2QVGA

The crystal structure of a two-component response regulator from legionella pneumophila
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
129
structure length
129
Chain Sequence
KVDILYLEDDEVDIQSVERVFHKISSLIKIEIAKSGNQALDMLYGRNKENKIHPKLILLDINIPKMNGIEFLKELRDDSSFTDIEVFVLTAAYTSKDKLAFESLNIRGHLIKPLDYGEAIKLFWILQSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a two-component response regulator from Legionella pneumophila.
rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
molecule tags Transferase
molecule keywords Two component response regulator
total genus 38
structure length 129
sequence length 129
ec nomenclature ec 2.7.3.-:
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qvgA00
5FWXA 3FFWA 4F06A 3A3KA 1T34A 2A9RA 5JS1A 3HV2A 4ZMRA 4P1ZA 3LFTA 4WZZA 1JYEA 3N8IA 3I09A 3M9XA 4MR9B 2WRZA 4MRMB 4W5QA 1DRJA 1RZRD 3CZCA 1A2OA 2P9HA 3DGEC 4YO7A 3HEBA 1KGSA 3GT7A 4KZKA 1QPZA 1HEYA 1L5ZA 5JNSA 1M5UA 5EWJB 4N03A 2WY2D 3Q7TA 4NV3A 3ROTA 4EVRA 4ETMA 1ISSA 4QICA 2NZUG 2QR3A 4MS4A 4TN5A 6CHYA 1Z12A 5E3JA 1FFGA 2E4VA 3EJWA 3RVLA 1DCMA 4YRZA 2HSGA 3LMKA 4ETIA 3F73A 2RGYA 1JFTA 1A04A 5CNIA 5EWLB 3HVRA 3CHYA 3NBMA 3H5IA 3OQNA 2WJAA 4RK6A 3H6GA 1P6QA 3HUTA 4YLEA 4LDAA 3QLUC 1C4WA 5PNTA 1UDRA 1U0SY 4G0PA 4RDCA 3CLKA 3DGFC 3NHMA 1NXTA 2E4WA 2NZVG 4KK4A 4Z0NA 1DZ3A 3FMVA 3OLWA 5TPZA 1ZH4A 2QW1A 5EWJA 4PZ0A 5F64A 4MQFA 3GA5A 3QK7A 4MS4B 1DC8A 4MAAA 3KLNA 5IUKC 2H0AA 3OLXA 1JLKA 2FMKA 3FGZA 4LE0A 1GCGA 1Z26A 1TMYA 4Q6BA 1AB6A 1SXGA 2I6FA 3KYJB 4JP1A 3OMWA 4TMYA 1XHFA 3H75A 1M5TA 4IGAA 2JB9A 3N0WA 2JRLA 5IEJA 4KK3A 4JA2A 4TLMB 4EVQA 1LBHA 3LUGA 5FWXB 3M9WA 1YS6A 2A9PA 2P4UA 4LRQA 5T7BA 3FFXA 4H60A 1E6LA 5GQSA 2GI4A 3BREA 5DTEA 5TQ2B 4WXMA 4RK1A 5BQ3A 2PUCA 3ILHA 2QV0A 4MR7A 4Q6WA 1BAPA 3HM9A 5KQMA 1DP4A 4PYRA 4KFCA 4CBVA 3CZ5A 1JWLA 3H1EA 3GBPA 5TQJA 3MQ4A 1RXEA 5JNRA 1BVHA 3D02A 1ZGZA 4G0OA 1JL3A 1K66A 1NXPA 2IOYA 3RVPA 4IILA 5JNWA 2LP4Y 2CWDA 1I3CA 1QQAA 5TPZD 3JVIA 3UKJA 6ABPA 3O1JC 4EGSA 2N9UA 3QLVA 4RKQA 3RVSA 1PHRA 4YGXB 4EYQA 1QP4A 4O1IA 1USIA 3I45A 1EHCA 1QO0D 3GRCA 5EWMA 3BRSA 2B4AA 2OQRA 4MR7B 1DBQA 2FQYA 5TE9A 4EYGA 3HK2A 5C5CA 4N41A 3CG0A 4RKRA 4RWEA 3CU5A 2MYUA 4IMJB 4ZYLA 5HM6A 2PJUA 1E6MA 2NT4A 4G0MA 4MR8A 4MGEA 3K9CA 1TLFA 3P9YA 1P2FA 2NT3A 3C3MA 3O75A 4EYKA 3DZDA 4RK7A 5KWSA 4Q7EA 3KHTA 4G0YA 4ETNA 3NNNA 1FSPA 4JOQA 2BGGA 1Z18A 3C3WA 1JBEA 1MVOA 4OG2A 3KLOA 4ZJPA 5JNVA 4MS1B 3IP9A 3EDCA 1K68A 1NY5A 2PUFA 3MM4A 2F8TA 2R47A 4H3KB 2YHBA 1CHNA 1DBWA 2J48A 1YS7A 1U2PA 3D8UA 3IP5A 4MR8B 1BA2A 3HDVA 3RVQA 1KMIY 3T6KA 5ED4A 4LX8A 4WUTA 2PL9A 3E3MA 3I42A 1JF8A 3GL9A 3UUGA 1SRRA 1NXSA 1OXKB 2FTKE 1U04A 3IPAA 1EWTA 4XLTA 3A10A 4MS3A 5FWYA 1USKA 4HYEA 3OLZA 5IBQA 3SM9A 2GBPA 3RVOA 1W9HA 4M88A 2GWRA 3CKMA 2PUEA 3URMA 1TVMA 3MYYA 3Q9SA 4XXHA 1Z25A 5EWLA 4Z99A 1NXWA 4RS3A 1ZESA 4N47A 2VUHB 4YR7A 1ABEA 2OENG 1C0EA 4EYOA 3EQ2A 1XWWA 4MRMA 1ZY2A 5EWMB 1PEAA 2X7XA 4PICA 3LUCA 1ISRA 3IDOA 1MB3A 2LIVA 3QX9A 5JS2A 1QKKA 3C97A 3T38A 1E2BA 3LUFA 3G1WA 4IRXA 2FQWA 4MS3B 2MYTA 1KRWA 4D6YA 3BILA 1QMPA 4RY9A 4LE2A 4F3TA 2R4QA 3A0UA 4L4UA 2ZWMA 3HZHA 3KCNA 3TX6A 4S04A 1PNRA 3OO0A 3BBLA 3QLTA 1U2QA 1ZGGA 3IPCA 3RQIA 4WXEA 5JNTA 3VNBA 2RDMA 4RXMA 2WMYA 5CHYA 4LDZA 4HNRA 2IPMA 3KSMA 4MS1A 2IKSA 3HJFA 3RVNA 3N75A 4DADA 2PUBA 2GX6A 2IYNA 1EWKA 4MLCA 3T95A 4QYWA 4PEVA 3Q15C 2B1JA 5CNMA 3MF4A 2FN9A 1RPJA 3L49A 2PLNA 1J56A 4LE1A 5FBKA 4XARA 2IPAB 3KYIB 1Z15A 5B3JC 2VK2A 3RVKA 1NXOA 1MIHA 1ZH2A 3F6CA 1QO0A 1GLGA 4IF4A 1QQBA 3N0RA 5TPWB 2H3HA 3O2JA 4RV5A 4ZPJA 1E6KA 4Z4EA 4EVSA 2LBPA 3HO1A 5CNJA 2PE5A 5D2CA 4B09A 3L6UA 2GKGA 2FXIA 2W42A 1EWVA 4GPAA 5FWYB 3LUHA 4RZSA 4WWHA 1NTRA 3H5OA 1LJLA 1ZN2A 4GNRA 1CYEA 1LBIA 4DQDA 2MYNA 4MQEB 2DRIA 1DG9A 2JVKA 3Q41A 5DCLA 3LUDA 2JVJA 1IIBA 4NQRA 3EAFA 4F11A 2M1ZA 1GUBA 5JNUA 4RY0A 2FMFA 4F12A 1DBPA 2QXYA 1JHZA 2XDYA 2TMYA 2V0NA 1L5YA 5DKFA 5BRJA 4TLLB 3EGCA 2JVIA 2QZJA 3OQOA 3N6VA 3TD9A 3OM1A 2CD7A 4YS6A 5C5EA 4RXTA 5KQGA 3GBVA 3TO5A 4JB2A 5TQ0A 4D6XA 1NATA 2JBAB 3BRQA 1MAVA 3K4HA 5IC5A 1D1PA 4KPYA 1LJUA 2L19A 3EQZA 3HS3A 3T8YA 4N76A 4H3HB 1W25A 4EUKA 1EAYA 2ID7A 2FKAA 3LTEA 3LUAA 4EY3A 3NNSA 2HPHA 2LPMA 3EODA 1GUDA 2IPLA 3GYBA 2FEPA 1QNLA 4UHJA 1QP0A 1VLZA 3A0RB 3CTPA 1PUXA 1Z17A 2L17A 1ZDMA 2ZAYA 4W5TA 2L18A 3H1GA 4G0ZA 3NNDA 3B2NA 1DCKA 1Z2EA 2Q5CA 3SG0A 1H9CA 1AB5A 4HNSA 1D5WA 2WJWA 2CHFA 3MMNA 4NCBA 1YK0A 1B00A 5KQPA 5KC8A 3OO1A 1SD5A 1U8TA 1P6UA 3H5WA 4RSMA 4RXUA 4XFKA 2R25B 3SAJA 4YV7A 4Z4CA 4OLAA 3LKVA 4W5RA 1M2EA 4W5OA 4XASA 1JX6A 1D2AA 5DGCA 3HXMA 2PKXA 4UHKA 4OATA 3CFYA 4N0QA 3VNAA 2JBAA 3CNBA 1APBA 1M2FA 2R48A 2PUAA 4JASB 2VUIB 3S99A 1ZAYA 1OXBB 3KG2A 2JCGA 3TB6A 5KC9A 2M98A 3NHZA 3SQNA 4LZLA 1F51E 3QEMB 3O1IC 1D4ZA 1URPA 4RK4A 2FLKA 2HQBA 2E4UA 3RVJA 3ROFA 3LKBA 4Y9TA 1D1QA 5CNKA 1GCAA 1JDNA 4RY8A 3SNKA 2FMIA 4YWHA 3H1FA 5TQ0B 1DRKA 2LUOA 3O2SB 4DN6A 3QX8A 4O1HA 4FB4A 4W5NA 3DBIA 3MA0A 4KVFA 3CS3A 2QU7A 1Z16A 4QYMA 2FLWA 2HQRA 2NUBA 4KMRA 4D74A 1DCFA 2FW0A 4MQFB 3H5TA 3DLBA 3R0JA 3KTOA 2RJOA 4E7PA 4ML3A 5T3YA 5IUNC 1TJYA 2MSLA 2MSWA 1JYFA 5HQJA 4KREA 2A9QA 2CHEA 4N0PA 2L2QA 3UK0A 1WETA 1ZVVA 2F8SA 2FVYA 2MSKA 3DLHA 3O1HB 3JTEA 5DLEA 2PL1A 3N53A 1KRXA 1DJMA 4OLBA 4Z4HA 2FEWB 3O21A 3OQMA 3I5AA 2AYZA 1CEYA 4OBBA 4KRFA 5BR1A 3OLYA 4RK0A 2JK1A 1Z13A 5HSGA 3F7NA 5TQ2A 1BDHA 1VPWA 1NXXA 5FBHA 4PE5B 2E4XA 1Y1LA 1YMVA 4G0XA 5B3JA 1ABFA 4KQ9A 2HJ9A 1R8JA 2QVGA 1P8AA 1YVUA 9ABPA 5I4CA 2E4YA 3JY6A 2IPNA 1JH9A 1FFWA 2O20A 1EFAA 3F6PA 2FMHA 4L85A 2IDMA 3QELB 3QEMA 4YP9A 3N0XA 2PUGA 4IMIB 1LK0A 7ABPA 4NICA 4S05A 1FFSA 2WWVD 4KQCA 4FE7A 4Z9AA 3LOPA 4OTZA 3JS5A 1S8NA 3QLUA 3TMYA 4MLDA 4JAVC 1YTUA 2KYRA 3QEKA 1JDPA 2FSPA 3FFTA 3LUJA 4Z9BA 1RXIA 3CRNA 3RVRA 1A0OA 1Z2DA 3H5LA 4ZMSA 1F4VA 2WB4A 4O5AA 4G86A 3O74A 4G97A 3Q7SA 3LUKA 3GV0A 5GOTA 5TPWA 3JPYA 2FEKA 4JB0A 4MPTA 3C6QA 4RU1A 1FQWA 4P98A 2VYCA 2PUDA 3M6MD 3RVMA 3KJXA 1NXVA 1VRVA 3HUUA 3C3KA 4HNQA 5ABPA 4MQEA 4QPJC 8ABPA 4NCAA 3G85A 3GWGA 1SXHA 1QP7A 4WT7A 3JVDA 4FE4A 4YCSA 5IUJC 1PNTA 1XHEA 2ID9A 3FDFA 5IULC 4KV7A 4MYRA 4RK5A 1VKRA 5KQLA 3H6HA 5HKOA 1TM2A 1BDIA 3MIZA 4G0QA 2QSJA 3HDGA 3JPWA 4MR9A 3EULA 3KKEA 3SY8A 1SXIA 2A9OA 3H5VA 3KS9A 1YIOA 1USGA 4E7OA 1JFSA 1YMUA 3W9SA 2AYXA 2YHAA 5BRAA 1RNLA 4Z4IA 4XAQA 3ILYA 2FQXA 1JFVA 3OMXA 4Z4GA 3HSYA 3Q7RA 3CG4A 3QELA 1MB0A 2HQOA 3RH0A 3E61A 3IP7A 1ZHHA 2FN8A 1BDJA 2MYPA 2E4ZA 2PAFA 4Z4FA 2QVCA 2PMCA 3HCWA 3QLVC 5IX8A 4F8JA 1PEYA 2RJNA 3IP6A 1RZRA 3O2QB 4KNYA 5IEBA 5KI6A 3OLVA 1DC7A 3OM0A 1YK1A 1ZITA
chains in the Genus database with same CATH superfamily
3RASA 1XTKA 4UBIA 3WK9A 1T34A 3QMWA 3FFAA 4QT4A 4LXTA 4AYXA 5LOVA 2XWBF 3TZHA 2YIDA 3ECAA 3OZIA 3RKSA 2JLRA 4OQPA 1C1XB 2B98A 4UMVA 1PSWA 3SC4A 3LPMA 5IKEA 3HEBA 1F1BA 4WINA 1KMQA 2Q99A 1O95A 2ZRKA 3NETA 4G67A 4J2TA 4OXYA 1WCYA 4L6AA 4TMTA 2P9CA 4WNYA 4QTTB 2NU8B 3EAGA 1ODJA 3KYCA 4DCTA 1Z34A 4CFSA 1CT9A 1UBKS 3T52A 2ZTSA 1W44A 4GMHA 2PYIA 4MEBA 1GTSA 2W37A 4FYYA 2RHBA 1D0SA 4NECA 3E9DA 3ICPA 3KXKA 3UC5A 4C06A 4MA5A 2A35A 3PE6A 3L8YA 3Q2KA 5I8WA 3HKDA 2X4IA 3HKBB 3VHRA 2W83A 4PCUA 4DE5A 4MYUA 3WKBA 3ROKA 4WBNF 3QEOA 2WJAA 3PXCX 3H6GA 4IVRA 1KAEA 4BRSA 2H9IA 1N6PA 3RUHA 3LBAA 2JA1A 3E9MA 1KPHA 2H4ZA 2ZCVA 5ECDA 1CW2B 4L2IA 1E1RD 3WVNA 2ZIZA 1T5DX 2VYVA 3CLKA 2YXBA 1L4KA 2E4WA 3OBIA 5D84A 4F56A 5CA1F 2AZMA 3Q10A 5H3HA 3B52X 5C5IA 5JT1A 3RC7A 2GLUA 5C5DA 1I14A 5F64A 1P7WA 4AS2A 1PVDA 2EBUA 4HC4A 1XNGA 1KZHA 5F7XA 2BZGA 2EU8A 2ZZKA 3LX8A 2OPBA 1U7UA 2CSUA 3LGXA 1BWSA 4IWXA 1Z45A 1M7BA 3RS9A 3RFTA 3C45A 2W9XA 2BSXA 4PLPA 4F72A 3M6AA 3GRAA 4Q6BA 1FOEB 1NIJA 1OI7A 3A3YA 1XHFA 4KGDA 4MULA 5C4GB 3PVZA 4I50A 1H66A 3CIFA 4MCJA 3JSXA 3UB4A 2SKCA 3OIFA 1BW9A 1E79A 1FDOA 1PLLA 4LRSB 3PNBA 1NBMD 3IUQA 4RMGA 1UANA 5FF9A 3NIGB 2I2FA 2P4UA 4QOFA 4G2NA 1SQ6A 3MBKA 4GKVA 2JK0A 2YN2A 2XDAA 4E5NA 3UAYA 3AVUA 4LJ6A 4IKOA 1O94C 5AI9A 3ASVA 1JJFA 5LWHA 2EIXA 3HNPA 4GPBA 3CEJA 5CX1B 1Z35A 3WSWA 1JLSA 2E48A 2JRCA 4NENA 3DXYA 4F4JA 2C9DA 2QHXA 2AJDA 3DS8A 1QRSA 2GK3A 1YZHA 2RK4A 5EZYF 2ONZA 3OM8A 3PEWA 2SCUA 4PBTA 5DU2A 3IBGA 4HWGA 3KSDO 1JWBB 2JFYA 1VMIA 1XQ9A 3A31A 1ZGZA 1DOZA 1N2XA 3LP6A 1JL3A 1G4AE 2C3UA 4B33A 2AOTB 3P97A 3SVLA 3QKSB 4M8KA 1E7YA 1KSGA 3CW2A 4P81A 3VKUA 2NP6A 3QTTA 3Q8LA 2QD5A 4N82A 1T1EA 5IYZF 4CCWA 2G04A 4K9QA 3VV3A 1TEHA 5I9TA 5IAGA 2EW1A 4G26A 1WEKA 4MKRA 2UXBB 5BSMA 2HO4A 3PLRA 1IN6A 1NKTA 3EZ6A 1QDEA 1YULA 3I4LA 3PIIA 5JH7A 3BRSA 5LD2B 2V8BA 4ND7A 5IJAA 3USES 4CNBA 3OWXA 5SYAA 4RW0A 4AKIA 5C5CA 3FZQA 2O2SA 3H2BA 4JUBA 2BRUA 3CG0A 4HGYA 4KN8A 4UE2A 1R74A 4GE3A 4XX0A 2NP7A 3ZZMA 2V5VA 3GGCA 3HLTA 3A06A 3IAAA 4GNKA 1DQZA 4JX8A 4CMAA 3NBAA 1IN1A 4X0EA 4FDTA 4ZIRB 2Y1GA 4LJ8A 3ZHOA 4DA0A 5FIUA 4A8PA 4NMHA 1KFJB 4HL6A 1X6VA 1A72A 3LHDA 1YA6A 5K1ZA 3ZVNA 3WK4A 3IJRA 2GO7A 1VA4A 1T9HA 3Q6MA 1W93A 2AR0A 3TL3A 3TF5A 3F4KA 1V2GA 2ZPUA 3LHKA 1G2OA 2CFSA 4IDPA 3UFXB 5KREA 4FFLA 1CLEA 1R6VA 4PAWA 4LV8B 3C16C 1KEWA 4QYIB 3LY5A 3NTRA 5AFSA 4OG2A 3VX3A 1PQ4A 4TRRA 4JP2A 1GU0A 3E2IA 4PX3A 2WF8A 1OZHA 3E7DA 4QSMA 2QLLA 3EUWA 1KMMA 2WJZB 1T6NA 3MM4A 1WXQA 3AHCA 4JKIA 2YHBA 3IGFA 4KAFA 4RIHA 4ZDJA 4L0MA 4ZHQB 4LSWA 3EY9A 4IHJB 3S29A 4U9UA 2BGMA 5AW9A 4A8JA 1HQKA 1TM3E 2NSJA 2V4MA 3MTQA 3ROQA 3C5HA 3AP3A 3G0CA 3PKJA 4LX8A 4BMPB 3QYJA 1U5CA 1UMDB 1IBRA 3PNSA 2C88A 3OJEA 3R4CA 4HSEA 4JLJA 4RV4A 4DAEA 3P2OA 2QA5A 3O3CA 1E1QD 1GQ2A 2J9FB 1W1WA 2V59A 3AW8A 5D3MB 5EINA 4ER0A 1Y9DA 5IK2D 2ZB3A 1QG6A 1SZDA 1RAAA 5BSEA 1N1MA 1OU0A 1YQTA 3LKDA 1YU6A 4R2LA 3A32A 1XCMA 3B3FA 4X7BA 5GMOA 1HT3A 4W7IA 5G4LA 2OZVA 4MVJG 3RU7A 3HFRA 3QTBA 4O4HA 1V8BA 2F9LA 4RVOA 1VCOA 3P52A 1SK9A 1GGFA 1Q0ZA 1S8AA 3ON5A 1UP7A 2HPZA 1XD8A 2P9QA 4Q7LA 1PWZA 3TXAA 1OW3B 1HRDA 4QECA 2NXWA 2QGFA 3OWOA 3N0TA 5EWMB 3VR2A 1D8AA 3G0DA 4YRGA 1OASA 1MVNA 3D8RA 1IEWA 1W49A 3M3DA 3HJNA 1EP3B 2WWWA 4QXAA 3RU3A 1N2HA 3TYXA 1MPXA 1ZLXA 3UXYA 3KJHA 1J0XO 1VJ1A 2A4KA 3ONDA 3NU1A 1BHO1 4H7JA 4X8HA 5BY2A 5LZ2A 2OMKA 3PI6A 1KARA 1N2SA 2AB0A 3O03A 1Y63A 2OCLA 4LYHA 4ARUA 3E9RA 1U8UA 2Z9CA 1I6LA 2Y9PB 2CLFB 3B1VA 3PITA 2LKCA 4R1NA 4TS9A 4UVEA 4EYEA 1W5BA 3HZHA 2INGX 1VLLA 1GDHA 4F92B 4G4GA 3SZGA 2W2QA 3F74A 1ZGGA 3PXGA 4BEVA 3LQ4A 4HN4B 2EX0A 4BE9A 4DM4A 4K3VA 4XI9A 2X2FA 1GZ7A 4HNRA 5E4TA 4YONB 3RSCA 3K1TA 1J33A 3N70A 1FVFA 4OHKA 4GPTA 2AC4A 2OBYA 2ZT6A 5A05A 2IY7A 4DADA 5DNUA 3CUUA 1CRQA 3Q11A 5IT4A 2XQGA 3AF6A 3O47A 3BULA 3U5ZB 1S9HA 3ETJA 3MF4A 2FN9A 4JENA 1PZMA 5EY5B 4DZZA 4PN7A 2EDAA 2VHQA 1K06A 1JR6A 1OZ0A 2C2XA 2ZI6A 4YT5A 4I4LA 3N7UA 2NX2A 4QDOA 4MJLA 3OKFA 4O6VA 5FFFA 1XYVA 5CFRA 3K0CC 4J1TA 3RUFA 4AULA 1M2VB 1X1TA 3DEHA 4JSYA 1SVWA 5HS6A 3VYUB 1IRIA 3MHTA 1A27A 1ZNQO 4TXHA 3Q8KA 4N5MA 2XBLA 1I6WA 2LBPA 3QPUA 3PHBE 4PYLA 2XNKA 2EG9A 4LWQA 1E1DA 4ZOQI 4TRJA 3UJCA 1HYEA 4LF4B 5I7SA 1W5TA 1ENYA 1B16A 1V8DA 1Z56C 4GPAA 4I2NA 2GILA 1GR0A 1RCUA 1ST3A 3FH0A 3PCXA 2O52A 3L0IB 4L3WA 4Q1DA 4BDTA 2JLQA 5LUBA 1EVLA 2P2GA 1Z75A 1LBIA 5K3EA 2I71A 1X9IA 4M1MA 3ZDEA 1FLDA 1V9CA 3AZPA 4NENB 2VJNA 4J3JA 1EGQA 5TNXA 4NV1A 4XYBA 4EQ6A 1YKGA 1M34B 4LYEA 3OOSA 3S1LA 4ZT7A 1IXYA 3THYB 3IVXA 1EP9A 2Z57A 3MLEA 2J7PA 2BSAA 3UWMA 2V0NA 4N5DA 4N12A 1NRJB 1BKYA 4KQMA 3PUZA 4YS6A 4E88A 2O7SA 3E7FA 4JVMA 1EFVB 3A6LA 3JQ7A 3QNMA 4HEQA 4JB2A 4D6XA 1NATA 1VPVA 3BRQA 1MAVA 4ND1A 4CKWA 3IBCA 1Z36A 2CXSA 1FTSA 2XYVA 2ZJBA 2ZJYA 1CHDA 4N7JA 3RLFA 2CF5A 5FJJA 3KSBC 4HDRA 2IBSA 5EHQA 3RKRA 5HZGA 1UINA 1M1UA 3DJFA 1YDWA 1UEXC 1LPSA 3AU8A 4NFLA 2C2YA 4EFMA 4XGKA 3E7WA 3ZU3A 3EIQA 3K53A 4MW4A 2WKRA 4OVKA 1QNLA 1A98A 5ALNA 3FNQA 5CBPA 2PS9A 2XUHA 4IZHA 4K0KB 1JJ7A 3TFWA 2HK7A 4OJKA 4P4LA 3B89A 3KFLA 1XL1A 3KVVA 4B3CA 3PDIB 4AX8A 5A4DA 1DL5A 1L8OA 4Q16A 4QXRA 5KQPA 4MK4A 3WGKA 4O2BB 3QKWA 4E4YA 4U4AA 1FVHA 5T4FA 5C3UA 5JW6A 1Z4PX 4RTJA 1TCCA 3UFXA 5C7IO 4OLAA 2J8ZA 4R81A 1QK3A 1JX6A 5E1DA 2OGSA 3DWEX 1ZYUA 1IH8A 4OATA 3LP8A 4OSOA 1POWA 3W90A 5FX2A 1GIAA 2CV2A 4N7MA 1L4FA 3EWSA 3A1WA 3DAGA 3KVNA 2OZLB 2OXIA 4REQB 2LV8A 2VUIB 3M2TA 4JASB 4DIUA 1B3RA 2AW5A 1OXBB 2EAUA 4X6UA 5DFAA 3WSTA 3QW4B 2FEOA 1V41E 2VO1A 3UO8B 3A28A 3ICCA 3OOWA 5HIMA 3ZK7A 3U9LA 1YWGO 1QYDA 1ORDA 5EJ9A 4OHUA 4PZCA 3LLCA 5T8KC 5K0BA 5TV2A 3OBBA 3GARA 3HUEA 5CVCA 1K4KA 5K3BA 4NIMA 3WL4A 2VHCA 2F55A 1PD1A 1SZPA 3P0JA 3H8WA 2OO5A 1L4NA 4OMDA 5AXAA 4F9TA 5HS4A 2N75A 3ABSB 2XLCA 4DDHA 5FUQA 3ITEA 2GEUA 2G09A 1NP6A 4FB4A 3ESXA 5AOVA 3TZBA 5HUJA 4J43A 4X60A 4ZQHA 1Z16A 5DTRA 2W43A 4Z1MD 2NUBA 1MO6A 4D74A 4MQFB 1Q0LA 1JJAA 4DV5B 1M3SA 1ZWKA 4GMFA 3FYDA 3KTOA 1Y9EA 2W7TA 3FCXA 4P7KA 5IJWA 1CUIA 2HXGA 2W4QA 4K46A 4OFXA 4JUIA 2V6MA 3EXIA 1VIAA 4Q7QA 3KETA 1YE3A 2GRAA 1RE1A 3C3CA 4RYLA 1DIOB 1FBNA 3FPEA 1M7GA 1RQLA 3JALB 5ISMA 2BW0A 3DLHA 3JQ6A 3F7MA 3I28A 4YHBA 3ZPXA 1A88A 3NEYA 4GMGA 4US1R 1DKNA 3WLOA 4RM3A 3DAOA 1FYWA 4LGCA 1E9RA 2WFMA 1JE0A 4F9FA 5JHGB 3OQMA 2WDPA 4L28A 5HDBB 2JH9A 3ZV3A 2VEDA 1CDDA 1ZM7A 1CUXA 4KOEC 3HN6A 3BDIA 3TNLA 1SU4A 4GVPA 1BDHA 3KEGA 4U2GA 2BFCA 1NNLA 5JD5A 2ZVDA 2FOLA 2HXSA 2ODWA 4GQBA 2YWXA 5JXJA 1P29A 4TWRA 3REQB 2UUAB 1PWYE 3L7JA 2DQYA 2WM2A 1EUDA 4UU8A 2O20A 5KSOA 5LMUB 1XHLA 3FLEA 5GV8A 1JIXA 1TT5A 3KQQA 1RHJA 3KPWA 4MUIA 3DULA 2BE9A 4X95A 4IMIB 2YJTD 5J9FA 4LXHA 4EYSA 1AKVA 1QV7A 3H9GA 4EB0A 4KO4S 2W2MA 3REGA 4FEGA 4N8EA 1JGTA 1U3DA 5K4AA 4B85A 4ZAWA 3LC2O 3SF0A 2HMUA 4B82A 2G76A 3WK8A 1J0DA 1DAEA 4K3UA 5DTJA 2YVLA 3EVCA 2DR2A 3LUJA 7YASA 3NT2A 3CRNA 4CPDA 1MGPA 1LPMA 3H5LA 1KE2A 4O4JF 3GYGA 4DQLA 1Q92A 1L4EA 1ZD1A 3PA6A 5SZKB 1RBZA 5EXEA 1RAIA 3MJVA 3MRTA 2R1TB 4J1NA 5D1HA 2RGBA 4J07A 5TPWA 3VR6D 2FJPA 2ADOA 4RULA 2WSSD 1FC0A 3JQAB 4LBYA 4L8VA 2P6PA 3RCBA 4ENTA 2BJVA 1GV0A 3D0RA 5TF0A 4HNQA 4XH9B 5BRNA 4Y1RB 3DSRA 3VU9A 2O06A 1NZJA 2VNAA 3L9XA 2G40A 1Z06A 4I1OA 3GLVA 4H59A 1LJ8A 4MGIR 3WB0A 2I62A 4B9EA 3OPYI 4YCSA 5IUJC 4HH0A 3FWKA 5FO0A 2C1XA 4EQ6B 5I7AA 4KTTE 1YE8A 3KZMA 4C7VA 1WKBA 2Q9UA 2JIPA 2G8LA 1RHMA 4LQLA 2Z9BA 5EMLA 4QXOA 4IXNA 2ZT7A 1PTJA 4P5PA 4DC1A 4E14A 5HKOA 4DR6B 1RKUA 4R2XA 1CUBA 4HGQA 3UJBA 2HZ7A 5JXIA 1JBKA 4WXRA 1JFSA 1TQ6A 4GVXA 2BWJA 3W9SA 1IAVA 2E4AA 2IEBA 3SHOA 3TNYA 1TC1A 3VGJA 4DS3A 3BFJA 4ZCLA 1KDZA 1H22A 4G36A 4QFCA 4NTZA 3B1KA 4PRYA 5DEIA 3N07A 2JL1A 3OPYA 3QELA 2GZRA 3ZGVA 1CZNA 2V3VA 4HUJA 4TN1A 4TSFD 4Z4FA 5I7WA 4OK3A 1QR2A 2N1BA 5AKKA 3ZHVA 1Q12A 2UXDB 4P0TA 1ZW1A 3DKPA 4M6WB 3U7QA 4DILA 1Q0SA 5H83A 2DBVO 4OY3A 3AZQA 4X7MA 4YAWA 4PYMA 2ZSJA 4QWWA 2YNMD 1UDCA 1OJ7A 3QW2A 1HYHA 1QLHA 3CZAA 2QAGB 2E18A 4OAQA 5KZMB 1A5TA 3PC8C 1R27A 1QH8B 4XD7A 1TYCA 3DLTA 4O2AB 2QUBA 4CGYA 3CZCA 4YO7A 2CLSA 2NQ2C 4KO2S 1B2RA 1HE5A 1TVKB 4PHFA 1J49A 3G59A 2RHHA 4BLWA 2IUEA 4Z7JA 1EJ0A 1OKKA 4Q1BA 4B45A 4BO6A 4F2PA 4V1CI 5JNSA 2Q21A 3O8DA 2QT1A 3QSYA 2EFDB 1XZBA 3BMOB 4A6PA 1TU0A 2PU7A 1KMNA 2WAXA 1C3JA 3I6ZA 3S28A 4CQMB 1ESNA 1HMPA 3PHGA 1O6ZA 2Q3EA 4D3YA 1Y6QA 3V2IA 3T5PA 1PLKA 4YDSA 2YBEA 1PLJA 3CHYA 1N2BA 4FQ8A 1N25A 1ZD2P 4QVKA 1ND6A 1C8LA 4KLRA 3VVMA 4YCLA 1KH3A 5DB4A 1KDOA 1A8PA 3FSGA 3VSEA 1L5FA 2E6UX 4JH0A 4C14A 1O87A 5JS8A 2QMOA 5JALA 3EJ6A 1BFUA 2CC2A 1XEWX 3QTLA 3BIFA 3AGQA 2XW6A 4UQLA 1W5AA 4HBGA 2OD2A 3RTEA 2O14A 2O2CA 7GPBA 2J0UA 2VHWA 3DFKA 4YP5A 4IXTA 1IUOA 4YFVA 4LNUA 2VAXA 4MQFA 3TTUA 4DSAA 3CRVA 3WHIA 1DC8A 4MAAA 5DULA 3HCCA 4UOZA 1NM5A 4JKOA 1LRJA 4M1SA 5IXJA 1CUYA 2LCFA 5EFZA 5KJEA 5TT0A 3W9BA 2JF0A 4EI7A 3A2MA 3BJMA 1LRKA 1VG9B 2MSEB 1P5HA 5UKDA 3RIGA 4A26A 1QRUA 4H17A 4MZXA 4TXLA 2I6FA 3H1BA 2FPIB 3OMWA 5EZ5A 1X2BA 1WS6A 3Q0EA 1DKUA 3R8XA 3BWYA 1SXJA 4KHZA 3R7BA 1SUBA 1CP2A 2GCOA 1D5CA 2ZUVA 4KE9A 4PYKA 4DLTA 4DPLA 3RNOA 4E46A 4AJ9A 2QJRA 2A9PA 1SHTX 3BXOA 3N2YA 2A5FA 1N9ZA 5EE0A 4TMWA 1CY7A 1K7XB 4ABYA 1MCZA 3FKJA 4FP9A 1EFDN 4ZO7A 3RBXA 4Y2RA 4L02A 2RHOA 4FBLA 4OQMA 4PG7A 2PZKA 4D8XA 5MF6A 4PYRA 1WHTA 3FPLA 1PJAA 1ZL0A 2XNJA 2VL7A 3QVGB 4BO2A 2JCYA 1PL6A 1P3JA 2OMEA 4EH1A 4ES6A 5AXCA 1XN4A 3ADOA 4TLCA 3ZDRA 3WLMA 3SN6A 4XWYA 1R15A 3FD8A 5BVGB 1EINA 4KCGA 3SJ7A 3DV0A 3X1KA 3OZDA 3QMMA 1OZFA 1P4SA 3EF3A 4MGHA 1QH1A 5B6IA 4XWWA 3HY4A 1YXMA 3S7ZA 1SZCA 1Z82A 1ZJ5A 1Z08A 1U94A 4YBZA 5GONA 1OHHD 4JU9A 4E4TA 3KQPA 3WZLA 5I51A 4HAXA 4TYPA 5KNCA 1X42A 3R6DA 1G55A 2VNHA 4HEHA 2D1SA 3IQIX 4GI2A 2C96A 3ANXA 3V9PA 1HDYA 4DHEA 3B20A 3CNQS 3VTKA 1PS9A 3M81A 2P5UA 5EE3A 3N05A 1QWSA 4LA4A 4LHZA 1ZI6A 1MO2A 3SP1A 5CURA 4D7AA 5AW7A 1E1NA 2HUPA 2XE6A 2ZJ4A 3KLMX 3LLMA 3M70A 3D43A 4HUTA 3K9CA 4HEJA 3R9KA 2RI0A 4YQFA 2JIDA 1L7EA 2QE7A 3LDGA 4Q9KA 5FUVA 5AM2A 2V6JA 4KUEA 1MB9A 1U3FA 3KJEA 4XB2A 3FRJA 3P9RA 1R0LA 3E70C 3ZYCA 4YJ2A 2BDEA 2Y1FA 3K1AA 4PZEA 2ZRHA 3QE2A 4D9JA 3NJ8A 2VXCA 4F4CA 4WEOA 2B4RO 5F1KA 3NX4A 1G63A 2JH8A 2OLEA 3UOAB 3CB2A 1QU3A 4XPZA 1K68A 2R11A 3KSRA 3RS7A 1YCGA 5JSUA 1TB4A 4FHDA 4BQSA 2ZQ5A 3A36A 1GV1A 2ANBA 3B78A 4CEHB 4H3KB 4MH0R 3SJZA 1DLJA 5CXUA 3V4PB 4UTNA 4YJGB 1VSUA 5G4KB 1YR8A 3PLAE 2I6TA 1AHHA 1L8AA 5FORA 1PYDA 3UF0A 1KMIY 5B57C 1ZA1A 1E6EA 2OHIA 2J59A 3PTZA 3QITA 1RHUA 4Q1FA 2ZETA 4QASA 5AVRA 1PQWA 1Y6GA 1A9SA 1FJXA 1GQSA 3ISVA 4J16C 4BKUA 1PGNA 4EX6A 2XGMA 3OJXA 2V8OA 4U6NA 1U04A 4MW9A 3BORA 4N5IX 4O08A 4J0FA 1H2WA 5FWYA 3TRIA 4W1RA 1BN7A 1N6LA 1YOVA 5AD1A 5FBZA 4ECEA 2WSBA 2PWBA 1P5FA 3EZNA 3OZAA 4TYYA 2X3UA 4DQVA 2OBBA 5YASA 3L7NA 1X7YA 4UBLA 4YBRA 4I1PA 4IX1A 1SU6A 4DMLA 1MABA 5AM3A 1DRWA 2O3JA 3B2QA 2XOKA 1EZZA 2YW9A 5IXYA 1CUGA 1IHUA 2BFOA 3GT4A 3U7RA 4CKCA 2ZXFA 3M6FA 2RHLA 2C9ZA 1IZ9A 2Y66A 3O91A 2ZUSA 5BN4B 2BGJA 4S1VA 5FR2A 2HRDA 2IFTA 3OJOA 3IUEA 4EKEA 5IAKA 4QFDA 5KYWA 3KELA 1QCZA 3V32A 1HFWA 3O4JA 2J46A 4CIVA 3HWX1 2FWJA 4FT2A 1ECGA 1GYQA 4Q9AA 2PKEA 3A0UA 3IJPA 3PDWA 821PA 5HZKA 4F3TA 4DY6A 1O9GA 1EFPA 1W6UA 4HD8A 4ZOEA 3CE9A 2GK4A 3RDPA 3KZVA 3Q3VA 5LZ8A 3DLCA 3UW3A 5D51S 3D4OA 1E3EA 3A1CA 2PO5A 2VRNA 4KPFC 1Y4DE 5FI0B 1KXZA 4R2MA 2OP1A 3KSMA 4RACA 1T9GR 2ZANA 4FZ5A 3DOCA 1CNMA 2HLNA 1PSZA 2FWIA 2FQ1A 4F5EA 1J23A 4KDEA 2OKCA 5HJ5A 2FZEA 5AUPB 1I4LD 2C4KA 3EXEB 2VSYA 5G0VA 5M5BA 5TY0A 4MV8A 3PSAA 2XSZA 3IAS1 3EZ7A 1AA9A 4YMSA 3TIXB 1EEXB 4L8FA 5M29A 3I4CA 1Z15A 2FK7A 1HDGO 1I1NA 3PPWA 2VPYA 2R6GA 3LYAA 3NANA 1ZR4A 1M6HA 5DGDA 2ZWOA 4IF4A 3PR3A 4J4HA 1MO4A 3SXUA 1V1MA 1Q7GA 1UIMA 3IP3A 3MC1A 4H7PA 2PE5A 1JQJC 2OC4A 4QNMA 1VL1A 5FO1A 4EI8A 4HMOA 4DMUB 2FXIA 1P61B 1DARA 3DDSA 4NFSA 4FCCA 1NPYA 3U3DA 2XGJA 2ZBDA 3GRYA 1V96A 1OBHA 3BMXA 4Q02A 2HA7A 2NGRA 2QSUA 3MJFA 1A4IA 4YYEA 1LJLA 1ZN2A 2XOXA 3O26A 4B3TB 3VH4A 3KQOA 4JIGA 5A5GA 2PR2A 2Z1NA 4E6EA 2V58A 2PFSA 2Y1DA 5AI4A 1LV8A 1Y81A 3JWJA 2FFAA 4M0CA 2HI0A 4X45A 4D97A 3VZDA 1U3CA 1W88A 5DWVA 2NXJA 4DEVA 2HRBA 1QZUA 4AP6A 1PW7A 3P5SA 3RSSA 1BG6A 1HTTA 1KI4A 1RKQA 3F5QA 2YV2A 1DT5A 2BMAA 4RMNA 2VH5R 3M0EA 1L5YA 1TMGE 3FRHA 3VISA 3W3AA 4AUEA 2Q6IA 1R5BA 3V8NA 5AJVB 3B13B 4FX2A 1WOYA 4TKLA 2I34A 2EKQA 1Y3IA 2P5TB 5ELXA 3BB1A 3C15C 3K0EA 4ZYXA 3QU9A 4MUFA 2I8AA 5BUCA 1QWOA 1VL6A 2OORA 3JAMA 1H2FA 5LXTB 1GYPA 2L19A 1HA3A 2WFZA 3M6VA 2VG8A 5JQGB 3L04A 1JKXA 3K9LA 2WU3A 2ID7A 2FG7C 5DBFA 3LUAA 5ESXA 3SDZA 4OBXA 1LVHA 1TU4A 5K6RA 3RF6A 3ZHYA 3S1SA 2JH3A 2PV0A 1ZSNA 4OB8A 3L0PA 1CG6A 5JAMA 1X70A 3LFUA 4PGAA 3A0RB 5K6AC 1BCSA 1Q0QA 1P7ZA 2VRCD 4AO8A 4CL3A 3JQGB 3DFZA 4BAZA 4AMBA 4EAQA 4UULA 4TMZA 4CIWA 2WSLA 3OPVA 2B1RA 5FA6A 2WJWA 1GFSA 1QHFA 1VYTA 3X1DA 3IX7A 2KE5A 4BFYA 4NCBA 3QU2A 3BD9A 1GNPA 1GZDA 3WNDA 2NZYA 1XRSB 1TM7E 2DT5A 3KO8A 1IBMB 3HCDA 3AVTA 2C5BA 2G1KA 4JWKA 1WXGA 2PT9A 3G0GA 4ARVA 1ML4A 3R1IA 3HXMA 2WIAA 2XT0A 3JWIA 3SOPA 1VJDA 2IITA 1BDBA 3CFYA 421PA 1IQUA 5KU1A 4UUQA 3V8MA 1B8NA 2PUAA 4BMNA 1GEGA 2H7CA 5TIIA 4CV3A 5IFLA 4D3DA 1YFKA 4P3XA 5HJ2A 5G2OA 5T41A 3ABRB 3PC7A 4J49A 1OWLA 2C57A 2G7ZA 2YFHA 3DW3X 1ATIA 3Q3IA 1B6GA 1FNNA 2HBZA 1MUUA 1LS6A 1URPA 1NQXA 2VYND 2O7RA 5GWXA 4B8ZA 1C41A 5BUZA 2YXLA 4FINA 4JJEA 2Q5FA 4QLBA 1IUPA 4BFWA 4F7DA 1PI3A 2WIFA 1VL0A 3QF4A 4KACA 5B3KA 2X0NA 1LTHR 4UAUA 4DT1A 1A50B 1GCAA 4BVJA 3FNEA 2JBWA 1W30A 2Y92A 4RD1A 4CYMA 3TR6A 4MWCA 1Q84A 3P2MA 4Y6LA 1SCAA 1M6NA 1XCJA 2ES4A 2X1HA 4Y2QA 3TJRA 5DGHA 3V42A 3TEJA 4X7RA 2G0TA 1A9RA 2YY5A 3IDFA 4DN6A 4EIWA 5HVNA 3LPLA 2GARA 3DV9A 4ZI5A 2CL6X 2FW0A 2RKOA 3FPKA 2X19A 3FY4A 3LWNA 1FXWA 5BQXA 4YO8A 2II6A 4GZLA 2YMLA 3KQMA 2IP4A 3VJMA 2QB5A 4EITA 1SQSA 1AURA 1M72A 1XF9A 1BFDA 1XU9A 4KQIA 5IK2A 1TUBA 1QE0A 1TIKA 2IH2A 3IIJA 1FVOA 3P5BA 3PQEA 4D8TA 3ZWYA 5B1IA 3NBZC 2CLCX 2V7EA 4UVDA 1ZVVA 4MCHA 4N1AA 4OX9B 1DGQA 1Y80A 3EASA 3E6AA 2ZR9A 2PL1A 1HORA 1XD2A 3UWSA 1CRLA 1DC4A 1X9GA 3O21A 5IARA 3RIXA 2X9NA 1RVDA 3QQPA 5KWEA 1NM5C 3FTEA 1FCJA 1R0XA 4Z49A 1F5NA 2NZJA 5H4HA 3TQSA 2JI6A 1D0VA 2DECA 1RE0A 1T9KA 1W19A 4JB3A 2AOTA 1WQ4A 1I01A 4GOKA 2YUTA 1KI7A 2HJ9A 1EBUA 3AIOA 3RYHA 4F86A 3UVEA 5FOVA 1UBHS 3ZHTA 5LQDA 2IPNA 4KYUA 2FWNA 1FFWA 3HYTA 3EA4A 2ERCA 4JHXA 2AFRA 3QE9Y 1MGOA 1SVLA 5AKYA 2EP7A 4YP9A 3AX6A 1T9DA 1UBNA 4MKIA 1F6BA 1HLFA 2RKWA 1H8ED 3MS2A 1Q50A 2WWVD 3TJMA 1QO9A 4JVOA 4B2IA 2W0SA 4KWEA 2R7KA 3L8CA 3WYEA 3TMYA 3K8YA 1JAXA 5AI8A 1S0UA 1JZQA 2AFIE 2L42A 2DFNA 1GZ5A 2YZ7A 3MTJA 3IBTA 4K6OA 4Z9BA 5JPCA 1BEUB 2DM6A 3LQRA 2ZS7A 3JQ8B 2IK8A 1E1YA 3OX4A 4O5OA 4ZMSA 1DKRA 5MN5A 4LC9A 1KY3A 3VZRA 4W9NA 3M33A 1BCRA 1E6WA 1LSOA 3N8KA 4F4HA 4Z7OB 1N3LA 3UMCA 3L8HA 3U9SA 3GEDA 3P2KA 5EKTA 5C53B 3STHA 4RU1A 1PKEA 4CM9D 5DNCA 3HGQA 3K30A 1MJNA 2FW7A 3NKVA 3K0BA 3KKZA 3KDAA 3TFQA 1CZHA 1C1DB 2ZE5A 1NXVA 3GDWA 4M1WA 4XWTA 3HUUA 2IEYA 4EHFA 1R88A 3GJYA 5HMLA 1I2BA 2PA3A 4FLFA 1CPYA 5H8WA 4WT7A 2XUAA 3PZRA 3QA9A 1JZTA 3GZJA 3ICEA 4GM1A 3EXFA 3IBYA 5LD2C 1DKPA 4L8GA 4Q3CA 2IEDA 2I78A 2W2TA 1E2GA 2SNIE 4MW7A 1E1CA 1JS1X 4CG3A 3H99A 3GNSA 1NQWA 1NRIA 1HQYE 2P9ZA 1NKSA 2X41A 3DE7X 3DMNA 3H5VA 3HZRA 5D3ZA 3W04A 4V0RA 1MOPA 1Q0RA 3ONEA 5E1BA 4EM6A 3ZY4A 4OKNA 3HI4A 1SEPA 1J8VA 3GLHB 3EPLA 1KOJA 3HCNA 5A6VA 4ZI7A 4RJTA 3INNA 5F7OA 1UBRS 2FQXA 3OQIA 2CNOA 5TLSA 5DRTA 1XEWY 4JLPA 1Y7HA 2I6GA 3OZCA 5HPYB 3ZDAA 5ESWA 3FDZB 4F21A 1V8FA 2C77A 1N7JA 3IUBA 4JXKA 1JHRA 2B36A 3FSGD 4IOKA 1FW8A 3DE1X 4P80A 4E2WA 2W6IA 3U0VA 2PZEA 4C6TB 3ZCVA 3KQHA 3GROA 1ZKDA 2O50A 3I9OA 3CKYA 5ICCA 3ZBTA 3K8OE 1NZFA 1YJ5A 5FNVA 2P0YA 2QX9A 3GRKA 1I0LA 3OLVA 3QXSA 4NU8X 4R9UC 1UK8A 2O05A 1X7ZA 5CB4B 2O5CA 1LPBB 1Z74A 4M87A 4YT8A 2P0EA 2HTEA 3I9KA 3ZLVA 4DF3A 4EARA 3EYWA 4E2ZA 5CCEA 2OHJA 2BFDA 2O19A 5JCJD 3N8IA 5BXYA 4MR9B 1K4YA 1I7PA 3LWZA 3ZXSA 1JKJB 4OUDA 3CGGA 2UUOA 3NIFB 3O8OA 5AXBA 5ITZB 3LY9A 1HLDA 4W7SA 2ECFA 5HF5A 2AUMA 1GZ4A 1FB5A 5EWJB 4K6GA 3ROTA 3RS8A 2XR1A 1Z5VA 1XOIA 3B3QA 5LBIA 2IXDA 1VGRA 3HCOA 3LCRA 3ED1A 4LSZA 3WDMA 1Y5MA 1JFTA 3HG7A 4YT2A 3ZXYA 4ZVUA 3HVRA 3TVTA 2W2LA 5KX5F 2OCXA 1GDDA 1RBQA 3ROPA 3FETA 4INZA 3NBMA 3PC3A 4FSHA 4YXWA 3TGPA 4I50B 2AYYA 2CZQA 4M0DA 5C1DA 3U6BA 4FYJA 1RAGA 1U0SY 2EFGA 4WZAA 2WJHA 3UA3A 4AT1A 1KHTA 1RCTE 2YC4C 3KQVA 4OM7A 4UBJA 5JROA 2NVOA 4JT9A 3D4BA 4NI5A 1K6JA 3O84A 3M1AA 4CQMD 2OCIA 4HS4A 2ORWA 3ZX4A 2OBLA 3G9UA 2H54A 4RHCA 1O5OA 3G2QA 3R41A 4UBMA 1N6RA 3UMFA 1CQJB 2CFIA 5A9TA 1T24A 3ABZA 1P77A 1VLMA 1P1FA 1RYMA 2FQQA 5HJEA 4DKJA 3E9EA 2DFDA 3CX7A 3GLUA 3MAGA 4K6KA 4ZK6A 2FOIA 3UMGA 5BWMA 3K71B 3ILSA 4WW0A 3OLXA 3MWEB 1CZRA 1A1VA 2YASA 3T1QA 2A9JA 2I1WA 2PRSA 3TW4A 4AMVA 4X8LA 4MUAA 4L74A 3KYJB 5GADl 2BFEA 4EB6B 2C2GA 3ZE1B 2QP9X 3N0WA 5F2NA 4C0WA 1LLDA 2J4FA 3FCYA 3I3SR 5ILGA 4YJ3F 2CNDA 5J2UA 1GUYA 1S2OA 1YS6A 3DR5A 3JQ9A 3RRFA 3M5PA 1UOEA 1UZNA 2PJDA 4QUJA 1GZ6A 2C61A 3W6UA 5K0ZA 4IV0A 1YDGA 3ICQB 1ZNXA 1R9GA 3UGQA 1DMRA 5BQ3A 2ZZMA 4IGKA 2QV0A 4MB2A 3QY0A 1BAPA 2VLIA 1GTG1 3FR8A 2ECQA 1ZMOA 4JYBA 5CLHA 3S4YA 1X87A 4X84A 4BNXA 4MRPA 2BEVB 5KQMA 2J41A 3LUBA 1PDWA 3RSLA 1ST2A 5TQJA 4HNGA 1BVHA 3CUWA 3U3RA 5KOJB 2F8TA 4P58A 4Y6GB 5BR8B 4RA9A 1NLZA 1SULA 3EG9A 4M36A 1Q6YA 3NEPX 4FFVA 3VDQA 1N32B 2UZIR 3I4FA 3MD0A 1A7AA 2PCLA 4DIOA 4IQ4A 4KWTA 1PHRA 3F5SA 1T15A 3NCTA 3U1VA 4DLLA 3F1KA 4ALJA 4WLUA 2JIZD 2AQKA 2H57A 3OZGA 3OE7A 4JXJA 2ZTHA 4M1EA 4ONEA 4D9KA 2P6RA 4Y7CA 1TK2A 1DWPA 3WDLA 1ZIXA 1EXVA 1NFRA 2FRVA 3RIEA 2W00A 3LIPA 3PDIA 2QK4A 2HPAA 3KZXA 3GCDA 4OA5A 1JZSA 3BAZA 4C43A 5LMNB 3NYIA 1BXRA 2H4YA 2ZDQA 1TADA 4HX5A 1NQTA 4KPUA 5JRDS 2HNKA 4HLQB 4PGMA 5I4KA 3TLGA 2Q3DA 1JDVA 1YV9A 1AQIA 2YZNA 4M9RA 5KWSA 5I7RA 2GVNA 4LMRA 4R8VA 5LB4A 5CDUA 1D3AA 5LLSA 4G9BA 2HHAA 4LJ5A 1KO4A 3ZZ0A 1DSSG 4PAMA 2A1UA 4U6QA 1UODA 1GNTA 5K0EA 3N28A 2QN7A 4R05A 3B53X 5NULA 1UJMA 4BUCA 5DCYA 4YRIA 2XNDD 3U17A 1F2TA 3G6KA 3R5KA 1T2DA 3SX4A 2AN4A 2VWHA 4DCJA 1A9YA 3MT0A 4ZK2A 1IOZA 1R4NA 1FZTA 1XIVA 4ZN6A 4IEFB 1A69A 1DEHA 1FNCA 2QRZA 3JXEA 4BNIA 4MR8B 3HN2A 4NZPA 1WOMA 2LCIA 3W05A 3HJGA 2ZIVB 2ZRLA 4OHPA 2PGXA 3T94A 4JZYA 2RHTA 3LECA 3U4CA 3IRUA 3E1SA 1OYVA 1LA2A 4LMBA 1NXSA 5IN5A 2WQ7A 4BBZA 4EECA 1P6XA 2XVYA 4IJ5A 2ZRIA 4N3AA 1XWFA 2NV6A 2P6UA 2GNOA 4W6ZA 1PYOA 3DQQA 4GZ5A 2HADA 4QJ3A 1PQUA 2XGGA 1L5MA 1OY1A 1GG9A 2WZBA 2PZ8A 3FYCA 2I4IA 3HBFA 1ZJZA 1JAIA 1F1JA 5CGQB 3FOZA 4NH0A 3AUSA 3EXHA 4D80A 1RMTA 1O57A 3MYYA 2K87A 5JBIA 4EKDA 4ZGWA 4YAFA 3TIGA 2WW8A 4UASA 2YCBA 1Z0JA 1TLLA 1IN8A 2FVXA 1LS1A 1QYVA 3F4LA 3P0IA 5FLYA 2GUGA 3FA2A 4ZZIA 5CA1B 2V7TA 5K8UA 1UMCA 1U81A 2VATA 3P96A 3ASZA 4R0NA 5KNCH 5D5HA 4P7FA 5ITZA 4IUBS 1G1MA 1Z4MA 2AN5A 4Q3KA 4X71A 5LR6A 3FLBA 2PEZA 3KJNA 1KVSA 3TXXA 2W2XA 4WZBB 1Z4JA 4D46A 2C2WA 3T15A 2J6BA 2J30A 2XDQB 4EUFA 3F2IA 1UUFA 1DJNA 4AS3A 1MX5A 5I4BA 2C7BA 2GJ8A 3DE6X 1YQEA 1BGXT 2BEJA 3UKDA 2FR0A 1F0NA 2G67A 4AF6A 1CVIA 1H5UA 1NW3A 4RY9A 4ZYUA 1YZNA 1EA7A 3DVAB 2J9FA 4AN0A 4U5QA 4Z7QB 2P7IA 2BVNA 4CODB 1GTJ1 1L5SA 2F1JA 4YK7A 4HT3B 1GTL1 1CNEA 1FBTA 3GGOA 2JLZA 2VDUE 4OFWA 2KPOA 3MERA 1DDIA 4ZI2A 3A4TA 3FE2A 4HV4A 1M8PA 1RQ2A 2UKDA 3T5MA 3O73A 4MSUA 2LD4A 2QX6A 1QAQA 3L8MA 1DTWB 2IYNA 3HABA 4QYWA 2WVAA 3MBIA 5A3VA 2I1VB 3R7FA 3DLPX 1YQWA 3G1UA 4NJOA 4KQ1A 5E2BA 2RGEA 4ZYYA 4GLJA 3O82A 3STUA 2PLNA 3TE7A 3UYKA 3OD1A 3KAPA 1MVLA 1XVTA 5BNTA 5ALEA 1T4CB 4UEJA 3O8QA 3QVJA 3U62A 3COYA 1ZU5A 1IULA 2AVDA 1NVGA 2NPIA 1P0FA 1VG0B 4CTOA 3AHIA 3L82B 3ADDA 1ISJA 1VRCA 3L6OO 4Q5IA 3WDSA 1E61A 2X5XA 2X8BA 3E23A 3R77A 1QM5A 4A1FA 1T3ZA 1C9JA 1GADO 1P44A 4PQRA 3W1VA 1J8QA 4QLOA 5AKXA 2HSEA 1L4BA 3TTTA 4KUHA 3X1YA 2YOFA 4G5RA 1AHIA 2YOGA 1F14A 2XADA 2ZG6A 4LXYA 3JQBA 3T1HB 1L5WA 2FZVA 5ALTA 5G3YA 1V4NA 5SYNA 2JJMA 4DQDA 2JKVA 4JT8A 3W5VA 5KNDA 1UBTS 1W5FA 2P91A 3RHZA 2ZR8A 5DLYA 1W87A 3K31A 4FYMA 3BCRA 1E20A 2BEKA 1Z29A 2IHVA 4A8JC 3E8SA 1VLJA 2C83A 2DFVA 2JVJA 2XPCA 3AH8A 3I6QA 4KL8S 2IU6A 4TMFA 4KQGA 3TOCA 1GXSB 1T8RA 1KTVA 3MXTA 2ZUEA 5MGBA 4MUBA 3E9QA 3V8QA 1TO6A 1DBPA 2B5WA 4J0IA 4H4CA 1JHZA 2Q0HA 3ORFA 5LB2A 3ZDDA 5ILOA 4FGKA 5DKFA 5TC4A 1ZN8A 4NBTA 1ENOA 4L5IA 2X76A 4TWAA 4X1IA 1X8XA 5DBEX 1E2MA 3NTQA 5ARDA 4YFYA 3UAGA 3UYLA 4DEYA 4F4UA 5CFPA 5K09A 3A2KA 2CZGA 2RH8A 1AQ6A 1S02A 3GG9A 4WAUA 4FDMA 1ZBQA 1MA3A 2CNWD 2KSQA 3RR2A 4PBRA 1GUZA 4E07A 4M3NA 3D6NB 2AXEA 4X1YB 3BJIC 2Y93A 1TQ2A 1GUDA 2WAMA 2G70A 3EODA 3HLKA 3IQWA 2VHVA 1W85A 4HPJB 4CMIB 1D4FA 1DDGA 1TGYA 4FZRA 5EIBD 1PJTA 4UM8B 1GJRA 4HZIA 2ZM5A 4B75A 4KR7A 3QWAA 5IABA 1Y1RA 3V8RA 4CG2A 5FBVB 2GNPA 3DEAA 3H3FA 5B4VA 4E3ZA 2FWPA 2Y0DA 3RGWS 3VPBA 4PLYA 4LECA 1YK0A 2YV4A 2Z4SA 4BFSA 1MJGA 3SBOA 4ZIRA 5JAHA 2ZB8A 3OEWA 5EUMA 1WDKA 2QM3A 3KOOA 1DNPA 3BH6A 1ZN7A 4WVLA 4Z4CA 5HX7A 2KHZA 3EUAA 3PQ8A 3VH3A 5SYMA 3DQPA 3RS4A 4QKQA 1C8BA 2FR8C 4B8YA 3MGKA 2PS3A 5F4ZA 1XCLA 2FPLA 2IRWA 2X14A 2X9LA 2B8WA 4COOA 4Z2AA 2KB0A 3B5IA 1GA4A 1N1GA 3HDJA 4NOJA 2J3IA 1QUEA 2ZI7A 2IEZA 1UDAA 3TZQA 2I2AA 3ZE8A 2P4QA 4K40A 2KX7A 2XRFA 3C98A 2M98A 4C89A 3PEVA 4V3BA 5KYYB 1MQ8B 4M7WA 2I7TA 5H02A 3RVJA 3QWIA 2C0QA 3CNLA 2XECA 3GUZA 3K0AB 2IF2A 4JC5A 3WWPA 2NMVA 4QPDA 3WIUA 3GCWA 4MCAA 3TJZA 3WMXA 4B5KA 4PYIA 2GOYA 5KQSA 1JSCA 3HJHA 2EOAA 2C04A 4KXQA 5D3QA 4O0MA 3KAJA 3ETGA 2JNWA 2VT6A 5JCOC 3RAEC 2G1JA 2YICA 2Q6VA 3UJPA 3IIIA 3TLAA 2H9AA 5BWCA 1QG0A 1DXYA 1XRLA 1Z6ZA 1SMKA 3DLBA 2DUJA 4LJYA 5BPFA 4OQFA 3AHDA 4UHBA 2FSFA 5I8ZA 3RJ5A 4BMCA 2IZZA 1HKUA 5WRFA 5HOQA 5JFTA 4LV6A 2BKVA 5IJXA 2WFLA 4KIJA 4CMEA 2OZLA 4BNZA 4JQOA 1OAAA 2QMUA 2FRDA 3EAQA 1X19A 1J90A 2C5EA 3BXPA 1HYQA 4B34A 4C6HA 1EWQA 1PV2A 4ITUA 4RKFA 1XQYA 2C5AA 3KRTA 4PW0A 4MWTA 2XVAA 3H11B 4I1YA 1QG4A 2DPHA 3F3MA 3G5TA 4FOOA 4IKPA 5EAIA 3IODA 4ESVA 2FN7A 2PBFA 1O97C 2JJ2D 2BLLA 4CM9A 1KP3A 3ONFA 2HWXA 4Q7MB 1WPRA 4KRFA 2WB2A 3ZVRA 2P40A 3EDOA 1HNZB 3QSGA 3GDHA 3I2KA 1J1ZA 1B6RA 1PF7E 4H18A 1ONSA 1FRZA 4L0DA 4JI3B 4INJA 1A9XA 2IW3A 2A14A 1O1YA 1Q57A 5B3JA 2DXIA 5F5XA 1MFZA 5EMJA 1P8AA 2EARA 4KXVA 1NJ5A 1PUJA 2R5NA 2VAVA 1TRHA 3ILXA 3GP8A 4UTRA 3CLSC 4I5DA 2X5JO 3EIXA 1MNAA 1YHYA 2IDMA 2JPDA 2NVUA 3A1EA 4UHDA 1AKYA 1WEHA 2N3ZA 4J9VA 4Z8YA 5DXAA 3ESAA 4BN0A 4BNWA 5IM4F 4QQKA 2Q9BA 5IZCA 3ZDCA 3K72B 1ZHFA 4JI4B 4LHXA 1GM5A 1N2CB 4GU5A 4MVJI 4QGFA 4KHPB 2CY0A 1FMJA 1NYTA 1XLVA 5BORA 5KMGA 1E59A 1JR3E 1JQBA 2YWBA 3QXHA 3OIUA 2FZKA 1JDPA 1VRWA 2C7GA 2V4ZA 2VEOA 1NVAA 2Y6UA 1QQ6A 2ZU0C 4MW2A 4HDKB 2P1RA 4A03A 4X54A 2ONJA 1PR1A 4RPIA 2B9EA 5KDDA 4CI9A 1EWRA 4PAQA 5K0GA 1CULC 1Y4AE 3S8EA 3SEAA 2DERA 2AI3A 3FLMA 3CQ9A 3D4LA 1NNEA 2VPQA 2C9YA 1M8GA 1P0CA 4DA9A 1C0IA 1QE3A 3HYLA 2ZAIA 4QRIA 2WE8A 2GFQA 3A4IA 4IH1A 3U3XA 4IS2A 5JFGA 4EVIA 1PVVA 4MQEA 4PO8A 5FOSA 1E1MA 1E5QA 1MAAA 2GHTA 2OORC 1D9XA 3LP5A 3NOQA 4BCDA 1EFRD 5EPUA 4Q12A 4PBSA 4EEXA 1DX9A 3NV9A 2YCLA 2Q4DA 4YJ3B 1JRLA 3HI6A 4LXIA 4EMSA 4B2PA 5IBPA 3L77A 5BMOA 1WO8A 2B61A 1ISHA 2MU1A 3MIZA 5KHOC 1BDIA 1Z2OX 3COZA 2MHCA 3KKEA 4ZAYA 1NBHA 1EVKA 2L82A 2A58A 2HF2A 1O6FA 3HVHA 3U4QA 1EUZA 5KJCA 1LF0A 4DMHA 2QAGA 5BQOA 4D41A 3IP1A 1K27A 2FG5A 1U1IA 3T7JA 3KHKA 1G8FA 2RGAA 3KPJA 4II7A 1Z5WA 2NXEA 4V1CB 2BUAA 4LPSA 4PIMA 3QOXA 3RYFA 4D0GA 3MILA 5B2FA 1N9KA 1SVSA 2QVCA 5DW0A 5HOEA 5FBWB 2ENUA 3DVSX 3KBOA 1GT6A 1PEYA 2RJNA 1GKYA 3D5QA 5KVVA 4PM4A 5IEBA 3FJOA 2ZLBA 3QBTA 5KI6A 3ULKA 4LJRA 4RQBA 3GIDA 4DW8A 1ZRNA 1DWQA 1DEXA 1YE5A 3U7IA 1OFTA 3DKKA 3PEUA 3WLFA 1U9JA 4IXDA 5BRJA 3DZCA 2VHZA 4OI2A 1C9NA 4YX9A 1YB6A 5KYWB 4GOLD 2MWMA 5ES3A 4XJSA 3DGEC 3ZCXA 3B6ZA 4B7XA 2NYUA 4C01A 3LWDA 5CITA 3AY0A 1Z0SA 4JLSA 4LNUB 1G8MA 4IHQA 5CG2A 2OCYC 3WRWA 2F7SA 4RCZA 2BMWA 4NG5A 1ORRA 4J91A 2RGYA 2ROQA 4RX1A 1UWVA 1YUMA 5CNIA 1OR8A 2R62A 1HFJA 5IZCC 1BO6A 3N9IA 4ZANA 4DREA 3W1WA 5F35A 5HBRA 4BY9E 2J3KA 5E6RB 3TWOA 4ERNA 1PL0A 3EQ9A 1NUPA 2F3UA 1UDRA 2Z5GA 4AI6A 3GVIA 2VH1A 1MBZA 1SUCA 3KHUA 2JFNA 1ZOSA 3NHMA 1NXTA 4GKAA 1W8DA 1T4BA 3MMXA 1NP3A 2FF7A 5F21A 4DIDA 1JILA 2QLFA 5FTMA 4ZOLA 3C87A 4AZ3B 1GQRA 1SUFA 1ZSVA 2WBLC 3FGOA 1M5RA 1GGVA 3ENKA 3OVMA 5IKPA 1BKDR 3COJA 4J2HA 3A1VA 4Z8XA 1GZSA 1SEVA 1NR5A 2H65A 4FNAA 4K86A 2OESA 4KR6A 1XO1A 4TRNA 3T3OA 2H1SA 1YJQA 1GN8A 3DBRA 3WYBA 3RSFA 1UFRA 2WI8A 2ZE7A 5ILQA 3O8CA 3QEAZ 3N1UA 1RR6A 1N2IA 3ZWPA 4KAXA 2ZBEA 3W8FA 4H60A 3UHFA 1FQOA 1E0DA 1E6LA 1GQYA 4HAUA 5K0JA 3N2LA 1LFDB 3KQUA 2I7DA 1ZMXA 3IA2A 4GC5A 1ZRMA 1V5IA 1LWNA 3P0EA 2W58A 3BREA 3V7YA 4WVFA 3OZRA 1MC8A 2WICA 4ADSG 1KC1A 3OQ1A 2C7PA 3PC6A 1A9PA 2Y99A 1NTOA 4OX9Y 4OAOA 5JADA 5LBTA 1W52X 1G3MA 2CLMB 2ZRFA 3HNOA 4JIMA 4L9SA 4A8HA 1RXEA 1MH9A 4EO7A 2CCJA 1JJBA 2O5VA 2A84A 2R6AA 4CN9A 5JNWA 1EDDA 4FGLA 4KR2A 2WF5A 1IN7A 4Q93A 4R16A 2WOOA 3K2IA 4A0HA 4CM4B 2OCPA 4FWTA 4ZREA 1N7IA 2IYEA 4EGSA 2GAOA 3WLSA 5HYVA 1MRNA 3B82A 3CUTA 5JAZA 2A88A 1JIVA 2ATXA 4GDFA 2IEAA 4DLZA 1BE6A 2ZBQA 1RI5A 1SXJB 2BBWA 1VMKA 2RHGB 3K6RA 4I9HA 4AC9A 2QTBA 1B8PA 1H2RS 4MX8A 4TVBA 4ZHQF 5GM2A 2BMVA 1S1CA 2QW0X 1H1LA 2A5JA 2XZTA 2JAOA 1LBQA 1YRLA 2NTNA 3Q8WA 3L7MA 4DLNA 1K3UB 1MT0A 2NVBA 3MB8A 4W4TA 3TM4A 3L0ZA 3GFFA 3N2IA 4CM6A 4MQ5A 3I9LA 2G0AA 4ZYZA 1U11A 4C0HA 4LGVA 5C8YB 5C8VA 1SWVA 4WLEA 4RUKA 4GXQA 5ALQA 2RE8A 2OGWA 3T1TA 2P3SA 3ABIA 3GUVA 3OT1B 2DUWA 1GAEO 3ZTWA 2X3YA 4BJHB 1R8XA 3N2GA 3U26A 4MKFA 1FX1A 1UJ4A 2QY9A 3BRCA 4XD2A 3LHFA 3LBFA 4B6PA 3BE8A 1VE7A 4AXBA 3VFDA 4Y1RA 3VU9B 5BVGA 1MVOA 3EVAA 5JNVA 1RLJA 1QS0B 4HNTA 1V5WA 1EFKA 2H1LA 2I6QA 4JJZA 5K3DA 3RTAA 3WOVA 2D5AA 1PN3A 2PRZA 3JAKB 4CCYB 4F2HA 4P83A 1M8FA 1MZVA 2C4MA 4MIEA 4BO8A 4BUJA 2PKQO 3K2BA 5BSUA 2GVZC 1U2PA 2BFPA 4IVQA 1R5NA 2MDTA 5EXXA 1T0BA 4ZO9A 3ZBPA 2ZT8A 3KYDA 3L2OB 4P31A 1PIWA 3R5SA 4BNTA 1TJ3A 3IP5A 4US2R 2XB8A 3OZWA 4HB0A 1QRAA 3PHCA 2C84A 5KTTA 2D2IA 1AMNA 4NULA 2AMVA 1KI9A 1G6Q1 1NN1A 4M1OA 4BV2A 1XFDA 1EM6A 2A59A 2JFZA 3NWBA 4GIBA 4OJQA 4G4SP 1WZCA 5IRCD 2Z95A 4MWBA 4ZCQA 4B0PA 2JIQA 2QUAA 2NPOA 4CKXA 1H4QA 4ZDKA 3C6XA 3A10A 3RAGA 2A5YB 2WKPA 3CXRA 3UH0A 3RVOA 2DEUA 2RGNC 3O7MA 2HBQA 1EESA 2AN1A 4D9CA 1GG5A 3SYTA 3CKMA 1LGYA 2OFWA 2PMBA 3LZ6A 5FFNA 2CKDA 4BJ6A 4YH1A 2JZCA 4N0EA 1TDJA 1WY7A 4RS3A 2GEBA 2ZRBA 4BZZA 3QVKA 1Y37A 3E0XA 4R9RA 4XE5A 4A0RA 4E08A 3GLIE 1L1FA 4TGLA 1PGQA 4TQUS 4ATNA 2VF5X 1Y9AA 3PC2A 4FX5A 4TQAA 5K6AA 3WLTA 2W6ID 2O8NA 5THXA 2OO5C 1UXGA 4LBVA 5CLIA 2RAFA 3GJZA 3RRMA 2AHOA 3E5RA 1YVPA 4L3VA 4XLLA 3ZY6A 1IZ0A 4OKIA 2ODPA 4QGSA 1MB3A 2LIVA 4KBYA 1EFHA 3ZNNA 5KYGA 4Z7NB 3E5HA 3HB0A 2JI4A 3FPBA 3R44A 4JLVA 3VYSB 1JEYB 1G6KA 4O4IB 5JJCA 4TVSA 2A1TS 4OP2A 3CE6A 4DR4B 5K9ZA 2XXAA 1Y9JA 3GNQA 5AH0A 2HU7A 3TX6A 1U2TA 3ZTYA 2HWUA 2Y67A 3O3NB 3TBHA 4J6FA 3FMGA 2GPWA 4GPD1 4JQSA 4TTRA 4MV7A 4WXEA 2IXTA 4X94A 2NU7A 3O90A 1N0UA 1HDCA 3BWVA 4CIXA 4CM1A 1KDRA 5IASA 3H83A 4PLVA 4YRSA 4KO1S 4NATA 3KFXA 1YTLA 2Y0CA 4TLAA 3RVNA 1YRQA 4Z1MA 1NURA 5KKCA 1S01A 1Z5GA 3VMMA 3CUEF 2V9ZA 1CVLA 3INRA 5DM1A 3HP1A 1JLLB 3E8MA 4WBNB 2ZFUA 1II0A 2BR4A 5CFMA 1CYDA 1HO3A 3TTSA 5CBPB 3QXGA 3BGIA 4BGIA 4DGQA 5COAA 1G8YA 5M7EA 5ENDA 5L8VA 1TJNA 3UT0A 3RVKA 1AV7A 4PX2A 1RADA 3EUEA 4HWKA 1AKEA 4LNAA 5HK9A 4NCXA 1YZTA 1SCIA 1IWBB 3GC6A 1C1DA 1E6KA 2D5CA 3FUCA 3HCRA 3IDSA 4MQ4A 2V96A 4M0UA 5DOZA 4IFEA 5E9JA 5IP5A 1XZIA 4F1WA 3K4QA 1NVFA 1OXVA 3THXB 1GEEA 2Z3ZA 1IXZA 1ZJYA 3CN9A 3N2NA 5EESA 3CLHA 2IUUA 5KSYA 1XJWA 3UW1A 5DVZA 2BHRA 2DQSA 5I7EA 2VQDA 3RFVA 3MB5A 2BGLA 1WZIA 2C2BA 4LYGA 5BWOA 4YJKA 4G4SO 2NO0A 2VSXA 5E8JA 2Q29A 2XA9A 4BAGA 4QUGA 4G5QA 2C7OA 2B3DA 2OY0A 4QPZA 5EUQB 4LOIA 4BNLA 2V5UA 3AL3A 4LF6B 4DXDA 1II8A 1HNXB 2YVKA 1VYUA 2FFBA 3CA8A 3O4VA 1SVIA 3K6JA 3GMSA 4JNCA 3MW8A 1Z22A 4DGSA 3S81A 2C82A 1ZP6A 1OWMA 5E7IA 4MA0A 2AXPA 5JNUA 2IP2A 4PLFA 3CW8X 3OPMA 3OHPA 3UUEA 4LYYA 5HRCA 4XQGA 1G66A 3RC2A 3ZVMA 3ZYZA 5KQGA 4WH0A 2R2AA 2JBAB 4L4RA 1XUOA 5LDHA 1Z6PA 3SZLA 3BICA 1ZD5A 4U7WA 3TIFA 4YUAA 3BWEA 4IH9A 1LC0A 1Q1AA 2W2KB 3LQFA 4Q48A 2ZZNA 5DBHX 2DUNA 1PR6A 3QKTA 3LQYA 2DPXA 4KXWA 4M8LA 3EOBI 2V3WA 5EJ8A 1J4AA 4R7TA 3VC7A 2DY0A 5I01A 4GD3Q 5H80A 2VP6A 3UM9A 2OAQ1 1DO8A 1ZGAA 1AN0A 1Y5LA 3B6EA 2BFDB 3BXEA 5E1OA 2EBFX 3JALA 4AICA 3WMFA 4D4HA 5B5SA 3PSHA 4LWZA 1GARA 1JQDA 1PEKE 1Z5OA 4CIAA 1JXOA 3OO1A 2YYSA 5HSGA 3H5WA 2G17A 1UBUS 4RTQA 2MJLA 2CL0X 5FWNA 1PYGA 3OEHA 4W5OA 5LQRA 2QZ9A 4ZT2A 1NW6A 2A5LA 1E9CA 1I7DA 3W1EA 1BX3A 3IMEA 3VNAA 4UFPA 3CNBA 4V2IA 3FZGA 3NI2A 1OD6A 2ZS9A 5T4EA 2UVDA 4CCSA 1RWBA 1YF3A 5J47A 4PQGA 1SIBE 5JQGA 3AQIA 2I6XA 5JXWA 3VSAA 2ACWA 3AOGA 4Q82A 3I9FA 2PWZA 3SC2B 1U7WA 1YFLA 4GYWA 1D4ZA 1XXLA 1GPAA 4EFLA 2AZXA 4BXOA 4I99A 4RF3A 1E0AA 3TL2A 3T61A 4A10A 2XODA 3F6YA 4M86A 5JE8A 4D4KA 1P3DA 4Q4HA 4Y6OA 3R9XB 1D1QA 4GZ6A 4YMWA 3CF4G 3PICA 2GYYA 3ZNOA 5TQVA 3KPUA 3KOMA 2FMIA 1WJGA 1VCMA 3DXZA 1RQNA 1IHYA 5TQ0B 1FY2A 2Y1LA 3L7OA 2ZYGA 1ZAKA 3JQFC 5AJYA 3RHTA 3SQOA 3VHXB 3HB7A 4K9SA 4ZICA 1EIZA 1ZOPA 1UXIA 1RI1A 2R8OA 2HQRA 3IKJA 5HDQA 2A4MA 1RYNA 4LHSA 1E7RA 2VT7A 3BXHA 1CFJA 4I9UA 1HNWB 2X8JB 4K7JA 4JBIA 3A04A 4ZI3A 1P7CA 1RRVA 5ER9A 4YLGA 3RYHB 1KETA 3W7VA 1IBLB 3SLKA 5KNBA 5LL6P 1LPPA 1DAPA 1NMXA 1E18A 3N8GA 1M1YE 3FGNA 2JI8A 4NAUA 3FRIA 4LZAA 4MGYR 1H4VB 5BNFA 2XB6A 2FJUA 2HJGA 5D6OA 2FWAA 1CIPA 2P6MA 3D3EA 3N3AC 2L2QA 2ZPTX 4FJ2A 5E0KB 3RRZA 4WY2A 1NUTA 3DT8A 5KS2A 3UAOA 4R8MA 1YVDA 2D5LA 3KZCA 3LO5A 3NYWA 4RGYA 1WUTA 4XVQA 1YVRA 4F5ZA 2DHDA 3ZDYB 3KB6A 1DJMA 2ORIA 5P21A 1CUVA 2WMNB 2XCIA 4JC8A 2DFLA 3ETLA 4RFVA 4XJXA 3A4MA 1CF4A 4WN3A 4ENUA 4LOKA 3AI2A 4N9QA 1OU4A 3I5UA 1RC0A 4H6WA 4C1BA 4AJ1A 4UQOA 3PCRB 1YMVA 2WF6A 3ADPA 4EOGA 5EJ4A 5FFMA 1VSBA 1E4EA 6YASA 3M1YA 4GWKA 3HY6A 2XDWA 4TL9A 4WADA 1ZVJA 3IPXA 5DHUA 3HY3A 2X0DA 3VOTA 1KMCA 3OU6A 1XP8A 4EF5A 2I54A 1T1SA 4G2TA 3OPYB 3QELB 3FTQA 3QEMA 2NOAA 3DB2A 3WKDA 5A62A 2G1PA 1EG7A 2X4GA 3IHWA 1VBMA 4C0QC 3QENA 1J5PA 1QVRA 1RRMA 3CX4A 3COWA 4F84A 3A58B 7MHTA 4BB5A 1JHMA 1LZKA 3L93A 1NAHA 2IHJA 2ZUFA 2VJLA 4MLDA 3HNRA 1RMYA 1E2LA 1OI3A 1U2EA 2HMSA 1B8UA 4FI3C 1UT5A 1SBNE 3EC2A 4A0QA 2I91A 1XDWA 1I2AA 1XD2B 4W5WA 1C8VB 3UWDA 3VYVA 3RFFA 3H05A 3O74A 5K8CA 3ZNQA 2FI1A 1CJBA 3AY3A 3QMPA 1X14A 4OK6A 1P2GA 5BNIA 3ITNA 4JB0A 1F0YA 1XRMA 3MK31 2ZRAA 1V48A 3C5WP 4HJRA 5AK4A 3SIXA 4AWBA 4XDGA 2K2WA 4DR5B 2BD0A 2N1MA 2ZIUB 1QCCA 3OLQA 3QX7A 3VPDA 1AV6A 3C3KA 4QPJC 8ABPA 4MQBA 2AX4A 2NM0A 3TG8A 1XZCA 3T9CA 1L6RA 3GMDA 1ZD4A 1HURA 4HLDA 2C1EA 4WNIA 3IEUA 2P4HX 1DMSA 3IMFA 1UEIA 1NMSA 2ZWVA 4WNAB 1I94B 1X0VA 1QF9A 4UM7A 1PWXA 1GUFA 1V1JA 2XNHA 4U7TB 5EHZA 2YQ4A 1VFPA 4ND6A 2QUZA 4C2AA 1OILA 3JD1A 2YY7A 4BIMA 2AXQA 4PYJA 1L5GB 1E3MA 2WTMA 1RPAA 4OHBA 2G28A 3C3EA 4IX9A 4MPJA 1HWYA 4RY2A 5TDHA 4IJVA 2Q4OA 2GYUA 5IXSA 1DZIA 1JDTA 1F7VA 3O8OB 5LYJB 2H59A 2IDJA 4OQQA 4ZO4A 2B99A 3EEOA 1PZNA 3VU1A 3RS2A 3VYRB 4LQDA 3KPVA 3N87A 4FMPA 4XRRA 1YJBA 1PJ8A 1OPRA 4QG3A 4D0NA 4ZAVA 3QLVC 3QJGA 1TW3A 1L4LA 4MUMA 3O2QB 3QOWA 4GYYA 1NRXA 4QOJA 4BFCA 4V0NA 2W5UA 3PEEA 1GKLA 1XFAA 1QVAA 3BE4A 3V7WA 1EK6A 3E4DA 4L73A 4C07A 3FFWA 1GTMA 1OX6A 1ESZA 1EZ1A 2R7MA 3FPFA 4OLHA 1J0BA 4ZOBA 3I30X 4C3OB 4F45A 4UEWA 5B2ZA 4ISBA 1OB5A 5F23A 1JYEA 1U2DC 1K08A 4I2VA 2YV1A 2UUPA 2AQ8A 1QG2A 4NE2A 3WI7A 3R4VA 3JQDA 4PFKA 3VTAA 5B7QA 4KMMA 2GM3A 1AHNA 5AKJA 4F2DA 1K2WA 3EPPA 1HF3A 4U7FA 1N78A 1T4GA 1G21E 1BNCA 1WCWA 2BISA 2REXB 5AI5A 2IZOA 4IV8A 5CYFA 4L3OA 1KKLA 1WABA 5CA0F 2E4VA 3FROA 4EUNA 3SLGA 1R00A 3O7WA 3ZUGA 2UYCA 4V0MA 4YACA 2DTXA 2X40A 2C97A 1LW6E 4O4LF 5CA0A 1KH1A 1KI1A 3PUXA 3NC0C 3RHSA 3FI9A 5HXAA 1DTWA 3SFZA 2XJ4A 4FONA 4MPPA 1HI9A 1U2ZA 1MX3A 3PPIA 5GONB 1YCDA 3IXMA 2P1ZA 3BK7A 3W7AA 5C1OA 2XCQA 2E49A 2IOHA 5A06A 4O3MA 3ZJTA 1ATZA 1HDIA 3NTOA 4FOSA 1Q0PA 3B8EA 3D7LA 3GFVA 4HH1A 4LJSA 4U3JA 1XVIA 4K8RB 4M99A 2HLHA 1LLFA 4WOJA 5EXTA 4D3XA 3AW9A 4IVPA 2J9ZB 1Y7TA 1NVKA 1O4WA 3V48A 3T54A 1YZLA 2XYQA 3FCUB 4S12A 3L1VA 2H0AA 3A1TA 1E2IA 3DCYA 4K6CA 3I23A 1O0SA 3KQYA 3HMQA 3WWYA 4IW3B 1PWEA 4F3CA 3HKDB 1HQCA 4E1VA 4NJMA 3NASA 1O8CA 2WT8A 3OUUA 1OLUA 2FDXA 3KJGA 2JRLA 3B1YA 5L7YA 2QL9A 1OOEA 1LBHA 3L18A 2QQ0A 4MUGA 4MP3A 1MXFA 2WUGA 1U9CA 1Y6RA 2JDIA 1P4HA 1VKZA 1LX7A 4MWZA 2AEEA 4N3GA 3ST7A 4IVNA 4RYDA 1Y6JA 7MDHA 1Z73A 3VTFA 2GDJA 4NNPA 4RGBA 3ZKWA 1T4DA 3A25A 4U8HA 1KJJA 4WY8A 5FEMA 4MUNA 2HA6A 1T8UA 1ZMBA 1HNNA 1S2MA 3JCZA 2X0KA 3HYRA 4ZD6A 4EZBA 1E8MA 1A3CA 4ZKDA 1H9AA 2HCJB 4B6GA 4D9MA 1ID8A 1Q2UA 4B71A 2ZWIA 1UT6A 2IIVA 3CLRD 5BT9A 3RTGA 1KSJA 2KJQA 2WWFA 4ZU3A 3SVZA 5KNDH 1ZIPA 3MHPA 2VHXA 1CUAA 3GQBA 3QLVA 2B9VA 4RKQA 4PG4A 1AQYA 4L9RA 2VDLB 4HGRA 5EIBC 1W85B 2ORVA 3NYRA 2G71A 3H9CA 1EAMA 4S2UA 4AZWA 1R18A 3PIRA 2WINI 4YMLA 3TRJA 2HO5A 3L0DA 1W59A 3WGMA 4IDCA 4BTEA 721PA 3HU5A 5DPMA 2H1CA 2MINB 2Z04A 2EJUA 4X24A 3S27A 1Q83A 2PJUA 3ID6C 1R6DA 4LKRA 1DIHA 3I12A 3VR3A 2YXDA 4AMYA 2XZOA 1RKXA 3OF3A 1BN6A 4DCMA 2CK3D 1GGJA 4ER7A 1JMKC 2DZDA 2O8CB 2P2LA 1QGAA 2H85A 4F4FA 3VC3A 3TAUA 5KYXB 4YCNA 2P41A 3DZ8A 5FAXA 2YJ6A 4YLYA 5I4IA 4LX0A 1JE1A 3NNNA 3GAMA 3KYBA 2CHGA 1PHPA 4PV7A 3F6SA 1V8ZA 3GLKA 4X1KA 4ZEWA 2DMRA 4D3SA 4QTXA 1VKHA 2AWOA 2CMFA 5B1DA 2GN1A 3E4CA 1GPH1 2CLHB 1QOQB 4CUJA 1SM4A 2QBYA 1NJ1A 4JS0A 2XV1A 1ZJ4A 3TZ6A 3H5RA 3WS7A 4IYRA 4QDUA 2J87A 1CHNA 1P1BA 1YOBA 2VDNB 3FMOB 3A6PC 1RU3A 5BXQC 2QGNA 1V35A 4MVJM 4BMVA 1K7CA 3RYCA 4XTRA 1I3MA 3HDVA 4OLFA 4KN5A 3T7TA 3BMNB 2WYHA 4WESB 3CIOA 1JHXA 4EB8A 4NZOA 3LZCA 3ZH2A 4PNHA 3I5MA 3A26A 3I42A 2XITA 2XA1A 4IUYA 4UFNA 4DYHA 3L5OA 3N2ZB 1QIIA 1T5HX 2VHJA 1YR2A 3QEJA 1P9OA 4OLJA 3UCXA 1H3NA 1REQA 1LC3A 3PQ2A 1JKMA 4CQLA 5IT5A 1M1XB 1R1DA 3D3QA 4HWRA 3SSMA 4NPHA 1L7RA 2UYGA 4BQPA 3AI3A 1E6CA 2AW3A 1DAMA 2QN9A 4UUBA 1RIIA 3T4PA 1GA6A 2OFFA 1WSDA 4YRCA 3URMA 5LIPA 4RADA 1NSTA 4ZHQA 1ZESA 2V4UA 4KMSA 1RC1A 4UD2A 1HLGA 3QOFA 5HIJA 4R8RA 1T4MA 3EQ2A 1DKMA 1PT7A 1QE5A 1XWWA 3EXG2 4Q9NA 1KVRA 2YIJA 4HLCA 4TM7A 3PJFA 1E4VA 2EHDA 3T5TA 3LQKA 2PFGA 1RXVA 1PTKA 1ISRA 2BM1A 3OCCA 1AG9A 1MNQA 3DVQX 3O9VA 3QNWA 4JI5B 1W88B 1KYXA 5BWBA 5L95A 5LOVB 2VKQA 2WAOA 2AIRA 1DKQA 2VFAA 4DWJA 2YYAA 1EGVB 2XMDA 1WE2A 3JW8A 2PSHA 3STYA 1WAMA 2C2HA 3I83A 4LE2A 4DQUA 3U7HB 5A5VA 5JVDB 3JVVA 5IPFA 4MIOA 2WIJA 3USZA 4ESEA 1D9ZA 2JEOA 3EH2A 5AO9A 5KOHB 3QG1A 2WC1A 4RELA 5GJCA 1RKBA 3SEQA 1SIOA 3HGTA 4XYLA 3DTTA 4MTLA 1S2GA 3VNBA 4BB0A 2G63A 3KR1A 4QU8A 5CHYA 3U4HA 2J3LA 2O3QA 3CYFA 3KXDA 1ECCA 1NC1A 1Y8QB 4JVNA 4MS1A 2WMDA 5AM1A 1WDWB 1BQEA 2XT9A 3CBQA 5AJWA 1L5VA 4D4GA 2YIVX 4MICA 5FUMA 3WGIA 4EW1A 2D8MA 4EO9A 5JDCA 3Q12A 1ZRHA 1JHOA 3OKPA 3RTCA 4DANA 3DYIA 5H4GA 1NA5A 1U0OC 4WZBA 3TGWA 1XZGA 2JHCA 1QO0A 2J0VA 2UVPB 2TMDA 4YREA 4C78A 5IHXA 1C3OA 1P7YA