY2 O;  2NTY A;  2WPS A;  2YU2 A;  3JAE A;  3VHL A;  2POH A;  4C7R A;  2IUB A;  4YLH A;  5TIS E;  4IL6 X;  3I1A A;  5KX5 E;  2C0W A;  2MTQ A;  3L71 E;  3H1I D;  2NRG A;  3KVB A;  1Z0P A;  1EC5 A;  1FU1 A;  4LLH A;  2W67 A;  1WMK A;  1SLQ A;  2Q3I A;  2YMY A;  2WDQ A;  2WWU A;  3SOL A;  4YT0 A;  2V7Q J;  3TYY A;  2N1G A;  2VRS A;  3ZJ2 A;  2V7M A;  5H6R B;  1GZL A;  3MIW A;  1XTC C;  5AW5 B;  2ZM6 T;  3P8C D;  1AJY A;  5E0O A;  1VQ9 P;  1LWU B;  4ZEY A;  5KAF E;  1XDO A;  5FL1 A;  5AQV B;  1XMQ T;  3A3Y B;  2OAR A;  1FC2 C;  1N7L A;  1LJ2 A;  2KLU A;  1NTM D;  3C64 A;  3PV0 F;  3C1L A;  5FXZ A;  4ZXL A;  2XNX A;  1QVF O;  1IBL T;  1RF0 C;  3OJA B;  1KOR A;  4HFI A;  1VQL P;  1JO5 A;  2XSB A;  1H0T B;  2A06 G;  3USS A;  3H3A A;  1P84 E;  2WU5 A;  1L0N D;  3H1H G;  1RF1 B;  2LXB A;  1PIX A;  4HE8 A;  3AEF A;  2PFX A;  2MPK A;  3KV9 A;  3MGN A;  5AW8 B;  4QH4 A;  4C90 A;  3SWK A;  3ETV A;  1QVG O;  5GON E;  1KQG B;  2XAG B;  1Q7Y Q;  2WSC H;  3I9Y A;  2VKD A;  2XQ5 A;  5FY1 A;  2JO1 A;  1NAY A;  1VF5 B;  2IPP A;  3PHL A;  3M0A A;  1GW3 A;  1SA0 E;  3MA9 A;  2UU9 T;  1GDT A;  3A8Y C;  2ODV A;  1N2D C;  2ZLY A;  3ITK A;  3EHZ A;  3TNU B;  3N9P A;  1SS1 A;  1EZV I;  1URQ C;  2E74 C;  1MMN A;  3O1H A;  4YTP A;  1VQ7 P;  3H1K D;  2YDS A;  3BRT B;  1KNZ A;  3HE4 A;  2HN2 A;  2E5V A;  1LTJ B;  5CBO A;  2C9N Y;  3TLV A;  5J2U E;  4EGW A;  2FYN C;  1LVF A;  3S4R A;  1RQU A;  2BBH A;  3O6Q A;  4WY4 D;  4H63 H;  4CQI A;  3H1L G;  3WUT A;  4YJ2 E;  5APS A;  3A2A A;  2XQA A;  5JDM A;  5L3D B;  3GHG B;  2FYU G;  4NUU A;  3RK2 B;  2BAS A;  1X22 A;  3L75 D;  1QUU A;  3CC7 P;  2CEA A;  3RGL A;  4JF7 A;  2LOS A;  5FY0 A;  5LJN A;  4YHH T;  1S3J A;  2K88 A;  5L3G B;  3BCC D;  4H9R C;  3UFG A;  2Q9Q C;  2VUR A;  1ZRT D;  1L0L G;  3H25 A;  2V5C A;  3OBV E;  5LGN B;  1T7S A;  3Q2M A;  2FY8 A;  2M3E A;  4PNI A;  1FE6 A;  1SFC B;  1KNR A;  3PLN A;  3KIN B;  1K8A Q;  5JH7 E;  2P7J A;  1NGM B;  1WLX A;  5HWY A;  2A45 G;  4UVC B;  1N34 T;  5JRC A;  1H7C A;  1DD4 A;  1D0Z A;  1DX7 A;  1KF6 A;  3M9B A;  2P10 A;  3G6E P;  4HFB A;  1IBM T;  3F89 A;  4MN4 C;  3L3P A;  1TU3 F;  5KAI H;  4U74 A;  3HL6 A;  4L73 A;  3II6 A;  3CXH D;  2XZE A;  5JQG E;  2E9X D;  2M5A A;  2CA5 A;  2WB5 A;  3PUX F;  1S2E A;  3PUW F;  1HTL C;  1NYH A;  1JEK A;  3HRN A;  2X9X A;  2E8I A;  4PD4 I;  1KB9 D;  4AQF C;  2WCA A;  3NBX X;  4YSX A;  4B3M T;  2W62 A;  3E22 E;  3RHW A;  1UII A;  1USD A;  1WRD A;  3N9M A;  4ILB A;  4CI1 B;  3MAC A;  1KN7 A;  3NMD A;  3VMX A;  2WMO A;  2IIU A;  3K3N A;  1FZC C;  4ASK A;  1L4A A;  4A56 A;  3WUU A;  3BAS A;  2CXL A;  1HR0 T;  5ABF B;  5APU A;  2M8R A;  2ODU A;  1AA0 A;  4R4M A;  2W2U A;  2WS3 A;  1NTK D;  3AED A;  3Q5E A;  4H9O C;  4H0L D;  1JY2 N;  3FZH B;  3AAA B;  1YQ4 A;  3L8R A;  4EIW A;  4IE0 A;  2C0S A;  2LHN A;  2D2C D;  3B13 A;  3RL0 B;  1HF9 A;  3L74 D;  1SQP D;  4HEA A;  3WU2 H;  3IN6 A;  3U78 A;  2YO2 A;  1GW4 A;  1FIO A;  1DU2 A;  4EZH A;  2QRX A;  2W90 A;  3LIE A;  5J0Z A;  3N9L A;  2LKH A;  1NU1 D;  2ZM2 A;  2WPV B;  4LFA T;  4ZNC A;  2NPS D;  3N2G E;  4LML A;  3PP5 A;  1WR0 A;  5LBM A;  4L0R A;  5AQN B;  1E79 H;  3ZST A;  5HEU A;  1Z56 A;  2JQQ A;  4HKA A;  1OED C;  2LKG A;  1YKE B;  1VQM P;  1JOC A;  1RE4 A;  3VMZ A;  3UQ4 A;  3VRA A;  1ZHC A;  1OVV A;  5APY A;  3RH3 A;  1D0Y A;  3CQG B;  1WR6 A;  3QB5 K;  4DMW A;  4OVN F;  4WB4 A;  3CQX C;  3RIU C;  4JI8 T;  2AXT E;  2YDR A;  2BVL A;  3T1Y T;  2KT9 A;  3RK2 D;  5AQP B;  3ZT5 A;  4CZZ B;  1H89 A;  3M0D C;  4PFO A;  1KTM A;  3UUM A;  2IDB A;  3P4P A;  5LP6 E;  5HYA A;  1HS7 A;  2BG9 C;  1BDD A;  4I55 E;  1E7P A;  4DR6 T;  1PP9 G;  3KXD A;  3TLU A;  2C9L Y;  3TGU G;  3V4W A;  1I6Z A;  5ADX L;  1SFC D;  2D0U A;  1X79 A;  4AKH A;  5L3F B;  2D9D A;  1JY3 P;  3CXH H;  1G2C B;  4OFZ A;  1N73 B;  4HWC A;  2GM4 A;  1XMO T;  1NTZ K;  2AEF A;  2N1T D;  4YXW H;  1K73 Q;  5EK3 A;  1KB9 H;  2CM0 A;  3MTU E;  4M3L A;  1S72 P;  1J1D C;  2NR4 A;  4L75 A;  2QJP B;  4IE5 A;  2JQK A;  3AE6 C;  3N4X A;  3PJS K;  1HFA A;  2WVR A;  1HX8 A;  3RK3 E;  4JI3 T;  4IDQ A;  4GYS A;  5AQO B;  3U1C A;  2OV9 A;  3Q9D A;  2FXP A;  2RMZ A;  2PP6 A;  1YW0 A;  2ITA A;  4DID B;  3N9Q A;  2I8D A;  3B4S A;  4WY4 C;  4IE7 A;  4OYJ A;  4YJ3 E;  4JI5 T;  3KZI H;  4U72 A;  3RYH E;  3AVR A;  1GL2 D;  2K9J B;  1RHZ B;  2P58 A;  3JC6 D;  4MFR A;  2HOD B;  3AE4 A;  3B5N B;  4D6T J;  2IAK A;  1LTG C;  3R6N A;  4GOU A;  5KTB A;  4EEB A;  4FI5 A;  1SQX J;  1FDM A;  3KHU A;  1EDI A;  1Z8U A;  4O4J E;  4WW0 A;  2WBL A;  3AE5 A;  1LT9 C;  2H89 A;  4TWD A;  1HJB A;  1NOH A;  3VU7 H;  4GYR A;  4YSY A;  4C7N A;  3ZPO A;  2QVA A;  5H2F H;  4A7P A;  2AEJ A;  2IC6 A;  1UGO A;  4MLK A;  1CI6 A;  1GU5 A;  4TV8 E;  3P4R A;  3U1A A;  1UX4 A;  4TUY E;  3IF8 B;  1VQ5 P;  4NIQ A;  5HXR A;  4EZ4 A;  4DBQ A;  2R3C A;  3N9N A;  5JR9 C;  2XPK A;  3O9X A;  2WU2 A;  2XAQ B;  4DR2 T;  5BVZ A;  2YK0 A;  4UEL A;  1MNE A;  2XQ4 A;  4HWD A;  2YIU B;  1US7 B;  2PG8 A;  1JB0 J;  2E9X C;  3TF5 A;  3L70 G;  2O1K A;  1LKX A;  1FMW A;  2K9A A;  2XAH B;  3EAB A;  2WWW A;  3PUY F;  4UV8 B;  2VL0 A;  4H63 V;  1KV4 A;  1YYC A;  4TT3 H;  2UXD T;  2CPB A;  2OTL P;  5HEO A;  4DR5 T;  4ZOL E;  1BGY J;  1LTT C;  4NPE A;  3Q1M A;  2A06 D;  5CCH D;  1LT1 A;  4UB8 E;  2K48 A;  2W6J H;  4DV1 T;  1DD3 A;  2ACX A;  4DMV A;  4OX9 T;  3OYZ A;  2ZVN B;  5APQ A;  4C46 A;  2CMR A;  4I7Z C;  2V6X A;  1HVV A;  3CX5 E;  2CPT A;  2WT7 B;  3EI0 A;  2WZH A;  4I0U A;  1NO4 A;  1X9V A;  2GUV A;  3TK1 A;  2R44 A;  5AW9 B;  5KKZ C;  3K5B A;  4H0L C;  5CCH A;  2FYZ A;  2X51 A;  5JVD E;  1LTS C;  5AVV B;  1JTH B;  4HH2 A;  2E76 B;  1S9K D;  1MFZ A;  1KQF B;  4IL6 E;  2D2C C;  3M06 A;  1E1H B;  3AAI A;  4K0K T;  5HEG A;  1NEN A;  2XKM A;  2KLV A;  2XDJ A;  3L72 G;  1IFJ A;  1RE4 C;  5LJM A;  1OW6 A;  2PJQ A;  1ZME C;  2NPS C;  4H13 D;  1RF0 A;  3EFF K;  1HJ0 A;  1T3J A;  3H1L D;  1GTW A;  3FBL A;  3EQ2 A;  2N9D A;  1VQP P;  4N78 E;  2KMF A;  2NZ2 A;  3I56 P;  2XM2 A;  2FYU D;  2WSE J;  3MP7 B;  3ANW A;  1FMV A;  4Z8X A;  2FJA A;  2JP3 A;  4JEH B;  1MIY A;  1VDF A;  2NTX A;  2KK7 A;  4N3Y B;  5FY7 A;  1U4Q A;  3RGU A;  4DV3 T;  5M1B A;  4ZI3 D;  2J59 M;  1L0L D;  3QWO C;  5FXV A;  1HGZ A;  4PV1 B;  1VQ8 P;  1GK6 A;  2M67 A;  2BKP A;  3CPW O;  4HB1 A;  4L76 A;  1R8I A;  3HE5 B;  4JQ0 D;  1KIL E;  2K37 A;  3OTO T;  3KDS E;  2ZT9 C;  5AQF B;  5GTI H;  4D6T E;  2C5K T;  3GMI A;  1SFC C;  4BAY B;  3C8V A;  1URQ A;  1ZOY C;  2G8Y A;  2DWK A;  3NZP A;  2CCQ A;  1HBW A;  1SQX E;  2IDO B;  2KS1 B;  2JEE A;  2B89 A;  4CXW A;  2FFD B;  3P4S A;  4JLE A;  2N1T C;  5E79 E;  3M65 A;  3GG2 A;  2M0B A;  2BDE A;  4TNV A;  4X5T A;  1SQB J;  4TV9 E;  4UIG A;  2Y0E A;  3ZMU B;  3HUS B;  2KND A;  3A0H E;  4LC1 A;  3RX6 A;  2CBJ A;  5AQL B;  3NVO A;  2IZ1 A;  3ZC0 A;  3RRC A;  4KUM B;  3LJC A;  5BMV E;  2WSC J;  4WVZ A;  3UUB A;  4GKK T;  4E7S A;  4XA4 A;  4X65 T;  1UIX A;  1FZE A;  2IBZ G;  2Q9Q A;  5KJ7 D;  3PUQ A;  3CPZ A;  4GDO A;  4YTN A;  1OIP A;  1Q90 D;  1WT6 A;  1GL2 C;  3JC6 C;  4GT1 A;  2A2F X;  4U2Y A;  3NRY A;  5HXC A;  4LF9 T;  1JMB A;  3TDK A;  2N2N A;  2H7O A;  2FKW B;  1VQN P;  2V6Y A;  1N36 T;  1JCC A;  4IGU A;  1JUN A;  1BGY E;  2B87 B;  3HD7 D;  2FXM A;  3LW5 H;  4GOD A;  2E76 D;  1GMJ A;  1KYO I;  1VL2 A;  3UUN A;  3HE4 B;  1L2P A;  1Y8A A;  2KWH A;  1WCR A;  4IDN A;  2E75 D;  5L47 A;  4QX8 B;  3KBT A;  4QMA A;  4W7Z A;  1PGP A;  3PJA A;  4AQF A;  3N2K E;  1BCC G;  3VP9 A;  3AE2 C;  3KYQ A;  5B66 E;  2GK9 A;  4U33 A;  1JY3 O;  2Y0D A;  3CXH I;  4LMK A;  1T2K D;  3SFD A;  1RH5 B;  3QH9 A;  5F5W A;  2JJL A;  1HWT C;  2RP4 A;  5AQQ B;  3N5L A;  3MZK B;  2Y0C A;  1QL2 A;  2OYH C;  2AE9 A;  4Y99 B;  4ZS2 A;  1KC8 Q;  1FZC A;  3VP8 A;  2PTF A;  4O4H E;  3BK9 A;  3PUA A;  1PV3 A;  4PW8 A;  3H32 A;  1M1K Q;  2LSG A;  5EZY E;  2WWV A;  3V4Q A;  3ZYM A;  2IML A;  1NTZ G;  2A45 H;  3F5H A;  1WYB A;  3KV5 A;  3CCL P;  1IO4 A;  2K1A A;  5LA6 E;  2BS3 A;  2KOG A;  2FJB A;  3K1S A;  2R5B A;  5JRC B;  3M91 A;  1UK5 A;  4AQR D;  4DZO A;  1T3U A;  3HTK A;  1EDK A;  3BAT A;  1PP9 D;  5CCH C;  1DIP A;  2BCC G;  3TGU D;  3PDY A;  4RJT A;  4PV1 D;  3D0T A;  4KP3 C;  5TIS H;  1T72 A;  2WTY A;  4RO0 A;  2WMM A;  3AXJ A;  2JQH A;  5BU5 A;  1ZXG A;  3WUV A;  2XAS B;  5FMN A;  2UUC T;  2NW9 A;  4EAH A;  3L09 A;  2SPC A;  1Y01 A;  4NPP A;  2E5Y A;  5KLI C;  2A3D A;  4H9S E;  1FAV A;  5AVQ B;  2JMK A;  3ZMS B;  1HUC A;  2P67 A;  3VN0 A;  1YHQ P;  3CWZ B;  3UU6 A;  2Z4E A;  3B57 A;  3PU8 A;  3A0B E;  4D6T G;  1OED A;  3OA7 A;  4ILU A;  4CXX A;  4UF0 A;  3A7O A;  3CML A;  1SQX G;  4U3C A;  2R6G F;  5KAF H;  1IFM A;  2X9W A;  4UXN B;  5LMU T;  2H7H A;  4QHO A;  3SWY A;  3L73 J;  3AVS A;  1YJW P;  3PU3 A;  3KFW X;  3RIU A;  4JI6 T;  1J1E C;  2CWY A;  1L4A B;  3RK3 B;  5CJ5 A;  5EK4 A;  3M9H A;  2ZAE B;  3FZM B;  1Q2N A;  2YNY A;  1MZ9 A;  5TJH A;  5AQG B;  2UXX B;  4H13 C;  3EFG A;  3M0D A;  4P1N A;  4JI4 T;  2QSI A;  3I55 P;  1SQB E;  5JDN A;  2X9Y A;  2QJY C;  2BG9 A;  4H44 D;  2XTL A;  2XM1 A;  3CCV P;  1ZV4 X;  1AQ5 A;  5DQW A;  1YIT P;  1FBM A;  2LM2 A;  4ASW A;  4U7Y A;  3H1J J;  2ZM8 A;  4B3T T;  4ZI3 C;  3L75 J;  3FXE A;  1BDC A;  4ZI2 D;  3P7K A;  4PJM A;  2JWA A;  1KQL A;  3HKB E;  2IBZ I;  4GIW A;  3EVY A;  2WZ7 A;  1N7S B;  1U7J A;  3AE6 A;  4X66 T;  4PJ0 E;  2XSA A;  1NWQ A;  3F57 A;  1T98 A;  3PUZ F;  4AYC A;  1YBK A;  1KZU B;  4IE4 A;  3AEC C;  4PK5 A;  5EFW B;  2EHO D;  2V5D A;  3AEE C;  3NWI A;  3GWH A;  1BGY G;  1D0X A;  2ZXX A;  3FHN A;  1XTG B;  3FWN A;  2X9H A;  2W83 C;  1SQV J;  1IK9 A;  1JNM A;  3ZYL A;  1SHZ C;  1FJK A;  4DV7 T;  4B3S T;  4WY4 A;  3L70 D;  2HR3 A;  1MMA A;  4ZKU A;  1SQQ J;  3IR9 A;  3JAF A;  3GLM A;  3LSV A;  3GN5 B;  3OVU A;  3BRV B;  2HH7 A;  3FBZ A;  2XND H;  3IF4 A;  3IHR A;  1RE3 C;  2J58 A;  3R84 B;  3Q5W A;  5AQT B;  1PGO A;  1QL1 A;  5JDH A;  2P1J A;  3RF1 A;  1W2E A;  2CRB A;  1LT9 A;  4L5G A;  1U7M A;  1X79 B;  1KYO D;  2IC9 A;  2NOX A;  3GF3 A;  5HXE A;  5KJ7 C;  3VKH A;  5AQM B;  4YY3 T;  4EI2 A;  5CJ4 A;  2IFN A;  2V7I A;  4RKU J;  4A5X A;  1OED E;  2UWJ E;  4JYA T;  1YXR A;  1YJN P;  3P8C E;  3L71 G;  3E0Z A;  2Y9Z A;  2YMK A;  2V26 A;  2XHE B;  5HWX A;  2WPR A;  2V7L A;  2LRK A;  5HCM A;  5BU8 B;  1NTK J;  2L9Q A;  5KAI E;  2G3A A;  5JR9 A;  3EDV A;  3HD7 C;  5KLV J;  2XAJ B;  1DH3 A;  3SFD C;  2E9X A;  2OA5 A;  1R8E A;  3BQL A;  2O01 H;  1S5L X;  2E75 C;  4DV6 T;  3L72 D;  1JY3 N;  4UVA B;  3L74 J;  1SQP J;  5LHI B;  1IZN B;  1LTA C;  3GMA A;  1A02 F;  2XQ6 A;  2HN1 A;  3AE1 C;  4IFF A;  4P09 A;  2ACZ A;  3ZMV B;  3SS1 A;  3FXD B;  1T2K C;  3C50 A;  3CKD A;  2YKO A;  2V7Q H;  1NU1 J;  3AA0 B;  4CN4 A;  3RK3 D;  5DQV A;  1O3X A;  2YKP A;  3ONX A;  1VQO P;  1IAP A;  3LK4 2;  3OJA A;  5LXT E;  3UIA A;  5DJQ C;  1RY3 A;  1HNW T;  3OKQ A;  1ZLL A;  3HR0 A;  5LHG B;  1E5W A;  2LSI A;  3L73 E;  3KBU A;  1KQS O;  2OTJ P;  5ABH A;  1VF5 D;  4WZX A;  1SQB G;  1YI2 P;  4AQG A;  1CI6 B;  4JPZ B;  3SFE C;  1LP1 A;  4U31 A;  5CA0 E;  2HPL A;  5IHY A;  2JR8 A;  2NW7 A;  1CHU A;  4JYB A;  4PV1 C;  4XBF B;  1SUM B;  5LYJ E;  1N7S D;  2IW5 B;  2JJ9 A;  1EXJ A;  5EK2 A;  1KIL B;  5DJU B;  3MHV A;  3K3Q C;  4GIF A;  1SVF A;  4ZKP A;  2VK9 A;  3H1J E;  3TNU A;  3VR8 A;  5FYM A;  4P0A A;  5C39 A;  4QH1 A;  3L36 A;  2NPS A;  3L75 E;  4NXM T;  3SSU A;  4LF6 T;  4ZMD A;  2FFD C;  2N9Y B;  4QX7 B;  3FZF B;  4OGQ B;  4JI2 T;  1FS0 E;  4HWH A;  3QNU A;  2ZVO B;  5J1G A;  2E5L T;  4ISS A;  3P32 A;  1KYO H;  3Q5R A;  3V5B A;  2QG4 A;  5AVZ B;  2AXT H;  2Q6Q A;  1USE A;  3SWH A;  3IA3 A;  2RN0 A;  3OPC A;  3HUS C;  3RI5 A;  2X66 A;  3NKZ A;  5B5E E;  1NKN A;  3MUD C;  2DLR A;  2WSS H;  1N8R Q;  5CJ0 A;  4XE5 B;  2IBZ D;  2OYI B;  4DOJ A;  1JNR A;  2WIT A;  1PPJ E;  2DCF A;  5AQH B;  1SQV E;  3AEA C;  4AKG A;  1EDJ A;  2KZI A;  1MMD A;  3DTO A;  3T1H T;  4H44 C;  3W67 A;  3FZK B;  3NZQ A;  2LSJ A;  1SQQ E;  2ES0 A;  2CBI A;  2KI7 B;  3ABV C;  3ZCJ A;  2W66 A;  1SFC A;  3R2P A;  1ZOY A;  3N7N A;  3ZC1 A;  2BKO A;  4DUY T;  4JBW F;  4Z91 A;  4OWF A;  1KB9 E;  3LK3 B;  2N1T A;  3UTK A;  4WWI A;  2A45 I;  1AVY A;  3CX5 D;  4ZI2 C;  1JNZ A;  4DR1 T;  4KI0 F;  1ZP0 C;  2OQQ A;  4H9N C;  5APV A;  4IDP A;  4TWH A;  2YU1 A;  1BSN A;  1Y9B A;  2KUB A;  2W6A A;  3PTR B;  1BCC D;  2JKV A;  1T8Z A;  2WPQ A;  2KP8 A;  4L74 A;  2EHO C;  5APX A;  1IFD A;  1JY2 P;  1SQX K;  1NTK E;  1VCS A;  4O2B E;  1OWA A;  3KZI E;  4EB6 E;  1Y47 A;  4DT0 A;  1ZW0 A;  1KD1 Q;  3N9O A;  3AB3 B;  4PJN A;  5KLV E;  1GL2 A;  5FNV E;  3WAK A;  3KV4 A;  3PUG A;  5AVS B;  1YTZ T;  3AEG A;  3L74 E;  1SQP E;  3V2P A;  1NTZ D;  2L5G B;  4IFM A;  2QA7 A;  2JWD A;  1FJG T;  4N78 D;  1X0T A;  3Q5S A;  1FJP A;  3LG7 A;  4B3R T;  5APT A;  4K0U A;  3CX7 B;  3RRW A;  4PK6 A;  4XZC A;  3RL0 D;  2LRL A;  4ZI7 E;  1CUN A;  3O1I A;  3VR9 A;  5A1L A;  1NU1 E;  3VYI A;  2BCC D;  5H6Q B;  2E74 B;  3M9Q A;  1VPC A;  1YD8 G;  3KV6 A;  1QEX A;  3CC4 P;  2LKM A;  3QUJ A;  3L73 G;  3H1H J;  1P84 I;  2FYN B;  3RL0 g;  2XUE A;  2YKS A;  3E1R A;  3JCU H;  3AE2 A;  2WSF J;  3LID A;  4WBA A;  3RBX A;  1UUS A;  2K3R A;  3J7Y q;  1KIL D;  3V2Q A;  1VQK P;  2MKV A;  2Y48 B;  2WP9 A;  3CMA P;  5AW7 B;  5JRE A;  4D6T D;  3VRB A;  1LWU C;  1SQX D;  2JRK A;  2OYH A;  1IFI A;  3JSV C;  2PBI A;  3I0O A;  2BS4 A;  2XQ8 A;  4G63 A;  2CWO A;  1M1J B;  2Q9Q B;  2NWB A;  3HKD E;  1EZV E;  2QEX P;  2Z5I A;  3CWB J;  1MIW A;  2AEM A;  1FZF A;  4M1P A;  2LSY A;  3JCF A;  4DND A;  5JDL A;  3LW5 J;  2MOZ A;  3AA7 B;  2CPS A;  2KIK A;  4E7Z A;  3RK3 C;  4UB8 H;  1RF1 C;  2QM7 A;  3X1D A;  1MFT A;  2H3R A;  3Q2Y A;  3C9I A;  4B6X A;  1BR1 A;  1E2A A;  3CX5 H;  3E7K A;  1W5C E;  3T97 B;  5F8P A;  2LE8 A;  2FYU J;  4WNK A;  3CD6 P;  1SQV G;  1VOM A;  4Z90 A;  1EQ7 A;  5LOV E;  1ZEE A;  1M7L A;  1VF5 C;  4O4I E;  4GKG A;  2RKL A;  4EDF A;  4O2A E;  4NPF X;  5LG3 A;  3PUR A;  1L0L J;  2B9B A;  1PFI A;  1J1J A;  1SQQ G;  5LMN T;  3F2E A;  3S4U A;  4QXB B;  3UU3 A;  1VCT A;  4JBZ A;  1FZA A;  1N7S C;  2O3J A;  3CCE P;  2CXF A;  2W6B A;  2BEZ F;  1BGY D;  2FJE A;  1LTJ C;  5HEJ A;  1XWM A;  1G1I A;  3ZYK A;  4F8H A;  1G1J A;  2BBJ A;  1PL5 A;  2VVN A;  4PAG A;  3PH0 A;  2H7V C;  3MD0 A;  4TZ4 C;  1FDI A;  3B5N D;  3GHG C;  5AFU L;  3MK7 C;  1H8A A;  4O4L E;  4LFC T;  3PE0 A;  4HWI B;  3RK2 C;  3CCJ P;  4UB6 H;  2DWG A;  1KMI Z;  1NEK A;  4B86 A;  4YPC A;  3CL3 D;  4BJM A;  2XJ7 A;  4LF4 T;  4PD4 E;  3HTK B;  2K9J A;  2E42 A;  2HOD A;  4COF A;  2JIW A;  3RC3 A;  2KYV A;  2DL1 A;  1YTZ I;  3A5X A;  3P4W A;  1IJ6 A;  4F6R C;  1VRB A;  4YTM A;  4MAL A;  2B88 A;  1FDO A;  5AW4 B;  2QGS A;  1ZR2 A;  1BR2 A;  4YXD C;  3EDU A;  3V5S A;  4WBN E;  2KWI B;  3SRZ A;  5JTG A;  1SQB K;  1LVK A;  1BR0 A;  5L3B B;  3L71 D;  1W0A A;  1M90 Q;  2F4V T;  1HTJ F;  1OED B;  1NVO A;  3AEC A;  3AEE A;  1JM0 A;  1EZ3 A;  4UF0 B;  5HAX A;  4HFH A;  4YFS A;  4IHJ E;  1CSB A;  1L0V A;  4LMJ A;  1AV1 A;  2H88 C;  4I50 E;  4EOZ B;  1S94 A;  2WZI A;  3PJA J;  5FP3 A;  5CB4 E;  3AE3 C;  2QJK B;  2A06 E;  4J2C A;  5GTH E;  2PGD A;  5FVK A;  2KLQ A;  5LNK A;  3H1H E;  2V4H A;  4DV0 T;  1W2B O;  5IYZ E;  3RKG A;  5F3J A;  3S9O A;  3P7I A;  4I43 B;  1RE3 A;  2BG9 B;  2WM9 A;  5CCG D;  2QA4 P;  1EDL A;  3ZMT B;  3AEG C;  2X68 A;  3MXZ A;  4U3F J;  3CCM P;  3C4W A;  4NPD A;  3P4Q A;  3AEB C;  5FL0 A;  2HPC A;  1HH0 A;  5KJ7 A;  3GW6 A;  2XU6 A;  3WAJ A;  1BE3 J;  1P84 D;  1EZV G;  1PZQ A;  2WSS V;  4IDO A;  5DAB A;  4I1L A;  5L3E B;  2WMN A;  3HI2 A;  1J1D B;  2OGU A;  1SQB D;  2IYO A;  2WT7 A;  3CWB E;  1KNP A;  3ONL C;  2UXC T;  5AQS B;  3PTZ A;  2C0X A;  4AKR B;  3RL0 C;  3AAE B;  5J2T E;  3O6Q B;  2LSK A;  3H1I J;  3HD7 A;  1M8O B;  2IHR 1;  5L8R J;  4O9B A;  4LFB T;  2ZJS E;  3WI3 A; 
#chains in the Genus database with same CATH homology
 2HR3 A;  4MN4 C;  2LR2 A;  5CBN A;  1H0T A;  1EDK A;  5DJU B;  3MHV A;  3QB5 A;  2M0B A;  4HKZ H;  2M5A A;  5C39 A;  2Q1K A;  2WMM A;  3AXJ A;  4ZMD A;  1H0T B;  1ZXG A;  4NPE A;  4HJG H;  1LT1 A;  1U7M A;  2B87 A;  2LXB A;  2K3R A;  2B88 A;  3FXD A;  2R44 A;  2UWJ E;  4ASV A;  4IOI H;  4WYV A;  5K5G B;  1KEY A;  1EDJ A;  1NVO A;  2KZI A;  1JM0 A;  3RIU A;  4CPG A;  1OVR A;  2ZAE B;  1SS1 A;  2M5A B;  1Q2N A;  2OTK E;  2I8D A;  1JMB A;  2KZJ A;  2KI7 B;  3AXJ B;  3PJA J;  3ZDM A;  2P58 A;  1DEE G;  2KIK A;  5CBO A;  2B87 B;  1MFT A;  4WWI A;  4GOD A;  4EYY Q;  1EDI A;  2SPZ A;  2QRX A;  4BXL A;  4ASW A;  1OVU A;  3MZW B;  4GOE A;  3PJA A;  1FC2 C;  1EDL A;  2LXC B;  2KUB A;  3FXE A;  4ZNC A;  1BDC A;  2QVA A;  4NPD A;  4GOF A;  3S1K A;  2RKL A;  4NPF X;  1S3J A;  1U7J A;  3RGU A;  1EC5 A;  1OVV A;  1J1J A;  3QWO C;  3QB5 K;  1Y47 A;  5DJT B;  5EFW B;  4K35 A;  3RIU C;  1LP1 A;  4HB1 A;  1ZW0 A;  4JBZ A;  4K3A A;  4KJM A;  1LP1 B;  2JWD A;  3PH0 A;  1X0T A;  2KS1 B;  2B89 A;  1BDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...