2QVAA

Crystal structure of drosophila melanogaster translin protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
182
structure length
182
Chain Sequence
VNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERSLNISHFIGDLNTGFRLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GM27569p
publication title Crystal structures of Drosophila mutant translin and characterization of translin variants reveal the structural plasticity of translin proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 69
structure length 182
sequence length 182
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2qvaA02
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 2qvaA01
1EDKA 1X0TA 1SS1A 3PJAJ 5EFWB 1LT1A 1OVRA 1H0TB 1Y47A 3ZDMA 4K3AA 3AXJB 2M5AA 1BDCA 4GOFA 3RGUA 4CPGA 1ZXGA 1NVOA 4HJGH 4JBZA 5C39A 1OVVA 1LP1A 2SPZA 5CBNA 1ZW0A 4BXLA 2P58A 3PJAA 4ZMDA 3FXEA 4GODA 4NPEA 1H0TA 4WWIA 2B89A 1KEYA 3AXJA 4HKZH 3RIUC 1FC2C 2K3RA 4KJMA 3QWOC 1EC5A 2KI7B 3PH0A 1JMBA 5DJUB 2KS1B 2RKLA 2KIKA 4GOEA 1EDLA 2LXBA 1OVUA 2Q1KA 2UWJE 3MZWB 2B87B 1S3JA 2KUBA 1EDIA 3S1KA 5DJTB 2OTKE 2M5AB 1U7JA 1MFTA 4IOIH 2ZAEB 1U7MA 1BDDA 2QRXA 1JM0A 3QB5K 5K5GB 2B88A 2I8DA 2LXCB 2B87A 1EDJA 2QVAA 3FXDA 2M0BA 4K35A 4ZNCA 1DEEG 2LR2A 2R44A 3RIUA 2JWDA 3QB5A 4WYVA 4ASWA 2KZJA 4MN4C 2WMMA 5CBOA 4HB1A 3MHVA 4ASVA 1J1JA 1Q2NA 2KZIA 4NPDA 4NPFX 2HR3A 1LP1B 4EYYQ
chains in the Genus database with same CATH superfamily
1U57A 3V2PA 1WT6A 1LTIC 2YU1A 5LMNT 1QLBA 4YTMA 3W68A 2X67A 2WZIA 4B3ST 1LT9A 4GOFA 4C7NB 4JI8T 2J4GA 1ZKEA 4DCKA 1OZHA 3PURA 1ZV4X 5APUA 1ZXGA 2W6JH 4AQFA 5L3CB 1W0BA 4PJJA 3RL0C 2WSEJ 5FVKA 4GIWA 2JJLA 2XDJA 2ODVA 4TNVA 3RHWA 4I7ZB 2LKMA 3M0DC 1KILA 4PV1B 2XAQB 5JQGE 1L0LD 3OPCA 2ZM8A 1KNZA 3O1IA 1GD2E 5APTA 2WM9A 2I59A 1SUMB 5AW4B 1YQ4A 2X68A 1N73B 1IFIA 4BAYB 4LFCT 4KX6A 3HR0A 1USDA 1Z8UA 3DP7A 1UUSA 4GOEA 3CWBE 4H44C 4PD4I 1LTAC 4EZ4A 3PTZA 2HYNA 4EAHA 3H1JD 2WPSA 5BMVE 3AA7B 5CFBA 4CZZB 5LHHB 2Z6EA 3AEDA 2FYZA 1KORA 3AE5C 4DV0T 5LG4A 3AE2C 2FXOA 2FUPA 5GTHH 5KKZC 1PFIA 2ZFCA 2FBWA 2YO3A 1HS7A 4XAXB 3NTNA 1HCIA 5C8YE 5APVA 4DV7T 1L0LG 2AXTE 1L0VA 2LSIA 2WT7B 2VURA 1PP9J 2FXMA 4GK5E 2WWUA 3CKDA 5L2LA 1JCCA 3RYFE 1WCRA 2E5TA 5CCGD 1ZOYA 1DEEG 3C50A 2QJPB 2FYUK 3C4XA 2DI4A 2KZ7B 3H1JJ 5JRCB 3ETUA 3C8VA 3H1JG 2NW7A 3RK2D 1FE6A 1ZRTE 1CI6B 4JLEA 3AEEA 1NTKK 5KJ7A 4ZS3A 4O2AE 4F8HA 3AAAB 2J58A 1Y9BA 2YINA 3F89A 2Y9ZA 5E79H 2YDQA 1X0TA 3JC6D 4I7ZC 4W80A 4B6XA 4PV1C 5C3JA 3PJAJ 1IK9A 3ZDMA 3Q5RA 1D0XA 2PTFA 2IYPA 5IWAT 2R3CA 2M5AA 1LKXA 4HWHA 1SQXE 1N73C 1SQVG 3AAIA 1MMNA 3EI0A 3QH9A 2QIWA 3S4RA 2ZM0A 3E0ZA 3SFEA 2P10A 3H1IG 4PJ0H 2FFDB 2CA5A 1Q7YQ 3R4YA 1CW5A 1VOMA 2X9HA 4TX5A 4TWHA 1KILE 2YN6A 2WBLA 5FNVE 2NP9A 1JMMA 4BXLA 1VQOP 4UB6H 2W66A 1SQQK 3PU8A 1QUUA 2X9YA 1L4AB 3V2RA 4TN7B 5FYMA 3RIUC 1G1JA 3RL0D 1XDOA 5AVSB 5KAFE 1KC8Q 2XHEB 3AE9C 2RKLA 1MMAA 2KIKA 4B3MT 3S4UA 3TNUB 2AEFA 4L0RA 3KV9A 5HEGA 2QA7A 5KAIH 4UXNB 2R6GF 2KUBA 1J5WA 1MIWA 1GL2B 3I56P 2QJPC 4L73A 5HCMA 4H44D 1HR0T 1M7KA 1YXRA 2LE8A 5AVWB 4EOTA 1X79B 3WAJA 2C9NY 3O9XA 3FX0A 3ZJ1A 4HTEA 5AVQB 2NPSA 2V7JA 3LIEA 3H6PA 3TF5A 2BKOA 1IFMA 2JQQA 3FXDA 3TSIA 3BVHA 4HE8A 3HD7A 3L71J 2V4HA 3TLSA 1NTMK 2PFXA 4ZXLA 3AEGA 4QH1A 3OYZA 3HKBE 1J2JB 1NTZK 1GU4A 1VQ8P 3L74E 3TDKA 2XAHB 1LT9B 3GN5A 1NEKA 4YTNA 3VP9A 4CN4A 5FY7A 4DV5T 3L36A 2WITA 3LBXA 2FFDC 1HGVA 1N32T 3L72D 4ZI3C 2WVRA 3GF3A 3C1LA 5AW9B 1BR2A 1SS1A 1OW6A 3GW6A 2FJAA 1KILB 3UU8A 2E5LT 3L70E 2KSRA 3RLFF 4ZI7E 2ACXA 2C0SA 5JREA 2IFNA 1L4AC 1YQ3C 2BEQD 2Q7CA 2HPCA 5EK2A 1IFNA 3TGUG 3ONLC 4PK5A 3LK2B 3CXHD 1RQVA 4PV1D 1A02F 5BU5A 3KBTA 2C5JA 5JDMA 3II6A 4OWFA 3VN0A 2JMKA 2YEVC 3PJAA 4OVNF 3AE8C 3HTKA 4AUWA 2MOZA 3GMIA 3KZIH 4HEAA 4ILBA 4HKZH 1GL2C 2BS2A 3CCLP 1IC2A 1M56D 1FC2C 4TV8E 5L3GB 2XQAA 3L72J 1S35A 4B86A 2O01H 1ZP0C 2W0GA 1JMBA 5LG3A 4UVBB 3Q5EA 1T8ZA 1UGOA 3ZC1A 5CMZA 5CJ4A 1IBLT 1QLED 4UF0A 5F5WA 1OIPA 3F57A 1HF9A 3HE5A 4E7SA 1KB9H 5JDFA 1UIIA 1GK4A 1PIXA 3ZSTA 3PHLA 3L4FA 3H1LE 4IT4A 1LT9C 5BVZA 1E5WA 3TLVA 3QB5K 3AE6A 4AQFC 4OGQB 5AQIB 5CA0E 2UXDT 4LF9T 2I8DA 3ZMUB 2GUVA 4L9IA 4CQIA 5GTIH 2R44A 1KILC 4AXPA 1R5LA 2A06D 2XQ5A 2CE7A 5HEJA 2KOGA 1JUNA 3GA8A 1KF6A 2KZJA 2AEJA 4D6TD 1YQ4C 4KP3C 4WW0A 5JH7E 1PP9E 1YD8G 5CBOA 3TKLB 1W0AA 4G63A 3CX8B 3X1DA 4GYRA 3OBVE 4QXCB 4C90A 2Y6XA 3EABA 2HLOA 4U72A 1DD3A 5AQFB 3RC8A 1J1JA 2CBIA 4H9NC 3M06A 3LG7A 3ZYKA 1MFZA 3TYYA 2WU2A 3CK6A 3RX6A 4DR3T 4JI4T 1R5SA 4DT0A 2QA4P 1YTZT 2BCCD 3AEDC 1OVRA 4O9BA 4YSZA 4O4HE 2Z5IA 4WY4D 3H1KG 1SP4A 4UELA 1KD1Q 2E5VA 1FOSF 2FBWC 2V5DA 3HUSA 2Y8DA 2JR8A 3CWBD 4YT0A 4CPGA 4AI6A 3KINB 2W67A 1L4AD 3AA1B 4D6TJ 4UB8E 3VMXA 4V1Av 3AE2A 3RYHE 1LVKA 1JY3P 1IAPA 1NU1D 3CQGB 3EHZA 1M1KQ 4IE6A 1ZOYC 4OHFA 5APYA 2KWIB 4M3LA 3UU3A 3B4SA 4A56A 2WSSV 3ZMTB 4JV5T 2KLUA 1BGYD 2M6BA 2BCCJ 3UTKA 1UURA 2HN2A 4U74A 1YITP 3AEEC 1GL2D 2NPSB 5KJ7C 1FJGT 4OGQC 2ZYDA 1N7LA 1HNZT 2N1GA 2V26A 1S3JA 4IL6E 3IFMA 3CWBG 2CM0A 1NHLA 3HD7B 3CC4P 3VTPC 5LYJE 3ZT7A 4AKRB 1ZRTD 5AQTB 5AQKB 3MTUE 2CEAA 1XMQT 1S5LX 1AV1A 4C7NA 2KNCB 1LTSC 3USSA 3GN5B 4HFEA 1NU1J 5AQJB 2ZAEB 3H32A 3SFEC 3EVYA 1E2AA 3LBXB 5JVDE 2LXCB 4DIDB 1BGYJ 4N78E 3IHRA 3L37A 3PP5A 5FKYA 1AVOA 2C0XA 3P8CD 2XU6A 1Z0PA 1ZLLA 3G4SP 3MXZA 4DR2T 3Q5XA 4WYVA 2V7IA 2FJDA 1D1CA 1JNZA 2OYOA 4OYJA 1YIJP 3B71A 2JQKA 3OAKA 5KLVG 1KILD 3CX6B 3L75D 5L4HA 2GA1A 3I1AA 1MIVA 3L71E 1K8AQ 4L5GA 2R5DA 5H2FE 5HXHA 3AE3A 1K73Q 4PNIA 2OQQA 4U7JA 3JSVC 2N9YB 3HTKB 1LT1A 1Y47A 2CLYB 1USEA 4ZI2C 1Q86Q 5AQNB 2LRKA 1WR6A 1CUNA 3PDYA 4IDPA 1KNRA 4HJGH 1DU2A 3C51A 5L3DB 2DCFA 1OVVA 1EQ7A 1PGJA 1SQXG 5KX5E 1E7PA 1LWUB 2NPSC 1L0LK 2V7MA 5FL0A 3UU5A 2LRLA 4ADZA 3ZT5A 4UF0B 4WWIA 4EIWA 2P67A 3L75J 3HD7C 3RIFA 3HE5B 4CI2B 1OEDA 1E1HB 3V5SA 4PK6A 3AEGC 4Z91A 1KFMA 2CRBA 2Q3IA 1CI6A 3F2EA 5LMUT 4ZOLE 5DJUB 4I6MC 5BR8T 4O4JE 4YSXA 3SWYA 5AQUB 4IL9A 3KV4A 3QNUA 2D0TA 1EZVD 1H8AA 2K9YA 5LHGB 2UWJE 1XDPA 2M3BA 3I0OA 2E42A 4CXXA 4QXBB 1YJ9P 3A5TA 3L3PA 4B3RT 1ZR2A 5KJ7D 4WVZA 5APXA 3C9IA 1AJYA 4OGQD 4JEHB 5L8RJ 2V7LA 3M9BA 5CJ0A 1KQLA 1CHUA 2IDBA 2WDVA 1HG2A 1SQVK 3CXHE 4WY4A 4JYCA 4ZEYA 3B13A 5F3JA 4I50E 5K5GB 3ZPOA 3L70D 2JKVA 2NRGA 2ZJSE 1LNQA 1XTCC 3A2AA 1JOCA 2VQET 1MMGA 1QL1A 5FXVA 3EFFK 2BEZF 1AQ5A 2CLYC 3CI9A 4ASWA 1D1BA 3O1HA 3HUSB 5FY1A 1HNWT 3NZQA 2ACZA 4ASVA 2YOEA 5M4YA 1FDIA 2R5BA 3ZCJA 1SQPD 3VOPA 3L74G 4MBQA 4AKLA 3GF7A 2DHRA 1KQFB 1UCUA 2YK0A 3Q5WA 2K48A 1P84H 5C2TA 3AEAA 1RH5B 3Q2YA 2WDRA 3CMAP 3E08A 2W4XA 4LLHA 1O3XA 3L70G 3A0HE 3VU7H 1OMIA 4UVCB 3RRWA 2C9LY 4ZI2D 3BCCD 5IYZE 2J47A 3AE6C 2AE9A 4DV6T 1OW7A 4IFDK 5LHIB 2XJ7A 4H9OC 5J1GA 1OEDE 5ABHA 1LTTC 5CHXA 1HFAA 4DMWA 5JDHA 1BE3J 1HWTC 3AXJA 3FBZA 1I6ZA 1SQPJ 2X0LB 3ZSSA 3H1LD 2NPSD 4TLFA 2A06E 1J5ET 3N2GE 4D6TE 3PUWF 3H32B 4X65T 3HD7D 5E0OA 1IFDA 5LB7B 4PAGA 4H9RC 3VRBA 1OVUA 2CPBA 1OXZA 2W62A 3LIDA 2DL1A 1M57D 3ANWA 2I1KA 2BBHA 1PP9D 5FY0A 2XZRA 3BCCJ 2I6HA 2BCCE 5B5EH 3B8EB 3U78A 1YTZI 2VVSA 3DTOA 3HUSC 4TNWA 1AA0A 1K05A 3GHGA 3H1LJ 3AEBA 4JI3T 1Q82Q 1VQ6P 2J1DG 2M0BA 2K24A 3T1HT 2O01J 3CIRA 4X66T 3HI2A 2NR4A 3FZHB 1NYHA 3QB5A 2QM7A 2VASA 4EYYR 1XNQT 1NU1E 4CI3B 1SQBD 3Q3DA 3A0BH 1T72A 2HH7A 1QVGO 4IREA 4HFCA 1NWQA 2WPRA 3VYIA 3WUTA 1MMDA 1RHZB 1BGYE 5CA1E 1PP9G 2XNXA 2WMNA 4DVDA 4YFSA 5TISH 1JY3N 5LBMA 3W15B 3UT5E 4AIUA 2A45I 3KDPB 3CXHI 4K3AA 3CC2P 1OEDB 4E7ZA 1BDCA 3R2PA 4NXNT 3J7Yq 4ZKUA 1U4QA 1AQTA 4U7YA 5JR9A 4C46A 5CCHA 1SLQA 4R4LA 2LHRA 5GTHE 1HH0A 3TLWA 3UFEA 2MKVA 1NWMX 4HFIA 4HFBA 4LF4T 2PRRA 5HEOA 2JWAA 2XM1A 3L39A 4IGUA 4YXDA 3NXSA 1SQBJ 3KQGA 2W63A 4HWFA 1D1AA 1VRBA 3KBUA 3RYIE 3IF8B 3FXEA 4JI0T 1QX8A 2VKHA 4AKIA 4AQYT 4N3YB 3L8RA 1DIPA 2WWWA 1ZN5A 4JBWF 5AVTB 1L0NJ 3P8CE 3JAFA 2XQ8A 5ABEA 2VKDA 2H88C 1T2KD 5AQHB 4EIJA 2ZXXA 1X8YA 3L09A 2KLVA 4WY4B 3SSUA 2WPVB 4N78D 3UUMA 3QC9A 2VK9A 3L75E 2WCAA 5HYAA 4UV9B 3AE3C 2E75B 3ONXA 4ILAA 2M8RA 1HUCA 4XFJA 5APQA 3AB3B 4U3FJ 5E79E 1GK6A 2H7OA 1FDOA 4O2BE 3FZFB 1X9VA 3L73D 3LK3B 2RA1A 4M1PA 2O1JA 2JMHA 3FZMB 4AQGA 2BZBA 3L71D 4IE5A 3PV0F 4CN6A 4A7PA 1FMVA 4BRYA 4I2LC 3KVAA 5FL1A 2QVAA 3NWIA 1NOHA 2CXLA 3EDUA 4PJ0E 3U1AA 4HWDA 4JI6T 3FGAD 1JY3O 1NH4A 3UU6A 1OEDC 4UB6E 2MPKA 4IFMA 4MN4C 3JC22 4UEMA 2L8KA 3RC3A 3H1HD 2BBJA 4XA4A 5AQLB 1VQKP 1LJ2A 4J2CA 3B5NA 1PZQA 4NPDA 1FAVA 2HPLA 2YXQB 3N9OA 4QHOA 1QGKB 2QG4A 3L73J 1XWMA 2X51A 4HKAA 2KINB 5M1BA 1OX3A 1EZVE 2PFVA 3ONJA 3UQ7A 3VP8A 3L71G 3AXJB 1VQPP 1QEXA 1HVVA 2KB7P 3ZKRA 2BVMA 2XUEA 2KNCA 5KAIE 3JCFA 3NMDA 2JPFA 4TWDA 1PGOA 1H89A 1IBMT 2YMYA 1CZQA 1UIXA 3U3IA 2DW3A 4WY4C 1IFPA 2P58A 3CCRP 4QX7B 4I55E 4GODA 1H88A 3EFGA 3H1HJ 2A72A 2E75C 1YJNP 3ANWB 4EEBA 2LHNA 3AVSA 4OX9T 2O3JA 4WBAA 4HFHA 4Y28J 4EI2A 2KP8A 1FIOA 4DMVA 2AEMA 3VRAA 2LKGA 3GHGB 2WSSH 1KK7A 3U59A 1NGMB 3BASA 1XMOT 1M7LA 5KLVK 2OLTA 3MZWB 1FZEA 1G1IA 1BE3E 4L76A 2Z4EA 2C5KT 4DUZT 4YJ2E 1SQPE 1RF1A 3P4SA 3IN6A 1UX4A 2JQHA 2WSFH 4KBMB 3AEAC 2AXCA 2FYUD 3AE7A 4EDFA 4DR6T 1FZBA 2IHR1 4KI0F 3L72G 3F31A 2B76A 2NW9A 2BKNA 3N9QA 3JADA 2FJBA 1NTKD 3NBXX 1LWUA 2X9WA 2LSGA 2YKQA 3G6EP 2GK9A 2E9XA 1KYOH 1IJ5A 2A45G 2ZT9B 1SQXK 4K35A 3BCCE 4AQRD 1T3JA 2W27A 3NVOA 1YKEB 4DOJA 3IA3A 1LVFA 4DR5T 1N33T 3A8YC 4TZ4C 3IBPA 1VDFA 3VHLA 2IBZE 3KZIE 1B7TA 1MUUA 5AW8B 3E1IA 5JR9B 4YHJA 4H0LD 4ERRA 4H9PC 4DO0A 2FYUJ 3UIAA 4YSYA 2KNDA 1Q2NA 3PUGA 5AQRB 1BCCD 1S94A 3LW5H 4OFZA 3N9PA 3KDSE 3SWFA 1H7CA 1FZGA 1X22A 3P4PA 3FXEB 3ZN1B 1SQQD 1D0YA 2G0UA 2LSYA 2ZM6T 1NTKJ 4LF7T 5LJNA 2OYHB 1P84D 1RE3A 1MNDA 1OFCX 1FZFA 1VQNP 4IDQA 3CD6P 2V7KA 2K5BB 2G3AA 1CSBA 2VKOA 4C7RA 3ZC0A 3HA4A 1VCTA 1KB9E 1T8BA 4JUYA 4A97A 3GHGC 1FZAA 3AEBC 3IAOA 3T8OA 2N9BA 2FY8A 4ZMDA 4KUMB 2B9BA 1H0TA 2B89A 2WZHA 5HWYA 1DD4A 3VMYA 1BCCJ 3ZLIA 4TWFA 4HYTB 4IL6X 4GKKT 1YYCA 2CK3H 2E43A 1FJKA 2MJZA 1PL5A 1K9MQ 3RBZA 2H43A 5GTIE 2Y9YA 3E1RA 4L75A 1EZVI 1SQQJ 3ZMZB 3LDQB 1SQBE 3CX5H 1G2CB 2E75D 1VQMP 2A06G 5ABGA 5LJMA 2B1EA 4BRYB 3CCVP 4X62T 4TT3H 4D6TG 5FXXA 2ZYGA 5JDLA 2ZT9C 2QE7H 1L0NE 1GTWA 2W00A 2K9JA 5LP6E 4IE0A 1FMWA 2XM2A 1GMJA 4QH5A 1NTMD 1KNPA 3KXDA 3CQXC 4X1IE 2Q6QA 2BDEA 3M9HA 2BS4A 2V5CA 2X9XA 2MBGA 2WY2A 5JR9C 5CCHC 2BCCG 2PAJA 3RYCE 1PGQA 3B5NB 5HCJA 2NTYA 4YXDC 2OGUA 1EDJA 3V2NA 4U3FE 3ZT6A 5J0ZA 1VQLP 3CL3D 3E22E 2IAKA 2JWDA 1N7SA 5LGUB 3CPZA 3H1IE 3SWHA 5CGMA 4EZHA 1XTGB 1LTJA 2OYHC 4DZOA 2WQYA 5L3FB 4I4TE 2VB6A 3ETVA 1EXJA 2W6BA 2ZVNB 5HXSA 2VL0A 3NZPA 1NU1G 1NTMJ 2N2NA 2XPKA 1URQA 2XKMA 5LNKA 3O4XE 3AE4A 1NTZJ 1DH3A 1T7SA 5AW5B 2D5UA 2E76B 1BR0A 4R4MA 2XSBA 2EHOA 2H89A 1BGYG 2QEXP 3AE1A 4ZZCA 4LMLA 4JYBA 3SS1A 3S9OA 4N6JA 4ILCA 2Y0DA 5AW0B 4DV4T 3GMAA 2XY8B 2H88A 2CCQA 1YJWP 5EK3A 2LM9A 3L73E 2PG8A 1S5LH 1QVFO 2JJ9A 3CPWO 2XQ6A 1NKZB 2SPZA 4XZCA 4IFFA 1SFCA 3PUAA 3WAKA 2IBZI 4GKJT 2WMOA 4Z8XA 3T97A 2GUSA 1RF1B 1VQ5P 3J9X1 1HF8A 3CWZB 2WSCH 5HXRA 2WB5A 4FI5A 1MNEA 1Q90D 3UUNA 3N7NA 2CHNA 2J59M 3MZKB 3SRZA 1BR4A 3ZMVB 1TU3F 4PD4H 1SHZC 1I94T 3TLTA 4H63H 3CCMP 2Q1KA 2HFED 3B5NC 3H1HE 2HPJA 3H3AA 4UVAB 2Q9QA 1D7MA 2E9XB 3QOFA 4LMKA 3Q1MA 2WS3A 2XQYA 3O8ZA 5JDNA 2FYNB 2L91A 2JP3A 3WU2H 2OTKE 2YU2A 3L75G 2DWKA 2V6YA 2N1TD 2HODA 1MFTA 5KXJA 2D2SA 3HKDE 2ZT9D 5B66H 2LSJA 2DNXA 4PFOA 2IZ1A 2E2AA 5AVZB 5JTGA 2CXFA 3JCUH 4B3TT 2M67A 1NENA 1NAYA 3E7KA 3KPEA 2UXNB 5IHYA 4ZNCA 5AVXB 3G71P 5LCYA 2E76C 5LA6E 5CCHD 2KWHA 3CLQA 1WRGA 2JQ9A 4A98A 2RN0A 1M62A 1JB0J 4K0UA 3MJXA 2W2UA 1MV8A 4I1LA 3EUHA 2LJLA 5AQSB 4CI1B 5LGTB 4P09A 2V7QH 5AFUL 1S72P 1IZNB 1ZEEA 3RBXA 4NPFX 2YKSA 2OYIA 4Z90A 1S4XA 3WUVA 1LGHB 2CMRA 3T1YT 4HGAA 3BQKA 4NUUA 4HFVA 1N8RQ 1H0TB 3AA0B 3V5BA 1RF1C 4DR1T 3RK3E 2G8YA 1D0ZA 1VCSA 1YW0A 3AE7C 3D71A 1EZVG 3RGUA 2FYUE 4PW8A 1W09A 4JI2T 3CMEP 4QMAA 5C39A 2M6IA 3NRXA 2A9UA 2MTQA 1IJDB 1BE3D 2D0UA 3C98B 2WAUA 1LWUC 1ZW0A 1OW8A 1NTKE 2HHHT 4JI5T 3NFQA 2E9XC 1KEYA 1GZLA 2X0YA 2FYNC 1E79H 3LJCA 2K9JB 3VR8A 2UU9T 2IFMA 2K3RA 3M0AA 3QWOC 3Q5PA 3A7MA 1EC5A 2I0MA 3K3NA 4U7IA 1VQ4P 2AXDS 1OWAA 1EXIA 1NAFA 3JAEA 4EEDA 5AQOB 1W2EA 1RF0A 2JEEA 3M91A 2HN1A 3AEFA 5AVRB 4NIQA 1BCCE 2BG9A 3WMM0 2IIUA 4U3CA 1T2KC 3BATA 2P9BA 1N7SB 2CXDA 2CHOA 2IBZD 1BE3G 1LTJB 1SQQE 2D2CB 1RE3C 1SQPG 3B5ND 3RGLA 4HH2A 4BA9A 1P84E 2OARA 4H63V 4IOIH 5FMNA 1JO5A 3PUZF 4JYAT 1BDDA 1U5PA 3A7OA 3MD0A 5DQVA 5A1LA 3MUDA 1URQB 2B88A 2A3DA 2OTLP 2WWVA 1YHQP 2LR2A 1KYOD 2EHOB 1M1JA 2VVNA 4EV6A 2C0WA 2LM2A 1KV4A 1JEKA 3BCCG 2ZVOB 1KB9D 3MP7B 2YDRA 3RK3B 3Q5DA 1M8OB 2QSIA 4G2AA 4ISTA 4JQ0D 4O4IE 2E76D 1JTHA 5LBQB 2XQ7A 3EDVA 2IBZG 2WSFJ 2Q9IA 3H1LG 1WMKA 2QJKB 1X9BA 4MALA 1SFCB 4YLHA 2ES0A 4JF7A 2E5YA 3GG2A 1T6AA 4QX8B 3T97B 2AXTH 3IF4A 4P0BA 5TAOA 3MGNA 5HXCA 2BASA 3HKEE 3BRVB 1GW4A 3WUUA 1NTME 5ABFA 4OH8B 4DV1T 4NXMT 3FHNA 2YO2A 2ZMAA 2LKHA 3C64A 4IE7A 1NTZE 3D6YA 2ZYAA 5KTBA 4AYCA 5H6RB 5B5EE 4PJNA 3VKHA 2N1TA 2JDIH 1L0ND 4DR4T 2SPCA 1VL2A 2Q9QB 2IMLA 4H0LB 5KMGP 2V6XA 3H3MA 3V6IA 1N7SC 3PLNA 1L0LJ 1LTJC 2V6YB 2D2CC 2WQYC 3PH0A 3LW5J 3ZMSB 2HODB 2E9XD 1RE4A 3CCSP 1BSNA 2JRKA 2WU5A 2X66A 1VPCA 2BKPA 4U2YA 5FVLA 1IBKT 1HTLC 4ZHQE 4IE4A 3P50A 2XAGB 3AA6B 1SQVD 4X5TA 2LXBA 4U3FD 3CX5D 2RPAA 1URQC 5BU8B 2BG9E 2GM4A 3A0BE 3AE4C 3H1ID 1SQBG 2WPQA 5AW1B 2ZXEB 2QJYB 4KT0J 4IIJE 5KLVE 2FJEA 2H89C 3AE1C 2EHOC 2K1AA 2OYHA 3PE0A 3VMAA 3M9QA 4HFDA 2LEHA 5TISE 3LSVA 2I1JA 1L0NG 2KS1A 3RK3C 3AECA 5FP3A 2QRXA 5EZYE 4WZXA 3FWLA 4UV8B 2E74B 4X1YE 3P4QA 2OYIB 1W2BO 3W67A 5KAFH 3G3ZA 2QJKC 4YJ3E 1SFCC 3GWHA 5AW3B 1Y8AA 4Y99B 4JI1T 1SQVJ 1VF5D 3ABVA 5HEUA 2KT9A 1UX5A 5DABA 5L47A 4U3FG 3H1IJ 4HB1A 1SA0E 5J2TE 1W5CE 1FEWA 3SFDA 2IDOB 1G2CA 3MIWA 2IC9A 1GQEA 2HR3A 2O01N 1ZMEC 3PUSA 5DJQC 4EYYQ 3MACA 5CJ5A 2VQFT 3N2OA 1P84I 2Q9QC 4H13B 4K0KT 4H0LC 1FBMA 2R32A 1FZCA 2UXXB 4AISA 1N36T 3TK1A 1Q81Q 1HJ0A 4FJOA 1IJ6A 4COFA 4YXWH 2UXBT 1BSHA 1LTBC 1QSDA 2P1JA 3EWKA 3PUXF 1FS0E 2POHA 5ETWA 1JY2N 1UK5A 3RF1A 3C4ZA 3KFWX 4EXTA 4U2ZA 2FKWB 5F8PA 4PJMA 2Y0CA 4OK0A 2XAFB 1FU1A 1A02J 3FWNA 3SOLA 5HWXA 2VKJA 3L73G 4DJGA 2WTYA 2XQ4A 3I55P 3NRYA 5AW7B 2BG9B 4ZS2A 2M3EA 2QJYC 3I0QA 3UQ4A 4KJMA 3OJAA 2P2UA 4DBRA 1AJ3A 4AKHA 4F6RC 3BK9A 4BWNA 2PBIA 3Q9DA 4EYUA 5KLIB 3TGUD 2XASB 1DEBA 1N7SD 4GIFA 3U1CA 3CX7B 2E74C 1FJPA 3IEEA 5HEHA 3RL0g 3HL6A 1NU1K 2D2CD 4PD4D 2OYIC 2OV9A 4ISSA 4GOUA 2NZ2A 1EDIA 1ZV8A 4YY3T 4LMJA 1M90Q 3CVRA 1M1JB 4Y99C 3H1HG 5DJTB 3ESLA 2KSEA 1HJBA 4U31A 5LGNB 3CC7P 1U7JA 3OKQA 1URQD 3A5XA 4YTPC 3CCEP 3KV6A 1U7MA 5AVYB 3MA9A 1JM0A 3HKCE 4CXYA 3VR9A 3K1SA 1SVFA 2EHOD 1JTHB 2QGSA 2UUAT 1S1CX 2B87A 5GONE 1HGZA 4O8SA 2WSCJ 3QK6A 3RK3D 1W9RA 3PU3A 4MFRA 4H13C 4UIGA 2WSEH 3TGUJ 3D70A 4GT1A 3CQCB 2YKPA 1KN7A 2H3RA 4IDOA 5DQWA 4GYSA 4DNDA 3O6QA 2C5IT 1PPJE 5KDMC 1SFCD 3M3ZB 5ABFB 3ZCIA 3LFMA 3HRNA 1JY2O 4GK0E 2JIWA 2KK7A 2WP9A 3RI5A 2N1TB 1EDKA 3P7KA 4W7YA 4AKGA 1RF0C 1KQGB 1N86A 4Z1MH 3AEFC 1ZHCA 2MAWA 1T3UA 4YHHT 2BG9C 3PUYF 1GW3A 2Q5UA 5AW6B 2IX7C 3KVBA 4KHPT 2NWBA 2DLRA 3OYXA 4LGDE 2N9DA 4JI7T 5CCGA 2W90A 3P4WA 3UUBA 3G9RA 3IR9A 3H37A 1MZ9A 3N2KE 3P7IA 1WRDA 4NUVA 1N34T 2Q9QD 2WDQA 1NVOA 2ZLYA 4A5XA 2V8SV 3UULA 2W83C 3HE4A 3K3OA 5HXEA 1KFYA 4GDOA 4LC1A 5KLIC 3OVUA 1JCDA 2FYUG 2DWGA 3MUDC 4RO0A 1RQUA 1S9KE 3K5BA 2CWYA 1YBKA 3RIAA 2V7QJ 2OA5A 1M1JC 1NTKG 1KYOE 3L35A 3A3YB 1HG5A 2KI7B 2F4VT 1R8IA 2KS1B 2O1KA 4LF6T 3H1KD 1G8XA 1EDLA 3ZJ2A 3GLMA 3BQLA 2XV5A 2H7HA 3R6NA 3ZN0B 3CMLA 1XNRT 5JDGA 3TLUA 1L0LE 4IDNA 2J62A 4RKUJ 3Q5SA 3FZKB 2UUCT 2M5AB 1NKNA 3ZEFB 1VQ7P 1VQ9P 1WR0A 5AQMB 1BCCG 2E74D 1J1EB 4UB8H 4HWIB 2LOSA 1ZR4A 3P32A 2RH0A 1BR1A 1SQQG 3SWKA 3CCUP 4LF5T 3M0DA 1PGPA 2KXPB 3V2QA 2BVLA 3H1JE 2N1TC 3OTOT 5FXZA 1S2EA 3CCQP 3H1KJ 4X64T 4EOZB 1FZCB 5H6QB 3PUVF 3C4WA 2YMKA 4HN9A 3V4WA 4C91A 3BRTB 4JEUB 1JNRA 4QWNB 3N9LA 4ZI3D 5AVVB 1EZ3A 1J1DB 4RESB 3B57A 3P8MC 2OTJP 1NTZD 4IL6H 1AFOA 4WBOA 1HX1B 5AQGB 4H13D 4LF8T 1RE4C 2KZIA 1WYCA 3UUXB 2PGDA 2KSJA 1HX8A 3AE5A 1SE7A 5EK4A 4XBFB 1JNMA 1SQVE 2LLYA 4NPPA 4IDZA 3CX5E 1Y01A 3AAEB 1N2DC 4O4LE 4OYKA 4ANJA 1QL2A 2Q3EA 2V1DB 2J5UA 1R8EA 2UXCT 3AVRA 4DV2T 3OJAB 4UR9A 3N9NA 1WFDA 2PJQA 4I0UA 5IUXA 1SQPK 3N9MA 4QKNA 3AECC 1L2PA 1LP1A 3RKGA 2IPPA 3RPUA 3QUJA 1NTMG 3G06A 3CWBJ 5CBNA 4BJMA 1Y64B 2RMZA 3KHUA 2R3SA 3FXDB 5CB4E 5KLVD 2K37A 1IFJA 4NPEA 1NTZG 2IUBA 4EB6E 5APWA 4DBQA 2Y0EA 5ADXL 1DX7A 3I9YA 2YIUB 3O1JA 4H9SE 4LFBT 3ABVC 4XE5B 2NW8A 2YNYA 1MIYA 3PUQA 5J2UE 1US7B 1J1EC 3N4XA 5H2FH 4X20E 2BS3A 3VKGA 1WYBA 3EQ2A 2IC6A 3SFDC 2XTLA 2W6AA 3V4QA 2NTXA 1K04A 2B87B 1YI2P 2Z5HA 1LTGC 2YXRB 3OA7A 3I9WA 3KYQA 1MKMA 3UFGA 1SQXD 4P0AA 4W7ZA 4RJTA 2XQ9A 2VRSA 2HPCB 1N73A 1FZCC 2LT3A 4ZKPA 3DJBA 4PFPA 4LFAT 5KLVJ 1J1DC 3RRCA 3O6QB 3RH3A 1JY2P 5L3BB 5LXTE 3K3QC 3OW2O 4DUYT 2IZ0A 2K9AA 1KYOI 4QH4A 4PJLA 4CN1A 1HTJF 5AQVB 3PJSK 2CBJA 3FB2A 3RIUA 1RY3A 1S5LE 1KB9I 2CPTA 1NO4A 3PRJA 5AQQB 2QM8A 4KMCA 4YPCA 3NKZA 3VMZA 5AVUB 2RP4A 2WMMA 3AE9A 3KV5A 4CXWA 3ZYLA 2WT7A 1SQXJ 3MHVA 2VWAA 3EAMA 1HBWA 3HE4B 2XNDH 3RK2B 5TJHA 1IO4A 3MKDA 2LOPA 2IW5B 2P7JA 2JO1A 2CWOA 3TGUE 4L74A 2H7VC 2KMFA 5EFWB 3CCJP 2K3WA 2YKOA 2XQ3A 4ILUA 3V5UA 1GU5A 4KHZF 5AQPB 2A45H 4PD4E 3FBLA 5JRCA 3CXHH 3D0TA 1SQBK 1GDTA 4JPZB 2QYWA 2YIUC 4QXHB 3WI3A 2KYVA 3I5CA 3MK7C 4MHCA 1HNXT 1YKHB 1KTMA 1G73A 2ZM2A 4IHJE 4H9QC 4JBZA 2E8IA 1T98A 4KHXA 3WU2E 2L9QA 1VF5B 1L0NK 3FZLB 1IK7A 4U33A 3Q2MA 2IYOA 4WB4A 3RQUA 3ITKA 4I43B 5B66E 3L72E 2YDSA 4PK4A 4DR7T 1Z56A 2VL8A 3JCUE 3L74D 4MLKA 5LOVE 4DV3T 3N5LA 2K88A 2Y48B 2L5GB 2MYSA 3PTRB 4YTPA 2FXPA 1FOSE 4TV9E 2W8ZA 5FXWA 3CX5I 2XAJB 4P1NA 1XZYA 2UUBT 2FFDA 3RL0B 1NJIQ 4X1KE 2H8PD 4BJNA 2HG5D 3K8PC 3UU4A 2X0HA 4TUYE 5JDQA 2NOXA 1L4AA 3A0HH 1YQ3A 1PV3A 3M65A 3S1KA 3RKOA 4WBNE 1V9DA 1PPJD 1KMIZ 2XZEA 2KLQA 4GKGA 5CCGC 2W61A 2ITAA 5APSA 3RQWA 4H44B 3L74J 3ZYMA 3TNUA 3P4RA 1KZUB 3RK2C 3AE8A 1KFNA 4Q25A 4ZZBA 1GL2A 3B5MA 2WZ7A 5KKZB 2XSAA 3L70J 1X79A 1ZP0A 2D9DA 3R84B 4ASKA 3D6ZA 4EGWA 1LRZA 2ODUA 5AW2B 3JC6C 2CPSA 2A2FX 2PP6A 3BQIA 3LK42 1AVYA 1KQSO 3H25A 5L3EB 5L4EA 1VF5C 4IL4A 1LP1B 2L3LA 4WNKA 4HWCA 1PPJG 1S9KD 3F5HA 1FDMA 1WLXA 5HAXA 3H1KE 2LSKA
chains in the Genus database with same CATH topology
1EDKA 1X0TA 1SS1A 3PJAJ 5EFWB 1LT1A 1OVRA 1H0TB 1Y47A 3ZDMA 4K3AA 3AXJB 2M5AA 1BDCA 4GOFA 3RGUA 4CPGA 1ZXGA 1NVOA 4HJGH 4JBZA 5C39A 1OVVA 1LP1A 2SPZA 5CBNA 1ZW0A 4BXLA 2P58A 3PJAA 4ZMDA 3FXEA 4GODA 4NPEA 1H0TA 4WWIA 2B89A 1KEYA 3AXJA 4HKZH 3RIUC 1FC2C 2K3RA 4KJMA 3QWOC 1EC5A 2KI7B 3PH0A 1JMBA 5DJUB 2KS1B 2RKLA 2KIKA 4GOEA 1EDLA 2LXBA 1OVUA 2Q1KA 2UWJE 3MZWB 2B87B 1S3JA 2KUBA 1EDIA 3S1KA 5DJTB 2OTKE 2M5AB 1U7JA 1MFTA 4IOIH 2ZAEB 1U7MA 1BDDA 2QRXA 1JM0A 3QB5K 5K5GB 2B88A 2I8DA 2LXCB 2B87A 1EDJA 2QVAA 3FXDA 2M0BA 4K35A 4ZNCA 1DEEG 2LR2A 2R44A 3RIUA 2JWDA 3QB5A 4WYVA 4ASWA 2KZJA 4MN4C 2WMMA 5CBOA 4HB1A 3MHVA 4ASVA 1J1JA 1Q2NA 2KZIA 4NPDA 4NPFX 2HR3A 1LP1B 4EYYQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDK A;  1X0T A;  1SS1 A;  3PJA J;  5EFW B;  1LT1 A;  1OVR A;  1H0T B;  1Y47 A;  3ZDM A;  4K3A A;  3AXJ B;  2M5A A;  1BDC A;  4GOF A;  3RGU A;  4CPG A;  1ZXG A;  1NVO A;  4HJG H;  4JBZ A;  5C39 A;  1OVV A;  1LP1 A;  2SPZ A;  5CBN A;  1ZW0 A;  4BXL A;  2P58 A;  3PJA A;  4ZMD A;  3FXE A;  4GOD A;  4NPE A;  1H0T A;  4WWI A;  2B89 A;  1KEY A;  3AXJ A;  4HKZ H;  3RIU C;  1FC2 C;  2K3R A;  4KJM A;  3QWO C;  1EC5 A;  2KI7 B;  3PH0 A;  1JMB A;  5DJU B;  2KS1 B;  2RKL A;  2KIK A;  4GOE A;  1EDL A;  2LXB A;  1OVU A;  2Q1K A;  2UWJ E;  3MZW B;  2B87 B;  1S3J A;  2KUB A;  1EDI A;  3S1K A;  5DJT B;  2OTK E;  2M5A B;  1U7J A;  1MFT A;  4IOI H;  2ZAE B;  1U7M A;  1BDD A;  2QRX A;  1JM0 A;  3QB5 K;  5K5G B;  2B88 A;  2I8D A;  2LXC B;  2B87 A;  1EDJ A;  2QVA A;  3FXD A;  2M0B A;  4K35 A;  4ZNC A;  1DEE G;  2LR2 A;  2R44 A;  3RIU A;  2JWD A;  3QB5 A;  4WYV A;  4ASW A;  2KZJ A;  4MN4 C;  2WMM A;  5CBO A;  4HB1 A;  3MHV A;  4ASV A;  1J1J A;  1Q2N A;  2KZI A;  4NPD A;  4NPF X;  2HR3 A;  1LP1 B;  4EYY Q; 
#chains in the Genus database with same CATH topology
 1U57 A;  3V2P A;  1WT6 A;  1LTI C;  2YU1 A;  5LMN T;  1QLB A;  4YTM A;  3W68 A;  2X67 A;  2WZI A;  4B3S T;  1LT9 A;  4GOF A;  4C7N B;  4JI8 T;  2J4G A;  1ZKE A;  4DCK A;  1OZH A;  3PUR A;  1ZV4 X;  5APU A;  1ZXG A;  2W6J H;  4AQF A;  5L3C B;  1W0B A;  4PJJ A;  3RL0 C;  2WSE J;  5FVK A;  4GIW A;  2JJL A;  2XDJ A;  2ODV A;  4TNV A;  3RHW A;  4I7Z B;  2LKM A;  3M0D C;  1KIL A;  4PV1 B;  2XAQ B;  5JQG E;  1L0L D;  3OPC A;  2ZM8 A;  1KNZ A;  3O1I A;  1GD2 E;  5APT A;  2WM9 A;  2I59 A;  1SUM B;  5AW4 B;  1YQ4 A;  2X68 A;  1N73 B;  1IFI A;  4BAY B;  4LFC T;  4KX6 A;  3HR0 A;  1USD A;  1Z8U A;  3DP7 A;  1UUS A;  4GOE A;  3CWB E;  4H44 C;  4PD4 I;  1LTA C;  4EZ4 A;  3PTZ A;  2HYN A;  4EAH A;  3H1J D;  2WPS A;  5BMV E;  3AA7 B;  5CFB A;  4CZZ B;  5LHH B;  2Z6E A;  3AED A;  2FYZ A;  1KOR A;  3AE5 C;  4DV0 T;  5LG4 A;  3AE2 C;  2FXO A;  2FUP A;  5GTH H;  5KKZ C;  1PFI A;  2ZFC A;  2FBW A;  2YO3 A;  1HS7 A;  4XAX B;  3NTN A;  1HCI A;  5C8Y E;  5APV A;  4DV7 T;  1L0L G;  2AXT E;  1L0V A;  2LSI A;  2WT7 B;  2VUR A;  1PP9 J;  2FXM A;  4GK5 E;  2WWU A;  3CKD A;  5L2L A;  1JCC A;  3RYF E;  1WCR A;  2E5T A;  5CCG D;  1ZOY A;  1DEE G;  3C50 A;  2QJP B;  2FYU K;  3C4X A;  2DI4 A;  2KZ7 B;  3H1J J;  5JRC B;  3ETU A;  3C8V A;  3H1J G;  2NW7 A;  3RK2 D;  1FE6 A;  1ZRT E;  1CI6 B;  4JLE A;  3AEE A;  1NTK K;  5KJ7 A;  4ZS3 A;  4O2A E;  4F8H A;  3AAA B;  2J58 A;  1Y9B A;  2YIN A;  3F89 A;  2Y9Z A;  5E79 H;  2YDQ A;  1X0T A;  3JC6 D;  4I7Z C;  4W80 A;  4B6X A;  4PV1 C;  5C3J A;  3PJA J;  1IK9 A;  3ZDM A;  3Q5R A;  1D0X A;  2PTF A;  2IYP A;  5IWA T;  2R3C A;  2M5A A;  1LKX A;  4HWH A;  1SQX E;  1N73 C;  1SQV G;  3AAI A;  1MMN A;  3EI0 A;  3QH9 A;  2QIW A;  3S4R A;  2ZM0 A;  3E0Z A;  3SFE A;  2P10 A;  3H1I G;  4PJ0 H;  2FFD B;  2CA5 A;  1Q7Y Q;  3R4Y A;  1CW5 A;  1VOM A;  2X9H A;  4TX5 A;  4TWH A;  1KIL E;  2YN6 A;  2WBL A;  5FNV E;  2NP9 A;  1JMM A;  4BXL A;  1VQO P;  4UB6 H;  2W66 A;  1SQQ K;  3PU8 A;  1QUU A;  2X9Y A;  1L4A B;  3V2R A;  4TN7 B;  5FYM A;  3RIU C;  1G1J A;  3RL0 D;  1XDO A;  5AVS B;  5KAF E;  1KC8 Q;  2XHE B;  3AE9 C;  2RKL A;  1MMA A;  2KIK A;  4B3M T;  3S4U A;  3TNU B;  2AEF A;  4L0R A;  3KV9 A;  5HEG A;  2QA7 A;  5KAI H;  4UXN B;  2R6G F;  2KUB A;  1J5W A;  1MIW A;  1GL2 B;  3I56 P;  2QJP C;  4L73 A;  5HCM A;  4H44 D;  1HR0 T;  1M7K A;  1YXR A;  2LE8 A;  5AVW B;  4EOT A;  1X79 B;  3WAJ A;  2C9N Y;  3O9X A;  3FX0 A;  3ZJ1 A;  4HTE A;  5AVQ B;  2NPS A;  2V7J A;  3LIE A;  3H6P A;  3TF5 A;  2BKO A;  1IFM A;  2JQQ A;  3FXD A;  3TSI A;  3BVH A;  4HE8 A;  3HD7 A;  3L71 J;  2V4H A;  3TLS A;  1NTM K;  2PFX A;  4ZXL A;  3AEG A;  4QH1 A;  3OYZ A;  3HKB E;  1J2J B;  1NTZ K;  1GU4 A;  1VQ8 P;  3L74 E;  3TDK A;  2XAH B;  1LT9 B;  3GN5 A;  1NEK A;  4YTN A;  3VP9 A;  4CN4 A;  5FY7 A;  4DV5 T;  3L36 A;  2WIT A;  3LBX A;  2FFD C;  1HGV A;  1N32 T;  3L72 D;  4ZI3 C;  2WVR A;  3GF3 A;  3C1L A;  5AW9 B;  1BR2 A;  1SS1 A;  1OW6 A;  3GW6 A;  2FJA A;  1KIL B;  3UU8 A;  2E5L T;  3L70 E;  2KSR A;  3RLF F;  4ZI7 E;  2ACX A;  2C0S A;  5JRE A;  2IFN A;  1L4A C;  1YQ3 C;  2BEQ D;  2Q7C A;  2HPC A;  5EK2 A;  1IFN A;  3TGU G;  3ONL C;  4PK5 A;  3LK2 B;  3CXH D;  1RQV A;  4PV1 D;  1A02 F;  5BU5 A;  3KBT A;  2C5J A;  5JDM A;  3II6 A;  4OWF A;  3VN0 A;  2JMK A;  2YEV C;  3PJA A;  4OVN F;  3AE8 C;  3HTK A;  4AUW A;  2MOZ A;  3GMI A;  3KZI H;  4HEA A;  4ILB A;  4HKZ H;  1GL2 C;  2BS2 A;  3CCL P;  1IC2 A;  1M56 D;  1FC2 C;  4TV8 E;  5L3G B;  2XQA A;  3L72 J;  1S35 A;  4B86 A;  2O01 H;  1ZP0 C;  2W0G A;  1JMB A;  5LG3 A;  4UVB B;  3Q5E A;  1T8Z A;  1UGO A;  3ZC1 A;  5CMZ A;  5CJ4 A;  1IBL T;  1QLE D;  4UF0 A;  5F5W A;  1OIP A;  3F57 A;  1HF9 A;  3HE5 A;  4E7S A;  1KB9 H;  5JDF A;  1UII A;  1GK4 A;  1PIX A;  3ZST A;  3PHL A;  3L4F A;  3H1L E;  4IT4 A;  1LT9 C;  5BVZ A;  1E5W A;  3TLV A;  3QB5 K;  3AE6 A;  4AQF C;  4OGQ B;  5AQI B;  5CA0 E;  2UXD T;  4LF9 T;  2I8D A;  3ZMU B;  2GUV A;  4L9I A;  4CQI A;  5GTI H;  2R44 A;  1KIL C;  4AXP A;  1R5L A;  2A06 D;  2XQ5 A;  2CE7 A;  5HEJ A;  2KOG A;  1JUN A;  3GA8 A;  1KF6 A;  2KZJ A;  2AEJ A;  4D6T D;  1YQ4 C;  4KP3 C;  4WW0 A;  5JH7 E;  1PP9 E;  1YD8 G;  5CBO A;  3TKL B;  1W0A A;  4G63 A;  3CX8 B;  3X1D A;  4GYR A;  3OBV E;  4QXC B;  4C90 A;  2Y6X A;  3EAB A;  2HLO A;  4U72 A;  1DD3 A;  5AQF B;  3RC8 A;  1J1J A;  2CBI A;  4H9N C;  3M06 A;  3LG7 A;  3ZYK A;  1MFZ A;  3TYY A;  2WU2 A;  3CK6 A;  3RX6 A;  4DR3 T;  4JI4 T;  1R5S A;  4DT0 A;  2QA4 P;  1YTZ T;  2BCC D;  3AED C;  1OVR A;  4O9B A;  4YSZ A;  4O4H E;  2Z5I A;  4WY4 D;  3H1K G;  1SP4 A;  4UEL A;  1KD1 Q;  2E5V A;  1FOS F;  2FBW C;  2V5D A;  3HUS A;  2Y8D A;  2JR8 A;  3CWB D;  4YT0 A;  4CPG A;  4AI6 A;  3KIN B;  2W67 A;  1L4A D;  3AA1 B;  4D6T J;  4UB8 E;  3VMX A;  4V1A v;  3AE2 A;  3RYH E;  1LVK A;  1JY3 P;  1IAP A;  1NU1 D;  3CQG B;  3EHZ A;  1M1K Q;  4IE6 A;  1ZOY C;  4OHF A;  5APY A;  2KWI B;  4M3L A;  3UU3 A;  3B4S A;  4A56 A;  2WSS V;  3ZMT B;  4JV5 T;  2KLU A;  1BGY D;  2M6B A;  2BCC J;  3UTK A;  1UUR A;  2HN2 A;  4U74 A;  1YIT P;  3AEE C;  1GL2 D;  2NPS B;  5KJ7 C;  1FJG T;  4OGQ C;  2ZYD A;  1N7L A;  1HNZ T;  2N1G A;  2V26 A;  1S3J A;  4IL6 E;  3IFM A;  3CWB G;  2CM0 A;  1NHL A;  3HD7 B;  3CC4 P;  3VTP C;  5LYJ E;  3ZT7 A;  4AKR B;  1ZRT D;  5AQT B;  5AQK B;  3MTU E;  2CEA A;  1XMQ T;  1S5L X;  1AV1 A;  4C7N A;  2KNC B;  1LTS C;  3USS A;  3GN5 B;  4HFE A;  1NU1 J;  5AQJ B;  2ZAE B;  3H32 A;  3SFE C;  3EVY A;  1E2A A;  3LBX B;  5JVD E;  2LXC B;  4DID B;  1BGY J;  4N78 E;  3IHR A;  3L37 A;  3PP5 A;  5FKY A;  1AVO A;  2C0X A;  3P8C D;  2XU6 A;  1Z0P A;  1ZLL A;  3G4S P;  3MXZ A;  4DR2 T;  3Q5X A;  4WYV A;  2V7I A;  2FJD A;  1D1C A;  1JNZ A;  2OYO A;  4OYJ A;  1YIJ P;  3B71 A;  2JQK A;  3OAK A;  5KLV G;  1KIL D;  3CX6 B;  3L75 D;  5L4H A;  2GA1 A;  3I1A A;  1MIV A;  3L71 E;  1K8A Q;  4L5G A;  2R5D A;  5H2F E;  5HXH A;  3AE3 A;  1K73 Q;  4PNI A;  2OQQ A;  4U7J A;  3JSV C;  2N9Y B;  3HTK B;  1LT1 A;  1Y47 A;  2CLY B;  1USE A;  4ZI2 C;  1Q86 Q;  5AQN B;  2LRK A;  1WR6 A;  1CUN A;  3PDY A;  4IDP A;  1KNR A;  4HJG H;  1DU2 A;  3C51 A;  5L3D B;  2DCF A;  1OVV A;  1EQ7 A;  1PGJ A;  1SQX G;  5KX5 E;  1E7P A;  1LWU B;  2NPS C;  1L0L K;  2V7M A;  5FL0 A;  3UU5 A;  2LRL A;  4ADZ A;  3ZT5 A;  4UF0 B;  4WWI A;  4EIW A;  2P67 A;  3L75 J;  3HD7 C;  3RIF A;  3HE5 B;  4CI2 B;  1OED A;  1E1H B;  3V5S A;  4PK6 A;  3AEG C;  4Z91 A;  1KFM A;  2CRB A;  2Q3I A;  1CI6 A;  3F2E A;  5LMU T;  4ZOL E;  5DJU B;  4I6M C;  5BR8 T;  4O4J E;  4YSX A;  3SWY A;  5AQU B;  4IL9 A;  3KV4 A;  3QNU A;  2D0T A;  1EZV D;  1H8A A;  2K9Y A;  5LHG B;  2UWJ E;  1XDP A;  2M3B A;  3I0O A;  2E42 A;  4CXX A;  4QXB B;  1YJ9 P;  3A5T A;  3L3P A;  4B3R T;  1ZR2 A;  5KJ7 D;  4WVZ A;  5APX A;  3C9I A;  1AJY A;  4OGQ D;  4JEH B;  5L8R J;  2V7L A;  3M9B A;  5CJ0 A;  1KQL A;  1CHU A;  2IDB A;  2WDV A;  1HG2 A;  1SQV K;  3CXH E;  4WY4 A;  4JYC A;  4ZEY A;  3B13 A;  5F3J A;  4I50 E;  5K5G B;  3ZPO A;  3L70 D;  2JKV A;  2NRG A;  2ZJS E;  1LNQ A;  1XTC C;  3A2A A;  1JOC A;  2VQE T;  1MMG A;  1QL1 A;  5FXV A;  3EFF K;  2BEZ F;  1AQ5 A;  2CLY C;  3CI9 A;  4ASW A;  1D1B A;  3O1H A;  3HUS B;  5FY1 A;  1HNW T;  3NZQ A;  2ACZ A;  4ASV A;  2YOE A;  5M4Y A;  1FDI A;  2R5B A;  3ZCJ A;  1SQP D;  3VOP A;  3L74 G;  4MBQ A;  4AKL A;  3GF7 A;  2DHR A;  1KQF B;  1UCU A;  2YK0 A;  3Q5W A;  2K48 A;  1P84 H;  5C2T A;  3AEA A;  1RH5 B;  3Q2Y A;  2WDR A;  3CMA P;  3E08 A;  2W4X A;  4LLH A;  1O3X A;  3L70 G;  3A0H E;  3VU7 H;  1OMI A;  4UVC B;  3RRW A;  2C9L Y;  4ZI2 D;  3BCC D;  5IYZ E;  2J47 A;  3AE6 C;  2AE9 A;  4DV6 T;  1OW7 A;  4IFD K;  5LHI B;  2XJ7 A;  4H9O C;  5J1G A;  1OED E;  5ABH A;  1LTT C;  5CHX A;  1HFA A;  4DMW A;  5JDH A;  1BE3 J;  1HWT C;  3AXJ A;  3FBZ A;  1I6Z A;  1SQP J;  2X0L B;  3ZSS A;  3H1L D;  2NPS D;  4TLF A;  2A06 E;  1J5E T;  3N2G E;  4D6T E;  3PUW F;  3H32 B;  4X65 T;  3HD7 D;  5E0O A;  1IFD A;  5LB7 B;  4PAG A;  4H9R C;  3VRB A;  1OVU A;  2CPB A;  1OXZ A;  2W62 A;  3LID A;  2DL1 A;  1M57 D;  3ANW A;  2I1K A;  2BBH A;  1PP9 D;  5FY0 A;  2XZR A;  3BCC J;  2I6H A;  2BCC E;  5B5E H;  3B8E B;  3U78 A;  1YTZ I;  2VVS A;  3DTO A;  3HUS C;  4TNW A;  1AA0 A;  1K05 A;  3GHG A;  3H1L J;  3AEB A;  4JI3 T;  1Q82 Q;  1VQ6 P;  2J1D G;  2M0B A;  2K24 A;  3T1H T;  2O01 J;  3CIR A;  4X66 T;  3HI2 A;  2NR4 A;  3FZH B;  1NYH A;  3QB5 A;  2QM7 A;  2VAS A;  4EYY R;  1XNQ T;  1NU1 E;  4CI3 B;  1SQB D;  3Q3D A;  3A0B H;  1T72 A;  2HH7 A;  1QVG O;  4IRE A;  4HFC A;  1NWQ A;  2WPR A;  3VYI A;  3WUT A;  1MMD A;  1RHZ B;  1BGY E;  5CA1 E;  1PP9 G;  2XNX A;  2WMN A;  4DVD A;  4YFS A;  5TIS H;  1JY3 N;  5LBM A;  3W15 B;  3UT5 E;  4AIU A;  2A45 I;  3KDP B;  3CXH I;  4K3A A;  3CC2 P;  1OED B;  4E7Z A;  1BDC A;  3R2P A;  4NXN T;  3J7Y q;  4ZKU A;  1U4Q A;  1AQT A;  4U7Y A;  5JR9 A;  4C46 A;  5CCH A;  1SLQ A;  4R4L A;  2LHR A;  5GTH E;  1HH0 A;  3TLW A;  3UFE A;  2MKV A;  1NWM X;  4HFI A;  4HFB A;  4LF4 T;  2PRR A;  5HEO A;  2JWA A;  2XM1 A;  3L39 A;  4IGU A;  4YXD A;  3NXS A;  1SQB J;  3KQG A;  2W63 A;  4HWF A;  1D1A A;  1VRB A;  3KBU A;  3RYI E;  3IF8 B;  3FXE A;  4JI0 T;  1QX8 A;  2VKH A;  4AKI A;  4AQY T;  4N3Y B;  3L8R A;  1DIP A;  2WWW A;  1ZN5 A;  4JBW F;  5AVT B;  1L0N J;  3P8C E;  3JAF A;  2XQ8 A;  5ABE A;  2VKD A;  2H88 C;  1T2K D;  5AQH B;  4EIJ A;  2ZXX A;  1X8Y A;  3L09 A;  2KLV A;  4WY4 B;  3SSU A;  2WPV B;  4N78 D;  3UUM A;  3QC9 A;  2VK9 A;  3L75 E;  2WCA A;  5HYA A;  4UV9 B;  3AE3 C;  2E75 B;  3ONX A;  4ILA A;  2M8R A;  1HUC A;  4XFJ A;  5APQ A;  3AB3 B;  4U3F J;  5E79 E;  1GK6 A;  2H7O A;  1FDO A;  4O2B E;  3FZF B;  1X9V A;  3L73 D;  3LK3 B;  2RA1 A;  4M1P A;  2O1J A;  2JMH A;  3FZM B;  4AQG A;  2BZB A;  3L71 D;  4IE5 A;  3PV0 F;  4CN6 A;  4A7P A;  1FMV A;  4BRY A;  4I2L C;  3KVA A;  5FL1 A;  2QVA A;  3NWI A;  1NOH A;  2CXL A;  3EDU A;  4PJ0 E;  3U1A A;  4HWD A;  4JI6 T;  3FGA D;  1JY3 O;  1NH4 A;  3UU6 A;  1OED C;  4UB6 E;  2MPK A;  4IFM A;  4MN4 C;  3JC2 2;  4UEM A;  2L8K A;  3RC3 A;  3H1H D;  2BBJ A;  4XA4 A;  5AQL B;  1VQK P;  1LJ2 A;  4J2C A;  3B5N A;  1PZQ A;  4NPD A;  1FAV A;  2HPL A;  2YXQ B;  3N9O A;  4QHO A;  1QGK B;  2QG4 A;  3L73 J;  1XWM A;  2X51 A;  4HKA A;  2KIN B;  5M1B A;  1OX3 A;  1EZV E;  2PFV A;  3ONJ A;  3UQ7 A;  3VP8 A;  3L71 G;  3AXJ B;  1VQP P;  1QEX A;  1HVV A;  2KB7 P;  3ZKR A;  2BVM A;  2XUE A;  2KNC A;  5KAI E;  3JCF A;  3NMD A;  2JPF A;  4TWD A;  1PGO A;  1H89 A;  1IBM T;  2YMY A;  1CZQ A;  1UIX A;  3U3I A;  2DW3 A;  4WY4 C;  1IFP A;  2P58 A;  3CCR P;  4QX7 B;  4I55 E;  4GOD A;  1H88 A;  3EFG A;  3H1H J;  2A72 A;  2E75 C;  1YJN P;  3ANW B;  4EEB A;  2LHN A;  3AVS A;  4OX9 T;  2O3J A;  4WBA A;  4HFH A;  4Y28 J;  4EI2 A;  2KP8 A;  1FIO A;  4DMV A;  2AEM A;  3VRA A;  2LKG A;  3GHG B;  2WSS H;  1KK7 A;  3U59 A;  1NGM B;  3BAS A;  1XMO T;  1M7L A;  5KLV K;  2OLT A;  3MZW B;  1FZE A;  1G1I A;  1BE3 E;  4L76 A;  2Z4E A;  2C5K T;  4DUZ T;  4YJ2 E;  1SQP E;  1RF1 A;  3P4S A;  3IN6 A;  1UX4 A;  2JQH A;  2WSF H;  4KBM B;  3AEA C;  2AXC A;  2FYU D;  3AE7 A;  4EDF A;  4DR6 T;  1FZB A;  2IHR 1;  4KI0 F;  3L72 G;  3F31 A;  2B76 A;  2NW9 A;  2BKN A;  3N9Q A;  3JAD A;  2FJB A;  1NTK D;  3NBX X;  1LWU A;  2X9W A;  2LSG A;  2YKQ A;  3G6E P;  2GK9 A;  2E9X A;  1KYO H;  1IJ5 A;  2A45 G;  2ZT9 B;  1SQX K;  4K35 A;  3BCC E;  4AQR D;  1T3J A;  2W27 A;  3NVO A;  1YKE B;  4DOJ A;  3IA3 A;  1LVF A;  4DR5 T;  1N33 T;  3A8Y C;  4TZ4 C;  3IBP A;  1VDF A;  3VHL A;  2IBZ E;  3KZI E;  1B7T A;  1MUU A;  5AW8 B;  3E1I A;  5JR9 B;  4YHJ A;  4H0L D;  4ERR A;  4H9P C;  4DO0 A;  2FYU J;  3UIA A;  4YSY A;  2KND A;  1Q2N A;  3PUG A;  5AQR B;  1BCC D;  1S94 A;  3LW5 H;  4OFZ A;  3N9P A;  3KDS E;  3SWF A;  1H7C A;  1FZG A;  1X22 A;  3P4P A;  3FXE B;  3ZN1 B;  1SQQ D;  1D0Y A;  2G0U A;  2LSY A;  2ZM6 T;  1NTK J;  4LF7 T;  5LJN A;  2OYH B;  1P84 D;  1RE3 A;  1MND A;  1OFC X;  1FZF A;  1VQN P;  4IDQ A;  3CD6 P;  2V7K A;  2K5B B;  2G3A A;  1CSB A;  2VKO A;  4C7R A;  3ZC0 A;  3HA4 A;  1VCT A;  1KB9 E;  1T8B A;  4JUY A;  4A97 A;  3GHG C;  1FZA A;  3AEB C;  3IAO A;  3T8O A;  2N9B A;  2FY8 A;  4ZMD A;  4KUM B;  2B9B A;  1H0T A;  2B89 A;  2WZH A;  5HWY A;  1DD4 A;  3VMY A;  1BCC J;  3ZLI A;  4TWF A;  4HYT B;  4IL6 X;  4GKK T;  1YYC A;  2CK3 H;  2E43 A;  1FJK A;  2MJZ A;  1PL5 A;  1K9M Q;  3RBZ A;  2H43 A;  5GTI E;  2Y9Y A;  3E1R A;  4L75 A;  1EZV I;  1SQQ J;  3ZMZ B;  3LDQ B;  1SQB E;  3CX5 H;  1G2C B;  2E75 D;  1VQM P;  2A06 G;  5ABG A;  5LJM A;  2B1E A;  4BRY B;  3CCV P;  4X62 T;  4TT3 H;  4D6T G;  5FXX A;  2ZYG A;  5JDL A;  2ZT9 C;  2QE7 H;  1L0N E;  1GTW A;  2W00 A;  2K9J A;  5LP6 E;  4IE0 A;  1FMW A;  2XM2 A;  1GMJ A;  4QH5 A;  1NTM D;  1KNP A;  3KXD A;  3CQX C;  4X1I E;  2Q6Q A;  2BDE A;  3M9H A;  2BS4 A;  2V5C A;  2X9X A;  2MBG A;  2WY2 A;  5JR9 C;  5CCH C;  2BCC G;  2PAJ A;  3RYC E;  1PGQ A;  3B5N B;  5HCJ A;  2NTY A;  4YXD C;  2OGU A;  1EDJ A;  3V2N A;  4U3F E;  3ZT6 A;  5J0Z A;  1VQL P;  3CL3 D;  3E22 E;  2IAK A;  2JWD A;  1N7S A;  5LGU B;  3CPZ A;  3H1I E;  3SWH A;  5CGM A;  4EZH A;  1XTG B;  1LTJ A;  2OYH C;  4DZO A;  2WQY A;  5L3F B;  4I4T E;  2VB6 A;  3ETV A;  1EXJ A;  2W6B A;  2ZVN B;  5HXS A;  2VL0 A;  3NZP A;  1NU1 G;  1NTM J;  2N2N A;  2XPK A;  1URQ A;  2XKM A;  5LNK A;  3O4X E;  3AE4 A;  1NTZ J;  1DH3 A;  1T7S A;  5AW5 B;  2D5U A;  2E76 B;  1BR0 A;  4R4M A;  2XSB A;  2EHO A;  2H89 A;  1BGY G;  2QEX P;  3AE1 A;  4ZZC A;  4LML A;  4JYB A;  3SS1 A;  3S9O A;  4N6J A;  4ILC A;  2Y0D A;  5AW0 B;  4DV4 T;  3GMA A;  2XY8 B;  2H88 A;  2CCQ A;  1YJW P;  5EK3 A;  2LM9 A;  3L73 E;  2PG8 A;  1S5L H;  1QVF O;  2JJ9 A;  3CPW O;  2XQ6 A;  1NKZ B;  2SPZ A;  4XZC A;  4IFF A;  1SFC A;  3PUA A;  3WAK A;  2IBZ I;  4GKJ T;  2WMO A;  4Z8X A;  3T97 A;  2GUS A;  1RF1 B;  1VQ5 P;  3J9X 1;  1HF8 A;  3CWZ B;  2WSC H;  5HXR A;  2WB5 A;  4FI5 A;  1MNE A;  1Q90 D;  3UUN A;  3N7N A;  2CHN A;  2J59 M;  3MZK B;  3SRZ A;  1BR4 A;  3ZMV B;  1TU3 F;  4PD4 H;  1SHZ C;  1I94 T;  3TLT A;  4H63 H;  3CCM P;  2Q1K A;  2HFE D;  3B5N C;  3H1H E;  2HPJ A;  3H3A A;  4UVA B;  2Q9Q A;  1D7M A;  2E9X B;  3QOF A;  4LMK A;  3Q1M A;  2WS3 A;  2XQY A;  3O8Z A;  5JDN A;  2FYN B;  2L91 A;  2JP3 A;  3WU2 H;  2OTK E;  2YU2 A;  3L75 G;  2DWK A;  2V6Y A;  2N1T D;  2HOD A;  1MFT A;  5KXJ A;  2D2S A;  3HKD E;  2ZT9 D;  5B66 H;  2LSJ A;  2DNX A;  4PFO A;  2IZ1 A;  2E2A A;  5AVZ B;  5JTG A;  2CXF A;  3JCU H;  4B3T T;  2M67 A;  1NEN A;  1NAY A;  3E7K A;  3KPE A;  2UXN B;  5IHY A;  4ZNC A;  5AVX B;  3G71 P;  5LCY A;  2E76 C;  5LA6 E;  5CCH D;  2KWH A;  3CLQ A;  1WRG A;  2JQ9 A;  4A98 A;  2RN0 A;  1M62 A;  1JB0 J;  4K0U A;  3MJX A;  2W2U A;  1MV8 A;  4I1L A;  3EUH A;  2LJL A;  5AQS B;  4CI1 B;  5LGT B;  4P09 A;  2V7Q H;  5AFU L;  1S72 P;  1IZN B;  1ZEE A;  3RBX A;  4NPF X;  2YKS A;  2OYI A;  4Z90 A;  1S4X A;  3WUV A;  1LGH B;  2CMR A;  3T1Y T;  4HGA A;  3BQK A;  4NUU A;  4HFV A;  1N8R Q;  1H0T B;  3AA0 B;  3V5B A;  1RF1 C;  4DR1 T;  3RK3 E;  2G8Y A;  1D0Z A;  1VCS A;  1YW0 A;  3AE7 C;  3D71 A;  1EZV G;  3RGU A;  2FYU E;  4PW8 A;  1W09 A;  4JI2 T;  3CME P;  4QMA A;  5C39 A;  2M6I A;  3NRX A;  2A9U A;  2MTQ A;  1IJD B;  1BE3 D;  2D0U A;  3C98 B;  2WAU A;  1LWU C;  1ZW0 A;  1OW8 A;  1NTK E;  2HHH T;  4JI5 T;  3NFQ A;  2E9X C;  1KEY A;  1GZL A;  2X0Y A;  2FYN C;  1E79 H;  3LJC A;  2K9J B;  3VR8 A;  2UU9 T;  2IFM A;  2K3R A;  3M0A A;  3QWO C;  3Q5P A;  3A7M A;  1EC5 A;  2I0M A;  3K3N A;  4U7I A;  1VQ4 P;  2AXD S;  1OWA A;  1EXI A;  1NAF A;  3JAE A;  4EED A;  5AQO B;  1W2E A;  1RF0 A;  2JEE A;  3M91 A;  2HN1 A;  3AEF A;  5AVR B;  4NIQ A;  1BCC E;  2BG9 A;  3WMM 0;  2IIU A;  4U3C A;  1T2K C;  3BAT A;  2P9B A;  1N7S B;  2CXD A;  2CHO A;  2IBZ D;  1BE3 G;  1LTJ B;  1SQQ E;  2D2C B;  1RE3 C;  1SQP G;  3B5N D;  3RGL A;  4HH2 A;  4BA9 A;  1P84 E;  2OAR A;  4H63 V;  4IOI H;  5FMN A;  1JO5 A;  3PUZ F;  4JYA T;  1BDD A;  1U5P A;  3A7O A;  3MD0 A;  5DQV A;  5A1L A;  3MUD A;  1URQ B;  2B88 A;  2A3D A;  2OTL P;  2WWV A;  1YHQ P;  2LR2 A;  1KYO D;  2EHO B;  1M1J A;  2VVN A;  4EV6 A;  2C0W A;  2LM2 A;  1KV4 A;  1JEK A;  3BCC G;  2ZVO B;  1KB9 D;  3MP7 B;  2YDR A;  3RK3 B;  3Q5D A;  1M8O B;  2QSI A;  4G2A A;  4IST A;  4JQ0 D;  4O4I E;  2E76 D;  1JTH A;  5LBQ B;  2XQ7 A;  3EDV A;  2IBZ G;  2WSF J;  2Q9I A;  3H1L G;  1WMK A;  2QJK B;  1X9B A;  4MAL A;  1SFC B;  4YLH A;  2ES0 A;  4JF7 A;  2E5Y A;  3GG2 A;  1T6A A;  4QX8 B;  3T97 B;  2AXT H;  3IF4 A;  4P0B A;  5TAO A;  3MGN A;  5HXC A;  2BAS A;  3HKE E;  3BRV B;  1GW4 A;  3WUU A;  1NTM E;  5ABF A;  4OH8 B;  4DV1 T;  4NXM T;  3FHN A;  2YO2 A;  2ZMA A;  2LKH A;  3C64 A;  4IE7 A;  1NTZ E;  3D6Y A;  2ZYA A;  5KTB A;  4AYC A;  5H6R B;  5B5E E;  4PJN A;  3VKH A;  2N1T A;  2JDI H;  1L0N D;  4DR4 T;  2SPC A;  1VL2 A;  2Q9Q B;  2IML A;  4H0L B;  5KMG P;  2V6X A;  3H3M A;  3V6I A;  1N7S C;  3PLN A;  1L0L J;  1LTJ C;  2V6Y B;  2D2C C;  2WQY C;  3PH0 A;  3LW5 J;  3ZMS B;  2HOD B;  2E9X D;  1RE4 A;  3CCS P;  1BSN A;  2JRK A;  2WU5 A;  2X66 A;  1VPC A;  2BKP A;  4U2Y A;  5FVL A;  1IBK T;  1HTL C;  4ZHQ E;  4IE4 A;  3P50 A;  2XAG B;  3AA6 B;  1SQV D;  4X5T A;  2LXB A;  4U3F D;  3CX5 D;  2RPA A;  1URQ C;  5BU8 B;  2BG9 E;  2GM4 A;  3A0B E;  3AE4 C;  3H1I D;  1SQB G;  2WPQ A;  5AW1 B;  2ZXE B;  2QJY B;  4KT0 J;  4IIJ E;  5KLV E;  2FJE A;  2H89 C;  3AE1 C;  2EHO C;  2K1A A;  2OYH A;  3PE0 A;  3VMA A;  3M9Q A;  4HFD A;  2LEH A;  5TIS E;  3LSV A;  2I1J A;  1L0N G;  2KS1 A;  3RK3 C;  3AEC A;  5FP3 A;  2QRX A;  5EZY E;  4WZX A;  3FWL A;  4UV8 B;  2E74 B;  4X1Y E;  3P4Q A;  2OYI B;  1W2B O;  3W67 A;  5KAF H;  3G3Z A;  2QJK C;  4YJ3 E;  1SFC C;  3GWH A;  5AW3 B;  1Y8A A;  4Y99 B;  4JI1 T;  1SQV J;  1VF5 D;  3ABV A;  5HEU A;  2KT9 A;  1UX5 A;  5DAB A;  5L47 A;  4U3F G;  3H1I J;  4HB1 A;  1SA0 E;  5J2T E;  1W5C E;  1FEW A;  3SFD A;  2IDO B;  1G2C A;  3MIW A;  2IC9 A;  1GQE A;  2HR3 A;  2O01 N;  1ZME C;  3PUS A;  5DJQ C;  4EYY Q;  3MAC A;  5CJ5 A;  2VQF T;  3N2O A;  1P84 I;  2Q9Q C;  4H13 B;  4K0K T;  4H0L C;  1FBM A;  2R32 A;  1FZC A;  2UXX B;  4AIS A;  1N36 T;  3TK1 A;  1Q81 Q;  1HJ0 A;  4FJO A;  1IJ6 A;  4COF A;  4YXW H;  2UXB T;  1BSH A;  1LTB C;  1QSD A;  2P1J A;  3EWK A;  3PUX F;  1FS0 E;  2POH A;  5ETW A;  1JY2 N;  1UK5 A;  3RF1 A;  3C4Z A;  3KFW X;  4EXT A;  4U2Z A;  2FKW B;  5F8P A;  4PJM A;  2Y0C A;  4OK0 A;  2XAF B;  1FU1 A;  1A02 J;  3FWN A;  3SOL A;  5HWX A;  2VKJ A;  3L73 G;  4DJG A;  2WTY A;  2XQ4 A;  3I55 P;  3NRY A;  5AW7 B;  2BG9 B;  4ZS2 A;  2M3E A;  2QJY C;  3I0Q A;  3UQ4 A;  4KJM A;  3OJA A;  2P2U A;  4DBR A;  1AJ3 A;  4AKH A;  4F6R C;  3BK9 A;  4BWN A;  2PBI A;  3Q9D A;  4EYU A;  5KLI B;  3TGU D;  2XAS B;  1DEB A;  1N7S D;  4GIF A;  3U1C A;  3CX7 B;  2E74 C;  1FJP A;  3IEE A;  5HEH A;  3RL0 g;  3HL6 A;  1NU1 K;  2D2C D;  4PD4 D;  2OYI C;  2OV9 A;  4ISS A;  4GOU A;  2NZ2 A;  1EDI A;  1ZV8 A;  4YY3 T;  4LMJ A;  1M90 Q;  3CVR A;  1M1J B;  4Y99 C;  3H1H G;  5DJT B;  3ESL A;  2KSE A;  1HJB A;  4U31 A;  5LGN B;  3CC7 P;  1U7J A;  3OKQ A;  1URQ D;  3A5X A;  4YTP C;  3CCE P;  3KV6 A;  1U7M A;  5AVY B;  3MA9 A;  1JM0 A;  3HKC E;  4CXY A;  3VR9 A;  3K1S A;  1SVF A;  2EHO D;  1JTH B;  2QGS A;  2UUA T;  1S1C X;  2B87 A;  5GON E;  1HGZ A;  4O8S A;  2WSC J;  3QK6 A;  3RK3 D;  1W9R A;  3PU3 A;  4MFR A;  4H13 C;  4UIG A;  2WSE H;  3TGU J;  3D70 A;  4GT1 A;  3CQC B;  2YKP A;  1KN7 A;  2H3R A;  4IDO A;  5DQW A;  4GYS A;  4DND A;  3O6Q A;  2C5I T;  1PPJ E;  5KDM C;  1SFC D;  3M3Z B;  5ABF B;  3ZCI A;  3LFM A;  3HRN A;  1JY2 O;  4GK0 E;  2JIW A;  2KK7 A;  2WP9 A;  3RI5 A;  2N1T B;  1EDK A;  3P7K A;  4W7Y A;  4AKG A;  1RF0 C;  1KQG B;  1N86 A;  4Z1M H;  3AEF C;  1ZHC A;  2MAW A;  1T3U A;  4YHH T;  2BG9 C;  3PUY F;  1GW3 A;  2Q5U A;  5AW6 B;  2IX7 C;  3KVB A;  4KHP T;  2NWB A;  2DLR A;  3OYX A;  4LGD E;  2N9D A;  4JI7 T;  5CCG A;  2W90 A;  3P4W A;  3UUB A;  3G9R A;  3IR9 A;  3H37 A;  1MZ9 A;  3N2K E;  3P7I A;  1WRD A;  4NUV A;  1N34 T;  2Q9Q D;  2WDQ A;  1NVO A;  2ZLY A;  4A5X A;  2V8S V;  3UUL A;  2W83 C;  3HE4 A;  3K3O A;  5HXE A;  1KFY A;  4GDO A;  4LC1 A;  5KLI C;  3OVU A;  1JCD A;  2FYU G;  2DWG A;  3MUD C;  4RO0 A;  1RQU A;  1S9K E;  3K5B A;  2CWY A;  1YBK A;  3RIA A;  2V7Q J;  2OA5 A;  1M1J C;  1NTK G;  1KYO E;  3L35 A;  3A3Y B;  1HG5 A;  2KI7 B;  2F4V T;  1R8I A;  2KS1 B;  2O1K A;  4LF6 T;  3H1K D;  1G8X A;  1EDL A;  3ZJ2 A;  3GLM A;  3BQL A;  2XV5 A;  2H7H A;  3R6N A;  3ZN0 B;  3CML A;  1XNR T;  5JDG A;  3TLU A;  1L0L E;  4IDN A;  2J62 A;  4RKU J;  3Q5S A;  3FZK B;  2UUC T;  2M5A B;  1NKN A;  3ZEF B;  1VQ7 P;  1VQ9 P;  1WR0 A;  5AQM B;  1BCC G;  2E74 D;  1J1E B;  4UB8 H;  4HWI B;  2LOS A;  1ZR4 A;  3P32 A;  2RH0 A;  1BR1 A;  1SQQ G;  3SWK A;  3CCU P;  4LF5 T;  3M0D A;  1PGP A;  2KXP B;  3V2Q A;  2BVL A;  3H1J E;  2N1T C;  3OTO T;  5FXZ A;  1S2E A;  3CCQ P;  3H1K J;  4X64 T;  4EOZ B;  1FZC B;  5H6Q B;  3PUV F;  3C4W A;  2YMK A;  4HN9 A;  3V4W A;  4C91 A;  3BRT B;  4JEU B;  1JNR A;  4QWN B;  3N9L A;  4ZI3 D;  5AVV B;  1EZ3 A;  1J1D B;  4RES B;  3B57 A;  3P8M C;  2OTJ P;  1NTZ D;  4IL6 H;  1AFO A;  4WBO A;  1HX1 B;  5AQG B;  4H13 D;  4LF8 T;  1RE4 C;  2KZI A;  1WYC A;  3UUX B;  2PGD A;  2KSJ A;  1HX8 A;  3AE5 A;  1SE7 A;  5EK4 A;  4XBF B;  1JNM A;  1SQV E;  2LLY A;  4NPP A;  4IDZ A;  3CX5 E;  1Y01 A;  3AAE B;  1N2D C;  4O4L E;  4OYK A;  4ANJ A;  1QL2 A;  2Q3E A;  2V1D B;  2J5U A;  1R8E A;  2UXC T;  3AVR A;  4DV2 T;  3OJA B;  4UR9 A;  3N9N A;  1WFD A;  2PJQ A;  4I0U A;  5IUX A;  1SQP K;  3N9M A;  4QKN A;  3AEC C;  1L2P A;  1LP1 A;  3RKG A;  2IPP A;  3RPU A;  3QUJ A;  1NTM G;  3G06 A;  3CWB J;  5CBN A;  4BJM A;  1Y64 B;  2RMZ A;  3KHU A;  2R3S A;  3FXD B;  5CB4 E;  5KLV D;  2K37 A;  1IFJ A;  4NPE A;  1NTZ G;  2IUB A;  4EB6 E;  5APW A;  4DBQ A;  2Y0E A;  5ADX L;  1DX7 A;  3I9Y A;  2YIU B;  3O1J A;  4H9S E;  4LFB T;  3ABV C;  4XE5 B;  2NW8 A;  2YNY A;  1MIY A;  3PUQ A;  5J2U E;  1US7 B;  1J1E C;  3N4X A;  5H2F H;  4X20 E;  2BS3 A;  3VKG A;  1WYB A;  3EQ2 A;  2IC6 A;  3SFD C;  2XTL A;  2W6A A;  3V4Q A;  2NTX A;  1K04 A;  2B87 B;  1YI2 P;  2Z5H A;  1LTG C;  2YXR B;  3OA7 A;  3I9W A;  3KYQ A;  1MKM A;  3UFG A;  1SQX D;  4P0A A;  4W7Z A;  4RJT A;  2XQ9 A;  2VRS A;  2HPC B;  1N73 A;  1FZC C;  2LT3 A;  4ZKP A;  3DJB A;  4PFP A;  4LFA T;  5KLV J;  1J1D C;  3RRC A;  3O6Q B;  3RH3 A;  1JY2 P;  5L3B B;  5LXT E;  3K3Q C;  3OW2 O;  4DUY T;  2IZ0 A;  2K9A A;  1KYO I;  4QH4 A;  4PJL A;  4CN1 A;  1HTJ F;  5AQV B;  3PJS K;  2CBJ A;  3FB2 A;  3RIU A;  1RY3 A;  1S5L E;  1KB9 I;  2CPT A;  1NO4 A;  3PRJ A;  5AQQ B;  2QM8 A;  4KMC A;  4YPC A;  3NKZ A;  3VMZ A;  5AVU B;  2RP4 A;  2WMM A;  3AE9 A;  3KV5 A;  4CXW A;  3ZYL A;  2WT7 A;  1SQX J;  3MHV A;  2VWA A;  3EAM A;  1HBW A;  3HE4 B;  2XND H;  3RK2 B;  5TJH A;  1IO4 A;  3MKD A;  2LOP A;  2IW5 B;  2P7J A;  2JO1 A;  2CWO A;  3TGU E;  4L74 A;  2H7V C;  2KMF A;  5EFW B;  3CCJ P;  2K3W A;  2YKO A;  2XQ3 A;  4ILU A;  3V5U A;  1GU5 A;  4KHZ F;  5AQP B;  2A45 H;  4PD4 E;  3FBL A;  5JRC A;  3CXH H;  3D0T A;  1SQB K;  1GDT A;  4JPZ B;  2QYW A;  2YIU C;  4QXH B;  3WI3 A;  2KYV A;  3I5C A;  3MK7 C;  4MHC A;  1HNX T;  1YKH B;  1KTM A;  1G73 A;  2ZM2 A;  4IHJ E;  4H9Q C;  4JBZ A;  2E8I A;  1T98 A;  4KHX A;  3WU2 E;  2L9Q A;  1VF5 B;  1L0N K;  3FZL B;  1IK7 A;  4U33 A;  3Q2M A;  2IYO A;  4WB4 A;  3RQU A;  3ITK A;  4I43 B;  5B66 E;  3L72 E;  2YDS A;  4PK4 A;  4DR7 T;  1Z56 A;  2VL8 A;  3JCU E;  3L74 D;  4MLK A;  5LOV E;  4DV3 T;  3N5L A;  2K88 A;  2Y48 B;  2L5G B;  2MYS A;  3PTR B;  4YTP A;  2FXP A;  1FOS E;  4TV9 E;  2W8Z A;  5FXW A;  3CX5 I;  2XAJ B;  4P1N A;  1XZY A;  2UUB T;  2FFD A;  3RL0 B;  1NJI Q;  4X1K E;  2H8P D;  4BJN A;  2HG5 D;  3K8P C;  3UU4 A;  2X0H A;  4TUY E;  5JDQ A;  2NOX A;  1L4A A;  3A0H H;  1YQ3 A;  1PV3 A;  3M65 A;  3S1K A;  3RKO A;  4WBN E;  1V9D A;  1PPJ D;  1KMI Z;  2XZE A;  2KLQ A;  4GKG A;  5CCG C;  2W61 A;  2ITA A;  5APS A;  3RQW A;  4H44 B;  3L74 J;  3ZYM A;  3TNU A;  3P4R A;  1KZU B;  3RK2 C;  3AE8 A;  1KFN A;  4Q25 A;  4ZZB A;  1GL2 A;  3B5M A;  2WZ7 A;  5KKZ B;  2XSA A;  3L70 J;  1X79 A;  1ZP0 A;  2D9D A;  3R84 B;  4ASK A;  3D6Z A;  4EGW A;  1LRZ A;  2ODU A;  5AW2 B;  3JC6 C;  2CPS A;  2A2F X;  2PP6 A;  3BQI A;  3LK4 2;  1AVY A;  1KQS O;  3H25 A;  5L3E B;  5L4E A;  1VF5 C;  4IL4 A;  1LP1 B;  2L3L A;  4WNK A;  4HWC A;  1PPJ G;  1S9K D;  3F5H A;  1FDM A;  1WLX A;  5HAX A;  3H1K E;  2LSK A; 
#chains in the Genus database with same CATH homology
 1EDK A;  1X0T A;  1SS1 A;  3PJA J;  5EFW B;  1LT1 A;  1OVR A;  1H0T B;  1Y47 A;  3ZDM A;  4K3A A;  3AXJ B;  2M5A A;  1BDC A;  4GOF A;  3RGU A;  4CPG A;  1ZXG A;  1NVO A;  4HJG H;  4JBZ A;  5C39 A;  1OVV A;  1LP1 A;  2SPZ A;  5CBN A;  1ZW0 A;  4BXL A;  2P58 A;  3PJA A;  4ZMD A;  3FXE A;  4GOD A;  4NPE A;  1H0T A;  4WWI A;  2B89 A;  1KEY A;  3AXJ A;  4HKZ H;  3RIU C;  1FC2 C;  2K3R A;  4KJM A;  3QWO C;  1EC5 A;  2KI7 B;  3PH0 A;  1JMB A;  5DJU B;  2KS1 B;  2RKL A;  2KIK A;  4GOE A;  1EDL A;  2LXB A;  1OVU A;  2Q1K A;  2UWJ E;  3MZW B;  2B87 B;  1S3J A;  2KUB A;  1EDI A;  3S1K A;  5DJT B;  2OTK E;  2M5A B;  1U7J A;  1MFT A;  4IOI H;  2ZAE B;  1U7M A;  1BDD A;  2QRX A;  1JM0 A;  3QB5 K;  5K5G B;  2B88 A;  2I8D A;  2LXC B;  2B87 A;  1EDJ A;  2QVA A;  3FXD A;  2M0B A;  4K35 A;  4ZNC A;  1DEE G;  2LR2 A;  2R44 A;  3RIU A;  2JWD A;  3QB5 A;  4WYV A;  4ASW A;  2KZJ A;  4MN4 C;  2WMM A;  5CBO A;  4HB1 A;  3MHV A;  4ASV A;  1J1J A;  1Q2N A;  2KZI A;  4NPD A;  4NPF X;  2HR3 A;  1LP1 B;  4EYY Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...