2QVAA

Crystal structure of drosophila melanogaster translin protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
182
structure length
182
Chain Sequence
VNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERSLNISHFIGDLNTGFRLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GM27569p
publication title Crystal structures of Drosophila mutant translin and characterization of translin variants reveal the structural plasticity of translin proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 69
structure length 182
sequence length 182
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2qvaA02
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 2qvaA01
3QB5K 3MZWB 3S1KA 3AXJB 3MHVA 2QVAA 4HKZH 4GOEA 3PJAA 2B87B 1KEYA 4KJMA 2KI7B 1S3JA 4GODA 1ZXGA 4HB1A 4ZNCA 4NPDA 4K3AA 2WMMA 2LXCB 1BDCA 2B88A 1LT1A 2R44A 2OTKE 4IOIH 1H0TA 5EFWB 3FXEA 2KUBA 3QWOC 2UWJE 5DJUB 1Y47A 4NPFX 3ZDMA 1H0TB 1U7MA 1EC5A 2ZAEB 4WWIA 2K3RA 1SS1A 1EDJA 1MFTA 1OVRA 4ZMDA 4NPEA 2HR3A 4MN4C 3PJAJ 5DJTB 4ASVA 4EYYQ 1BDDA 4GOFA 1U7JA 1EDKA 3FXDA 5K5GB 2LXBA 3QB5A 5C39A 5CBNA 2KS1B 1EDIA 2M5AA 2LR2A 2P58A 1JMBA 2Q1KA 1EDLA 4HJGH 4JBZA 1JM0A 1DEEG 2M5AB 1OVVA 2KZIA 2RKLA 3RIUC 2M0BA 4CPGA 1NVOA 2KZJA 1X0TA 3RGUA 1Q2NA 2QRXA 1LP1A 4BXLA 4WYVA 1OVUA 1ZW0A 2JWDA 4ASWA 5CBOA 2I8DA 3PH0A 3RIUA 1J1JA 4K35A 1LP1B 2B89A 3AXJA 1FC2C 2SPZA 2KIKA 2B87A
chains in the Genus database with same CATH superfamily
1KILC 5AVZB 1GW3A 2XAFB 1LTSC 1L0LD 3AXJB 1KN7A 1NHLA 1X79B 3KHUA 1CZQA 3OJAA 4H9OC 3WU2H 2GM4A 4DVDA 1HGZA 2CK3H 5L3EB 2JMHA 1SQBD 2IIUA 1E79H 3PHLA 1KYOI 3CC2P 1N73C 1LTAC 3HL6A 3HR0A 5LHIB 3AE8C 3NZPA 1D1CA 3MZKB 2C0WA 2A72A 5EFWB 4IDNA 2XM1A 3FXEA 4H44D 2XQ4A 4JI1T 2OGUA 2IHR1 3ONJA 5FKYA 3QWOC 5CJ5A 3DTOA 4RO0A 1SUMB 4EIWA 2A06D 4HWIB 5BMVE 4AYCA 2ZAEB 3TGUJ 4WWIA 4LF7T 2X9HA 2NPSA 1L0NJ 3H37A 2HN2A 3ZN1B 4NPEA 2BBHA 1M1JB 1N33T 2JP3A 1IBLT 4EOTA 2XAQB 5HCMA 1FE6A 3L73G 3CCUP 2AXDS 1JNMA 1E7PA 5E0OA 1EDKA 4DV7T 1S5LH 2LXBA 5FL0A 2CPBA 3UUMA 3J7Yq 4DV2T 2Y0EA 2M5AA 3GHGC 3AE4C 2VKOA 3L8RA 5LBQB 2Q1KA 2D0TA 4HJGH 3D71A 4HEAA 4HH2A 4JBWF 4UF0A 4C91A 1FDMA 3H3MA 2YOEA 2ZXEB 3P4SA 3S9OA 4AUWA 4OGQB 1X8YA 3E1IA 3CWZB 3ANWB 3A2AA 1YHQP 4UB8H 4ILCA 1LWUC 4OHFA 4A98A 1ZLLA 2WSEJ 3HTKA 3L73D 1J1JA 4YLHA 3F57A 2W4XA 2IZ0A 4KMCA 1SQXK 1VQOP 4R4MA 5IWAT 3JCUE 2BG9C 2BVMA 2RH0A 1FDIA 2WSSV 3Q9DA 3N4XA 2WBLA 3SS1A 4B3RT 4N3YB 4PFOA 1BR0A 4U7JA 3HKBE 4HKZH 2N1TC 3HE4A 1KFMA 3AE6C 2NW9A 4M1PA 2A2FX 2WZIA 2DI4A 2V7QH 1PFIA 1S3JA 3ZMSB 4DV3T 4HB1A 1CW5A 3OJAB 1JNRA 2LHRA 4GYRA 2NZ2A 4H9QC 3RYFE 1SFCB 3VMXA 1WLXA 5BU5A 3CK6A 4YSZA 1FZCC 2X9WA 4D6TE 4CI3B 3LJCA 2WDRA 1PIXA 4X20E 1DX7A 1SQPG 4JI8T 1JMMA 3FXEB 3EFGA 2LEHA 4DJGA 2K37A 1NH4A 5ABGA 1MFTA 3H1IG 5JH7E 3RX6A 2DHRA 2ZM6T 1HS7A 3CI9A 3IN6A 5CHXA 2W6BA 5L47A 1IJDB 2G0UA 2NPSB 2FYUK 2FXMA 2PAJA 3CCLP 3HD7C 3H1HG 4QH1A 1UK5A 5HXHA 5LXTE 1S1CX 2QGSA 2V5CA 4ILBA 3JC22 5LP6E 3ETVA 2PBIA 1SLQA 4JI0T 1NTZK 1O3XA 5IHYA 4C46A 3HRNA 1S2EA 5FXVA 1FJGT 3AEFA 1FZAA 3FB2A 5ETWA 4MALA 1HTLC 1UIXA 2JO1A 1M57D 1X22A 3V2RA 1KD1Q 2LR2A 4PJNA 1A02F 1MKMA 3MK7C 3BRTB 3II6A 2AEFA 1XNRT 3CWBG 2Y0CA 5KAIE 3HUSC 2M5AB 4GKGA 2YK0A 3H1ID 2R3SA 5KMGP 1SQVG 3FGAD 3TKLB 1VDFA 2VL8A 4U74A 1Q81Q 2W63A 3FWLA 3RK3E 1BSHA 1JNZA 3L72G 2W0GA 3OKQA 4UF0B 3BATA 3ZT6A 3RYIE 1LP1A 3AVSA 1VQ6P 1CSBA 2NRGA 3WUVA 3H1HD 3FHNA 3NBXX 3L71J 1YJ9P 1WRGA 4CI2B 4H0LD 3WAJA 3WAKA 3RBZA 2K3WA 2KSJA 3VR8A 1CI6A 1EZVI 1Q7YQ 3VOPA 3BCCE 2E74B 2L3LA 4AQGA 4EV6A 3T97A 3TGUE 3KXDA 2A45I 2N1GA 2CBJA 4QMAA 1RF1A 3I0QA 3AECC 3FZMB 4I1LA 5AW4B 4W7ZA 1FJPA 5CA0E 3CCQP 2BBJA 4QH4A 3ZYMA 5LHGB 1VL2A 3JCUH 1L0LE 1E1HB 3CXHD 5IYZE 3CWBD 3UQ7A 1G2CA 3SWKA 1L0NK 2EHOD 3TSIA 4U33A 4KHPT 1AQTA 1SQBE 2ZLYA 4W7YA 5KKZC 2E75C 2H88A 5KJ7A 1KQSO 2OYIC 5FXXA 2YU2A 1UIIA 3LW5H 2UWJE 3TLWA 2VURA 2QM7A 3L74G 1V9DA 2NTXA 3H1KD 2Y8DA 2XV5A 2K3RA 2FYZA 4G63A 2A06E 1CHUA 2I6HA 4X66T 5JRCA 2E76C 3N9MA 3CX5I 2QE7H 2PRRA 2QYWA 4JI5T 4MN4C 3LDQB 3RK2B 1Y01A 2L8KA 4HFVA 2BKNA 1YQ4C 3L4FA 5JR9C 1CUNA 1YXRA 1L2PA 2IDBA 2WWWA 1KNRA 2IC9A 2QJYC 4IREA 1W0AA 1OMIA 5C39A 2FFDC 2WM9A 3QC9A 5AVYB 5J2UE 3P8MC 3L74D 4DV5T 1EDLA 3ABVA 4IDQA 1ZP0C 3JCFA 4PK6A 1DEEG 1WYCA 4YPCA 4I0UA 5B66H 5J1GA 3H1KJ 3MTUE 3CCSP 3W68A 2POHA 2KLUA 4HFIA 4LFCT 3RGUA 5KAIH 1Q2NA 1ZOYA 2QRXA 3PU3A 2IBZG 2W67A 3GLMA 3QNUA 3LK3B 5AQJB 2KLQA 2P10A 2PTFA 3PUAA 4C7RA 1L4AD 3LIDA 2Y0DA 2E9XD 1I94T 4ZXLA 1LP1B 1LVKA 3H6PA 2YNYA 1N7SB 3L73E 3M9BA 1R8EA 2D2CD 1KB9I 4DZOA 3B5MA 1DIPA 1FAVA 1CI6B 5FY7A 1YBKA 3FZLB 3T97B 2XQ3A 2R6GF 1XTGB 4GOEA 3G06A 1LTGC 1RF1B 2YIUB 4K0UA 1KILD 2OTLP 5E79E 3PUXF 1D0YA 3CCVP 2XM2A 4K3AA 3M0DC 1VQ7P 3PDYA 1G2CB 2XQ9A 1YTZI 2IBZD 1DH3A 2KSRA 2OTKE 3HE5A 4IL6E 3UULA 5CMZA 4P1NA 2LHNA 5TJHA 3IF4A 2XU6A 3ZDMA 2KK7A 3AE7A 4NPPA 5KLVJ 3AAEB 1IFJA 2KYVA 3AE5A 3JSVC 3VKHA 1EDJA 2E5YA 1XNQT 3L35A 2CLYB 5HXEA 2LOSA 3C98B 1AJ3A 2I1JA 1BCCG 2JWAA 3F89A 1YKHB 4Z1MH 3UU4A 4LF4T 2WQYC 4U72A 2JJLA 2PFXA 3F2EA 4OWFA 1GK6A 4CZZB 1J1EB 5JRCB 2HODA 4LMJA 1JY3N 4TWFA 2C5KT 3AEEC 2XZRA 3H1LG 2WWVA 4H9PC 5LB7B 1LTJA 2Y48B 1USEA 4DV1T 4TWHA 2V26A 1URQC 4QXHB 3Q1MA 5L3DB 1GL2C 1ZN5A 5LJNA 5APVA 2CCQA 3KV6A 1J1DB 2KWHA 4Q25A 4DR5T 3F31A 1M8OB 5GTHE 4AQFA 4ZI2C 2KZJA 4PD4D 1BCCD 3Q5WA 2YMKA 1ZRTD 3P32A 2XKMA 3H1IE 1T98A 5HYAA 1AA0A 1Z56A 1HNWT 4XFJA 1EQ7A 4PV1B 2JWDA 4GDOA 2XHEB 1OFCX 2LSIA 3H1LD 2WTYA 3CMEP 5AW7B 4I7ZB 4O2BE 4HWHA 1FZBA 1HF8A 4ASKA 4O9BA 4I2LC 2WPVB 2XJ7A 3CQGB 3ZT5A 3CQCB 3AEBC 3NWIA 5IUXA 3VP8A 1SP4A 2CWOA 2J59M 5CCHC 1Y9BA 1KEYA 5L3GB 1NJIQ 1NU1G 2LT3A 5HWYA 3CXHE 3CWBE 4U7YA 3RIFA 2N1TD 1W5CE 3RPUA 2QA4P 2UXBT 3K3OA 5E79H 3OA7A 1HX8A 2X51A 2E8IA 2YKSA 3ZMUB 3Q5EA 4TUYE 5AQQB 2V5DA 3WU2E 2IC6A 5JDHA 2I1KA 4ZKPA 3HE5B 2W90A 1YD8G 1BGYG 4X62T 4JYAT 3K3QC 1EC5A 1PGPA 5AW0B 2PGDA 4Y28J 5AVXB 1PL5A 2NW7A 3H1KE 2Q6QA 1VQ4P 1T2KC 4OYKA 3H3AA 4DR1T 3OPCA 1NKNA 1NU1D 5FY0A 4ZI3C 2K5BB 4YTPA 2HG5D 2ZMAA 3PV0F 1BDDA 3ZT7A 3LG7A 3A8YC 2XASB 1MNEA 1YTZT 2Q5UA 2H7HA 3ZKRA 1NTMD 3HD7D 2HODB 4QKNA 4EOZB 1QGKB 3QB5A 2E5TA 2OQQA 3NXSA 1JY2P 4BJNA 2MAWA 1LTJB 2KB7P 1BGYD 2W83C 2ZJSE 3MUDA 3NZQA 5LNKA 2IZ1A 4O4IE 4BA9A 3L37A 1KMIZ 3L74E 2H89C 5AQMB 5LCYA 3PUGA 2IFMA 4LF6T 3P7IA 4CN1A 3P4WA 2QA7A 5GTHH 3LW5J 4EZHA 2FYNB 2V1DB 3LSVA 5AW1B 1OVUA 2P9BA 2BASA 3C4XA 2M3EA 1ZW0A 2E43A 5L3BB 2Z4EA 3N9QA 3MXZA 1RH5B 1ZR2A 4D6TJ 4O4JE 2LSYA 2YMYA 2WB5A 1M1JC 1HX1B 1L4AA 5AQHB 2C9LY 4CN4A 3H32A 1GDTA 1IAPA 5LHHB 2WZ7A 1KF6A 3MZWB 2CBIA 3CMLA 1XMQT 1NTMJ 3ZSTA 1HNXT 2QVAA 2WCAA 4LMKA 2CXFA 1M56D 4YTNA 5KLVK 4KJMA 1FZGA 3O1JA 4AKLA 3SSUA 2LKHA 2V7JA 4JYBA 1LKXA 2BS2A 1H7CA 3KV4A 1KILA 1KILE 2K1AA 3EDUA 1Y8AA 3Q2MA 1HG2A 3MGNA 1MIYA 1K73Q 5EZYE 3NFQA 3L3PA 4WNKA 5AQKB 5AFUL 4WZXA 5LGNB 3CXHH 3BRVB 4ZOLE 2WZHA 2IBZE 1S9KD 2WMOA 3PU8A 2SPCA 3CX6B 1YQ3C 1QX8A 4EEDA 5AVQB 2E75D 4UV8B 2G3AA 1IJ5A 3PRJA 3DJBA 5AVTB 4I50E 1T6AA 3E22E 4GT1A 2PG8A 3PJSK 1NAYA 1FZFA 5FY1A 2VWAA 5F3JA 2BKPA 3E7KA 3OYXA 3JAFA 1LGHB 1KZUB 2IFNA 3GW6A 5HXSA 5CCGC 2AXTH 5APQA 4IFMA 2E76D 3L70G 1J5ET 3L75G 4U3FJ 3AE2C 3SFDA 4P09A 3AE9C 1MMAA 4AQRD 2WWUA 2W61A 2X0YA 5DQWA 3Q2YA 3D0TA 3N9LA 3BCCJ 3H1JD 2K9JA 2LRLA 2IYPA 4LGDE 4JLEA 1M1KQ 3RRWA 3ZEFB 5APXA 2KNCA 3GF7A 5A1LA 1W2BO 3ETUA 1SFCC 1L0LJ 2OYHC 1VF5C 4JBZA 5L8RJ 4NXNT 3NMDA 3A5TA 3T8OA 2JDIH 3CC7P 5AVSB 2XQ5A 1X0TA 3GHGA 3ONLC 4XZCA 1SQBJ 4PD4E 1BCCE 4YXWH 2ODVA 4IDOA 4C7NA 1ZRTE 3S4UA 3L70D 3FBZA 2O1KA 3L75D 1GZLA 2GUVA 1PP9G 5AQLB 5CBOA 2C0SA 1EZVG 3TK1A 4NUVA 2KP8A 2NPSC 3M0AA 1FC2C 3H1LE 2A45G 3HKDE 4EB6E 1M7KA 4X65T 3H1JJ 3HKCE 1L4AB 1FS0E 1HUCA 4IFDK 1KQFB 1QVFO 2X9XA 1P84D 3H32B 3QH9A 1K04A 5TAOA 4LFBT 3T1HT 1QVGO 2O01H 1ZV8A 4MFRA 1U5PA 3C50A 1ZXGA 4LC1A 2X0HA 4HN9A 4IDPA 5AQTB 2WMMA 2LXCB 2IPPA 3L39A 2E5LT 2N1TA 4GK0E 3AA1B 1KILB 2VVSA 2DL1A 5AQIB 2CPSA 1PP9D 1PPJG 3U1AA 4FJOA 2C0XA 1Q86Q 2KMFA 4CXXA 5B5EE 3Q5RA 2ZYDA 1X9VA 5FXZA 1AJYA 3KBTA 2VQET 3NTNA 2WAUA 1FZCA 1DD3A 2LKMA 3UU8A 3UFEA 2XSAA 1WMKA 4WBNE 1X9BA 3NRYA 2R5BA 3A7OA 1NU1E 3B13A 1SQQG 3EVYA 5AQVB 4YXDA 2JQ9A 3I9WA 4OK0A 3PUWF 3EUHA 3L73J 3FXDA 1G1IA 4ZKUA 5L2LA 5L4HA 1PPJD 1HBWA 3HD7A 1NTME 4EYYR 3M3ZB 3UU5A 5AW3B 1FZEA 1YI2P 5KLIB 4QX8B 1DD4A 1LT9A 2K9JB 2ZFCA 1JY3O 1URQD 3UTKA 3RHWA 5KDMC 1OVVA 2KNCB 1FOSF 1GL2D 3V5BA 3CX5D 3RKGA 4V1Av 2FJBA 1GK4A 3GG2A 4UV9B 3SWHA 3RC8A 2ZYGA 1K8AQ 4DUZT 2QEXP 3Q5DA 1WFDA 4ZI2D 1YIJP 2C9NY 3EWKA 3HUSA 2RN0A 3ZMTB 3GHGB 1SQQD 3BQLA 5LJMA 1HJ0A 1BR2A 1UX5A 2LSJA 5B66E 4PD4H 3I56P 1LRZA 2X68A 3X1DA 2W00A 4DIDB 4C7NB 4HWFA 1SQPD 5H6RB 4GKJT 3RK2C 2SPZA 1EXJA 2B87A 5HAXA 5L3CB 3ZCJA 2OV9A 3CCRP 3S1KA 3NVOA 2P2UA 3ZC1A 3AEAA 1AVOA 3RC3A 4EZ4A 1OIPA 1XZYA 2FJDA 2WMNA 4HFCA 2KI7B 2JIWA 1W2EA 3U1CA 3V4WA 4U3FE 3C8VA 1HFAA 3N7NA 5CCHD 3A0HH 4ZNCA 3AECA 2H7OA 3TNUA 3AEFC 1OXZA 2B88A 1LT1A 5CJ4A 4HWCA 2RMZA 3ZJ2A 5FNVE 1NGMB 2MJZA 3N9NA 5TISH 3HTKB 4PAGA 2K9AA 3BQKA 4KP3C 2N1TB 2ZT9B 3CPWO 1S9KE 4EEBA 4Y99B 4EYUA 1VQ5P 1SQPJ 1W9RA 2FBWA 4Z91A 1SQVD 4TN7B 3MIWA 2OYIA 5B5EH 3HE4B 5HCJA 4WY4C 1D1BA 2N2NA 2I0MA 3L72D 3H1IJ 2BCCG 3FX0A 4IFFA 3JADA 1N7SC 1KNPA 1L0LK 4DT0A 2A3DA 1LNQA 1FZCB 4HE8A 5JDNA 2XQ6A 3B4SA 2UU9T 1T2KD 3H1HJ 3CCMP 2ACXA 1RF0C 1SQBK 4ZI3D 2YIUC 2CHNA 3KZIE 3RIAA 2LM9A 3USSA 4UVAB 3H1JE 2CPTA 2M6BA 1YQ4A 3RH3A 2YDSA 3FXDB 1OZHA 1JM0A 3HD7B 3N2GE 2CE7A 4U7IA 1RE3C 5LMUT 2YKQA 3RIUC 2W27A 2M3BA 3TF5A 1LT9B 3CWBJ 3NKZA 5CGMA 2ZXXA 1QSDA 3RLFF 1MIWA 2BCCD 2NW8A 1SQVJ 2DLRA 3ZMZB 4TLFA 5KJ7C 4RJTA 4L73A 3RBXA 1NTKG 3RL0g 5AW6B 3L72J 1N7LA 2H8PD 4EI2A 2CLYC 1KC8Q 3PTZA 1M7LA 2B89A 3K5BA 3L75E 4E7ZA 4JUYA 1R8IA 1FBMA 4JEUB 3D6YA 3HUSB 3GF3A 3RL0C 1AVYA 2XSBA 4H13C 2XNDH 3CCJP 3MHVA 1NAFA 2JR8A 1Q90D 4I6MC 3KV5A 1IFIA 2B87B 1KORA 3GA8A 5HEJA 1KQLA 4L0RA 4ZEYA 3CMAP 2M67A 4C90A 4H9NC 3CCEP 1P84E 3WI3A 3RK3B 2KSEA 2WSFH 2OTJP 2FY8A 3RQWA 1BDCA 4UELA 1AV1A 2XNXA 1NTKD 2E5VA 3TLUA 1WT6A 3TNUB 3KV9A 1WR6A 5L4EA 3HA4A 5AQFB 2HHHT 1S72P 1HWTC 3PUVF 4HKAA 4KUMB 4IT4A 4H9RC 4ISTA 3L74J 4PV1C 2JEEA 2R5DA 2LM2A 4MLKA 1IZNB 3TLTA 3JAEA 4WW0A 3OBVE 2YO3A 5BU8B 2JQQA 3ZPOA 2NWBA 3ZLIA 1NKZB 4N6JA 2WSCH 3CXHI 3VKGA 1A02J 1R5LA 1T3UA 2CXDA 1Y64B 2OYIB 1S4XA 3EHZA 5JREA 2Z5IA 4EYYQ 4EIJA 1N86A 5JDMA 1DU2A 4FI5A 2KS1A 2MPKA 1U7JA 5CCGD 2YXQB 2WQYA 4B3MT 5AQPB 1JEKA 4F8HA 4GIWA 4HGAA 1MZ9A 2WSSH 2IUBA 4H44B 2HPCA 2O01J 3AEEA 2BEQD 2BS4A 1BE3G 4L74A 3KZIH 4XAXB 1GD2E 3SFEA 3AEGA 1KFYA 4ERRA 5AW9B 2Y9ZA 1E5WA 5JQGE 2CWYA 1NVOA 4TT3H 4YY3T 3V2NA 1RHZB 2IX7C 1SFCD 2P7JA 3P7KA 1VF5D 3CX5E 2QJYB 4YSXA 1BSNA 2Q9QC 4GYSA 4KHZF 5KAFE 1AQ5A 2L9QA 4AQYT 2FUPA 3AA0B 3AE5C 5CA1E 1VQ8P 4BAYB 1SQQE 3U3IA 1OEDC 3V5UA 2XY8B 5HWXA 1T8BA 1SQPE 1XMOT 2H7VC 4A97A 4AISA 2W2UA 2K48A 5C2TA 1BE3D 2NPSD 2XQAA 2N9BA 2QM8A 5AVWB 4H63H 4X1KE 2IW5B 1VCSA 4LF5T 1VQKP 2IMLA 2Q7CA 2WITA 1SQXG 4XBFB 4IE5A 2Q9IA 1IK7A 3N9OA 1XDPA 3VYIA 3G71P 1LTJC 3H1HE 3S4RA 3L36A 4GKKT 5CCHA 1P84H 4A5XA 5AW2B 3V4QA 2PFVA 1IO4A 4A7PA 1ZMEC 2D2SA 1IFDA 3A5XA 2O3JA 4K0KT 4EXTA 1IJ6A 5LGTB 1MNDA 1YJWP 2OYOA 1MUUA 2VRSA 3ESLA 2FXOA 3VU7H 3KDSE 2GA1A 1SQVE 1NWMX 3PJAJ 2C5IT 3NRXA 3T1YT 1BCCJ 2EHOA 2A45H 1LVFA 3L72E 3CX7B 1SQXD 3RYCE 4EGWA 4I43B 4XA4A 5M4YA 3TDKA 1SVFA 2CA5A 2X9YA 2VQFT 2YDQA 3H1LJ 3R4YA 4A56A 3AEDC 2KS1B 4EAHA 4LMLA 3AE1C 2FYUG 2AXTE 2V6XA 1HG5A 4B6XA 2LLYA 2Z5HA 4QHOA 4YHJA 1X79A 3B5NC 1OX3A 1NTZG 2HPCB 1WRDA 2AEJA 1KYOD 1JY2N 1L0VA 3O8ZA 3IBPA 1IBKT 1OW7A 4WYVA 2XUEA 1Z0PA 2UXCT 2BCCE 5ABEA 1K05A 5AVUB 5DABA 3ONXA 5APUA 2H89A 2MBGA 4PJJA 1NENA 2K88A 4K35A 3CX5H 3N2OA 3I55P 3AE3A 4GK5E 5AQOB 3RRCA 4L9IA 4JQ0D 4YFSA 3LK2B 3MKDA 5KAFH 4PFPA 1PZQA 2Y6XA 2LSKA 3QB5K 3VMZA 3ZMVB 2FYUD 3OYZA 2DCFA 2C5JA 3SOLA 1ZKEA 2AE9A 3KBUA 3RK2D 3JC6C 2K9YA 4YTPC 5FL1A 5LYJE 1PGOA 1NTZD 2J1DG 4MBQA 3CX8B 4GODA 3QK6A 4RESB 1G8XA 2XAJB 1NU1J 1T3JA 1HR0T 3I1AA 2E9XA 1FEWA 1KFNA 2FJEA 2ZM8A 2KUBA 4BJMA 3UFGA 1N2DC 1NTKE 4CXYA 4H0LB 3TGUG 3V2PA 4ISSA 4P0BA 1FU1A 1NEKA 1L0NG 1QLED 4ZI7E 4IGUA 2XQ7A 1RE4C 2HFED 3KDPB 2VKJA 1LTIC 5EK4A 2WDVA 3Q5XA 4JI7T 5CB4E 3G3ZA 4W80A 3AA7B 4COFA 1BGYJ 2CEAA 4JV5T 1JO5A 3KVBA 3OAKA 2HR3A 1HNZT 3VP9A 4TX5A 1FJKA 1YQ3A 5AVVB 4JF7A 2UUCT 2YKOA 3W67A 4IE7A 3BK9A 2PP6A 4WVZA 4ZS2A 4B3TT 2FKWB 4ILUA 4WY4D 2B9BA 1KV4A 3O6QA 4OGQC 2HPLA 3VMAA 1N7SD 4IE0A 2EHOB 1H8AA 1N73A 3O1HA 2QJKB 3HKEE 3AE8A 5JDFA 3O9XA 4JYCA 5FP3A 1Z8UA 3C51A 5DJQC 3TGUD 3R2PA 1FIOA 1UURA 4BRYA 4UR9A 3AE2A 1L0ND 2A06G 1U57A 3AE9A 2WSFJ 3RGLA 3TLVA 4PJ0H 2KLVA 2KZIA 2RKLA 2DWGA 4X5TA 3E1RA 4DUYT 2P67A 3SRZA 3O4XE 3KYQA 2QSIA 2HPJA 3RKOA 4BXLA 4AKHA 2D9DA 1SFCA 1RQVA 2OYHA 1J2JB 1IC2A 3N2KE 2JJ9A 5KJ7D 3ZCIA 1JTHA 2ZVNB 1NWQA 1H89A 3L09A 2VKDA 2V7MA 2WSCJ 3A3YB 2B76A 1WCRA 3K1SA 1IBMT 4YJ3E 3EQ2A 2QJPB 2LJLA 5LA6E 1QEXA 3PJAA 3RL0D 3AE4A 1JCDA 2RPAA 1BE3E 4H13D 3MP7B 2CHOA 2V6YA 4PW8A 4CN6A 3SFDC 4TNWA 4O2AE 3PURA 5KLIC 1BR1A 5AVRB 3IHRA 2H43A 2UUBT 5LMNT 2R44A 3CVRA 1IK9A 2O01N 3PTRB 4KX6A 2ZVOB 3H25A 4HFEA 3KINB 1LWUA 5DJUB 5GTIE 4IHJE 2E9XB 4HYTB 3M91A 3A0HE 3CQXC 1UCUA 2YU1A 4PNIA 1JCCA 4H9SE 1SS1A 3VTPC 2D2CB 2VKHA 5F8PA 4X64T 4ZMDA 5J2TE 1USDA 2BG9A 4ZZCA 2BG9E 2XQ8A 2WDQA 5TISE 2IAKA 3V2QA 3CPZA 4KHXA 1D1AA 4PV1D 2A9UA 1S94A 3RI5A 3AE6A 3C64A 4IL4A 2MKVA 5JDQA 3B71A 5AQNB 4HWDA 1EZVD 3I9YA 2X67A 4LF8T 1SQXE 2XTLA 3L70J 4I55E 3L75J 3I5CA 1Q82Q 5H2FE 5FMNA 5AQGB 3EI0A 5C3JA 2W62A 3O6QB 2WT7A 5CBNA 1EDIA 1NO4A 2Q3EA 3FZKB 3V5SA 1N73B 2M6IA 5HEOA 4QX7B 2YINA 4HFDA 4IL6X 3C1LA 2KNDA 4E7SA 5LGUB 4TNVA 2E74C 4DMVA 4BRYB 4M3LA 1G73A 1HTJF 1SHZC 1LTTC 3FBLA 2XZEA 5EK2A 3BQIA 4KI0F 2LE8A 2ZT9C 3L71G 4UVCB 1KYOE 3IAOA 4Y99C 2YKPA 2L91A 5ADXL 4ASWA 3FZHB 1PGQA 3AVRA 4NXMT 1AFOA 2L5GB 2OA5A 1NU1K 4IDZA 3MA9A 3M9HA 3UUBA 1PP9J 2M8RA 2OYHB 2Q9QD 4YJ2E 1VF5B 4TV8E 2KZ7B 2KIKA 5BVZA 1BGYE 3LIEA 5ABFA 4X1YE 1JTHB 1NTMK 1D0ZA 1XDOA 4MHCA 2NP9A 2V7LA 2DW3A 1G1JA 2MYSA 2FYUE 4BWNA 4CI1B 2GK9A 4YXDC 1RQUA 3MD0A 4UEMA 3WMM0 2B1EA 4H63V 3O1IA 1NTZE 3L71D 5AQRB 1XTCC 2V6YB 1FMWA 2NR4A 3GN5A 1MMDA 3A7MA 4X1IE 4OH8B 2DWKA 2XAHB 1LT9C 4O8SA 3OVUA 3G4SP 1TU3F 2CM0A 2WU5A 3P8CD 3OW2O 2DNXA 4DR3T 1UGOA 2R32A 2ITAA 2J58A 2K24A 1LWUB 3IEEA 4HFHA 5GTIH 2F4VT 1YYCA 3DP7A 3ITKA 2CMRA 3KVAA 1P84I 1QLBA 5DQVA 4ILAA 3VRAA 4PK4A 5M1BA 3P4PA 2BG9B 1VQNP 2VB6A 4DMWA 4L5GA 3CL3D 1H88A 3CIRA 1IFNA 2OARA 2NOXA 1ZEEA 2MOZA 4WY4A 1SQQJ 3SWFA 1KB9D 1N7SA 5FXWA 5K5GB 1MMNA 1N34T 3BVHA 3RK3C 3AAIA 2YDRA 1JMBA 3AEAC 5AW8B 4NIQA 4WBAA 5H2FH 2P1JA 2UXDT 3H1KG 4WB4A 5APYA 5HXCA 1VRBA 1RF0A 3Q5PA 4DCKA 3UT5E 2WT7B 1L0NE 2KT9A 1HF9A 2V4HA 2LKGA 1KTMA 3VRBA 1MV8A 4ZZBA 5HEUA 1HVVA 2MTQA 3B5ND 1RF1C 1FDOA 4Z90A 3ZN0B 1JB0J 1RE3A 5KTBA 2UUAT 1GTWA 1EXIA 2ZM0A 3AB3B 3RIUA 3F5HA 1KYOH 2JQKA 2KXPB 1J5WA 5HEGA 1VQ9P 5JR9A 2BEZF 1JY2O 2FBWC 2FJAA 4U3CA 5H6QB 3WUTA 5BR8T 3ZYKA 3EABA 2FFDA 1QL1A 1ZV4X 2UXNB 4YT0A 3U78A 2HH7A 4QWNB 2H88C 4P0AA 5ABFB 3CLQA 3CC4P 1ZP0A 1VPCA 4H44C 3JC6D 4O4HE 4NPDA 1FMVA 2V7IA 3LK42 3ZC0A 4R4LA 3L70E 5GONE 2BKOA 4IOIH 1H0TA 1S5LX 1J1EC 4PJMA 2CXLA 4Z8XA 5KLVG 4OFZA 4XE5B 3Q3DA 1HCIA 2ODUA 1N32T 3GN5B 3EFFK 3G6EP 2XDJA 3RF1A 3U59A 5APWA 5F5WA 2XQYA 3UUXB 3B8EB 2OLTA 4I4TE 2BDEA 4CQIA 5KXJA 1J1DC 3J9X1 4GIFA 1BR4A 4ASVA 2BZBA 2BCCJ 1R5SA 4N78D 2WPQA 4WBOA 3Q5SA 4JI4T 1WR0A 2Z6EA 3V6IA 3ABVC 2W6JH 2WPSA 2O1JA 4ANJA 2LRKA 1PP9E 3M0DA 1NOHA 1T8ZA 1EZVE 2HLOA 3R84B 1QUUA 1QL2A 5KLVD 5LBMA 4OGQD 2AEMA 3IFMA 4OVNF 4DR7T 1LJ2A 4WY4B 3C9IA 1ZOYC 5APTA 3VHLA 4I7ZC 5KKZB 2E75B 3UUNA 1PV3A 2YN6A 2PJQA 4OX9T 2M0BA 3ZJ1A 5L3FB 3E0ZA 4LLHA 5FVKA 1MMGA 1SE7A 5JDGA 4O4LE 3W15B 3B57A 4B3ST 1XWMA 4KBMB 2VASA 2ZM2A 4DV0T 2ES0A 2FXPA 4UB6E 5C8YE 2E2AA 4DV4T 2V8SV 1N8RQ 3C4ZA 3N5LA 2E76B 1NTKJ 2JRKA 2I59A 1HGVA 1VQLP 2D0UA 4LF9T 2X0LB 4QXCB 1PPJE 3UU3A 2JKVA 4TV9E 5LG4A 2Q9QA 1M62A 3QOFA 1WYBA 1UX4A 1URQA 2VL0A 3KFWX 5JR9B 1VOMA 3GMIA 1GL2A 1UUSA 2BVLA 2IDOB 1OEDA 5JTGA 1OEDE 5CFBA 1OW6A 5FVLA 2J47A 1I6ZA 2FFDB 3QUJA 2WS3A 4NUUA 4TZ4C 3AE7C 3K8PC 3P50A 2LSGA 4DBRA 5HEHA 1U4QA 3RL0B 1OWAA 3MACA 3L71E 2UXXB 3M65A 4H13B 3OTOT 4KT0J 1VQMP 3SFEC 3AEGC 2RP4A 4PK5A 2N9YB 1H0TB 1B7TA 2J62A 1SQQK 1ZR4A 3PUQA 4QXBB 4UXNB 3CKDA 2WSEH 4LFAT 1T7SA 3P8CE 1JY3P 1SQPK 1D0XA 3RQUA 3G9RA 2KWIB 4AIUA 3AEBA 2V7QJ 3N9PA 4ADZA 4OYJA 2AXCA 4DOJA 5JVDE 2HYNA 3D70A 1PGJA 2H3RA 2WU2A 4HTEA 4GOFA 2QIWA 3TLSA 3PE0A 1S35A 3PP5A 1MIVA 4JI3T 2N9DA 1M90Q 2D5UA 4AQFC 3LBXA 1YITP 2FYNC 2V7KA 3A0BE 3LFMA 4U31A 5EK3A 4IE6A 3UQ4A 4B86A 1DEBA 2IYOA 3I0OA 1KB9E 3PUZF 2WPRA 1W0BA 1GQEA 3PUSA 4UVBB 3E08A 2VVNA 3P4QA 1BE3J 2G8YA 1GMJA 4ZS3A 2KINB 1W09A 4QH5A 4H0LC 1GU4A 2W66A 3AEDA 1EZ3A 3AE1A 5J0ZA 2GUSA 3M06A 3KPEA 1IFPA 2ACZA 4DR4T 2E74D 2JQHA 1SQVK 1LTBC 3IF8B 2WP9A 4DO0A 4J2CA 2IBZI 4D6TG 4U2ZA 1ZHCA 3B5NA 4PJLA 3KQGA 3AAAB 4PJ0E 3K3NA 1K9MQ 2ZT9D 3PH0A 5HXRA 5JDLA 1VQPP 3AXJA 5AW5B 1YJNP 5LOVE 1KNZA 4UB6H 4JPZB 4TWDA 1NTMG 1JOCA 1N36T 3UIAA 5AQUB 5ABHA 2WVRA 2J5UA 3P4RA 4UIGA 2ZYAA 4IL6H 3SWYA 2EHOC 1US7B 2QJKC 3FZFB 4DNDA 2Q9QB 4CXWA 5FYMA 4AXPA 2W6AA 3RYHE 1URQB 1IFMA 4AI6A 4YHHT 1GL2B 1T72A 1FOSE 2KOGA 5AQSB 2CRBA 1OEDB 1SQXJ 4RKUJ 4YTMA 4D6TD 2WY2A 1GU5A 2VK9A 2R3CA 3GMAA 2XAGB 2XPKA 3EAMA 3GWHA 4DV6T 1Y47A 4NPFX 1VCTA 2NTYA 2HN1A 3VR9A 4DR2T 1U7MA 2Y9YA 4AKIA 4HFBA 1M1JA 1YKEB 4IL9A 2JPFA 4IIJE 2J4GA 3ZSSA 1OVRA 4G2AA 1MFZA 2RA1A 4DR6T 4PD4I 2X66A 4AKRB 1YW0A 3VN0A 4U3FG 4JI2T 5DJTB 3MJXA 1RE4A 1NYHA 4DBQA 3FWNA 4IE4A 1GW4A 2YEVC 1S5LE 3M9QA 2BS3A 4GOUA 3AE3C 2Q3IA 3BCCG 4ZHQE 2YO2A 2QJPC 3MUDC 4N78E 4JI6T 2W8ZA 1SA0E 3IR9A 3PLNA 3R6NA 1HJBA 2P58A 1L0LG 1NTKK 1KK7A 1KQGB 1OW8A 4JEHB 3LBXB 5KLVE 3UU6A 3A0BH 2JMKA 4AKGA 3PUYF 3VMYA 2FYUJ 5KX5E 2LOPA 2E42A 1HH0A 2QG4A 3RK3D 1E2AA 3ANWA 3EDVA 1KB9H 1RY3A 3C4WA 4CPGA 4UB8E 3ZYLA 1SQBG 1L4AC 4EDFA 1NTZJ 2E9XC 1D7MA 1JUNA 3TYYA 4F6RC 4U3FD 3WUUA 5LG3A 4L76A 3CD6P 2D2CC 5CCGA 2YXRB 3BCCD 2I8DA 3BASA 5APSA 4L75A 4U2YA 3D6ZA 3IA3A 3HI2A 3B5NB 3H1JG 4YSYA 5CJ0A 3AA6B
chains in the Genus database with same CATH topology
3QB5K 3MZWB 3S1KA 3AXJB 3MHVA 2QVAA 4HKZH 4GOEA 3PJAA 2B87B 1KEYA 4KJMA 2KI7B 1S3JA 4GODA 1ZXGA 4HB1A 4ZNCA 4NPDA 4K3AA 2WMMA 2LXCB 1BDCA 2B88A 1LT1A 2R44A 2OTKE 4IOIH 1H0TA 5EFWB 3FXEA 2KUBA 3QWOC 2UWJE 5DJUB 1Y47A 4NPFX 3ZDMA 1H0TB 1U7MA 1EC5A 2ZAEB 4WWIA 2K3RA 1SS1A 1EDJA 1MFTA 1OVRA 4ZMDA 4NPEA 2HR3A 4MN4C 3PJAJ 5DJTB 4ASVA 4EYYQ 1BDDA 4GOFA 1U7JA 1EDKA 3FXDA 5K5GB 2LXBA 3QB5A 5C39A 5CBNA 2KS1B 1EDIA 2M5AA 2LR2A 2P58A 1JMBA 2Q1KA 1EDLA 4HJGH 4JBZA 1JM0A 1DEEG 2M5AB 1OVVA 2KZIA 2RKLA 3RIUC 2M0BA 4CPGA 1NVOA 2KZJA 1X0TA 3RGUA 1Q2NA 2QRXA 1LP1A 4BXLA 4WYVA 1OVUA 1ZW0A 2JWDA 4ASWA 5CBOA 2I8DA 3PH0A 3RIUA 1J1JA 4K35A 1LP1B 2B89A 3AXJA 1FC2C 2SPZA 2KIKA 2B87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QB5 K;  3MZW B;  3S1K A;  3AXJ B;  3MHV A;  2QVA A;  4HKZ H;  4GOE A;  3PJA A;  2B87 B;  1KEY A;  4KJM A;  2KI7 B;  1S3J A;  4GOD A;  1ZXG A;  4HB1 A;  4ZNC A;  4NPD A;  4K3A A;  2WMM A;  2LXC B;  1BDC A;  2B88 A;  1LT1 A;  2R44 A;  2OTK E;  4IOI H;  1H0T A;  5EFW B;  3FXE A;  2KUB A;  3QWO C;  2UWJ E;  5DJU B;  1Y47 A;  4NPF X;  3ZDM A;  1H0T B;  1U7M A;  1EC5 A;  2ZAE B;  4WWI A;  2K3R A;  1SS1 A;  1EDJ A;  1MFT A;  1OVR A;  4ZMD A;  4NPE A;  2HR3 A;  4MN4 C;  3PJA J;  5DJT B;  4ASV A;  4EYY Q;  1BDD A;  4GOF A;  1U7J A;  1EDK A;  3FXD A;  5K5G B;  2LXB A;  3QB5 A;  5C39 A;  5CBN A;  2KS1 B;  1EDI A;  2M5A A;  2LR2 A;  2P58 A;  1JMB A;  2Q1K A;  1EDL A;  4HJG H;  4JBZ A;  1JM0 A;  1DEE G;  2M5A B;  1OVV A;  2KZI A;  2RKL A;  3RIU C;  2M0B A;  4CPG A;  1NVO A;  2KZJ A;  1X0T A;  3RGU A;  1Q2N A;  2QRX A;  1LP1 A;  4BXL A;  4WYV A;  1OVU A;  1ZW0 A;  2JWD A;  4ASW A;  5CBO A;  2I8D A;  3PH0 A;  3RIU A;  1J1J A;  4K35 A;  1LP1 B;  2B89 A;  3AXJ A;  1FC2 C;  2SPZ A;  2KIK A;  2B87 A; 
#chains in the Genus database with same CATH topology
 1KIL C;  5AVZ B;  1GW3 A;  2XAF B;  1LTS C;  1L0L D;  3AXJ B;  1KN7 A;  1NHL A;  1X79 B;  3KHU A;  1CZQ A;  3OJA A;  4H9O C;  3WU2 H;  2GM4 A;  4DVD A;  1HGZ A;  2CK3 H;  5L3E B;  2JMH A;  1SQB D;  2IIU A;  1E79 H;  3PHL A;  1KYO I;  3CC2 P;  1N73 C;  1LTA C;  3HL6 A;  3HR0 A;  5LHI B;  3AE8 C;  3NZP A;  1D1C A;  3MZK B;  2C0W A;  2A72 A;  5EFW B;  4IDN A;  2XM1 A;  3FXE A;  4H44 D;  2XQ4 A;  4JI1 T;  2OGU A;  2IHR 1;  3ONJ A;  5FKY A;  3QWO C;  5CJ5 A;  3DTO A;  4RO0 A;  1SUM B;  4EIW A;  2A06 D;  4HWI B;  5BMV E;  4AYC A;  2ZAE B;  3TGU J;  4WWI A;  4LF7 T;  2X9H A;  2NPS A;  1L0N J;  3H37 A;  2HN2 A;  3ZN1 B;  4NPE A;  2BBH A;  1M1J B;  1N33 T;  2JP3 A;  1IBL T;  4EOT A;  2XAQ B;  5HCM A;  1FE6 A;  3L73 G;  3CCU P;  2AXD S;  1JNM A;  1E7P A;  5E0O A;  1EDK A;  4DV7 T;  1S5L H;  2LXB A;  5FL0 A;  2CPB A;  3UUM A;  3J7Y q;  4DV2 T;  2Y0E A;  2M5A A;  3GHG C;  3AE4 C;  2VKO A;  3L8R A;  5LBQ B;  2Q1K A;  2D0T A;  4HJG H;  3D71 A;  4HEA A;  4HH2 A;  4JBW F;  4UF0 A;  4C91 A;  1FDM A;  3H3M A;  2YOE A;  2ZXE B;  3P4S A;  3S9O A;  4AUW A;  4OGQ B;  1X8Y A;  3E1I A;  3CWZ B;  3ANW B;  3A2A A;  1YHQ P;  4UB8 H;  4ILC A;  1LWU C;  4OHF A;  4A98 A;  1ZLL A;  2WSE J;  3HTK A;  3L73 D;  1J1J A;  4YLH A;  3F57 A;  2W4X A;  2IZ0 A;  4KMC A;  1SQX K;  1VQO P;  4R4M A;  5IWA T;  3JCU E;  2BG9 C;  2BVM A;  2RH0 A;  1FDI A;  2WSS V;  3Q9D A;  3N4X A;  2WBL A;  3SS1 A;  4B3R T;  4N3Y B;  4PFO A;  1BR0 A;  4U7J A;  3HKB E;  4HKZ H;  2N1T C;  3HE4 A;  1KFM A;  3AE6 C;  2NW9 A;  4M1P A;  2A2F X;  2WZI A;  2DI4 A;  2V7Q H;  1PFI A;  1S3J A;  3ZMS B;  4DV3 T;  4HB1 A;  1CW5 A;  3OJA B;  1JNR A;  2LHR A;  4GYR A;  2NZ2 A;  4H9Q C;  3RYF E;  1SFC B;  3VMX A;  1WLX A;  5BU5 A;  3CK6 A;  4YSZ A;  1FZC C;  2X9W A;  4D6T E;  4CI3 B;  3LJC A;  2WDR A;  1PIX A;  4X20 E;  1DX7 A;  1SQP G;  4JI8 T;  1JMM A;  3FXE B;  3EFG A;  2LEH A;  4DJG A;  2K37 A;  1NH4 A;  5ABG A;  1MFT A;  3H1I G;  5JH7 E;  3RX6 A;  2DHR A;  2ZM6 T;  1HS7 A;  3CI9 A;  3IN6 A;  5CHX A;  2W6B A;  5L47 A;  1IJD B;  2G0U A;  2NPS B;  2FYU K;  2FXM A;  2PAJ A;  3CCL P;  3HD7 C;  3H1H G;  4QH1 A;  1UK5 A;  5HXH A;  5LXT E;  1S1C X;  2QGS A;  2V5C A;  4ILB A;  3JC2 2;  5LP6 E;  3ETV A;  2PBI A;  1SLQ A;  4JI0 T;  1NTZ K;  1O3X A;  5IHY A;  4C46 A;  3HRN A;  1S2E A;  5FXV A;  1FJG T;  3AEF A;  1FZA A;  3FB2 A;  5ETW A;  4MAL A;  1HTL C;  1UIX A;  2JO1 A;  1M57 D;  1X22 A;  3V2R A;  1KD1 Q;  2LR2 A;  4PJN A;  1A02 F;  1MKM A;  3MK7 C;  3BRT B;  3II6 A;  2AEF A;  1XNR T;  3CWB G;  2Y0C A;  5KAI E;  3HUS C;  2M5A B;  4GKG A;  2YK0 A;  3H1I D;  2R3S A;  5KMG P;  1SQV G;  3FGA D;  3TKL B;  1VDF A;  2VL8 A;  4U74 A;  1Q81 Q;  2W63 A;  3FWL A;  3RK3 E;  1BSH A;  1JNZ A;  3L72 G;  2W0G A;  3OKQ A;  4UF0 B;  3BAT A;  3ZT6 A;  3RYI E;  1LP1 A;  3AVS A;  1VQ6 P;  1CSB A;  2NRG A;  3WUV A;  3H1H D;  3FHN A;  3NBX X;  3L71 J;  1YJ9 P;  1WRG A;  4CI2 B;  4H0L D;  3WAJ A;  3WAK A;  3RBZ A;  2K3W A;  2KSJ A;  3VR8 A;  1CI6 A;  1EZV I;  1Q7Y Q;  3VOP A;  3BCC E;  2E74 B;  2L3L A;  4AQG A;  4EV6 A;  3T97 A;  3TGU E;  3KXD A;  2A45 I;  2N1G A;  2CBJ A;  4QMA A;  1RF1 A;  3I0Q A;  3AEC C;  3FZM B;  4I1L A;  5AW4 B;  4W7Z A;  1FJP A;  5CA0 E;  3CCQ P;  2BBJ A;  4QH4 A;  3ZYM A;  5LHG B;  1VL2 A;  3JCU H;  1L0L E;  1E1H B;  3CXH D;  5IYZ E;  3CWB D;  3UQ7 A;  1G2C A;  3SWK A;  1L0N K;  2EHO D;  3TSI A;  4U33 A;  4KHP T;  1AQT A;  1SQB E;  2ZLY A;  4W7Y A;  5KKZ C;  2E75 C;  2H88 A;  5KJ7 A;  1KQS O;  2OYI C;  5FXX A;  2YU2 A;  1UII A;  3LW5 H;  2UWJ E;  3TLW A;  2VUR A;  2QM7 A;  3L74 G;  1V9D A;  2NTX A;  3H1K D;  2Y8D A;  2XV5 A;  2K3R A;  2FYZ A;  4G63 A;  2A06 E;  1CHU A;  2I6H A;  4X66 T;  5JRC A;  2E76 C;  3N9M A;  3CX5 I;  2QE7 H;  2PRR A;  2QYW A;  4JI5 T;  4MN4 C;  3LDQ B;  3RK2 B;  1Y01 A;  2L8K A;  4HFV A;  2BKN A;  1YQ4 C;  3L4F A;  5JR9 C;  1CUN A;  1YXR A;  1L2P A;  2IDB A;  2WWW A;  1KNR A;  2IC9 A;  2QJY C;  4IRE A;  1W0A A;  1OMI A;  5C39 A;  2FFD C;  2WM9 A;  3QC9 A;  5AVY B;  5J2U E;  3P8M C;  3L74 D;  4DV5 T;  1EDL A;  3ABV A;  4IDQ A;  1ZP0 C;  3JCF A;  4PK6 A;  1DEE G;  1WYC A;  4YPC A;  4I0U A;  5B66 H;  5J1G A;  3H1K J;  3MTU E;  3CCS P;  3W68 A;  2POH A;  2KLU A;  4HFI A;  4LFC T;  3RGU A;  5KAI H;  1Q2N A;  1ZOY A;  2QRX A;  3PU3 A;  2IBZ G;  2W67 A;  3GLM A;  3QNU A;  3LK3 B;  5AQJ B;  2KLQ A;  2P10 A;  2PTF A;  3PUA A;  4C7R A;  1L4A D;  3LID A;  2Y0D A;  2E9X D;  1I94 T;  4ZXL A;  1LP1 B;  1LVK A;  3H6P A;  2YNY A;  1N7S B;  3L73 E;  3M9B A;  1R8E A;  2D2C D;  1KB9 I;  4DZO A;  3B5M A;  1DIP A;  1FAV A;  1CI6 B;  5FY7 A;  1YBK A;  3FZL B;  3T97 B;  2XQ3 A;  2R6G F;  1XTG B;  4GOE A;  3G06 A;  1LTG C;  1RF1 B;  2YIU B;  4K0U A;  1KIL D;  2OTL P;  5E79 E;  3PUX F;  1D0Y A;  3CCV P;  2XM2 A;  4K3A A;  3M0D C;  1VQ7 P;  3PDY A;  1G2C B;  2XQ9 A;  1YTZ I;  2IBZ D;  1DH3 A;  2KSR A;  2OTK E;  3HE5 A;  4IL6 E;  3UUL A;  5CMZ A;  4P1N A;  2LHN A;  5TJH A;  3IF4 A;  2XU6 A;  3ZDM A;  2KK7 A;  3AE7 A;  4NPP A;  5KLV J;  3AAE B;  1IFJ A;  2KYV A;  3AE5 A;  3JSV C;  3VKH A;  1EDJ A;  2E5Y A;  1XNQ T;  3L35 A;  2CLY B;  5HXE A;  2LOS A;  3C98 B;  1AJ3 A;  2I1J A;  1BCC G;  2JWA A;  3F89 A;  1YKH B;  4Z1M H;  3UU4 A;  4LF4 T;  2WQY C;  4U72 A;  2JJL A;  2PFX A;  3F2E A;  4OWF A;  1GK6 A;  4CZZ B;  1J1E B;  5JRC B;  2HOD A;  4LMJ A;  1JY3 N;  4TWF A;  2C5K T;  3AEE C;  2XZR A;  3H1L G;  2WWV A;  4H9P C;  5LB7 B;  1LTJ A;  2Y48 B;  1USE A;  4DV1 T;  4TWH A;  2V26 A;  1URQ C;  4QXH B;  3Q1M A;  5L3D B;  1GL2 C;  1ZN5 A;  5LJN A;  5APV A;  2CCQ A;  3KV6 A;  1J1D B;  2KWH A;  4Q25 A;  4DR5 T;  3F31 A;  1M8O B;  5GTH E;  4AQF A;  4ZI2 C;  2KZJ A;  4PD4 D;  1BCC D;  3Q5W A;  2YMK A;  1ZRT D;  3P32 A;  2XKM A;  3H1I E;  1T98 A;  5HYA A;  1AA0 A;  1Z56 A;  1HNW T;  4XFJ A;  1EQ7 A;  4PV1 B;  2JWD A;  4GDO A;  2XHE B;  1OFC X;  2LSI A;  3H1L D;  2WTY A;  3CME P;  5AW7 B;  4I7Z B;  4O2B E;  4HWH A;  1FZB A;  1HF8 A;  4ASK A;  4O9B A;  4I2L C;  2WPV B;  2XJ7 A;  3CQG B;  3ZT5 A;  3CQC B;  3AEB C;  3NWI A;  5IUX A;  3VP8 A;  1SP4 A;  2CWO A;  2J59 M;  5CCH C;  1Y9B A;  1KEY A;  5L3G B;  1NJI Q;  1NU1 G;  2LT3 A;  5HWY A;  3CXH E;  3CWB E;  4U7Y A;  3RIF A;  2N1T D;  1W5C E;  3RPU A;  2QA4 P;  2UXB T;  3K3O A;  5E79 H;  3OA7 A;  1HX8 A;  2X51 A;  2E8I A;  2YKS A;  3ZMU B;  3Q5E A;  4TUY E;  5AQQ B;  2V5D A;  3WU2 E;  2IC6 A;  5JDH A;  2I1K A;  4ZKP A;  3HE5 B;  2W90 A;  1YD8 G;  1BGY G;  4X62 T;  4JYA T;  3K3Q C;  1EC5 A;  1PGP A;  5AW0 B;  2PGD A;  4Y28 J;  5AVX B;  1PL5 A;  2NW7 A;  3H1K E;  2Q6Q A;  1VQ4 P;  1T2K C;  4OYK A;  3H3A A;  4DR1 T;  3OPC A;  1NKN A;  1NU1 D;  5FY0 A;  4ZI3 C;  2K5B B;  4YTP A;  2HG5 D;  2ZMA A;  3PV0 F;  1BDD A;  3ZT7 A;  3LG7 A;  3A8Y C;  2XAS B;  1MNE A;  1YTZ T;  2Q5U A;  2H7H A;  3ZKR A;  1NTM D;  3HD7 D;  2HOD B;  4QKN A;  4EOZ B;  1QGK B;  3QB5 A;  2E5T A;  2OQQ A;  3NXS A;  1JY2 P;  4BJN A;  2MAW A;  1LTJ B;  2KB7 P;  1BGY D;  2W83 C;  2ZJS E;  3MUD A;  3NZQ A;  5LNK A;  2IZ1 A;  4O4I E;  4BA9 A;  3L37 A;  1KMI Z;  3L74 E;  2H89 C;  5AQM B;  5LCY A;  3PUG A;  2IFM A;  4LF6 T;  3P7I A;  4CN1 A;  3P4W A;  2QA7 A;  5GTH H;  3LW5 J;  4EZH A;  2FYN B;  2V1D B;  3LSV A;  5AW1 B;  1OVU A;  2P9B A;  2BAS A;  3C4X A;  2M3E A;  1ZW0 A;  2E43 A;  5L3B B;  2Z4E A;  3N9Q A;  3MXZ A;  1RH5 B;  1ZR2 A;  4D6T J;  4O4J E;  2LSY A;  2YMY A;  2WB5 A;  1M1J C;  1HX1 B;  1L4A A;  5AQH B;  2C9L Y;  4CN4 A;  3H32 A;  1GDT A;  1IAP A;  5LHH B;  2WZ7 A;  1KF6 A;  3MZW B;  2CBI A;  3CML A;  1XMQ T;  1NTM J;  3ZST A;  1HNX T;  2QVA A;  2WCA A;  4LMK A;  2CXF A;  1M56 D;  4YTN A;  5KLV K;  4KJM A;  1FZG A;  3O1J A;  4AKL A;  3SSU A;  2LKH A;  2V7J A;  4JYB A;  1LKX A;  2BS2 A;  1H7C A;  3KV4 A;  1KIL A;  1KIL E;  2K1A A;  3EDU A;  1Y8A A;  3Q2M A;  1HG2 A;  3MGN A;  1MIY A;  1K73 Q;  5EZY E;  3NFQ A;  3L3P A;  4WNK A;  5AQK B;  5AFU L;  4WZX A;  5LGN B;  3CXH H;  3BRV B;  4ZOL E;  2WZH A;  2IBZ E;  1S9K D;  2WMO A;  3PU8 A;  2SPC A;  3CX6 B;  1YQ3 C;  1QX8 A;  4EED A;  5AVQ B;  2E75 D;  4UV8 B;  2G3A A;  1IJ5 A;  3PRJ A;  3DJB A;  5AVT B;  4I50 E;  1T6A A;  3E22 E;  4GT1 A;  2PG8 A;  3PJS K;  1NAY A;  1FZF A;  5FY1 A;  2VWA A;  5F3J A;  2BKP A;  3E7K A;  3OYX A;  3JAF A;  1LGH B;  1KZU B;  2IFN A;  3GW6 A;  5HXS A;  5CCG C;  2AXT H;  5APQ A;  4IFM A;  2E76 D;  3L70 G;  1J5E T;  3L75 G;  4U3F J;  3AE2 C;  3SFD A;  4P09 A;  3AE9 C;  1MMA A;  4AQR D;  2WWU A;  2W61 A;  2X0Y A;  5DQW A;  3Q2Y A;  3D0T A;  3N9L A;  3BCC J;  3H1J D;  2K9J A;  2LRL A;  2IYP A;  4LGD E;  4JLE A;  1M1K Q;  3RRW A;  3ZEF B;  5APX A;  2KNC A;  3GF7 A;  5A1L A;  1W2B O;  3ETU A;  1SFC C;  1L0L J;  2OYH C;  1VF5 C;  4JBZ A;  5L8R J;  4NXN T;  3NMD A;  3A5T A;  3T8O A;  2JDI H;  3CC7 P;  5AVS B;  2XQ5 A;  1X0T A;  3GHG A;  3ONL C;  4XZC A;  1SQB J;  4PD4 E;  1BCC E;  4YXW H;  2ODV A;  4IDO A;  4C7N A;  1ZRT E;  3S4U A;  3L70 D;  3FBZ A;  2O1K A;  3L75 D;  1GZL A;  2GUV A;  1PP9 G;  5AQL B;  5CBO A;  2C0S A;  1EZV G;  3TK1 A;  4NUV A;  2KP8 A;  2NPS C;  3M0A A;  1FC2 C;  3H1L E;  2A45 G;  3HKD E;  4EB6 E;  1M7K A;  4X65 T;  3H1J J;  3HKC E;  1L4A B;  1FS0 E;  1HUC A;  4IFD K;  1KQF B;  1QVF O;  2X9X A;  1P84 D;  3H32 B;  3QH9 A;  1K04 A;  5TAO A;  4LFB T;  3T1H T;  1QVG O;  2O01 H;  1ZV8 A;  4MFR A;  1U5P A;  3C50 A;  1ZXG A;  4LC1 A;  2X0H A;  4HN9 A;  4IDP A;  5AQT B;  2WMM A;  2LXC B;  2IPP A;  3L39 A;  2E5L T;  2N1T A;  4GK0 E;  3AA1 B;  1KIL B;  2VVS A;  2DL1 A;  5AQI B;  2CPS A;  1PP9 D;  1PPJ G;  3U1A A;  4FJO A;  2C0X A;  1Q86 Q;  2KMF A;  4CXX A;  5B5E E;  3Q5R A;  2ZYD A;  1X9V A;  5FXZ A;  1AJY A;  3KBT A;  2VQE T;  3NTN A;  2WAU A;  1FZC A;  1DD3 A;  2LKM A;  3UU8 A;  3UFE A;  2XSA A;  1WMK A;  4WBN E;  1X9B A;  3NRY A;  2R5B A;  3A7O A;  1NU1 E;  3B13 A;  1SQQ G;  3EVY A;  5AQV B;  4YXD A;  2JQ9 A;  3I9W A;  4OK0 A;  3PUW F;  3EUH A;  3L73 J;  3FXD A;  1G1I A;  4ZKU A;  5L2L A;  5L4H A;  1PPJ D;  1HBW A;  3HD7 A;  1NTM E;  4EYY R;  3M3Z B;  3UU5 A;  5AW3 B;  1FZE A;  1YI2 P;  5KLI B;  4QX8 B;  1DD4 A;  1LT9 A;  2K9J B;  2ZFC A;  1JY3 O;  1URQ D;  3UTK A;  3RHW A;  5KDM C;  1OVV A;  2KNC B;  1FOS F;  1GL2 D;  3V5B A;  3CX5 D;  3RKG A;  4V1A v;  2FJB A;  1GK4 A;  3GG2 A;  4UV9 B;  3SWH A;  3RC8 A;  2ZYG A;  1K8A Q;  4DUZ T;  2QEX P;  3Q5D A;  1WFD A;  4ZI2 D;  1YIJ P;  2C9N Y;  3EWK A;  3HUS A;  2RN0 A;  3ZMT B;  3GHG B;  1SQQ D;  3BQL A;  5LJM A;  1HJ0 A;  1BR2 A;  1UX5 A;  2LSJ A;  5B66 E;  4PD4 H;  3I56 P;  1LRZ A;  2X68 A;  3X1D A;  2W00 A;  4DID B;  4C7N B;  4HWF A;  1SQP D;  5H6R B;  4GKJ T;  3RK2 C;  2SPZ A;  1EXJ A;  2B87 A;  5HAX A;  5L3C B;  3ZCJ A;  2OV9 A;  3CCR P;  3S1K A;  3NVO A;  2P2U A;  3ZC1 A;  3AEA A;  1AVO A;  3RC3 A;  4EZ4 A;  1OIP A;  1XZY A;  2FJD A;  2WMN A;  4HFC A;  2KI7 B;  2JIW A;  1W2E A;  3U1C A;  3V4W A;  4U3F E;  3C8V A;  1HFA A;  3N7N A;  5CCH D;  3A0H H;  4ZNC A;  3AEC A;  2H7O A;  3TNU A;  3AEF C;  1OXZ A;  2B88 A;  1LT1 A;  5CJ4 A;  4HWC A;  2RMZ A;  3ZJ2 A;  5FNV E;  1NGM B;  2MJZ A;  3N9N A;  5TIS H;  3HTK B;  4PAG A;  2K9A A;  3BQK A;  4KP3 C;  2N1T B;  2ZT9 B;  3CPW O;  1S9K E;  4EEB A;  4Y99 B;  4EYU A;  1VQ5 P;  1SQP J;  1W9R A;  2FBW A;  4Z91 A;  1SQV D;  4TN7 B;  3MIW A;  2OYI A;  5B5E H;  3HE4 B;  5HCJ A;  4WY4 C;  1D1B A;  2N2N A;  2I0M A;  3L72 D;  3H1I J;  2BCC G;  3FX0 A;  4IFF A;  3JAD A;  1N7S C;  1KNP A;  1L0L K;  4DT0 A;  2A3D A;  1LNQ A;  1FZC B;  4HE8 A;  5JDN A;  2XQ6 A;  3B4S A;  2UU9 T;  1T2K D;  3H1H J;  3CCM P;  2ACX A;  1RF0 C;  1SQB K;  4ZI3 D;  2YIU C;  2CHN A;  3KZI E;  3RIA A;  2LM9 A;  3USS A;  4UVA B;  3H1J E;  2CPT A;  2M6B A;  1YQ4 A;  3RH3 A;  2YDS A;  3FXD B;  1OZH A;  1JM0 A;  3HD7 B;  3N2G E;  2CE7 A;  4U7I A;  1RE3 C;  5LMU T;  2YKQ A;  3RIU C;  2W27 A;  2M3B A;  3TF5 A;  1LT9 B;  3CWB J;  3NKZ A;  5CGM A;  2ZXX A;  1QSD A;  3RLF F;  1MIW A;  2BCC D;  2NW8 A;  1SQV J;  2DLR A;  3ZMZ B;  4TLF A;  5KJ7 C;  4RJT A;  4L73 A;  3RBX A;  1NTK G;  3RL0 g;  5AW6 B;  3L72 J;  1N7L A;  2H8P D;  4EI2 A;  2CLY C;  1KC8 Q;  3PTZ A;  1M7L A;  2B89 A;  3K5B A;  3L75 E;  4E7Z A;  4JUY A;  1R8I A;  1FBM A;  4JEU B;  3D6Y A;  3HUS B;  3GF3 A;  3RL0 C;  1AVY A;  2XSB A;  4H13 C;  2XND H;  3CCJ P;  3MHV A;  1NAF A;  2JR8 A;  1Q90 D;  4I6M C;  3KV5 A;  1IFI A;  2B87 B;  1KOR A;  3GA8 A;  5HEJ A;  1KQL A;  4L0R A;  4ZEY A;  3CMA P;  2M67 A;  4C90 A;  4H9N C;  3CCE P;  1P84 E;  3WI3 A;  3RK3 B;  2KSE A;  2WSF H;  2OTJ P;  2FY8 A;  3RQW A;  1BDC A;  4UEL A;  1AV1 A;  2XNX A;  1NTK D;  2E5V A;  3TLU A;  1WT6 A;  3TNU B;  3KV9 A;  1WR6 A;  5L4E A;  3HA4 A;  5AQF B;  2HHH T;  1S72 P;  1HWT C;  3PUV F;  4HKA A;  4KUM B;  4IT4 A;  4H9R C;  4IST A;  3L74 J;  4PV1 C;  2JEE A;  2R5D A;  2LM2 A;  4MLK A;  1IZN B;  3TLT A;  3JAE A;  4WW0 A;  3OBV E;  2YO3 A;  5BU8 B;  2JQQ A;  3ZPO A;  2NWB A;  3ZLI A;  1NKZ B;  4N6J A;  2WSC H;  3CXH I;  3VKG A;  1A02 J;  1R5L A;  1T3U A;  2CXD A;  1Y64 B;  2OYI B;  1S4X A;  3EHZ A;  5JRE A;  2Z5I A;  4EYY Q;  4EIJ A;  1N86 A;  5JDM A;  1DU2 A;  4FI5 A;  2KS1 A;  2MPK A;  1U7J A;  5CCG D;  2YXQ B;  2WQY A;  4B3M T;  5AQP B;  1JEK A;  4F8H A;  4GIW A;  4HGA A;  1MZ9 A;  2WSS H;  2IUB A;  4H44 B;  2HPC A;  2O01 J;  3AEE A;  2BEQ D;  2BS4 A;  1BE3 G;  4L74 A;  3KZI H;  4XAX B;  1GD2 E;  3SFE A;  3AEG A;  1KFY A;  4ERR A;  5AW9 B;  2Y9Z A;  1E5W A;  5JQG E;  2CWY A;  1NVO A;  4TT3 H;  4YY3 T;  3V2N A;  1RHZ B;  2IX7 C;  1SFC D;  2P7J A;  3P7K A;  1VF5 D;  3CX5 E;  2QJY B;  4YSX A;  1BSN A;  2Q9Q C;  4GYS A;  4KHZ F;  5KAF E;  1AQ5 A;  2L9Q A;  4AQY T;  2FUP A;  3AA0 B;  3AE5 C;  5CA1 E;  1VQ8 P;  4BAY B;  1SQQ E;  3U3I A;  1OED C;  3V5U A;  2XY8 B;  5HWX A;  1T8B A;  1SQP E;  1XMO T;  2H7V C;  4A97 A;  4AIS A;  2W2U A;  2K48 A;  5C2T A;  1BE3 D;  2NPS D;  2XQA A;  2N9B A;  2QM8 A;  5AVW B;  4H63 H;  4X1K E;  2IW5 B;  1VCS A;  4LF5 T;  1VQK P;  2IML A;  2Q7C A;  2WIT A;  1SQX G;  4XBF B;  4IE5 A;  2Q9I A;  1IK7 A;  3N9O A;  1XDP A;  3VYI A;  3G71 P;  1LTJ C;  3H1H E;  3S4R A;  3L36 A;  4GKK T;  5CCH A;  1P84 H;  4A5X A;  5AW2 B;  3V4Q A;  2PFV A;  1IO4 A;  4A7P A;  1ZME C;  2D2S A;  1IFD A;  3A5X A;  2O3J A;  4K0K T;  4EXT A;  1IJ6 A;  5LGT B;  1MND A;  1YJW P;  2OYO A;  1MUU A;  2VRS A;  3ESL A;  2FXO A;  3VU7 H;  3KDS E;  2GA1 A;  1SQV E;  1NWM X;  3PJA J;  2C5I T;  3NRX A;  3T1Y T;  1BCC J;  2EHO A;  2A45 H;  1LVF A;  3L72 E;  3CX7 B;  1SQX D;  3RYC E;  4EGW A;  4I43 B;  4XA4 A;  5M4Y A;  3TDK A;  1SVF A;  2CA5 A;  2X9Y A;  2VQF T;  2YDQ A;  3H1L J;  3R4Y A;  4A56 A;  3AED C;  2KS1 B;  4EAH A;  4LML A;  3AE1 C;  2FYU G;  2AXT E;  2V6X A;  1HG5 A;  4B6X A;  2LLY A;  2Z5H A;  4QHO A;  4YHJ A;  1X79 A;  3B5N C;  1OX3 A;  1NTZ G;  2HPC B;  1WRD A;  2AEJ A;  1KYO D;  1JY2 N;  1L0V A;  3O8Z A;  3IBP A;  1IBK T;  1OW7 A;  4WYV A;  2XUE A;  1Z0P A;  2UXC T;  2BCC E;  5ABE A;  1K05 A;  5AVU B;  5DAB A;  3ONX A;  5APU A;  2H89 A;  2MBG A;  4PJJ A;  1NEN A;  2K88 A;  4K35 A;  3CX5 H;  3N2O A;  3I55 P;  3AE3 A;  4GK5 E;  5AQO B;  3RRC A;  4L9I A;  4JQ0 D;  4YFS A;  3LK2 B;  3MKD A;  5KAF H;  4PFP A;  1PZQ A;  2Y6X A;  2LSK A;  3QB5 K;  3VMZ A;  3ZMV B;  2FYU D;  3OYZ A;  2DCF A;  2C5J A;  3SOL A;  1ZKE A;  2AE9 A;  3KBU A;  3RK2 D;  3JC6 C;  2K9Y A;  4YTP C;  5FL1 A;  5LYJ E;  1PGO A;  1NTZ D;  2J1D G;  4MBQ A;  3CX8 B;  4GOD A;  3QK6 A;  4RES B;  1G8X A;  2XAJ B;  1NU1 J;  1T3J A;  1HR0 T;  3I1A A;  2E9X A;  1FEW A;  1KFN A;  2FJE A;  2ZM8 A;  2KUB A;  4BJM A;  3UFG A;  1N2D C;  1NTK E;  4CXY A;  4H0L B;  3TGU G;  3V2P A;  4ISS A;  4P0B A;  1FU1 A;  1NEK A;  1L0N G;  1QLE D;  4ZI7 E;  4IGU A;  2XQ7 A;  1RE4 C;  2HFE D;  3KDP B;  2VKJ A;  1LTI C;  5EK4 A;  2WDV A;  3Q5X A;  4JI7 T;  5CB4 E;  3G3Z A;  4W80 A;  3AA7 B;  4COF A;  1BGY J;  2CEA A;  4JV5 T;  1JO5 A;  3KVB A;  3OAK A;  2HR3 A;  1HNZ T;  3VP9 A;  4TX5 A;  1FJK A;  1YQ3 A;  5AVV B;  4JF7 A;  2UUC T;  2YKO A;  3W67 A;  4IE7 A;  3BK9 A;  2PP6 A;  4WVZ A;  4ZS2 A;  4B3T T;  2FKW B;  4ILU A;  4WY4 D;  2B9B A;  1KV4 A;  3O6Q A;  4OGQ C;  2HPL A;  3VMA A;  1N7S D;  4IE0 A;  2EHO B;  1H8A A;  1N73 A;  3O1H A;  2QJK B;  3HKE E;  3AE8 A;  5JDF A;  3O9X A;  4JYC A;  5FP3 A;  1Z8U A;  3C51 A;  5DJQ C;  3TGU D;  3R2P A;  1FIO A;  1UUR A;  4BRY A;  4UR9 A;  3AE2 A;  1L0N D;  2A06 G;  1U57 A;  3AE9 A;  2WSF J;  3RGL A;  3TLV A;  4PJ0 H;  2KLV A;  2KZI A;  2RKL A;  2DWG A;  4X5T A;  3E1R A;  4DUY T;  2P67 A;  3SRZ A;  3O4X E;  3KYQ A;  2QSI A;  2HPJ A;  3RKO A;  4BXL A;  4AKH A;  2D9D A;  1SFC A;  1RQV A;  2OYH A;  1J2J B;  1IC2 A;  3N2K E;  2JJ9 A;  5KJ7 D;  3ZCI A;  1JTH A;  2ZVN B;  1NWQ A;  1H89 A;  3L09 A;  2VKD A;  2V7M A;  2WSC J;  3A3Y B;  2B76 A;  1WCR A;  3K1S A;  1IBM T;  4YJ3 E;  3EQ2 A;  2QJP B;  2LJL A;  5LA6 E;  1QEX A;  3PJA A;  3RL0 D;  3AE4 A;  1JCD A;  2RPA A;  1BE3 E;  4H13 D;  3MP7 B;  2CHO A;  2V6Y A;  4PW8 A;  4CN6 A;  3SFD C;  4TNW A;  4O2A E;  3PUR A;  5KLI C;  1BR1 A;  5AVR B;  3IHR A;  2H43 A;  2UUB T;  5LMN T;  2R44 A;  3CVR A;  1IK9 A;  2O01 N;  3PTR B;  4KX6 A;  2ZVO B;  3H25 A;  4HFE A;  3KIN B;  1LWU A;  5DJU B;  5GTI E;  4IHJ E;  2E9X B;  4HYT B;  3M91 A;  3A0H E;  3CQX C;  1UCU A;  2YU1 A;  4PNI A;  1JCC A;  4H9S E;  1SS1 A;  3VTP C;  2D2C B;  2VKH A;  5F8P A;  4X64 T;  4ZMD A;  5J2T E;  1USD A;  2BG9 A;  4ZZC A;  2BG9 E;  2XQ8 A;  2WDQ A;  5TIS E;  2IAK A;  3V2Q A;  3CPZ A;  4KHX A;  1D1A A;  4PV1 D;  2A9U A;  1S94 A;  3RI5 A;  3AE6 A;  3C64 A;  4IL4 A;  2MKV A;  5JDQ A;  3B71 A;  5AQN B;  4HWD A;  1EZV D;  3I9Y A;  2X67 A;  4LF8 T;  1SQX E;  2XTL A;  3L70 J;  4I55 E;  3L75 J;  3I5C A;  1Q82 Q;  5H2F E;  5FMN A;  5AQG B;  3EI0 A;  5C3J A;  2W62 A;  3O6Q B;  2WT7 A;  5CBN A;  1EDI A;  1NO4 A;  2Q3E A;  3FZK B;  3V5S A;  1N73 B;  2M6I A;  5HEO A;  4QX7 B;  2YIN A;  4HFD A;  4IL6 X;  3C1L A;  2KND A;  4E7S A;  5LGU B;  4TNV A;  2E74 C;  4DMV A;  4BRY B;  4M3L A;  1G73 A;  1HTJ F;  1SHZ C;  1LTT C;  3FBL A;  2XZE A;  5EK2 A;  3BQI A;  4KI0 F;  2LE8 A;  2ZT9 C;  3L71 G;  4UVC B;  1KYO E;  3IAO A;  4Y99 C;  2YKP A;  2L91 A;  5ADX L;  4ASW A;  3FZH B;  1PGQ A;  3AVR A;  4NXM T;  1AFO A;  2L5G B;  2OA5 A;  1NU1 K;  4IDZ A;  3MA9 A;  3M9H A;  3UUB A;  1PP9 J;  2M8R A;  2OYH B;  2Q9Q D;  4YJ2 E;  1VF5 B;  4TV8 E;  2KZ7 B;  2KIK A;  5BVZ A;  1BGY E;  3LIE A;  5ABF A;  4X1Y E;  1JTH B;  1NTM K;  1D0Z A;  1XDO A;  4MHC A;  2NP9 A;  2V7L A;  2DW3 A;  1G1J A;  2MYS A;  2FYU E;  4BWN A;  4CI1 B;  2GK9 A;  4YXD C;  1RQU A;  3MD0 A;  4UEM A;  3WMM 0;  2B1E A;  4H63 V;  3O1I A;  1NTZ E;  3L71 D;  5AQR B;  1XTC C;  2V6Y B;  1FMW A;  2NR4 A;  3GN5 A;  1MMD A;  3A7M A;  4X1I E;  4OH8 B;  2DWK A;  2XAH B;  1LT9 C;  4O8S A;  3OVU A;  3G4S P;  1TU3 F;  2CM0 A;  2WU5 A;  3P8C D;  3OW2 O;  2DNX A;  4DR3 T;  1UGO A;  2R32 A;  2ITA A;  2J58 A;  2K24 A;  1LWU B;  3IEE A;  4HFH A;  5GTI H;  2F4V T;  1YYC A;  3DP7 A;  3ITK A;  2CMR A;  3KVA A;  1P84 I;  1QLB A;  5DQV A;  4ILA A;  3VRA A;  4PK4 A;  5M1B A;  3P4P A;  2BG9 B;  1VQN P;  2VB6 A;  4DMW A;  4L5G A;  3CL3 D;  1H88 A;  3CIR A;  1IFN A;  2OAR A;  2NOX A;  1ZEE A;  2MOZ A;  4WY4 A;  1SQQ J;  3SWF A;  1KB9 D;  1N7S A;  5FXW A;  5K5G B;  1MMN A;  1N34 T;  3BVH A;  3RK3 C;  3AAI A;  2YDR A;  1JMB A;  3AEA C;  5AW8 B;  4NIQ A;  4WBA A;  5H2F H;  2P1J A;  2UXD T;  3H1K G;  4WB4 A;  5APY A;  5HXC A;  1VRB A;  1RF0 A;  3Q5P A;  4DCK A;  3UT5 E;  2WT7 B;  1L0N E;  2KT9 A;  1HF9 A;  2V4H A;  2LKG A;  1KTM A;  3VRB A;  1MV8 A;  4ZZB A;  5HEU A;  1HVV A;  2MTQ A;  3B5N D;  1RF1 C;  1FDO A;  4Z90 A;  3ZN0 B;  1JB0 J;  1RE3 A;  5KTB A;  2UUA T;  1GTW A;  1EXI A;  2ZM0 A;  3AB3 B;  3RIU A;  3F5H A;  1KYO H;  2JQK A;  2KXP B;  1J5W A;  5HEG A;  1VQ9 P;  5JR9 A;  2BEZ F;  1JY2 O;  2FBW C;  2FJA A;  4U3C A;  5H6Q B;  3WUT A;  5BR8 T;  3ZYK A;  3EAB A;  2FFD A;  1QL1 A;  1ZV4 X;  2UXN B;  4YT0 A;  3U78 A;  2HH7 A;  4QWN B;  2H88 C;  4P0A A;  5ABF B;  3CLQ A;  3CC4 P;  1ZP0 A;  1VPC A;  4H44 C;  3JC6 D;  4O4H E;  4NPD A;  1FMV A;  2V7I A;  3LK4 2;  3ZC0 A;  4R4L A;  3L70 E;  5GON E;  2BKO A;  4IOI H;  1H0T A;  1S5L X;  1J1E C;  4PJM A;  2CXL A;  4Z8X A;  5KLV G;  4OFZ A;  4XE5 B;  3Q3D A;  1HCI A;  2ODU A;  1N32 T;  3GN5 B;  3EFF K;  3G6E P;  2XDJ A;  3RF1 A;  3U59 A;  5APW A;  5F5W A;  2XQY A;  3UUX B;  3B8E B;  2OLT A;  4I4T E;  2BDE A;  4CQI A;  5KXJ A;  1J1D C;  3J9X 1;  4GIF A;  1BR4 A;  4ASV A;  2BZB A;  2BCC J;  1R5S A;  4N78 D;  2WPQ A;  4WBO A;  3Q5S A;  4JI4 T;  1WR0 A;  2Z6E A;  3V6I A;  3ABV C;  2W6J H;  2WPS A;  2O1J A;  4ANJ A;  2LRK A;  1PP9 E;  3M0D A;  1NOH A;  1T8Z A;  1EZV E;  2HLO A;  3R84 B;  1QUU A;  1QL2 A;  5KLV D;  5LBM A;  4OGQ D;  2AEM A;  3IFM A;  4OVN F;  4DR7 T;  1LJ2 A;  4WY4 B;  3C9I A;  1ZOY C;  5APT A;  3VHL A;  4I7Z C;  5KKZ B;  2E75 B;  3UUN A;  1PV3 A;  2YN6 A;  2PJQ A;  4OX9 T;  2M0B A;  3ZJ1 A;  5L3F B;  3E0Z A;  4LLH A;  5FVK A;  1MMG A;  1SE7 A;  5JDG A;  4O4L E;  3W15 B;  3B57 A;  4B3S T;  1XWM A;  4KBM B;  2VAS A;  2ZM2 A;  4DV0 T;  2ES0 A;  2FXP A;  4UB6 E;  5C8Y E;  2E2A A;  4DV4 T;  2V8S V;  1N8R Q;  3C4Z A;  3N5L A;  2E76 B;  1NTK J;  2JRK A;  2I59 A;  1HGV A;  1VQL P;  2D0U A;  4LF9 T;  2X0L B;  4QXC B;  1PPJ E;  3UU3 A;  2JKV A;  4TV9 E;  5LG4 A;  2Q9Q A;  1M62 A;  3QOF A;  1WYB A;  1UX4 A;  1URQ A;  2VL0 A;  3KFW X;  5JR9 B;  1VOM A;  3GMI A;  1GL2 A;  1UUS A;  2BVL A;  2IDO B;  1OED A;  5JTG A;  1OED E;  5CFB A;  1OW6 A;  5FVL A;  2J47 A;  1I6Z A;  2FFD B;  3QUJ A;  2WS3 A;  4NUU A;  4TZ4 C;  3AE7 C;  3K8P C;  3P50 A;  2LSG A;  4DBR A;  5HEH A;  1U4Q A;  3RL0 B;  1OWA A;  3MAC A;  3L71 E;  2UXX B;  3M65 A;  4H13 B;  3OTO T;  4KT0 J;  1VQM P;  3SFE C;  3AEG C;  2RP4 A;  4PK5 A;  2N9Y B;  1H0T B;  1B7T A;  2J62 A;  1SQQ K;  1ZR4 A;  3PUQ A;  4QXB B;  4UXN B;  3CKD A;  2WSE H;  4LFA T;  1T7S A;  3P8C E;  1JY3 P;  1SQP K;  1D0X A;  3RQU A;  3G9R A;  2KWI B;  4AIU A;  3AEB A;  2V7Q J;  3N9P A;  4ADZ A;  4OYJ A;  2AXC A;  4DOJ A;  5JVD E;  2HYN A;  3D70 A;  1PGJ A;  2H3R A;  2WU2 A;  4HTE A;  4GOF A;  2QIW A;  3TLS A;  3PE0 A;  1S35 A;  3PP5 A;  1MIV A;  4JI3 T;  2N9D A;  1M90 Q;  2D5U A;  4AQF C;  3LBX A;  1YIT P;  2FYN C;  2V7K A;  3A0B E;  3LFM A;  4U31 A;  5EK3 A;  4IE6 A;  3UQ4 A;  4B86 A;  1DEB A;  2IYO A;  3I0O A;  1KB9 E;  3PUZ F;  2WPR A;  1W0B A;  1GQE A;  3PUS A;  4UVB B;  3E08 A;  2VVN A;  3P4Q A;  1BE3 J;  2G8Y A;  1GMJ A;  4ZS3 A;  2KIN B;  1W09 A;  4QH5 A;  4H0L C;  1GU4 A;  2W66 A;  3AED A;  1EZ3 A;  3AE1 A;  5J0Z A;  2GUS A;  3M06 A;  3KPE A;  1IFP A;  2ACZ A;  4DR4 T;  2E74 D;  2JQH A;  1SQV K;  1LTB C;  3IF8 B;  2WP9 A;  4DO0 A;  4J2C A;  2IBZ I;  4D6T G;  4U2Z A;  1ZHC A;  3B5N A;  4PJL A;  3KQG A;  3AAA B;  4PJ0 E;  3K3N A;  1K9M Q;  2ZT9 D;  3PH0 A;  5HXR A;  5JDL A;  1VQP P;  3AXJ A;  5AW5 B;  1YJN P;  5LOV E;  1KNZ A;  4UB6 H;  4JPZ B;  4TWD A;  1NTM G;  1JOC A;  1N36 T;  3UIA A;  5AQU B;  5ABH A;  2WVR A;  2J5U A;  3P4R A;  4UIG A;  2ZYA A;  4IL6 H;  3SWY A;  2EHO C;  1US7 B;  2QJK C;  3FZF B;  4DND A;  2Q9Q B;  4CXW A;  5FYM A;  4AXP A;  2W6A A;  3RYH E;  1URQ B;  1IFM A;  4AI6 A;  4YHH T;  1GL2 B;  1T72 A;  1FOS E;  2KOG A;  5AQS B;  2CRB A;  1OED B;  1SQX J;  4RKU J;  4YTM A;  4D6T D;  2WY2 A;  1GU5 A;  2VK9 A;  2R3C A;  3GMA A;  2XAG B;  2XPK A;  3EAM A;  3GWH A;  4DV6 T;  1Y47 A;  4NPF X;  1VCT A;  2NTY A;  2HN1 A;  3VR9 A;  4DR2 T;  1U7M A;  2Y9Y A;  4AKI A;  4HFB A;  1M1J A;  1YKE B;  4IL9 A;  2JPF A;  4IIJ E;  2J4G A;  3ZSS A;  1OVR A;  4G2A A;  1MFZ A;  2RA1 A;  4DR6 T;  4PD4 I;  2X66 A;  4AKR B;  1YW0 A;  3VN0 A;  4U3F G;  4JI2 T;  5DJT B;  3MJX A;  1RE4 A;  1NYH A;  4DBQ A;  3FWN A;  4IE4 A;  1GW4 A;  2YEV C;  1S5L E;  3M9Q A;  2BS3 A;  4GOU A;  3AE3 C;  2Q3I A;  3BCC G;  4ZHQ E;  2YO2 A;  2QJP C;  3MUD C;  4N78 E;  4JI6 T;  2W8Z A;  1SA0 E;  3IR9 A;  3PLN A;  3R6N A;  1HJB A;  2P58 A;  1L0L G;  1NTK K;  1KK7 A;  1KQG B;  1OW8 A;  4JEH B;  3LBX B;  5KLV E;  3UU6 A;  3A0B H;  2JMK A;  4AKG A;  3PUY F;  3VMY A;  2FYU J;  5KX5 E;  2LOP A;  2E42 A;  1HH0 A;  2QG4 A;  3RK3 D;  1E2A A;  3ANW A;  3EDV A;  1KB9 H;  1RY3 A;  3C4W A;  4CPG A;  4UB8 E;  3ZYL A;  1SQB G;  1L4A C;  4EDF A;  1NTZ J;  2E9X C;  1D7M A;  1JUN A;  3TYY A;  4F6R C;  4U3F D;  3WUU A;  5LG3 A;  4L76 A;  3CD6 P;  2D2C C;  5CCG A;  2YXR B;  3BCC D;  2I8D A;  3BAS A;  5APS A;  4L75 A;  4U2Y A;  3D6Z A;  3IA3 A;  3HI2 A;  3B5N B;  3H1J G;  4YSY A;  5CJ0 A;  3AA6 B; 
#chains in the Genus database with same CATH homology
 3QB5 K;  3MZW B;  3S1K A;  3AXJ B;  3MHV A;  2QVA A;  4HKZ H;  4GOE A;  3PJA A;  2B87 B;  1KEY A;  4KJM A;  2KI7 B;  1S3J A;  4GOD A;  1ZXG A;  4HB1 A;  4ZNC A;  4NPD A;  4K3A A;  2WMM A;  2LXC B;  1BDC A;  2B88 A;  1LT1 A;  2R44 A;  2OTK E;  4IOI H;  1H0T A;  5EFW B;  3FXE A;  2KUB A;  3QWO C;  2UWJ E;  5DJU B;  1Y47 A;  4NPF X;  3ZDM A;  1H0T B;  1U7M A;  1EC5 A;  2ZAE B;  4WWI A;  2K3R A;  1SS1 A;  1EDJ A;  1MFT A;  1OVR A;  4ZMD A;  4NPE A;  2HR3 A;  4MN4 C;  3PJA J;  5DJT B;  4ASV A;  4EYY Q;  1BDD A;  4GOF A;  1U7J A;  1EDK A;  3FXD A;  5K5G B;  2LXB A;  3QB5 A;  5C39 A;  5CBN A;  2KS1 B;  1EDI A;  2M5A A;  2LR2 A;  2P58 A;  1JMB A;  2Q1K A;  1EDL A;  4HJG H;  4JBZ A;  1JM0 A;  1DEE G;  2M5A B;  1OVV A;  2KZI A;  2RKL A;  3RIU C;  2M0B A;  4CPG A;  1NVO A;  2KZJ A;  1X0T A;  3RGU A;  1Q2N A;  2QRX A;  1LP1 A;  4BXL A;  4WYV A;  1OVU A;  1ZW0 A;  2JWD A;  4ASW A;  5CBO A;  2I8D A;  3PH0 A;  3RIU A;  1J1J A;  4K35 A;  1LP1 B;  2B89 A;  3AXJ A;  1FC2 C;  2SPZ A;  2KIK A;  2B87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...