2QVAA

Crystal structure of drosophila melanogaster translin protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
182
structure length
182
Chain Sequence
VNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERSLNISHFIGDLNTGFRLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Drosophila mutant translin and characterization of translin variants reveal the structural plasticity of translin proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords GM27569p
total genus 69
structure length 182
sequence length 182
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2qvaA02
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 2qvaA01
4GOEA 1EC5A 1LT1A 3QWOC 1JM0A 2LR2A 2B87B 2QVAA 1FC2C 4WYVA 1OVVA 1J1JA 2WMMA 1EDKA 2OTKE 3FXEA 2B88A 3QB5A 1OVRA 2B89A 2KIKA 2LXBA 4EYYQ 1SS1A 2UWJE 1DEEG 3RGUA 4GODA 5CBNA 2K3RA 1ZXGA 2KI7B 4HKZH 1H0TB 1OVUA 1U7JA 2I8DA 5DJUB 1MFTA 2B87A 3MZWB 1H0TA 1EDIA 2M5AB 4JBZA 4CPGA 1KEYA 4KJMA 2SPZA 4NPFX 1JMBA 2ZAEB 1Y47A 3RIUC 1X0TA 3S1KA 4ASWA 3MHVA 4K35A 5K5GB 3PH0A 3QB5K 4K3AA 1ZW0A 1EDLA 5DJTB 1Q2NA 1S3JA 2LXCB 4BXLA 3RIUA 2KS1B 2M5AA 5C39A 4NPDA 3ZDMA 1EDJA 3PJAA 4ASVA 3AXJB 4GOFA 2Q1KA 2KUBA 3PJAJ 5EFWB 2RKLA 2P58A 4WWIA 1BDCA 4IOIH 1U7MA 4NPEA 2KZIA 2KZJA 1LP1B 4ZMDA 2HR3A 2M0BA 4HJGH 4MN4C 5CBOA 2QRXA 2JWDA 1NVOA 1LP1A 4ZNCA 3AXJA 4HB1A 2R44A 3FXDA 1BDDA
chains in the Genus database with same CATH superfamily
4UB6H 1PPJG 4PD4E 3V2QA 1Y8AA 1SQQE 1ZP0A 2WDRA 3L71J 1YITP 1NYHA 3SSUA 3Q5PA 2V6YA 1KB9I 2PRRA 2ZMAA 4GDOA 4ZI2C 4D6TJ 2XY8B 2KSJA 1LWUA 5E79H 3TGUJ 2FXOA 4IE4A 3PUAA 1SQVG 2NW9A 4EYYQ 5M4YA 2H88A 5LYJE 3RK3E 3EUHA 2E2AA 2YKSA 4CXYA 2KI7B 2WPSA 3N9LA 1G2CA 3NZPA 5ADXL 3AE4C 2D5UA 1KILC 2IBZG 3M06A 1E5WA 1N7SA 1PZQA 3JC22 1ZLLA 4QXCB 3ZYLA 5TJHA 3NBXX 2NPSB 3USSA 2SPZA 1AJYA 1YHQP 1KFMA 3TSIA 5J0ZA 1J5ET 1N7SB 2K9JA 1J1EC 2OYHA 4YSXA 1IC2A 3AEFC 1N73C 3PJSK 3H1HJ 2WWWA 3ONLC 2ZM8A 1MIYA 2BCCJ 2EHOB 3CC2P 4CN1A 3RPUA 3AE7C 1AQTA 1NAYA 3L71E 3C4WA 3ETVA 4JI1T 1GD2E 4EZHA 5LGTB 4IDNA 1E79H 1NTZD 2UUAT 2IYPA 1D0ZA 5AW5B 2E76D 2W8ZA 3RIUA 4A97A 2KS1B 1VQLP 4IL6H 5LHHB 4AKRB 2BS2A 5L3EB 2FYUE 1KYOH 4PJ0E 2CHNA 2NOXA 2V26A 1W2BO 1JTHA 1VQNP 3CVRA 3FBLA 2KS1A 3A0HH 2NP9A 2Y48B 4AIUA 3RH3A 2WMOA 2P10A 1MMDA 3HUSC 3HR0A 3FXEB 2B76A 3A7MA 1ZOYA 1J1DB 2I1KA 4XZCA 1L0LK 2W0GA 5HXRA 4WY4D 1KNRA 2JJLA 4LF7T 2M0BA 4YPCA 4DO0A 1RQUA 1VQ9P 3ZKRA 3LW5H 1PP9G 4RJTA 1Q90D 1EZVI 3IEEA 1R5SA 3VRAA 1FOSE 1S4XA 2JWAA 1WR6A 3MUDC 3M0AA 1VQ5P 2HODB 4OGQC 5KJ7A 4I0UA 2WSEH 3FGAD 1JM0A 3C4XA 2LR2A 2L5GB 3B5ND 5JVDE 4IIJE 2IDBA 4U74A 3ZN0B 5KLVG 3F57A 4PD4H 3BQKA 3LJCA 4JI7T 5B5EH 4AQRD 5AVQB 2FYUJ 3AAIA 4O4LE 3C9IA 1M8OB 2KXPB 1Q82Q 1YQ4C 1QL2A 1LWUB 3KVAA 1DEEG 4UB6E 2CK3H 4UF0A 4LMKA 1QLBA 4WB4A 5AVRB 2E75C 3M9QA 4YT0A 2HG5D 1G1IA 3ETUA 4DMVA 5KDMC 2QJKC 5AQRB 3ZC0A 3AEEA 3RK3C 3H32A 4JBZA 4AI6A 2BS3A 3ZT7A 3RL0g 3AE6A 1HF9A 3N9QA 3AE8C 4H13B 5KLVD 2MAWA 4YFSA 3HE4B 3AEDA 2L3LA 2W61A 3AA7B 1X22A 1A02F 3G71P 2P2UA 2DLRA 5JRCB 5KX5E 1SHZC 3EFFK 4D6TG 5HEJA 2W83C 4ZZCA 1RH5B 1SFCD 1URQB 5E79E 1GL2B 3J9X1 3GMAA 4B3TT 2CPSA 2W62A 3KV5A 2B9BA 3L72D 3EWKA 1S3JA 2IMLA 4DNDA 2FYUK 2H89C 3AAEB 3A5XA 2M5AA 2ZVOB 2CEAA 5L3BB 1VF5B 2D9DA 2V4HA 2ZYGA 4UXNB 3HRNA 2XKMA 3K1SA 4ZS2A 1NJIQ 2KUBA 3LFMA 1BR4A 2JDIH 5DJQC 4NIQA 1IFDA 4C91A 3QC9A 4YTNA 4CQIA 5JR9B 2K9AA 2ZLYA 2V6XA 2C0XA 4IGUA 5JDMA 2I59A 4H44C 3VN0A 1VQPP 4WY4B 4O2AE 1HGVA 5APTA 2FBWA 5AW7B 3OYZA 2BCCG 2HR3A 1L0NE 1GW3A 3BCCE 5CBOA 2UXCT 4JI6T 3KV4A 5CMZA 1BE3J 5L47A 1S9KE 1PP9D 2KK7A 2LRLA 1KB9D 1N7SC 1MNDA 3D0TA 3ZMTB 2J47A 3AVRA 3K3QC 2W4XA 3H1JG 2X0YA 2QJYC 1YD8G 1SQBJ 4H9QC 3H1ID 3P8CE 3I9YA 2WCAA 3E22E 4PFPA 5DQVA 3UUBA 2Z5HA 2C5JA 2E5VA 4JQ0D 5HEGA 2LSYA 3SFDC 2BBHA 1FZEA 1NTKJ 1T8BA 1KORA 5HXCA 3UTKA 4LC1A 2YU2A 1WLXA 2RMZA 2A06G 1NTMG 4O4HE 2VURA 5F8PA 1L0NJ 1YJNP 4OYJA 5KAIE 3D70A 1HF8A 4UVCB 4NXNT 1T3JA 4TV9E 3ZSTA 5EZYE 1R8IA 4PK6A 1FS0E 3IBPA 3TNUA 2XQYA 4I7ZB 5AQSB 3FWLA 2O3JA 3PV0F 2IBZD 1O3XA 4YHJA 3ZCJA 1IZNB 5CCGD 5GTHH 1ZW0A 3T8OA 5FY7A 4KBMB 4YJ2E 2LXCB 3N9PA 4H0LD 4RKUJ 4Y99B 3A5TA 1NTKE 1EDJA 4IDPA 1IFIA 3B13A 3VU7H 3AXJB 4ASKA 3P8CD 4DIDB 5KXJA 5HEUA 3A7OA 4HH2A 1V9DA 2N1GA 2W66A 3V4QA 2WITA 5AW8B 3Q5SA 1ZRTE 1N86A 3KYQA 5AQUB 4H9PC 1CW5A 2VK9A 3NRXA 1NU1D 1FZCC 1LTGC 2L9QA 2VKDA 3F2EA 1PP9E 4OVNF 3R84B 3BCCD 1NKNA 3G4SP 2J58A 1WRDA 2LHRA 1WT6A 1SQPJ 1M62A 3JADA 4CZZB 4HJGH 3CI9A 1KNPA 2QJYB 2BG9B 2V7JA 1LP1A 4XAXB 2VKOA 3U78A 4YHHT 1K9MQ 3EHZA 1NKZB 5KKZB 2K3WA 3NZQA 1FE6A 4H44D 2HFED 3H1KD 1Z0PA 1L0LD 5APUA 5AW0B 3VMZA 5CJ5A 3EQ2A 1OXZA 3P50A 1FDMA 3V5SA 2VKHA 3KFWX 5L4HA 3UIAA 3OA7A 3H3AA 2IC6A 1EDKA 2G8YA 4N78D 3FXEA 3H1IJ 4I4TE 2YOEA 4JI2T 2MJZA 3JCUH 3Q9DA 3RL0B 1DU2A 3B71A 3RYIE 2KIKA 3SWKA 5FVKA 3UULA 3CMEP 2N1TD 1URQC 4PV1B 5FY1A 2E9XC 3C4ZA 3TLTA 1M90Q 2LJLA 3L75E 3DJBA 4LF4T 3C8VA 3PE0A 3G6EP 4TZ4C 2V8SV 3BQLA 5LG3A 4DV7T 1UCUA 3KVBA 2ZT9C 1VQ8P 2NWBA 1RE4C 1AA0A 1JY3O 4HFDA 5AVZB 1GQEA 2OYHB 1JEKA 2PGDA 3L74D 3VHLA 3MK7C 1GL2D 3FB2A 3L70D 1S1CX 2JMHA 1W9RA 1AQ5A 4HFEA 3AE1C 5LGNB 1HJ0A 3SS1A 3CCQP 1N2DC 3ZJ1A 4U3FE 3O1IA 1RF1C 2Q1KA 1HGZA 4TWHA 3DTOA 3N9MA 4YXWH 3VTPC 2KLQA 3H1LE 5FP3A 4GT1A 1G73A 1BR1A 3P4RA 4CXXA 5L3FB 2Z4EA 1VQ6P 1P84H 3D71A 3CMLA 3TK1A 1U7MA 3AEDC 3L75J 4DCKA 3AB3B 1IJ5A 4L0RA 3FZKB 3RQUA 2C0WA 4MN4C 3B5NA 3HD7D 5CGMA 2CMRA 1VQ7P 3V4WA 4UVBB 1J1DC 2GUVA 4F6RC 2VVNA 3UU4A 2M6IA 4IFDK 2WQYA 3I0QA 3H1LD 2FFDA 1BDDA 2NPSC 3H32B 1JOCA 2XAFB 3PP5A 1T6AA 2N1TC 2HYNA 2IZ1A 1UGOA 1IK7A 3V5BA 1M56D 3RL0C 5CJ4A 5FVLA 3TYYA 4NUUA 2QJKB 3CXHE 1KFYA 1RHZB 1VF5D 1JUNA 3K8PC 5LB7B 1KC8Q 3L74E 1S5LE 1KYOE 4PJ0H 1SA0E 2VVSA 1HR0T 3ABVC 1KK7A 3ANWB 2XNXA 3F89A 3RGUA 5CBNA 2NTYA 3RRWA 4UB8H 5AW4B 1RF0A 4QHOA 3Q1MA 1MV8A 4YTPC 2PBIA 2Y0DA 2YNYA 4HWHA 3EFGA 1P84I 4EEDA 2IYOA 2JQHA 2IFMA 3NVOA 3AE5A 4U2ZA 4J2CA 3L75D 4YJ3E 2C9LY 3N9OA 5AQFB 5AFUL 5BU5A 1JY2P 2ZAEB 3CX5I 3VRBA 4DVDA 3CK6A 3RK3D 1HWTC 4AYCA 2WT7A 2H7OA 4PNIA 2X9HA 4TV8E 1JY3N 3MHVA 2LT3A 3W67A 4E7SA 3LSVA 1VOMA 2OYHC 1M1JC 2K1AA 4WY4C 1KQSO 3ZJ2A 4OHFA 2V7IA 3RYHE 3CXHD 4IDQA 2BVLA 5H6QB 2Y6XA 4GOFA 3C98B 3ZSSA 4O9BA 1VPCA 2Y0CA 3P4SA 3AE4A 4QXHB 2X9WA 4JEUB 3BASA 2MTQA 3WI3A 2P58A 2X67A 3NRYA 3K3OA 2YEVC 5AW6B 4IOIH 1T72A 2E9XB 2KLVA 1CI6B 1MMNA 3RKGA 4BAYB 3RC8A 4YXDC 1YJWP 2Q3EA 3PUYF 3RGLA 3PUZF 2YDRA 3BRVB 2AE9A 2OGUA 2RPAA 1H8AA 2QA7A 2XZRA 3VP8A 1M7LA 2K9JB 4HB1A 3RK3B 3SFEC 1DD3A 2ITAA 3N7NA 1YJ9P 3ZYKA 3UFEA 5HAXA 3L4FA 1N36T 2H88C 1L0NK 4I50E 4U3FD 4TT3H 2YKOA 5FYMA 2A06E 5AVWB 1KV4A 4WYVA 1H7CA 3RI5A 5IUXA 2YIUC 3AEGA 5LXTE 2FFDC 3FHNA 3GF7A 4UEMA 3N2KE 3B5MA 1KQLA 1T2KD 2VKJA 3CX6B 2E9XD 2UXBT 1OVRA 2B89A 3U1AA 4HFHA 1QVFO 4DT0A 1SQBG 2E76C 1WMKA 2KB7P 1SQQG 1MIVA 4GODA 3CWBD 2M3EA 4YSZA 2AXDS 5DJUB 3O8ZA 1MFTA 2FXMA 2WPQA 3ONJA 3PTZA 4L76A 5CA1E 1SQPD 2QSIA 4GKGA 2OYIC 2FYNB 1KEYA 4K0UA 2ZYAA 2HLOA 4LMLA 5APQA 4HWFA 1IFPA 2JEEA 3HKDE 3L71G 2PG8A 1R8EA 3AEBA 1KYOD 2YO2A 4ZHQE 2Z5IA 3O1HA 3VMXA 3CPZA 3ZEFB 1NOHA 3CL3D 2WDVA 4EEBA 1DIPA 4CI1B 1URQD 3VR9A 2XASB 2XU6A 2DI4A 2JR8A 2O1KA 5JDLA 1L4AB 4U3FJ 2MYSA 2A45G 3UQ4A 5AQQB 2XQ4A 3S4UA 1LTJC 5FNVE 4AXPA 1WYCA 4N3YB 2FKWB 3CIRA 4UV8B 4LF6T 1R5LA 2YINA 3H1KE 4DR1T 1PP9J 2W6JH 5ABEA 3U1CA 5BMVE 2YXRB 5M1BA 4JBWF 4IFMA 1OW8A 1WR0A 3HUSB 4NPEA 1OMIA 3MGNA 2CLYC 3PRJA 3L09A 4PFOA 3AEGC 3ZCIA 4DUYT 2XPKA 4KMCA 3ZMSB 3RX6A 3KPEA 5AVYB 5AQHB 2BKNA 2FYUG 5L8RJ 2V7LA 4JEHB 4AKLA 2JIWA 3SFEA 1ZP0C 2WMNA 2LSJA 5APWA 4RO0A 1DD4A 1BSHA 5HXSA 5CCGA 1I6ZA 3QB5A 5FXXA 2QIWA 1WFDA 3P32A 2Y8DA 2QA4P 2WU2A 1NU1G 4DR7T 2DW3A 2EHOA 1LT9C 4HKZH 1YKEB 1VQMP 3PUSA 1YQ3C 4WZXA 3CWZB 4OK0A 3BCCJ 5KJ7C 4LMJA 5DQWA 3MUDA 1EZVE 3OBVE 4M1PA 5CHXA 1OIPA 3CX7B 2HH7A 5APSA 1MUUA 4DBQA 4DJGA 3RBXA 3LDQB 4IE6A 3L75G 4Z1MH 2A45I 3B5NC 3S4RA 1A02J 4QKNA 1VCTA 3S1KA 5AVXB 4EV6A 3RLFF 4ASWA 4K35A 2W00A 4K0KT 3UQ7A 2XSBA 1OZHA 3RIFA 1MMAA 3M0DC 4PAGA 1S94A 3OJAA 3C1LA 1JB0J 4X65T 3RK2D 2CLYB 4G63A 1SFCA 2AXTH 2KWIB 5HWXA 3VYIA 3H1LJ 4O2BE 1LT9B 3CQXC 5LMNT 1MMGA 3E0ZA 2DWKA 1Q7YQ 2WZIA 4WW0A 3FZMB 3IHRA 1Z56A 2RKLA 5FY0A 4QH4A 2X9YA 3P7IA 4BRYA 4TWFA 1W0AA 2A45H 1J1EB 2RA1A 4Z8XA 2W27A 3AE7A 2CXDA 4JI3T 3H1LG 2OLTA 4BJNA 1L0ND 2ZVNB 3G06A 2OARA 2QRXA 2VQFT 3UU8A 2RH0A 3CCUP 3A3YB 2K88A 1M57D 4LFCT 1M7KA 2CPBA 3T97A 1UURA 1FOSF 1LTAC 2Q9QD 1AV1A 1KZUB 1YQ3A 4C7NB 2LSKA 4AQYT 2CWYA 1FMWA 1URQA 3IN6A 1YTZI 3V2NA 2N9DA 5LJNA 3VKGA 4FJOA 5KJ7D 3BVHA 1SQBD 2M6BA 4JLEA 3L72E 4H13C 4H44B 3HL6A 4AQFC 5H2FH 1ZOYC 2OTLP 1KMIZ 2IAKA 2ACXA 2MKVA 4H0LC 5C3JA 3VOPA 3T1HT 3Q5EA 1BE3D 3HD7A 4HE8A 4O8SA 2Q5UA 1AVOA 1EZVD 1GTWA 1SQPE 1JCCA 3N9NA 5KLVE 1H88A 3OTOT 1BSNA 1KTMA 2BVMA 1KQGB 3C51A 5EK4A 4AUWA 3AA0B 5L4EA 4PW8A 2CXLA 2N1TB 2H7VC 1PGQA 2GUSA 2ZXXA 1Y47A 2ACZA 1ZV4X 4TNWA 5LBMA 1JNRA 3MD0A 2WTYA 1L0LG 2XAGB 1HG5A 3FX0A 4QX7B 5AQPB 1L4AD 2LKGA 5TISE 4D6TD 5IWAT 2WZ7A 1OFCX 4NXMT 3PUQA 3PUXF 1J5WA 5DJTB 3H1IE 2K37A 2K9YA 4UR9A 1PGJA 3AE3C 2JP3A 4DV5T 3B57A 4NPDA 2BG9C 3H1HG 4W80A 3CX5H 1AFOA 3QOFA 3GA8A 1NTKK 1MIWA 2E74C 3BCCG 1KB9E 3J7Yq 3AE8A 1JNZA 1ZEEA 3AE6C 2HPCA 5C2TA 4ILCA 2E43A 2HN2A 1NAFA 1AJ3A 1Q86Q 2E5YA 4W7ZA 4C46A 1KILB 1SQBK 1JY2N 5AQKB 3H25A 2WS3A 2DCFA 1LP1B 4IL9A 3WUVA 3CCMP 3HE5B 2WDQA 4CI2B 1D1AA 4FI5A 1HJBA 1XNQT 1NVOA 1YTZT 3JCFA 1SVFA 3BATA 4ZNCA 1CZQA 3AECC 1QSDA 3N2GE 2RP4A 2XNDH 5IHYA 3C50A 4GOEA 1ZR4A 2KNCB 4LLHA 3HD7C 5LNKA 1LT1A 4KT0J 3PU8A 4U7IA 2OTJP 2ZT9D 5JQGE 5AQIB 4I7ZC 4WBAA 4AKIA 3QK6A 4X66T 1NTZE 1GK4A 5E0OA 1PGPA 3L37A 2IZ0A 4DV2T 2FJEA 3RL0D 1SS1A 3ZN1B 2QEXP 2R6GF 2UUBT 2NPSA 5GTIH 5AQNB 2WSEJ 2HPCB 4CI3B 3OAKA 2I6HA 2WP9A 2VASA 1S5LX 2N9BA 2B87A 1E1HB 3ZMUB 3VP9A 3TNUB 1H0TA 1LTJA 2NW8A 5HWYA 2VRSA 2M5AB 4X62T 2YDQA 4C7RA 5FMNA 2RN0A 2B1EA 3AECA 2G3AA 2XQ6A 1LTJB 2N9YB 1NTZG 2IW5B 4CXWA 5JTGA 1SQXK 1OW7A 1OWAA 2BG9A 1GW4A 1HNXT 3RIUC 4DR4T 3HA4A 3CXHI 1MKMA 2CRBA 3M91A 5BU8B 3FBZA 3L73D 3L70J 2DL1A 3EI0A 2A06D 3NFQA 3H3MA 4EGWA 2YN6A 1MNEA 3E7KA 3L74J 1SQVE 3LK3B 2O01J 3AEFA 3H1KJ 2BKOA 3PJAA 2BCCD 2Z6EA 1L0LE 4ZS3A 5KAIH 3VR8A 3P4QA 4QX8B 5L2LA 3LG7A 1ZHCA 4UV9B 1KNZA 4B6XA 3HD7B 1IFNA 4MHCA 4WY4A 2LEHA 5J2TE 3L74G 3V2RA 2G0UA 4EB6E 3X1DA 3H1IG 1YKHB 1USEA 5HEHA 4DV3T 2WSFJ 4ZMDA 2XAHB 1K73Q 1RE3C 5B66E 5F3JA 4JV5T 2WSCJ 4JI4T 3WMM0 4ZI2D 1NU1E 2FYNC 3L72G 1UIIA 4RESB 3MIWA 5JDFA 2CBJA 3TGUG 3OKQA 3UFGA 2R44A 5GTIE 1QUUA 5AQGB 5FXWA 3L70E 1Y01A 3TLWA 2QM7A 3GN5A 4GYSA 1HNZT 2B87B 2QVAA 4H63H 1QEXA 4WVZA 1I94T 3KV9A 1XMQT 2E74B 5DABA 3RIAA 2Q9QB 2H43A 2JPFA 4GKKT 5AQLB 4JYAT 1GL2C 2W6AA 3TLVA 5KLVJ 3CCEP 3F31A 4HKAA 1FZAA 1LTBC 5H2FE 3PTRB 4BJMA 3JAFA 4UF0B 3LBXB 3CD6P 2UUCT 4U72A 1Y9BA 1W2EA 4MALA 1X0TA 1Y64B 2J1DG 5CB4E 2Q6QA 3GF3A 1VRBA 2R3CA 2D2CB 3TF5A 1KB9H 3PH0A 3TGUD 3UUNA 3HUSA 1N34T 1HVVA 2XZEA 2AXCA 3TDKA 1CHUA 4IREA 4CN4A 2W63A 1SUMB 2WSSH 4H9NC 3K5BA 3ESLA 3FXDB 5C8YE 2MPKA 3HKEE 4PD4D 2LLYA 2XDJA 3V5UA 4PV1C 4YSYA 1S2EA 3CQGB 1D1BA 3AE1A 3L3PA 3PJAJ 1SE7A 2ZM6T 2X0LB 1EZVG 4A98A 4DV0T 3MZKB 4MFRA 4GOUA 4QXBB 1T2KC 2KP8A 5AW1B 1ZN5A 4IFFA 4QH5A 2GA1A 2XTLA 1FZBA 4HWCA 3R4YA 2OYOA 3ZT5A 2K24A 1IO4A 1JO5A 3P4WA 1RE4A 2PJQA 4QH1A 3WUUA 1N73A 1ZRTD 3G9RA 2LSIA 3IF8B 5B5EE 3NTNA 2IFNA 1HH0A 5CCGC 2MOZA 5JH7E 3EDVA 2N1TA 1VQ4P 2D0TA 3L73G 3E1IA 1OEDA 2LHNA 4U33A 4GIFA 1QGKB 2WQYC 1NHLA 4I2LC 1VCSA 1H89A 3PUWF 2DWGA 4IDOA 1NH4A 2BEQD 2V7QJ 1K05A 1NTMD 5CCHC 3N5LA 5HXHA 1KD1Q 2K48A 3WAJA 1IAPA 1LT9A 1YYCA 4IHJE 1N73B 5ABHA 3ZLIA 1FIOA 1IJDB 3S9OA 1SQXJ 4HFCA 1FZCB 5TISH 2EHOD 1NTZK 3RKOA 1L0NG 1VQOP 2YK0A 3Q5XA 2CPTA 1RE3A 5CA0E 1D1CA 1JMMA 3M65A 2X51A 3RYCE 1GMJA 2OV9A 2POHA 3P8MC 3D6YA 2FYZA 2I8DA 3MJXA 2NR4A 2JQKA 1MFZA 1G2CB 2VQET 1EDIA 3H1JD 4C90A 2QJPC 4JI8T 1W0BA 4ZKPA 1JMBA 2XUEA 3ZC1A 5LP6E 5J2UE 1GK6A 4QMAA 1X79A 2ZJSE 2BS4A 2NRGA 2N2NA 3SRZA 5HYAA 5HEOA 2AXTE 2WSSV 3LK2B 4LF8T 4OH8B 4JPZB 5BR8T 1UK5A 3UU3A 4I43B 4K3AA 3CCRP 4AQGA 1CI6A 2X66A 1W09A 5KAFE 3F5HA 1SQXE 1TU3F 3G3ZA 4KHXA 3TLSA 2H89A 4ADZA 4ISTA 2WY2A 4DR2T 1L0LJ 1IBKT 1NTME 3EAMA 5JDHA 2UXDT 2UU9T 1FJKA 5L3DB 5HCJA 1S9KD 1MZ9A 3GWHA 4HGAA 2JJ9A 1PIXA 3C64A 4DMWA 2D2CC 2IUBA 1OX3A 4TLFA 1X8YA 2R32A 3ZMZB 5CJ0A 1LVKA 3NWIA 2ES0A 2KZIA 1PL5A 2KZJA 3N4XA 3LK42 4X1KE 5CCHD 2IHR1 4HFIA 2IPPA 2GM4A 1IFJA 2WT7B 4IE5A 3AEBC 3AE5C 1OEDE 1WCRA 3FZHB 4DV1T 4EYUA 3HI2A 4ZKUA 2HPLA 2W6BA 4PK5A 3FXDA 4EAHA 2QG4A 2IC9A 3ZPOA 2OQQA 3SWYA 3QWOC 1PGOA 2FYUD 1NTZJ 5LMUT 2V7MA 4HWDA 2CHOA 2KINB 5TAOA 1D0XA 4DR5T 4B3RT 5LA6E 2LOPA 2KMFA 1L0VA 2WM9A 2J4GA 2R5DA 4GK0E 3H1HD 2BDEA 1JY2O 4ZOLE 1J2JB 2WB5A 1QL1A 4U7YA 1FZCA 2E74D 3A0BE 2A2FX 4DBRA 3RK2C 3IR9A 3AE9A 2WSCH 1BCCG 3MP7B 3JC6C 4X1YE 4YLHA 3AAAB 2W90A 1OVUA 4DOJA 1D0YA 2V6YB 1K8AQ 2M3BA 2ZXEB 1HCIA 1HS7A 1X9BA 2WSFH 3R2PA 1GU5A 4DV4T 3KQGA 2AEMA 2LE8A 1JY3P 3E1RA 1OEDB 2WU5A 2JKVA 1T3UA 3I55P 3VMAA 1L4AC 1LTIC 1EZ3A 2YMKA 2YKQA 3RC3A 2KZ7B 2YIUB 2IIUA 1HTJF 4WBOA 4GYRA 2FBWC 5GONE 5K5GB 2QGSA 3I9WA 5AW9B 2O01H 1N32T 4LGDE 3QH9A 1RF1A 3L72J 2LOSA 1LNQA 1SQQJ 4X64T 3KV6A 4I55E 1DX7A 1Z8UA 3PURA 1HNWT 4BWNA 3ZT6A 4TNVA 5APYA 1KQFB 1UIXA 3LIEA 1JCDA 1QVGO 2OYIB 2W2UA 3Q5DA 4Z91A 4H13D 4ZEYA 5JDGA 2XM1A 1M1JA 3CWBG 1SQQK 2A3DA 2KT9A 1L2PA 5LJMA 4YTPA 1N33T 5LHGB 1G8XA 3SFDA 3MTUE 3HTKA 1NU1J 2P9BA 1U5PA 1KF6A 3UU6A 3Q5RA 1E2AA 4OYKA 1WRGA 1GU4A 3GW6A 1T98A 2YU1A 3KDSE 4LFAT 3AXJA 4COFA 2O01N 4L75A 2P1JA 3EABA 4P09A 3CCLP 5ABFA 2LKMA 1HUCA 2Y9ZA 1CSBA 3GHGC 3AEEC 3FZFB 1W5CE 1LGHB 2BBJA 2Q9IA 1BR0A 4AKHA 1YIJP 2BCCE 3CKDA 2NZ2A 5GTHE 3B5NB 1J1JA 1T7SA 3SWFA 2ODUA 4YTMA 1SQVD 2PFVA 3HE5A 1FJGT 5AQVB 1QX8A 2JQ9A 3L36A 3MA9A 3L73E 4PJMA 4O4IE 3A8YC 1B7TA 4XE5B 2UWJE 1EQ7A 4EOZB 2XAJB 3RYFE 1H0TB 3PU3A 4ANJA 3Q5WA 5KMGP 2JMKA 4H63V 3U3IA 3II6A 1RY3A 1PPJD 2YO3A 1UX5A 4HFVA 4KJMA 3N2OA 2XHEB 4NUVA 3LIDA 4JI5T 2PAJA 3CQCB 2QM8A 3UT5E 2WBLA 2VWAA 4TX5A 2NW7A 4TWDA 4JUYA 2MBGA 3D6ZA 2XSAA 1NWMX 3P7KA 3M0DA 1NTKG 2WPVB 3ANWA 3TLUA 5APVA 5AQMB 1U4QA 3ONXA 1KYOI 3KINB 2KNCA 2J59M 4I1LA 4JYCA 1LJ2A 4BXLA 5ABFB 3A0BH 3UUXB 3Q2MA 4B86A 1IK9A 3CLQA 2C5IT 4PK4A 4KHPT 5KAFH 3OW2O 1HFAA 3UUMA 2UXXB 3A0HE 3WU2E 2A9UA 3VMYA 1BGYD 1KILD 1QLED 5L3GB 4WWIA 4GK5E 2KOGA 1SQVK 3H6PA 1YQ4A 2D0UA 2CA5A 2JO1A 3O1JA 4DUZT 3O6QB 4WNKA 1LRZA 4HTEA 3IAOA 4UB8E 3WUTA 1BCCJ 5AQOB 3GHGB 4X5TA 4EYYR 2XQ7A 2M67A 1E7PA 4C7NA 4ISSA 2KSEA 5CFBA 4P0AA 1VF5C 4H9OC 3IA3A 2K5BB 3K3NA 3M9BA 3O9XA 3AA1B 5ABGA 2C5KT 4I6MC 4IL6X 1SQVJ 1S72P 2L8KA 1JNMA 1FDIA 1S5LH 2YMYA 2WZHA 3EVYA 4U7JA 2XQ9A 3I1AA 4EI2A 3W68A 1BE3G 4U3CA 4KUMB 3L71D 3AEAA 3O4XE 3GHGA 2CE7A 1FZFA 4ZI3C 4P0BA 5KLIC 3CCVP 2OTKE 3O6QA 2KLUA 3CCSP 3HE4A 1VL2A 2XQ5A 2YXQB 1IBMT 1LWUC 4D6TE 4ILUA 3PLNA 1HG2A 2X9XA 1D7MA 2NTXA 5LG4A 5KLIB 3L8RA 3AEAC 1SQPK 3CCJP 3JC6D 4OGQB 3E08A 1U7JA 3KBTA 3B8EB 5CCHA 1ZKEA 4ERRA 1XZYA 1SQXG 2PTFA 4X20E 2E5TA 2FXPA 3RBZA 5EK3A 2OA5A 2KSRA 2HPJA 2XQ8A 2BG9E 4GKJT 2L91A 2FFDB 3H1JE 4L74A 3OJAB 2UXNB 2VL0A 4NPPA 5AVTB 1NEKA 4XBFB 3RRCA 4N78E 4MBQA 4U3FG 1BE3E 4UELA 2BZBA 2CXFA 1SQPG 4H9RC 2O1JA 5F5WA 3UU5A 2AEFA 4IE7A 1NGMB 3OYXA 4KHZF 4XA4A 3H1HE 3RF1A 4Y28J 3KBUA 5JDQA 5FXZA 5LCYA 1EDLA 2WPRA 4H0LB 3CX5D 4UVAB 1SQBE 1SQQD 5JR9A 1IFMA 2BASA 4L5GA 5C39A 1HBWA 1PV3A 1YXRA 2FJBA 5FL1A 4ILBA 4N6JA 1NWQA 1AVYA 3I5CA 4QWNB 4B3ST 2FY8A 4HFBA 5APXA 1P84D 3GN5B 4EIJA 2GK9A 2V7QH 1XDOA 5IYZE 1LKXA 2CM0A 1BCCD 2E8IA 5B66H 2J62A 2HN1A 3M3ZB 2VL8A 2PFXA 3R6NA 1XNRT 2KYVA 2P7JA 2PP6A 3NXSA 1BR2A 2QE7H 2W67A 1Q81Q 3MKDA 2JWDA 3KDPB 3V6IA 2WWUA 2LRKA 5FXVA 3JCUE 4JYBA 1CUNA 4TUYE 4EXTA 1US7B 1FDOA 1NU1K 3NMDA 3AA6B 1ZMEC 5JDNA 4O4JE 1SFCB 1NTKD 1YW0A 1RF0C 3SWHA 2E5LT 3H1KG 1EC5A 4IL6E 4A7PA 3HKBE 5LGUB 3KHUA 2XJ7A 1LVFA 1XWMA 5AW3B 1NO4A 4LFBT 1BGYG 4HYTB 1M1KQ 1LTSC 2V5CA 3M9HA 2H3RA 3U59A 5KLVK 2IBZE 3ZMVB 5AVSB 3HTKB 1EXIA 4Y99C 4H9SE 2FJAA 3HKCE 2V7KA 1LTTC 3L73J 4X1IE 5BVZA 4HEAA 3TGUE 4DR6T 3FWNA 2SPCA 3BK9A 1M1JB 2LXBA 2QJPB 1VDFA 2Q3IA 2ODVA 3FZLB 1VQKP 2KNDA 4PV1D 4R4LA 1ZXGA 3PDYA 1G1JA 3CPWO 4YXDA 1IJ6A 3WU2H 2ZYDA 4JF7A 3P4PA 1FJPA 3MZWB 1IBLT 5AQJB 4CPGA 3PHLA 1NENA 1KN7A 1SP4A 4ZXLA 2J5UA 4NPFX 2C9NY 2M8RA 3OPCA 1SFCC 3W15B 4A56A 4YY3T 3I0OA 3MACA 3OVUA 2I1JA 1OW6A 3Q2YA 4HWIB 2LM9A 2F4VT 4XFJA 2QYWA 2IX7C 2YKPA 5EK2A 5KTBA 5HXEA 1DH3A 4PJNA 4DR3T 1S35A 3BRTB 3CC4P 3ITKA 1N7SD 2Y9YA 4PD4I 3AVSA 1K04A 3AE2A 4LF5T 3ZDMA 5JR9C 2AEJA 4ASVA 4DV6T 2HHHT 1JTHB 1FU1A 2D2CD 1FZGA 4M3LA 4KP3C 5LBQB 3PUVF 4LF9T 1RQVA 4DZOA 5L3CB 3PUGA 2FJDA 4ZZBA 1FAVA 2EHOC 2CBIA 3BQIA 5ETWA 4L9IA 2CWOA 4L73A 2KWHA 5J1GA 1HX8A 5AVUB 1ZR2A 2D2SA 4OFZA 3WAKA 2H8PD 3Q3DA 2X0HA 2Q7CA 3NKZA 1BCCE 5AW2B 1GZLA 1T8ZA 1HX1B 2LM2A 4JI0T 1NTMK 1X9VA 2XM2A 3ABVA 4TN7B 4WBNE 3CX8B 3L70G 4IT4A 4AQFA 1L4AA 1KILA 1BGYE 1KILE 2HODA 3DP7A 2ZFCA 1ZV8A 2DHRA 1XTGB 3L39A 3KZIH 1SQXD 1DEBA 1PFIA 4Z90A 3KZIE 3CX5E 3H37A 5LHIB 4P1NA 2V5DA 4UIGA 4EOTA 1FC2C 1N8RQ 3RQWA 5A1LA 4B3MT 1OVVA 1NTMJ 3ZYMA 2WMMA 1OEDC 2IDOB 2LKHA 1XMOT 1XTCC 3AE9C 1GDTA 2C0SA 4Q25A 2JRKA 2WAUA 2B88A 3VKHA 1RF1B 2ZM2A 3RHWA 2DNXA 5FL0A 5AVVB 2XQ3A 3QUJA 4IE0A 1N7LA 2V1DB 3L35A 3GLMA 3LBXA 1HTLC 2E75D 2K3RA 3RK2B 3GG2A 5AQTB 4IL4A 4ILAA 4PJJA 4EIWA 4KI0F 3IF4A 1FMVA 3H1JJ 3AE2C 1PPJE 2Q9QA 4ZI7E 1UX4A 4ZI3D 1FEWA 2ZT9B 4U2YA 1BGYJ 2XQAA 3CWBE 3EDUA 4BA9A 2VB6A 2IBZI 3A2AA 2Y0EA 3I56P 3JAEA 3T1YT 3B4SA 1KFNA 1SLQA 1WYBA 1X79B 1YI2P 3QB5K 1FBMA 1XDPA 4F8HA 2H7HA 3QNUA 5KKZC 4A5XA 2E76B 1Q2NA 3CXHH 4GIWA 1U57A 5FKYA 4AISA 3TKLB 1EXJA 3GMIA 2LSGA 2BEZF 2R5BA 4R4MA 3JSVC 2CCQA 3IFMA 2OYIA 2E42A 4AKGA 4EDFA 2FUPA 4CN6A 4G2AA 4MLKA 4U31A 2X68A 3AE3A 3MXZA 2P67A 3T97B 1USDA 5EFWB 4IDZA 4OX9T 3V2PA 2E75B 2WWVA 2R3SA 4OWFA 2I0MA 1BDCA 2A72A 2E9XA 2XAQB 5JREA 2YDSA 2BKPA 4OGQD 1GL2A 4PJLA 2ZM0A 3LW5J 4V1Av 2Q9QC 3SOLA 4E7ZA 4W7YA 4KX6A 5HCMA 5JRCA 2NPSD 2WVRA 1YBKA 1P84E 5H6RB 3CC7P 4EZ4A 5LOVE 4HN9A 1UUSA 3CWBJ 3CMAP 4BRYB 2JQQA 3KXDA 2XV5A
chains in the Genus database with same CATH topology
4GOEA 1EC5A 1LT1A 3QWOC 1JM0A 2LR2A 2B87B 2QVAA 1FC2C 4WYVA 1OVVA 1J1JA 2WMMA 1EDKA 2OTKE 3FXEA 2B88A 3QB5A 1OVRA 2B89A 2KIKA 2LXBA 4EYYQ 1SS1A 2UWJE 1DEEG 3RGUA 4GODA 5CBNA 2K3RA 1ZXGA 2KI7B 4HKZH 1H0TB 1OVUA 1U7JA 2I8DA 5DJUB 1MFTA 2B87A 3MZWB 1H0TA 1EDIA 2M5AB 4JBZA 4CPGA 1KEYA 4KJMA 2SPZA 4NPFX 1JMBA 2ZAEB 1Y47A 3RIUC 1X0TA 3S1KA 4ASWA 3MHVA 4K35A 5K5GB 3PH0A 3QB5K 4K3AA 1ZW0A 1EDLA 5DJTB 1Q2NA 1S3JA 2LXCB 4BXLA 3RIUA 2KS1B 2M5AA 5C39A 4NPDA 3ZDMA 1EDJA 3PJAA 4ASVA 3AXJB 4GOFA 2Q1KA 2KUBA 3PJAJ 5EFWB 2RKLA 2P58A 4WWIA 1BDCA 4IOIH 1U7MA 4NPEA 2KZIA 2KZJA 1LP1B 4ZMDA 2HR3A 2M0BA 4HJGH 4MN4C 5CBOA 2QRXA 2JWDA 1NVOA 1LP1A 4ZNCA 3AXJA 4HB1A 2R44A 3FXDA 1BDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOE A;  1EC5 A;  1LT1 A;  3QWO C;  1JM0 A;  2LR2 A;  2B87 B;  2QVA A;  1FC2 C;  4WYV A;  1OVV A;  1J1J A;  2WMM A;  1EDK A;  2OTK E;  3FXE A;  2B88 A;  3QB5 A;  1OVR A;  2B89 A;  2KIK A;  2LXB A;  4EYY Q;  1SS1 A;  2UWJ E;  1DEE G;  3RGU A;  4GOD A;  5CBN A;  2K3R A;  1ZXG A;  2KI7 B;  4HKZ H;  1H0T B;  1OVU A;  1U7J A;  2I8D A;  5DJU B;  1MFT A;  2B87 A;  3MZW B;  1H0T A;  1EDI A;  2M5A B;  4JBZ A;  4CPG A;  1KEY A;  4KJM A;  2SPZ A;  4NPF X;  1JMB A;  2ZAE B;  1Y47 A;  3RIU C;  1X0T A;  3S1K A;  4ASW A;  3MHV A;  4K35 A;  5K5G B;  3PH0 A;  3QB5 K;  4K3A A;  1ZW0 A;  1EDL A;  5DJT B;  1Q2N A;  1S3J A;  2LXC B;  4BXL A;  3RIU A;  2KS1 B;  2M5A A;  5C39 A;  4NPD A;  3ZDM A;  1EDJ A;  3PJA A;  4ASV A;  3AXJ B;  4GOF A;  2Q1K A;  2KUB A;  3PJA J;  5EFW B;  2RKL A;  2P58 A;  4WWI A;  1BDC A;  4IOI H;  1U7M A;  4NPE A;  2KZI A;  2KZJ A;  1LP1 B;  4ZMD A;  2HR3 A;  2M0B A;  4HJG H;  4MN4 C;  5CBO A;  2QRX A;  2JWD A;  1NVO A;  1LP1 A;  4ZNC A;  3AXJ A;  4HB1 A;  2R44 A;  3FXD A;  1BDD A; 
#chains in the Genus database with same CATH topology
 4UB6 H;  1PPJ G;  4PD4 E;  3V2Q A;  1Y8A A;  1SQQ E;  1ZP0 A;  2WDR A;  3L71 J;  1YIT P;  1NYH A;  3SSU A;  3Q5P A;  2V6Y A;  1KB9 I;  2PRR A;  2ZMA A;  4GDO A;  4ZI2 C;  4D6T J;  2XY8 B;  2KSJ A;  1LWU A;  5E79 H;  3TGU J;  2FXO A;  4IE4 A;  3PUA A;  1SQV G;  2NW9 A;  4EYY Q;  5M4Y A;  2H88 A;  5LYJ E;  3RK3 E;  3EUH A;  2E2A A;  2YKS A;  4CXY A;  2KI7 B;  2WPS A;  3N9L A;  1G2C A;  3NZP A;  5ADX L;  3AE4 C;  2D5U A;  1KIL C;  2IBZ G;  3M06 A;  1E5W A;  1N7S A;  1PZQ A;  3JC2 2;  1ZLL A;  4QXC B;  3ZYL A;  5TJH A;  3NBX X;  2NPS B;  3USS A;  2SPZ A;  1AJY A;  1YHQ P;  1KFM A;  3TSI A;  5J0Z A;  1J5E T;  1N7S B;  2K9J A;  1J1E C;  2OYH A;  4YSX A;  1IC2 A;  3AEF C;  1N73 C;  3PJS K;  3H1H J;  2WWW A;  3ONL C;  2ZM8 A;  1MIY A;  2BCC J;  2EHO B;  3CC2 P;  4CN1 A;  3RPU A;  3AE7 C;  1AQT A;  1NAY A;  3L71 E;  3C4W A;  3ETV A;  4JI1 T;  1GD2 E;  4EZH A;  5LGT B;  4IDN A;  1E79 H;  1NTZ D;  2UUA T;  2IYP A;  1D0Z A;  5AW5 B;  2E76 D;  2W8Z A;  3RIU A;  4A97 A;  2KS1 B;  1VQL P;  4IL6 H;  5LHH B;  4AKR B;  2BS2 A;  5L3E B;  2FYU E;  1KYO H;  4PJ0 E;  2CHN A;  2NOX A;  2V26 A;  1W2B O;  1JTH A;  1VQN P;  3CVR A;  3FBL A;  2KS1 A;  3A0H H;  2NP9 A;  2Y48 B;  4AIU A;  3RH3 A;  2WMO A;  2P10 A;  1MMD A;  3HUS C;  3HR0 A;  3FXE B;  2B76 A;  3A7M A;  1ZOY A;  1J1D B;  2I1K A;  4XZC A;  1L0L K;  2W0G A;  5HXR A;  4WY4 D;  1KNR A;  2JJL A;  4LF7 T;  2M0B A;  4YPC A;  4DO0 A;  1RQU A;  1VQ9 P;  3ZKR A;  3LW5 H;  1PP9 G;  4RJT A;  1Q90 D;  1EZV I;  3IEE A;  1R5S A;  3VRA A;  1FOS E;  1S4X A;  2JWA A;  1WR6 A;  3MUD C;  3M0A A;  1VQ5 P;  2HOD B;  4OGQ C;  5KJ7 A;  4I0U A;  2WSE H;  3FGA D;  1JM0 A;  3C4X A;  2LR2 A;  2L5G B;  3B5N D;  5JVD E;  4IIJ E;  2IDB A;  4U74 A;  3ZN0 B;  5KLV G;  3F57 A;  4PD4 H;  3BQK A;  3LJC A;  4JI7 T;  5B5E H;  4AQR D;  5AVQ B;  2FYU J;  3AAI A;  4O4L E;  3C9I A;  1M8O B;  2KXP B;  1Q82 Q;  1YQ4 C;  1QL2 A;  1LWU B;  3KVA A;  1DEE G;  4UB6 E;  2CK3 H;  4UF0 A;  4LMK A;  1QLB A;  4WB4 A;  5AVR B;  2E75 C;  3M9Q A;  4YT0 A;  2HG5 D;  1G1I A;  3ETU A;  4DMV A;  5KDM C;  2QJK C;  5AQR B;  3ZC0 A;  3AEE A;  3RK3 C;  3H32 A;  4JBZ A;  4AI6 A;  2BS3 A;  3ZT7 A;  3RL0 g;  3AE6 A;  1HF9 A;  3N9Q A;  3AE8 C;  4H13 B;  5KLV D;  2MAW A;  4YFS A;  3HE4 B;  3AED A;  2L3L A;  2W61 A;  3AA7 B;  1X22 A;  1A02 F;  3G71 P;  2P2U A;  2DLR A;  5JRC B;  5KX5 E;  1SHZ C;  3EFF K;  4D6T G;  5HEJ A;  2W83 C;  4ZZC A;  1RH5 B;  1SFC D;  1URQ B;  5E79 E;  1GL2 B;  3J9X 1;  3GMA A;  4B3T T;  2CPS A;  2W62 A;  3KV5 A;  2B9B A;  3L72 D;  3EWK A;  1S3J A;  2IML A;  4DND A;  2FYU K;  2H89 C;  3AAE B;  3A5X A;  2M5A A;  2ZVO B;  2CEA A;  5L3B B;  1VF5 B;  2D9D A;  2V4H A;  2ZYG A;  4UXN B;  3HRN A;  2XKM A;  3K1S A;  4ZS2 A;  1NJI Q;  2KUB A;  3LFM A;  1BR4 A;  2JDI H;  5DJQ C;  4NIQ A;  1IFD A;  4C91 A;  3QC9 A;  4YTN A;  4CQI A;  5JR9 B;  2K9A A;  2ZLY A;  2V6X A;  2C0X A;  4IGU A;  5JDM A;  2I59 A;  4H44 C;  3VN0 A;  1VQP P;  4WY4 B;  4O2A E;  1HGV A;  5APT A;  2FBW A;  5AW7 B;  3OYZ A;  2BCC G;  2HR3 A;  1L0N E;  1GW3 A;  3BCC E;  5CBO A;  2UXC T;  4JI6 T;  3KV4 A;  5CMZ A;  1BE3 J;  5L47 A;  1S9K E;  1PP9 D;  2KK7 A;  2LRL A;  1KB9 D;  1N7S C;  1MND A;  3D0T A;  3ZMT B;  2J47 A;  3AVR A;  3K3Q C;  2W4X A;  3H1J G;  2X0Y A;  2QJY C;  1YD8 G;  1SQB J;  4H9Q C;  3H1I D;  3P8C E;  3I9Y A;  2WCA A;  3E22 E;  4PFP A;  5DQV A;  3UUB A;  2Z5H A;  2C5J A;  2E5V A;  4JQ0 D;  5HEG A;  2LSY A;  3SFD C;  2BBH A;  1FZE A;  1NTK J;  1T8B A;  1KOR A;  5HXC A;  3UTK A;  4LC1 A;  2YU2 A;  1WLX A;  2RMZ A;  2A06 G;  1NTM G;  4O4H E;  2VUR A;  5F8P A;  1L0N J;  1YJN P;  4OYJ A;  5KAI E;  3D70 A;  1HF8 A;  4UVC B;  4NXN T;  1T3J A;  4TV9 E;  3ZST A;  5EZY E;  1R8I A;  4PK6 A;  1FS0 E;  3IBP A;  3TNU A;  2XQY A;  4I7Z B;  5AQS B;  3FWL A;  2O3J A;  3PV0 F;  2IBZ D;  1O3X A;  4YHJ A;  3ZCJ A;  1IZN B;  5CCG D;  5GTH H;  1ZW0 A;  3T8O A;  5FY7 A;  4KBM B;  4YJ2 E;  2LXC B;  3N9P A;  4H0L D;  4RKU J;  4Y99 B;  3A5T A;  1NTK E;  1EDJ A;  4IDP A;  1IFI A;  3B13 A;  3VU7 H;  3AXJ B;  4ASK A;  3P8C D;  4DID B;  5KXJ A;  5HEU A;  3A7O A;  4HH2 A;  1V9D A;  2N1G A;  2W66 A;  3V4Q A;  2WIT A;  5AW8 B;  3Q5S A;  1ZRT E;  1N86 A;  3KYQ A;  5AQU B;  4H9P C;  1CW5 A;  2VK9 A;  3NRX A;  1NU1 D;  1FZC C;  1LTG C;  2L9Q A;  2VKD A;  3F2E A;  1PP9 E;  4OVN F;  3R84 B;  3BCC D;  1NKN A;  3G4S P;  2J58 A;  1WRD A;  2LHR A;  1WT6 A;  1SQP J;  1M62 A;  3JAD A;  4CZZ B;  4HJG H;  3CI9 A;  1KNP A;  2QJY B;  2BG9 B;  2V7J A;  1LP1 A;  4XAX B;  2VKO A;  3U78 A;  4YHH T;  1K9M Q;  3EHZ A;  1NKZ B;  5KKZ B;  2K3W A;  3NZQ A;  1FE6 A;  4H44 D;  2HFE D;  3H1K D;  1Z0P A;  1L0L D;  5APU A;  5AW0 B;  3VMZ A;  5CJ5 A;  3EQ2 A;  1OXZ A;  3P50 A;  1FDM A;  3V5S A;  2VKH A;  3KFW X;  5L4H A;  3UIA A;  3OA7 A;  3H3A A;  2IC6 A;  1EDK A;  2G8Y A;  4N78 D;  3FXE A;  3H1I J;  4I4T E;  2YOE A;  4JI2 T;  2MJZ A;  3JCU H;  3Q9D A;  3RL0 B;  1DU2 A;  3B71 A;  3RYI E;  2KIK A;  3SWK A;  5FVK A;  3UUL A;  3CME P;  2N1T D;  1URQ C;  4PV1 B;  5FY1 A;  2E9X C;  3C4Z A;  3TLT A;  1M90 Q;  2LJL A;  3L75 E;  3DJB A;  4LF4 T;  3C8V A;  3PE0 A;  3G6E P;  4TZ4 C;  2V8S V;  3BQL A;  5LG3 A;  4DV7 T;  1UCU A;  3KVB A;  2ZT9 C;  1VQ8 P;  2NWB A;  1RE4 C;  1AA0 A;  1JY3 O;  4HFD A;  5AVZ B;  1GQE A;  2OYH B;  1JEK A;  2PGD A;  3L74 D;  3VHL A;  3MK7 C;  1GL2 D;  3FB2 A;  3L70 D;  1S1C X;  2JMH A;  1W9R A;  1AQ5 A;  4HFE A;  3AE1 C;  5LGN B;  1HJ0 A;  3SS1 A;  3CCQ P;  1N2D C;  3ZJ1 A;  4U3F E;  3O1I A;  1RF1 C;  2Q1K A;  1HGZ A;  4TWH A;  3DTO A;  3N9M A;  4YXW H;  3VTP C;  2KLQ A;  3H1L E;  5FP3 A;  4GT1 A;  1G73 A;  1BR1 A;  3P4R A;  4CXX A;  5L3F B;  2Z4E A;  1VQ6 P;  1P84 H;  3D71 A;  3CML A;  3TK1 A;  1U7M A;  3AED C;  3L75 J;  4DCK A;  3AB3 B;  1IJ5 A;  4L0R A;  3FZK B;  3RQU A;  2C0W A;  4MN4 C;  3B5N A;  3HD7 D;  5CGM A;  2CMR A;  1VQ7 P;  3V4W A;  4UVB B;  1J1D C;  2GUV A;  4F6R C;  2VVN A;  3UU4 A;  2M6I A;  4IFD K;  2WQY A;  3I0Q A;  3H1L D;  2FFD A;  1BDD A;  2NPS C;  3H32 B;  1JOC A;  2XAF B;  3PP5 A;  1T6A A;  2N1T C;  2HYN A;  2IZ1 A;  1UGO A;  1IK7 A;  3V5B A;  1M56 D;  3RL0 C;  5CJ4 A;  5FVL A;  3TYY A;  4NUU A;  2QJK B;  3CXH E;  1KFY A;  1RHZ B;  1VF5 D;  1JUN A;  3K8P C;  5LB7 B;  1KC8 Q;  3L74 E;  1S5L E;  1KYO E;  4PJ0 H;  1SA0 E;  2VVS A;  1HR0 T;  3ABV C;  1KK7 A;  3ANW B;  2XNX A;  3F89 A;  3RGU A;  5CBN A;  2NTY A;  3RRW A;  4UB8 H;  5AW4 B;  1RF0 A;  4QHO A;  3Q1M A;  1MV8 A;  4YTP C;  2PBI A;  2Y0D A;  2YNY A;  4HWH A;  3EFG A;  1P84 I;  4EED A;  2IYO A;  2JQH A;  2IFM A;  3NVO A;  3AE5 A;  4U2Z A;  4J2C A;  3L75 D;  4YJ3 E;  2C9L Y;  3N9O A;  5AQF B;  5AFU L;  5BU5 A;  1JY2 P;  2ZAE B;  3CX5 I;  3VRB A;  4DVD A;  3CK6 A;  3RK3 D;  1HWT C;  4AYC A;  2WT7 A;  2H7O A;  4PNI A;  2X9H A;  4TV8 E;  1JY3 N;  3MHV A;  2LT3 A;  3W67 A;  4E7S A;  3LSV A;  1VOM A;  2OYH C;  1M1J C;  2K1A A;  4WY4 C;  1KQS O;  3ZJ2 A;  4OHF A;  2V7I A;  3RYH E;  3CXH D;  4IDQ A;  2BVL A;  5H6Q B;  2Y6X A;  4GOF A;  3C98 B;  3ZSS A;  4O9B A;  1VPC A;  2Y0C A;  3P4S A;  3AE4 A;  4QXH B;  2X9W A;  4JEU B;  3BAS A;  2MTQ A;  3WI3 A;  2P58 A;  2X67 A;  3NRY A;  3K3O A;  2YEV C;  5AW6 B;  4IOI H;  1T72 A;  2E9X B;  2KLV A;  1CI6 B;  1MMN A;  3RKG A;  4BAY B;  3RC8 A;  4YXD C;  1YJW P;  2Q3E A;  3PUY F;  3RGL A;  3PUZ F;  2YDR A;  3BRV B;  2AE9 A;  2OGU A;  2RPA A;  1H8A A;  2QA7 A;  2XZR A;  3VP8 A;  1M7L A;  2K9J B;  4HB1 A;  3RK3 B;  3SFE C;  1DD3 A;  2ITA A;  3N7N A;  1YJ9 P;  3ZYK A;  3UFE A;  5HAX A;  3L4F A;  1N36 T;  2H88 C;  1L0N K;  4I50 E;  4U3F D;  4TT3 H;  2YKO A;  5FYM A;  2A06 E;  5AVW B;  1KV4 A;  4WYV A;  1H7C A;  3RI5 A;  5IUX A;  2YIU C;  3AEG A;  5LXT E;  2FFD C;  3FHN A;  3GF7 A;  4UEM A;  3N2K E;  3B5M A;  1KQL A;  1T2K D;  2VKJ A;  3CX6 B;  2E9X D;  2UXB T;  1OVR A;  2B89 A;  3U1A A;  4HFH A;  1QVF O;  4DT0 A;  1SQB G;  2E76 C;  1WMK A;  2KB7 P;  1SQQ G;  1MIV A;  4GOD A;  3CWB D;  2M3E A;  4YSZ A;  2AXD S;  5DJU B;  3O8Z A;  1MFT A;  2FXM A;  2WPQ A;  3ONJ A;  3PTZ A;  4L76 A;  5CA1 E;  1SQP D;  2QSI A;  4GKG A;  2OYI C;  2FYN B;  1KEY A;  4K0U A;  2ZYA A;  2HLO A;  4LML A;  5APQ A;  4HWF A;  1IFP A;  2JEE A;  3HKD E;  3L71 G;  2PG8 A;  1R8E A;  3AEB A;  1KYO D;  2YO2 A;  4ZHQ E;  2Z5I A;  3O1H A;  3VMX A;  3CPZ A;  3ZEF B;  1NOH A;  3CL3 D;  2WDV A;  4EEB A;  1DIP A;  4CI1 B;  1URQ D;  3VR9 A;  2XAS B;  2XU6 A;  2DI4 A;  2JR8 A;  2O1K A;  5JDL A;  1L4A B;  4U3F J;  2MYS A;  2A45 G;  3UQ4 A;  5AQQ B;  2XQ4 A;  3S4U A;  1LTJ C;  5FNV E;  4AXP A;  1WYC A;  4N3Y B;  2FKW B;  3CIR A;  4UV8 B;  4LF6 T;  1R5L A;  2YIN A;  3H1K E;  4DR1 T;  1PP9 J;  2W6J H;  5ABE A;  3U1C A;  5BMV E;  2YXR B;  5M1B A;  4JBW F;  4IFM A;  1OW8 A;  1WR0 A;  3HUS B;  4NPE A;  1OMI A;  3MGN A;  2CLY C;  3PRJ A;  3L09 A;  4PFO A;  3AEG C;  3ZCI A;  4DUY T;  2XPK A;  4KMC A;  3ZMS B;  3RX6 A;  3KPE A;  5AVY B;  5AQH B;  2BKN A;  2FYU G;  5L8R J;  2V7L A;  4JEH B;  4AKL A;  2JIW A;  3SFE A;  1ZP0 C;  2WMN A;  2LSJ A;  5APW A;  4RO0 A;  1DD4 A;  1BSH A;  5HXS A;  5CCG A;  1I6Z A;  3QB5 A;  5FXX A;  2QIW A;  1WFD A;  3P32 A;  2Y8D A;  2QA4 P;  2WU2 A;  1NU1 G;  4DR7 T;  2DW3 A;  2EHO A;  1LT9 C;  4HKZ H;  1YKE B;  1VQM P;  3PUS A;  1YQ3 C;  4WZX A;  3CWZ B;  4OK0 A;  3BCC J;  5KJ7 C;  4LMJ A;  5DQW A;  3MUD A;  1EZV E;  3OBV E;  4M1P A;  5CHX A;  1OIP A;  3CX7 B;  2HH7 A;  5APS A;  1MUU A;  4DBQ A;  4DJG A;  3RBX A;  3LDQ B;  4IE6 A;  3L75 G;  4Z1M H;  2A45 I;  3B5N C;  3S4R A;  1A02 J;  4QKN A;  1VCT A;  3S1K A;  5AVX B;  4EV6 A;  3RLF F;  4ASW A;  4K35 A;  2W00 A;  4K0K T;  3UQ7 A;  2XSB A;  1OZH A;  3RIF A;  1MMA A;  3M0D C;  4PAG A;  1S94 A;  3OJA A;  3C1L A;  1JB0 J;  4X65 T;  3RK2 D;  2CLY B;  4G63 A;  1SFC A;  2AXT H;  2KWI B;  5HWX A;  3VYI A;  3H1L J;  4O2B E;  1LT9 B;  3CQX C;  5LMN T;  1MMG A;  3E0Z A;  2DWK A;  1Q7Y Q;  2WZI A;  4WW0 A;  3FZM B;  3IHR A;  1Z56 A;  2RKL A;  5FY0 A;  4QH4 A;  2X9Y A;  3P7I A;  4BRY A;  4TWF A;  1W0A A;  2A45 H;  1J1E B;  2RA1 A;  4Z8X A;  2W27 A;  3AE7 A;  2CXD A;  4JI3 T;  3H1L G;  2OLT A;  4BJN A;  1L0N D;  2ZVN B;  3G06 A;  2OAR A;  2QRX A;  2VQF T;  3UU8 A;  2RH0 A;  3CCU P;  3A3Y B;  2K88 A;  1M57 D;  4LFC T;  1M7K A;  2CPB A;  3T97 A;  1UUR A;  1FOS F;  1LTA C;  2Q9Q D;  1AV1 A;  1KZU B;  1YQ3 A;  4C7N B;  2LSK A;  4AQY T;  2CWY A;  1FMW A;  1URQ A;  3IN6 A;  1YTZ I;  3V2N A;  2N9D A;  5LJN A;  3VKG A;  4FJO A;  5KJ7 D;  3BVH A;  1SQB D;  2M6B A;  4JLE A;  3L72 E;  4H13 C;  4H44 B;  3HL6 A;  4AQF C;  5H2F H;  1ZOY C;  2OTL P;  1KMI Z;  2IAK A;  2ACX A;  2MKV A;  4H0L C;  5C3J A;  3VOP A;  3T1H T;  3Q5E A;  1BE3 D;  3HD7 A;  4HE8 A;  4O8S A;  2Q5U A;  1AVO A;  1EZV D;  1GTW A;  1SQP E;  1JCC A;  3N9N A;  5KLV E;  1H88 A;  3OTO T;  1BSN A;  1KTM A;  2BVM A;  1KQG B;  3C51 A;  5EK4 A;  4AUW A;  3AA0 B;  5L4E A;  4PW8 A;  2CXL A;  2N1T B;  2H7V C;  1PGQ A;  2GUS A;  2ZXX A;  1Y47 A;  2ACZ A;  1ZV4 X;  4TNW A;  5LBM A;  1JNR A;  3MD0 A;  2WTY A;  1L0L G;  2XAG B;  1HG5 A;  3FX0 A;  4QX7 B;  5AQP B;  1L4A D;  2LKG A;  5TIS E;  4D6T D;  5IWA T;  2WZ7 A;  1OFC X;  4NXM T;  3PUQ A;  3PUX F;  1J5W A;  5DJT B;  3H1I E;  2K37 A;  2K9Y A;  4UR9 A;  1PGJ A;  3AE3 C;  2JP3 A;  4DV5 T;  3B57 A;  4NPD A;  2BG9 C;  3H1H G;  4W80 A;  3CX5 H;  1AFO A;  3QOF A;  3GA8 A;  1NTK K;  1MIW A;  2E74 C;  3BCC G;  1KB9 E;  3J7Y q;  3AE8 A;  1JNZ A;  1ZEE A;  3AE6 C;  2HPC A;  5C2T A;  4ILC A;  2E43 A;  2HN2 A;  1NAF A;  1AJ3 A;  1Q86 Q;  2E5Y A;  4W7Z A;  4C46 A;  1KIL B;  1SQB K;  1JY2 N;  5AQK B;  3H25 A;  2WS3 A;  2DCF A;  1LP1 B;  4IL9 A;  3WUV A;  3CCM P;  3HE5 B;  2WDQ A;  4CI2 B;  1D1A A;  4FI5 A;  1HJB A;  1XNQ T;  1NVO A;  1YTZ T;  3JCF A;  1SVF A;  3BAT A;  4ZNC A;  1CZQ A;  3AEC C;  1QSD A;  3N2G E;  2RP4 A;  2XND H;  5IHY A;  3C50 A;  4GOE A;  1ZR4 A;  2KNC B;  4LLH A;  3HD7 C;  5LNK A;  1LT1 A;  4KT0 J;  3PU8 A;  4U7I A;  2OTJ P;  2ZT9 D;  5JQG E;  5AQI B;  4I7Z C;  4WBA A;  4AKI A;  3QK6 A;  4X66 T;  1NTZ E;  1GK4 A;  5E0O A;  1PGP A;  3L37 A;  2IZ0 A;  4DV2 T;  2FJE A;  3RL0 D;  1SS1 A;  3ZN1 B;  2QEX P;  2R6G F;  2UUB T;  2NPS A;  5GTI H;  5AQN B;  2WSE J;  2HPC B;  4CI3 B;  3OAK A;  2I6H A;  2WP9 A;  2VAS A;  1S5L X;  2N9B A;  2B87 A;  1E1H B;  3ZMU B;  3VP9 A;  3TNU B;  1H0T A;  1LTJ A;  2NW8 A;  5HWY A;  2VRS A;  2M5A B;  4X62 T;  2YDQ A;  4C7R A;  5FMN A;  2RN0 A;  2B1E A;  3AEC A;  2G3A A;  2XQ6 A;  1LTJ B;  2N9Y B;  1NTZ G;  2IW5 B;  4CXW A;  5JTG A;  1SQX K;  1OW7 A;  1OWA A;  2BG9 A;  1GW4 A;  1HNX T;  3RIU C;  4DR4 T;  3HA4 A;  3CXH I;  1MKM A;  2CRB A;  3M91 A;  5BU8 B;  3FBZ A;  3L73 D;  3L70 J;  2DL1 A;  3EI0 A;  2A06 D;  3NFQ A;  3H3M A;  4EGW A;  2YN6 A;  1MNE A;  3E7K A;  3L74 J;  1SQV E;  3LK3 B;  2O01 J;  3AEF A;  3H1K J;  2BKO A;  3PJA A;  2BCC D;  2Z6E A;  1L0L E;  4ZS3 A;  5KAI H;  3VR8 A;  3P4Q A;  4QX8 B;  5L2L A;  3LG7 A;  1ZHC A;  4UV9 B;  1KNZ A;  4B6X A;  3HD7 B;  1IFN A;  4MHC A;  4WY4 A;  2LEH A;  5J2T E;  3L74 G;  3V2R A;  2G0U A;  4EB6 E;  3X1D A;  3H1I G;  1YKH B;  1USE A;  5HEH A;  4DV3 T;  2WSF J;  4ZMD A;  2XAH B;  1K73 Q;  1RE3 C;  5B66 E;  5F3J A;  4JV5 T;  2WSC J;  4JI4 T;  3WMM 0;  4ZI2 D;  1NU1 E;  2FYN C;  3L72 G;  1UII A;  4RES B;  3MIW A;  5JDF A;  2CBJ A;  3TGU G;  3OKQ A;  3UFG A;  2R44 A;  5GTI E;  1QUU A;  5AQG B;  5FXW A;  3L70 E;  1Y01 A;  3TLW A;  2QM7 A;  3GN5 A;  4GYS A;  1HNZ T;  2B87 B;  2QVA A;  4H63 H;  1QEX A;  4WVZ A;  1I94 T;  3KV9 A;  1XMQ T;  2E74 B;  5DAB A;  3RIA A;  2Q9Q B;  2H43 A;  2JPF A;  4GKK T;  5AQL B;  4JYA T;  1GL2 C;  2W6A A;  3TLV A;  5KLV J;  3CCE P;  3F31 A;  4HKA A;  1FZA A;  1LTB C;  5H2F E;  3PTR B;  4BJM A;  3JAF A;  4UF0 B;  3LBX B;  3CD6 P;  2UUC T;  4U72 A;  1Y9B A;  1W2E A;  4MAL A;  1X0T A;  1Y64 B;  2J1D G;  5CB4 E;  2Q6Q A;  3GF3 A;  1VRB A;  2R3C A;  2D2C B;  3TF5 A;  1KB9 H;  3PH0 A;  3TGU D;  3UUN A;  3HUS A;  1N34 T;  1HVV A;  2XZE A;  2AXC A;  3TDK A;  1CHU A;  4IRE A;  4CN4 A;  2W63 A;  1SUM B;  2WSS H;  4H9N C;  3K5B A;  3ESL A;  3FXD B;  5C8Y E;  2MPK A;  3HKE E;  4PD4 D;  2LLY A;  2XDJ A;  3V5U A;  4PV1 C;  4YSY A;  1S2E A;  3CQG B;  1D1B A;  3AE1 A;  3L3P A;  3PJA J;  1SE7 A;  2ZM6 T;  2X0L B;  1EZV G;  4A98 A;  4DV0 T;  3MZK B;  4MFR A;  4GOU A;  4QXB B;  1T2K C;  2KP8 A;  5AW1 B;  1ZN5 A;  4IFF A;  4QH5 A;  2GA1 A;  2XTL A;  1FZB A;  4HWC A;  3R4Y A;  2OYO A;  3ZT5 A;  2K24 A;  1IO4 A;  1JO5 A;  3P4W A;  1RE4 A;  2PJQ A;  4QH1 A;  3WUU A;  1N73 A;  1ZRT D;  3G9R A;  2LSI A;  3IF8 B;  5B5E E;  3NTN A;  2IFN A;  1HH0 A;  5CCG C;  2MOZ A;  5JH7 E;  3EDV A;  2N1T A;  1VQ4 P;  2D0T A;  3L73 G;  3E1I A;  1OED A;  2LHN A;  4U33 A;  4GIF A;  1QGK B;  2WQY C;  1NHL A;  4I2L C;  1VCS A;  1H89 A;  3PUW F;  2DWG A;  4IDO A;  1NH4 A;  2BEQ D;  2V7Q J;  1K05 A;  1NTM D;  5CCH C;  3N5L A;  5HXH A;  1KD1 Q;  2K48 A;  3WAJ A;  1IAP A;  1LT9 A;  1YYC A;  4IHJ E;  1N73 B;  5ABH A;  3ZLI A;  1FIO A;  1IJD B;  3S9O A;  1SQX J;  4HFC A;  1FZC B;  5TIS H;  2EHO D;  1NTZ K;  3RKO A;  1L0N G;  1VQO P;  2YK0 A;  3Q5X A;  2CPT A;  1RE3 A;  5CA0 E;  1D1C A;  1JMM A;  3M65 A;  2X51 A;  3RYC E;  1GMJ A;  2OV9 A;  2POH A;  3P8M C;  3D6Y A;  2FYZ A;  2I8D A;  3MJX A;  2NR4 A;  2JQK A;  1MFZ A;  1G2C B;  2VQE T;  1EDI A;  3H1J D;  4C90 A;  2QJP C;  4JI8 T;  1W0B A;  4ZKP A;  1JMB A;  2XUE A;  3ZC1 A;  5LP6 E;  5J2U E;  1GK6 A;  4QMA A;  1X79 A;  2ZJS E;  2BS4 A;  2NRG A;  2N2N A;  3SRZ A;  5HYA A;  5HEO A;  2AXT E;  2WSS V;  3LK2 B;  4LF8 T;  4OH8 B;  4JPZ B;  5BR8 T;  1UK5 A;  3UU3 A;  4I43 B;  4K3A A;  3CCR P;  4AQG A;  1CI6 A;  2X66 A;  1W09 A;  5KAF E;  3F5H A;  1SQX E;  1TU3 F;  3G3Z A;  4KHX A;  3TLS A;  2H89 A;  4ADZ A;  4IST A;  2WY2 A;  4DR2 T;  1L0L J;  1IBK T;  1NTM E;  3EAM A;  5JDH A;  2UXD T;  2UU9 T;  1FJK A;  5L3D B;  5HCJ A;  1S9K D;  1MZ9 A;  3GWH A;  4HGA A;  2JJ9 A;  1PIX A;  3C64 A;  4DMW A;  2D2C C;  2IUB A;  1OX3 A;  4TLF A;  1X8Y A;  2R32 A;  3ZMZ B;  5CJ0 A;  1LVK A;  3NWI A;  2ES0 A;  2KZI A;  1PL5 A;  2KZJ A;  3N4X A;  3LK4 2;  4X1K E;  5CCH D;  2IHR 1;  4HFI A;  2IPP A;  2GM4 A;  1IFJ A;  2WT7 B;  4IE5 A;  3AEB C;  3AE5 C;  1OED E;  1WCR A;  3FZH B;  4DV1 T;  4EYU A;  3HI2 A;  4ZKU A;  2HPL A;  2W6B A;  4PK5 A;  3FXD A;  4EAH A;  2QG4 A;  2IC9 A;  3ZPO A;  2OQQ A;  3SWY A;  3QWO C;  1PGO A;  2FYU D;  1NTZ J;  5LMU T;  2V7M A;  4HWD A;  2CHO A;  2KIN B;  5TAO A;  1D0X A;  4DR5 T;  4B3R T;  5LA6 E;  2LOP A;  2KMF A;  1L0V A;  2WM9 A;  2J4G A;  2R5D A;  4GK0 E;  3H1H D;  2BDE A;  1JY2 O;  4ZOL E;  1J2J B;  2WB5 A;  1QL1 A;  4U7Y A;  1FZC A;  2E74 D;  3A0B E;  2A2F X;  4DBR A;  3RK2 C;  3IR9 A;  3AE9 A;  2WSC H;  1BCC G;  3MP7 B;  3JC6 C;  4X1Y E;  4YLH A;  3AAA B;  2W90 A;  1OVU A;  4DOJ A;  1D0Y A;  2V6Y B;  1K8A Q;  2M3B A;  2ZXE B;  1HCI A;  1HS7 A;  1X9B A;  2WSF H;  3R2P A;  1GU5 A;  4DV4 T;  3KQG A;  2AEM A;  2LE8 A;  1JY3 P;  3E1R A;  1OED B;  2WU5 A;  2JKV A;  1T3U A;  3I55 P;  3VMA A;  1L4A C;  1LTI C;  1EZ3 A;  2YMK A;  2YKQ A;  3RC3 A;  2KZ7 B;  2YIU B;  2IIU A;  1HTJ F;  4WBO A;  4GYR A;  2FBW C;  5GON E;  5K5G B;  2QGS A;  3I9W A;  5AW9 B;  2O01 H;  1N32 T;  4LGD E;  3QH9 A;  1RF1 A;  3L72 J;  2LOS A;  1LNQ A;  1SQQ J;  4X64 T;  3KV6 A;  4I55 E;  1DX7 A;  1Z8U A;  3PUR A;  1HNW T;  4BWN A;  3ZT6 A;  4TNV A;  5APY A;  1KQF B;  1UIX A;  3LIE A;  1JCD A;  1QVG O;  2OYI B;  2W2U A;  3Q5D A;  4Z91 A;  4H13 D;  4ZEY A;  5JDG A;  2XM1 A;  1M1J A;  3CWB G;  1SQQ K;  2A3D A;  2KT9 A;  1L2P A;  5LJM A;  4YTP A;  1N33 T;  5LHG B;  1G8X A;  3SFD A;  3MTU E;  3HTK A;  1NU1 J;  2P9B A;  1U5P A;  1KF6 A;  3UU6 A;  3Q5R A;  1E2A A;  4OYK A;  1WRG A;  1GU4 A;  3GW6 A;  1T98 A;  2YU1 A;  3KDS E;  4LFA T;  3AXJ A;  4COF A;  2O01 N;  4L75 A;  2P1J A;  3EAB A;  4P09 A;  3CCL P;  5ABF A;  2LKM A;  1HUC A;  2Y9Z A;  1CSB A;  3GHG C;  3AEE C;  3FZF B;  1W5C E;  1LGH B;  2BBJ A;  2Q9I A;  1BR0 A;  4AKH A;  1YIJ P;  2BCC E;  3CKD A;  2NZ2 A;  5GTH E;  3B5N B;  1J1J A;  1T7S A;  3SWF A;  2ODU A;  4YTM A;  1SQV D;  2PFV A;  3HE5 A;  1FJG T;  5AQV B;  1QX8 A;  2JQ9 A;  3L36 A;  3MA9 A;  3L73 E;  4PJM A;  4O4I E;  3A8Y C;  1B7T A;  4XE5 B;  2UWJ E;  1EQ7 A;  4EOZ B;  2XAJ B;  3RYF E;  1H0T B;  3PU3 A;  4ANJ A;  3Q5W A;  5KMG P;  2JMK A;  4H63 V;  3U3I A;  3II6 A;  1RY3 A;  1PPJ D;  2YO3 A;  1UX5 A;  4HFV A;  4KJM A;  3N2O A;  2XHE B;  4NUV A;  3LID A;  4JI5 T;  2PAJ A;  3CQC B;  2QM8 A;  3UT5 E;  2WBL A;  2VWA A;  4TX5 A;  2NW7 A;  4TWD A;  4JUY A;  2MBG A;  3D6Z A;  2XSA A;  1NWM X;  3P7K A;  3M0D A;  1NTK G;  2WPV B;  3ANW A;  3TLU A;  5APV A;  5AQM B;  1U4Q A;  3ONX A;  1KYO I;  3KIN B;  2KNC A;  2J59 M;  4I1L A;  4JYC A;  1LJ2 A;  4BXL A;  5ABF B;  3A0B H;  3UUX B;  3Q2M A;  4B86 A;  1IK9 A;  3CLQ A;  2C5I T;  4PK4 A;  4KHP T;  5KAF H;  3OW2 O;  1HFA A;  3UUM A;  2UXX B;  3A0H E;  3WU2 E;  2A9U A;  3VMY A;  1BGY D;  1KIL D;  1QLE D;  5L3G B;  4WWI A;  4GK5 E;  2KOG A;  1SQV K;  3H6P A;  1YQ4 A;  2D0U A;  2CA5 A;  2JO1 A;  3O1J A;  4DUZ T;  3O6Q B;  4WNK A;  1LRZ A;  4HTE A;  3IAO A;  4UB8 E;  3WUT A;  1BCC J;  5AQO B;  3GHG B;  4X5T A;  4EYY R;  2XQ7 A;  2M67 A;  1E7P A;  4C7N A;  4ISS A;  2KSE A;  5CFB A;  4P0A A;  1VF5 C;  4H9O C;  3IA3 A;  2K5B B;  3K3N A;  3M9B A;  3O9X A;  3AA1 B;  5ABG A;  2C5K T;  4I6M C;  4IL6 X;  1SQV J;  1S72 P;  2L8K A;  1JNM A;  1FDI A;  1S5L H;  2YMY A;  2WZH A;  3EVY A;  4U7J A;  2XQ9 A;  3I1A A;  4EI2 A;  3W68 A;  1BE3 G;  4U3C A;  4KUM B;  3L71 D;  3AEA A;  3O4X E;  3GHG A;  2CE7 A;  1FZF A;  4ZI3 C;  4P0B A;  5KLI C;  3CCV P;  2OTK E;  3O6Q A;  2KLU A;  3CCS P;  3HE4 A;  1VL2 A;  2XQ5 A;  2YXQ B;  1IBM T;  1LWU C;  4D6T E;  4ILU A;  3PLN A;  1HG2 A;  2X9X A;  1D7M A;  2NTX A;  5LG4 A;  5KLI B;  3L8R A;  3AEA C;  1SQP K;  3CCJ P;  3JC6 D;  4OGQ B;  3E08 A;  1U7J A;  3KBT A;  3B8E B;  5CCH A;  1ZKE A;  4ERR A;  1XZY A;  1SQX G;  2PTF A;  4X20 E;  2E5T A;  2FXP A;  3RBZ A;  5EK3 A;  2OA5 A;  2KSR A;  2HPJ A;  2XQ8 A;  2BG9 E;  4GKJ T;  2L91 A;  2FFD B;  3H1J E;  4L74 A;  3OJA B;  2UXN B;  2VL0 A;  4NPP A;  5AVT B;  1NEK A;  4XBF B;  3RRC A;  4N78 E;  4MBQ A;  4U3F G;  1BE3 E;  4UEL A;  2BZB A;  2CXF A;  1SQP G;  4H9R C;  2O1J A;  5F5W A;  3UU5 A;  2AEF A;  4IE7 A;  1NGM B;  3OYX A;  4KHZ F;  4XA4 A;  3H1H E;  3RF1 A;  4Y28 J;  3KBU A;  5JDQ A;  5FXZ A;  5LCY A;  1EDL A;  2WPR A;  4H0L B;  3CX5 D;  4UVA B;  1SQB E;  1SQQ D;  5JR9 A;  1IFM A;  2BAS A;  4L5G A;  5C39 A;  1HBW A;  1PV3 A;  1YXR A;  2FJB A;  5FL1 A;  4ILB A;  4N6J A;  1NWQ A;  1AVY A;  3I5C A;  4QWN B;  4B3S T;  2FY8 A;  4HFB A;  5APX A;  1P84 D;  3GN5 B;  4EIJ A;  2GK9 A;  2V7Q H;  1XDO A;  5IYZ E;  1LKX A;  2CM0 A;  1BCC D;  2E8I A;  5B66 H;  2J62 A;  2HN1 A;  3M3Z B;  2VL8 A;  2PFX A;  3R6N A;  1XNR T;  2KYV A;  2P7J A;  2PP6 A;  3NXS A;  1BR2 A;  2QE7 H;  2W67 A;  1Q81 Q;  3MKD A;  2JWD A;  3KDP B;  3V6I A;  2WWU A;  2LRK A;  5FXV A;  3JCU E;  4JYB A;  1CUN A;  4TUY E;  4EXT A;  1US7 B;  1FDO A;  1NU1 K;  3NMD A;  3AA6 B;  1ZME C;  5JDN A;  4O4J E;  1SFC B;  1NTK D;  1YW0 A;  1RF0 C;  3SWH A;  2E5L T;  3H1K G;  1EC5 A;  4IL6 E;  4A7P A;  3HKB E;  5LGU B;  3KHU A;  2XJ7 A;  1LVF A;  1XWM A;  5AW3 B;  1NO4 A;  4LFB T;  1BGY G;  4HYT B;  1M1K Q;  1LTS C;  2V5C A;  3M9H A;  2H3R A;  3U59 A;  5KLV K;  2IBZ E;  3ZMV B;  5AVS B;  3HTK B;  1EXI A;  4Y99 C;  4H9S E;  2FJA A;  3HKC E;  2V7K A;  1LTT C;  3L73 J;  4X1I E;  5BVZ A;  4HEA A;  3TGU E;  4DR6 T;  3FWN A;  2SPC A;  3BK9 A;  1M1J B;  2LXB A;  2QJP B;  1VDF A;  2Q3I A;  2ODV A;  3FZL B;  1VQK P;  2KND A;  4PV1 D;  4R4L A;  1ZXG A;  3PDY A;  1G1J A;  3CPW O;  4YXD A;  1IJ6 A;  3WU2 H;  2ZYD A;  4JF7 A;  3P4P A;  1FJP A;  3MZW B;  1IBL T;  5AQJ B;  4CPG A;  3PHL A;  1NEN A;  1KN7 A;  1SP4 A;  4ZXL A;  2J5U A;  4NPF X;  2C9N Y;  2M8R A;  3OPC A;  1SFC C;  3W15 B;  4A56 A;  4YY3 T;  3I0O A;  3MAC A;  3OVU A;  2I1J A;  1OW6 A;  3Q2Y A;  4HWI B;  2LM9 A;  2F4V T;  4XFJ A;  2QYW A;  2IX7 C;  2YKP A;  5EK2 A;  5KTB A;  5HXE A;  1DH3 A;  4PJN A;  4DR3 T;  1S35 A;  3BRT B;  3CC4 P;  3ITK A;  1N7S D;  2Y9Y A;  4PD4 I;  3AVS A;  1K04 A;  3AE2 A;  4LF5 T;  3ZDM A;  5JR9 C;  2AEJ A;  4ASV A;  4DV6 T;  2HHH T;  1JTH B;  1FU1 A;  2D2C D;  1FZG A;  4M3L A;  4KP3 C;  5LBQ B;  3PUV F;  4LF9 T;  1RQV A;  4DZO A;  5L3C B;  3PUG A;  2FJD A;  4ZZB A;  1FAV A;  2EHO C;  2CBI A;  3BQI A;  5ETW A;  4L9I A;  2CWO A;  4L73 A;  2KWH A;  5J1G A;  1HX8 A;  5AVU B;  1ZR2 A;  2D2S A;  4OFZ A;  3WAK A;  2H8P D;  3Q3D A;  2X0H A;  2Q7C A;  3NKZ A;  1BCC E;  5AW2 B;  1GZL A;  1T8Z A;  1HX1 B;  2LM2 A;  4JI0 T;  1NTM K;  1X9V A;  2XM2 A;  3ABV A;  4TN7 B;  4WBN E;  3CX8 B;  3L70 G;  4IT4 A;  4AQF A;  1L4A A;  1KIL A;  1BGY E;  1KIL E;  2HOD A;  3DP7 A;  2ZFC A;  1ZV8 A;  2DHR A;  1XTG B;  3L39 A;  3KZI H;  1SQX D;  1DEB A;  1PFI A;  4Z90 A;  3KZI E;  3CX5 E;  3H37 A;  5LHI B;  4P1N A;  2V5D A;  4UIG A;  4EOT A;  1FC2 C;  1N8R Q;  3RQW A;  5A1L A;  4B3M T;  1OVV A;  1NTM J;  3ZYM A;  2WMM A;  1OED C;  2IDO B;  2LKH A;  1XMO T;  1XTC C;  3AE9 C;  1GDT A;  2C0S A;  4Q25 A;  2JRK A;  2WAU A;  2B88 A;  3VKH A;  1RF1 B;  2ZM2 A;  3RHW A;  2DNX A;  5FL0 A;  5AVV B;  2XQ3 A;  3QUJ A;  4IE0 A;  1N7L A;  2V1D B;  3L35 A;  3GLM A;  3LBX A;  1HTL C;  2E75 D;  2K3R A;  3RK2 B;  3GG2 A;  5AQT B;  4IL4 A;  4ILA A;  4PJJ A;  4EIW A;  4KI0 F;  3IF4 A;  1FMV A;  3H1J J;  3AE2 C;  1PPJ E;  2Q9Q A;  4ZI7 E;  1UX4 A;  4ZI3 D;  1FEW A;  2ZT9 B;  4U2Y A;  1BGY J;  2XQA A;  3CWB E;  3EDU A;  4BA9 A;  2VB6 A;  2IBZ I;  3A2A A;  2Y0E A;  3I56 P;  3JAE A;  3T1Y T;  3B4S A;  1KFN A;  1SLQ A;  1WYB A;  1X79 B;  1YI2 P;  3QB5 K;  1FBM A;  1XDP A;  4F8H A;  2H7H A;  3QNU A;  5KKZ C;  4A5X A;  2E76 B;  1Q2N A;  3CXH H;  4GIW A;  1U57 A;  5FKY A;  4AIS A;  3TKL B;  1EXJ A;  3GMI A;  2LSG A;  2BEZ F;  2R5B A;  4R4M A;  3JSV C;  2CCQ A;  3IFM A;  2OYI A;  2E42 A;  4AKG A;  4EDF A;  2FUP A;  4CN6 A;  4G2A A;  4MLK A;  4U31 A;  2X68 A;  3AE3 A;  3MXZ A;  2P67 A;  3T97 B;  1USD A;  5EFW B;  4IDZ A;  4OX9 T;  3V2P A;  2E75 B;  2WWV A;  2R3S A;  4OWF A;  2I0M A;  1BDC A;  2A72 A;  2E9X A;  2XAQ B;  5JRE A;  2YDS A;  2BKP A;  4OGQ D;  1GL2 A;  4PJL A;  2ZM0 A;  3LW5 J;  4V1A v;  2Q9Q C;  3SOL A;  4E7Z A;  4W7Y A;  4KX6 A;  5HCM A;  5JRC A;  2NPS D;  2WVR A;  1YBK A;  1P84 E;  5H6R B;  3CC7 P;  4EZ4 A;  5LOV E;  4HN9 A;  1UUS A;  3CWB J;  3CMA P;  4BRY B;  2JQQ A;  3KXD A;  2XV5 A; 
#chains in the Genus database with same CATH homology
 4GOE A;  1EC5 A;  1LT1 A;  3QWO C;  1JM0 A;  2LR2 A;  2B87 B;  2QVA A;  1FC2 C;  4WYV A;  1OVV A;  1J1J A;  2WMM A;  1EDK A;  2OTK E;  3FXE A;  2B88 A;  3QB5 A;  1OVR A;  2B89 A;  2KIK A;  2LXB A;  4EYY Q;  1SS1 A;  2UWJ E;  1DEE G;  3RGU A;  4GOD A;  5CBN A;  2K3R A;  1ZXG A;  2KI7 B;  4HKZ H;  1H0T B;  1OVU A;  1U7J A;  2I8D A;  5DJU B;  1MFT A;  2B87 A;  3MZW B;  1H0T A;  1EDI A;  2M5A B;  4JBZ A;  4CPG A;  1KEY A;  4KJM A;  2SPZ A;  4NPF X;  1JMB A;  2ZAE B;  1Y47 A;  3RIU C;  1X0T A;  3S1K A;  4ASW A;  3MHV A;  4K35 A;  5K5G B;  3PH0 A;  3QB5 K;  4K3A A;  1ZW0 A;  1EDL A;  5DJT B;  1Q2N A;  1S3J A;  2LXC B;  4BXL A;  3RIU A;  2KS1 B;  2M5A A;  5C39 A;  4NPD A;  3ZDM A;  1EDJ A;  3PJA A;  4ASV A;  3AXJ B;  4GOF A;  2Q1K A;  2KUB A;  3PJA J;  5EFW B;  2RKL A;  2P58 A;  4WWI A;  1BDC A;  4IOI H;  1U7M A;  4NPE A;  2KZI A;  2KZJ A;  1LP1 B;  4ZMD A;  2HR3 A;  2M0B A;  4HJG H;  4MN4 C;  5CBO A;  2QRX A;  2JWD A;  1NVO A;  1LP1 A;  4ZNC A;  3AXJ A;  4HB1 A;  2R44 A;  3FXD A;  1BDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...