2QWQB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the amppnp hydrolyzed form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
total genus 27
structure length 92
sequence length 92
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwqB00
1FPOA 1BQ0A 2DN9A 3BVOA 2QWQB 2Y4UA 2GUZA 2L6LA 1BQZA 3APQA 1XBLA 2N05A 2QWRB 2QWNB 4RWUA 2EJ7A 1FAFA 3UO3A 2KQXA 1GH6A 3APOA 1HDJA 2PF4E 3UO2A 2CTPA 2CUGA 4J7ZA 2OCHA 2GUZB 3UCSC 2YUAA 1IURA 2LO1A 3AG7A 2Y4TA 2LGWA 2CTRA 2M6YA 2N04A 2QWPB 4IT5A 2CTQA 2YS8A 2CTWA 1WJZA 2QSAA 1NZ6A 2DMXA 2QWOB 4J80A 1N4CA
chains in the Genus database with same CATH superfamily
4DR1O 2VRZA 4JYAB 4NXNO 4QGPA 3FYIB 2YDEA 4NXNB 1T5EA 5IY5B 3SJBC 3RW0A 3ZHSA 4H0LB 1I5XA 3ML0A 1TGOA 3G67A 2Q9LA 3BEHA 2P6JA 2LGQA 1SQGA 1PP9H 4W4KA 4PA7A 5FNVB 1SERA 1JX9A 1FXKA 2IW5A 5JJEB 2LQTA 4AILC 3CS5A 4ZHQA 5KA6A 1Y76B 4X1YB 1EN6A 3JALB 1WB8A 1R1BA 2JDIG 2P22C 3B40A 1W0KG 3JD0A 4JI6B 4DRXB 3F5TA 1WA8A 4IL6Z 1XOUA 4B7EA 4MT8A 2Y0IA 1IBMO 4I55A 2QR4A 3QVNA 3J81N 4N21A 3OE7G 1W59A 4LFCB 1LR1A 1CPYA 1NQTA 3C3TA 1DK1A 1M56C 4DV1O 4DV1B 2HKOA 4FIPC 1S5HC 2WA3A 1Q43A 4H44B 1PM9A 3RWRD 2ETNA 2F23A 4NYKA 1AP6A 2OCHA 1ZL8A 2Y69B 3HKEB 3HKBA 2XAQA 1R6TA 4IGGA 1WLEA 2KG7B 1NH2B 1GN6A 3T1CA 4FLTA 1PL4A 4R7CA 3LDCA 2Z3YA 2AZ0A 5KUKA 4YY3B 3B4SA 3I5DA 1F23A 3BCCH 1Y66A 3ICXA 1FFTB 1R3JC 2DE0X 4DUZB 5LP6B 5L3DA 2ZCEA 2FB5A 4UV9A 4OX9O 5KHGA 1E1RG 2LO1A 3JARB 3DXRA 4X1KA 4X62B 1PV0A 3JSLA 5IY5C 2AHYA 3K5LA 5F2VO 2ZINA 2P5OA 4FLVA 4FLUA 3K9SA 5H5NA 2QKAA 3N2GB 4TOIA 2Q68A 4K8XA 4UFZA 2XHBA 1Q82W 1AROP 1GM8A 4LF6O 1HP8A 1XREA 4O4JA 3T1YB 2WA4A 2JS3A 4UB6Z 3VQXA 3ZHRA 3KCXA 1U96A 2Q7EA 3D36C 1R73A 3P32A 4O4HA 4X66O 1XL6A 4JYYA 1MSDA 5EBMC 1Y74A 2GSMB 4B3MO 2KB1A 5J2UA 3ZHQA 3ETDA 1HNXO 3STZC 3UT5A 2QWPB 2IU3A 4IT5A 2VS0A 1RPRA 1TUBA 5CA1A 3L75H 3ZMZA 2IJKA 4LFAO 3HKDB 2P4KA 1B3QA 1JOYA 4WFFA 3APQA 5KHKA 1ZX3A 1SQBH 1G4YB 4O4LB 3SPCA 4DR5O 4MW8A 2AZ2A 2YI9A 4FLYA 3JAWB 2GHYA 1XMOO 5IE9A 3M7MX 1XMOB 2HR3A 2ITDC 4JV5O 2ODMA 1ROPA 1HW7A 3OM3B 4R8CA 1SQQH 1JA8A 1HNZB 2ZR3A 3CJHA 1XMQB 1F4NA 1D5NA 2ZXWB 1MSWD 1QCEA 1K92A 3A0HZ 4MTFA 4N23A 3EVKA 5LP6C 1L8DA 2DOSA 3VOUA 2UXDO 1LUWA 3F7VC 3D3QA 4UXNA 1DLBA 4X65B 3KG2A 5ITZB 4K0KO 4DYLA 2CDYA 2Q0AA 5GTHZ 2A79B 3ABUA 4AQYO 1CP9A 4AQYB 4GKJB 1VF6C 5IYZA 3ASOC 4NTWA 3ZIAG 1S77D 1HR0B 1GTOA 1NKDA 1O9HA 3MD0A 5JVDA 2QJ1A 3K0DA 2UUCB 2YICA 1EBOA 1MABG 3DC6A 2A7WA 1H2GA 1AJPA 2UUAO 4QE7A 3IC7A 5KHJA 1VQMV 1HNWB 4IYIA 4EFBA 4JI2O 4JI2B 2WPDG 4DR4O 2W0FC 5LBQA 2DYRB 2ITCC 2WWWA 5LXTB 1VQPV 2VWJA 1BCCH 3BVOA 3CMAV 2WSSG 1GN4A 1R6KA 3UKMA 1YF2A 5FL7G 4FM1A 2UU9O 2VWKA 4IHJB 4DV6O 1FXKC 4WF9V 2ZNJA 3OT7A 2WLIA 3OTOO 3W7XA 2HLDG 1I08A 1U97A 5L3FA 3U11A 4Z1VA 1AILA 3CE2A 1VEWA 1IXMA 4ZI7A 4D7TA 2EIJC 4JYCA 1Q6IA 2UXCO 4DR3O 2UXCB 3JD1A 3CCEV 2LFSA 2F66C 3D3IA 3K9AA 4KXRA 5L3GA 2HFEC 3RYIB 4MVQA 2PY5A 1N33B 5KUMA 4B3TO 1QLEB 4B3TB 4X64B 3RYCA 2ZIOA 4TQFA 1SETA 1H2KA 2A06H 3A2FA 4G27B 1MA1A 1THZA 1OCZB 2AXTZ 1CEZA 1SZTA 1J5EB 2DW4A 4LFBB 1IDSA 2DWEC 3IAYA 1XL4A 3ZRSA 1K73W 4J7KA 3G71V 3BABA 4I50B 3FAVB 1YZBA 1N36O 1G8MA 1NTZH 2PUSA 1N36B 2QEXV 4FZ0A 3JD4A 2Q8VA 3M8AA 4FVMA 3MHHC 1FJGB 4PDLA 3JASA 4TV8B 3FD9A 5K1XA 4UV8A 5LOVB 4I9WA 1FFXB 3G4SV 5KAIZ 2QTSA 5JH7A 3ZCCA 1N8RW 3NXSA 5IT9N 1N4CA 1NTMH 2DYRC 4QJFB 2YI8A 2BSKB 1JPXA 2XUMA 1NR7A 2M7WA 2UUBO 1I0HA 1L0LH 2VQFB 5JQGB 2EIKB 3P3NA 5CBFA 1UFIA 4JTDB 4WFGA 1XDCA 1OCCB 3VQWA 1KB9F 2GTSA 4B3SO 2VQEO 4LNUB 4B3SB 1TAEA 2VQEB 4BWAA 1KP2A 3SDLA 5IWAO 2CTPA 4TWKA 4DV5O 3UQ8A 4X20A 3OUFA 2Q4PA 2CGOA 1VQOV 1Q6HA 2L35A 2QSAA 4BIUA 2QKSA 1Q81W 1AI4A 3QNEA 1YHQV 1US6A 3OR7C 1P7BA 2YIDA 4YIPA 1KP3A 3AG4B 1QLEC 1ZTEA 4XDKA 3F5WC 3CXCU 2EINC 4DV7O 1VARA 4ZBMA 4O4IA 2ZDIC 2CTQA 1H2NA 3QO8A 4L87A 4F6RA 3DSQA 1YTFD 4DUYO 4ABMA 2X6BA 1K9MW 3K3WA 2XOKG 1P7GA 3BA9A 5LA6B 1YITV 2Q6AA 4A5UB 1F51A 3B77A 5CB4A 5EZYB 4MVUA 4EB6B 4J80A 1ZSPA 1D2DA 3RYFB 3S3WA 4MTXA 1WPBA 4HNAA 5LMNO 4DV2O 4DV2B 1JMKC 1AJNA 3QO7A 4DV3B 1DGSA 2EX3A 1K4CC 4FMTA 4J10A 1JFFB 5LGUA 3E22B 5IDJA 2OTJV 2R72A 3J7AU 1N32B 2P7TC 3QO5A 2ZQMA 1HDJA 2PF4E 1IBLB 4WBNA 3SYPA 4I4TB 3ZX6A 2YUAA 2E5LB 1BHBA 5B5EZ 3H1LH 3IFXA 2E75B 2PYLA 1SF9A 3BA8A 3CHXA 3BHPA 3CPWU 2QGNA 1GAXA 3G6BA 1RSOA 4CC5A 4UCUA 3ASNC 4DR1B 4UUJC 5D5QA 1V55B 2CE4A 1X59A 4PD4F 5C8YA 1JQ0A 2A9HA 2ZE7A 3FB7C 3SYAA 4YHHO 4B7KA 4TV9B 4K8ZA 2LGWA 1GN3A 3AG4C 5FLXN 2MW2B 4WFBV 2PYJA 4X1IA 3TXQA 1NZ6A 2RN9A 2YIAA 1EN5A 1B04A 4JI1O 5A9GA 3W7SA 4BW5A 2B9ZA 3ZMUA 4ASUG 1SA0A 5DECA 3K79A 3THOA 1NVPB 4CS3A 4MW3A 4NTYA 3BRCA 1S5LZ 4JYBA 2IU0A 4H37A 2JK5C 2WLMA 5C93A 1XUQA 1QVGU 1VQ5V 4UB8Z 2FYUH 2XAJA 4ZOLB 4YJ2B 4DXWA 1RM1C 2IH1C 1KKCA 1OCOB 3E35A 4U7OA 2WLHA 3M99B 2OYQA 1W0JG 3ZBHA 3CRRA 4LF5O 4CBCA 1YCIA 2ZE5A 2IJJA 1YEWA 3ZMSA 5JCOA 1IBMB 5BMVB 3ABLB 4QIWF 1GRJA 1VQNV 5LYJB 2DJVA 3L70H 2JJ2G 2UXNA 1XNRO 3CB2A 1YSCA 2X0LA 2QWNB 1XNRB 1QBZA 1G1XB 5KX5A 1FAFA 2GDSA 3MHSC 4J41A 3SYQA 1PNLA 5B1OA 5B1BC 4JI8O 4JZ2A 1WB7A 4FFBB 2JEXA 2ADQB 4GZRB 3T4DA 1K7DA 3ZHUA 4KP4A 2HJDA 5J9PC 5K1PA 3MAQA 4LWSA 1SS3A 1QU7A 1BE3H 3UO3A 3K59A 4TQDA 3RGBA 4OX9B 1TA8A 1V55C 4DV4O 1E79G 4JAVA 1VQKV 1Z5WA 3OMAB 2YEVB 1FXVA 4HBNA 2JEUA 4O2BB 3K03A 5CBGA 3BY6A 2AW9A 3RVYA 3VBBA 1VQ8V 5IYBO 1GO3F 3BAAA 4RQFA 1P4RA 3HKCA 1VIBA 4BR6A 4LF6B 3G80A 4GYCB 3KCYA 3ASOB 4O2AB 3CRCA 1YJNV 2UXXA 4FPPA 2IJIA 3CCMV 1YTFB 1SESA 4LP8A 4LF8O 4Q20A 1VP7A 1R3KC 5JJNB 2OTLV 4X66B 3K04A 3QG5A 3T1HO 1OCOC 1R3LC 1P84F 1KC8W 3FX7A 2V7QG 4B3MB 3N27A 4JGSA 1HNXB 1N34O 4J42A 2YS8A 2A0LA 4I0XA 3ABLC 5B1NA 3IC9A 4LFAB 2G38A 4R50A 4J7JA 1L0NH 4QPJA 1H8EG 5IJ0A 3OEEG 4J7ZA 5EIBD 4DR5B 1FXKB 2JRIA 3IJ4A 2WLLA 2ATKC 1Q5OA 2BTQA 5CA3A 4QNHB 4ZHQB 5L3EA 1WJZA 1M5IA 5GONA 2YIBA 4JV5B 2C2AA 3JD2A 2R9AA 3K58A 3AK2A 2QWQB 3AEIA 3CRMA 3TJTA 4JTCB 2EIJB 2JGDA 1BL8A 4U3JA 4CH4A 1WA8B 2H94A 1KD1W 2FKXA 1WP7A 4I55B 4NB5A 4DK1A 3OUSA 1YDXA 5GW7A 1SQXH 4CC6A 1VF5B 2UXDB 3CSXA 4DV0O 3P30A 4DV0B 3ABKB 2CAZC 4TUYB 2ZM6O 5BR8O 4YJ3B 3OW2U 1M1KW 1ENVA 1H2LA 4K0KB 4P30A 1GN2A 1Q3EA 4EFEA 1ZL8B 4DW0A 2W6JG 3HKBB 4NVPA 1BQ0A 1JVMA 4MVSA 3ZRVA 4LF4O 3ABTA 1ORQC 4RUEA 4LBEC 2UUAB 2NLJC 3EHBB 4TT3G 1KECA 4J9YB 3AK1A 4DR4B 2X7RB 3I55V 3SPJA 3DXRB 4X1KB 3VQYA 2IM9A 4GX5A 2BOBC 4RO2A 2R70A 4H13B 3K5NA 2EILB 1Z2GA 2UU9B 4NXMO 3OD4A 1Q7YW 4O4JB 4OPAA 4DV6B 4HZ3A 4PI0A 4IIJA 4DR2O 5J2TA 3T2MA 4DR2B 1XNQO 4DO2A 4FZ1A 3ZMTA 3OTOB 1K4DC 2GBOA 3K08A 3CYOA 3FB8C 3CX5F 4O4HB 4KUMA 2HVJC 3OAAG 4J11A 1Y74B 3LNNA 4LH6A 5IJ9A 2EJRA 4DR3B 3PJSK 3K06A 5J2UB 2ZKOA 3CC4V 2K1EA 4MTOA 4C7UA 2V4DA 3OGCC 5CA0A 3JAKA 3U10A 1KUQA 2ADPA 1TUBB 5CA1B 2CH7A 4DR7O 5EC2C 4DR7B 1M57C 1W2BU 3OMIB 2EINB 1SQPH 2LW1A 3N2KA 1QLNA 3OGIB 5EZYA 3ABKC 3ZN0A 4CS2A 2AHZA 2M6YA 5E79Z 4YIOA 2ZR2A 3A8TA 1KMIZ 1A32A 1N0NA 3OEHG 3RYHA 1NTKH 3O65A 1MNGA 4BIOA 1J95A 4WFAV 3TK1A 1Y4MA 2ZE6A 1AR1B 1UJWB 1VQ4V 1NT2B 3CJHB 2Q7GA 1K5SA 1JR9A 1FXHA 3ZN1A 1PD3A 1X4TA 1VQ6V 5LL6Y 1AI5A 5KMGA 1NS1A 2L6LA 5LMUO 1XHXA 2QWRB 3CCJV 3G6EV 1KQSU 3LNMB 1TVKA 3JATA 5A2QN 3OR6C 3CRQA 1XI1A 1AP5A 2UUBB 3Q4HA 4HYOA 3ZRWA 2EBOA 3BFRA 2D3OW 4JF3A 1FD9A 2O57A 1K97A 2EILC 1FKAO 3FB5C 4UCOA 1OZ0A 5CMUA 5IYZB 1MZEA 2WLKA 2PI5A 3B09A 3X2QB 2HEPA 3H1IH 1SQVH 5JVDB 5IWAB 3L9DA 1PPJH 1VF7A 2JGUA 4DV5B 2N74A 3SJAC 1R3IC 1AI6A 3S3XA 4PELA 2GTAA 4GLXA 5FNVA 3TGUH 1PNMA 3ASNB 4Q6GA 4JI7O 5EYPB 2V1DA 4X88A 1YJWV 4FFKA 3D36A 1Y76A 2EULA 4X1YA 2LFRA 3LSQA 1F4MA 3WU2Z 2ZE8A 3JALA 4YJ2A 4LF9O 4LF9B 3H01A 4DRXA 2P06A 1YI2V 4GKKO 4DV7B 3LSUA 4EEQA 4WFEA 3R66A 1EFRG 3DC5A 1BQZA 4DUYB 1OCRB 4K3AA 1VMGA 1B06A 2WLIB 4MVZA 4KL1A 2ZNIA 2HG5C 1E1QG 5LYJA 1FS0G 2ZIMA 2DYSC 1RM1B 1IXBA 4CS4A 2ILMA 1AVMA 1YIJV 5IYDO 4ZI7B 4JI5O 2RJZA 3JD3A 3L72H 1MOFA 4H33A 3AG2B 1QHTA 3HKEA 1WP8A 1IBKO 3CCVV 1IBKB 4RUFA 4AI8A 5LMNB 2KG7A 4ZIBA 5KHHA 3AG7A 1TUEB 1SQFA 5EC1C 4MVRA 2QM8A 2R9RB 4U3FH 2F95B 4ICGA 4OGQB 3RVZA 3ZJZA 3K0GA 5LP6A 4FJCC 4UCTA 2XTAA 4DR6O 3A0BZ 1QNMA 4OXSA 2A3QA 3JARA 1NI8A 3RBZA 2HHHO 4CH6A 4F4LA 5B1BB 1QR8A 2JJ1G 1WAZA 1OJHA 2QA4V 3RT3C 3X2QC 4CH5A 5EIBC 4FLWA 2K9PA 3JASB 3N2GA 3CC2V 1EZJA 5GTIZ 1S0VA 5D5PA 2P90A 1BS3A 5JH7B 4LF7O 5LGTA 1VF6A 1QR9A 5FPRA 2KQXA 2JS5A 2BCCH 4PA4A 3ZRXA 4UVCA 4YHHB 2RMKB 5JJJB 3E2EA 1BZKA 4JAAA 3FKSG 2OWOA 4JYAO 1K34A 4JI1B 2FTKA 2Y4UA 4CZZA 1R6NA 1NJIW 1EZVH 1VQ7V 4PDVA 1GK9A 2YXYA 3AK3A 2KSDA 2GUZB 1OCRC 1K5QA 3AG3C 4QE9A 3CCLV 4X20B 2XAHA 3HKDA 3H1KH 1V54B 4GCZA 3A0RA 4O4LA 3C3SA 3SYCA 1VQ9V 1RFYA 5DEDA 3FB6C 4JAUA 3ABMC 3JAWA 3AG2C 4LF5B 3D8CA 3UO2A 3TETA 1ZWIC 2IBZH 2JVDA 4J9ZB 3PN1A 1BSMA 4JI6O 4ZKIA 1S3JA 4NR1A 2D2CB 2Q73A 5H9CA 4O4IB 4CH3A 3ZEDA 2FL4A 4F6RB 1DF4A 1P49A 3ZMVA 5B1AB 2MK3A 3W7WA 2DQ0A 5B3SB 3H1JH 2AGAA 4PDMA 4LFCO 2HJFC 4F6EA 5KHIA 2YSUB 4JI8B 1NR1A 3K5OA 1OV9A 2QWOB 4MVMA 4TUYA 2EZOA 4BIZA 4YJ3A 5ITZA 3C90A 4OPHA 3ETGA 5CB4B 5EK0A 2OIEA 3K57A 2E3CA 4X89A 4P2ZA 1O9GA 2RQ6A 3H1HH 3OMNB 4HNAB 4DV4B 4B08A 3SPIA 5DM6V 2ZD9A 3SYOA 3GWKC 3E86A 3E8BA 2OCCB 4YY3O 1G6UA 1SZXA 5LHHA 4FM0A 2PTMA 2QM4A 3MDSA 5H2FZ 2Y0PA 4DUZO 3ZHVA 4JI3O 3NR7A 4JI3B 4NKGB 2HVKC 3TXSA 2YIBD 4Z1MG 5LGNA 3GVMA 2B1IA 5L3BA 4X62O 2Y4TA 2N04A 5LXTA 4WBNB 1Q8IA 2QE7G 4G28B 2DMXA 2FMLA 3FFQA 1COWG 2F93B 4PA9A 4LF8B 1V54C 3JCZA 3JAMN 2GV9A 3E8HA 2EJ7A 2Q7HA 3GWOA 3T1HB 3RFRA 4IHJA 3T1YO 1JJOA 1RSOB 1AJQA 2NNUA 5BZBA 4RQEA 5C8YB 4RAIA 5DN6G 3KKYA 1N34B 4MVOA 4GUNA 1K33A 1PKXA 4WCEV 2DQ3A 2LW7A 4X1IB 4GT1A 3BPZA 1H2MA 2BE3A 4LR3A 1XQ8A 1SA0B 4XBFA 3U0ZA 5BXZA 3HPLC 4IYHA 1PNKA 5KAFZ 3RYIA 5B1AC 4E4EA 1K3EA 5B3SC 2WLNA 1GKFA 4UCRA 2H3OA 2DN9A 1LNQA 2ZDIA 1Y6XA 3WFVA 3APOA 2CK3G 3AG1B 1NBMG 3CEIA 3QF7A 5AG2A 5LHGA 1XEQA 1BMFG 1IX9A 2ZT9B 1RPOA 1IURA 4I50A 3FAVA 2CTRA 2F1MA 2R9IA 1MMMA 3HR0A 2Y69C 1IVSA 4PHZA 2LP7A 1M90W 1M57B 4DW1A 2CGNA 1HNZO 4TV8A 2QM7A 1XBLA 4MS2A 3O9OA 1XMQO 5LOVA 1H2SB 2OCCC 1FFXA 3E8GA 1YVWA 2ZM6B 1ZAUA 5BR8B 5KX5B 2LJ2A 3DTUB 4MTGA 1OHHG 4X8AA 1WN7A 4LH7A 5CN0A 3ETEA 2B5UA 3OFNG 1DF5A 2BSKA 1Q90D 2RCVA 4X65O 1AR4A 1I94O 2IH3C 4PI2A 1I94B 5BY1A 5JQGA 4LF4B 3JSNA 3ZHTA 4FK5C 4LWSB 4GKJO 1WPXA 2P67A 2RNBA 4LNUA 3GB7C 1HR0O 1MG1A 5FPOA 1LUVA 2H8PC 3FYEB 1M9NA 2X6AA 2UUCO 4D7SA 3WB0A 2N05A 3CD6V 3WB1A 3L74H 1HNWO 3STLC 1SRYA 2YXLA 3CRAA 3SPGA 5HFLA 3HKCB 5EYPA 1BHAA 5EBWC 4U7NA 3I56V 1GMGA 3CP1A 4QPKA 4NXMB 1YXBA 1XHZA 1B6QA 2BTOA 1MZFA 1WNSA 2P4VA 5TISZ 1ZUQA 1ZLZA 1XNQB 4GX1A 1Z5VA 3QTCA 1S72V 1YJ9V 4PV1B 5LHIA 1XILA 2X6CA 3R65A 5IYCO 2PGGA 2F4VO 1I5YA 2HP8A 3EXAA 2F4VB 4Z2WA 3AG1C 3JCUZ 3JYCA 4P9PA 4XDJA 3CWBH 4EKWA 2YXHA 3CMEV 1AR5A 3UT5B 3CCRV 4PA3A 5HFMA 2OT5A 5LA6A 4JASA 5JCOC 4I0XB 4JI4O 2IJHA 1KU9A 4JI4B 1GH6A 5EBLC 1DTOA 2JIZG 3E89A 3W7TA 2QKCA 4UCSA 4EB6A 2ZXWC 5IJ0B 3RYFA 3W7UA 4YXWG 2EZPA 1N33O 2WLLB 4XDLA 5H6RA 4R6ZA 4X64O 2BTQB 1KKDA 4JZGA 1PL0A 3LUTB 5GONB 2DYSB 3WB2A 1NU1H 5H6QA 4HAMA 4L8JA 1NVPD 1J5EO 1JFFA 4BAYA 1QVFU 4LFBO 5KA5A 2JGDB 4U3JB 3E22A 4PJ0Z 2CTWA 2XAFA 2QTOA 3DGEA 5JWPA 2DWDC 5B66Z 2Q0OC 3UM7A 3K5MA 4JPRA 1K8AW 2NR5A 4I4TA 4B3RO 1FJGO 3KZIZ 5LMUB 4B3RB 4KFMA 3B2EE 4KHPO 4KHPB 5E1AC 2YC0A 4GX0A 1EM1A 1Q86W 3CC7V 3CXHF 4AHCA 1AB3A 3LSSA 1H8HG 4WFHA 1CXZB 4G2KA 4TV9A 4I7ZB 1N0JA 3SR2C 3H9VA 4MSWC 3UCSC 4D6TH 2VQFO 4FLXA 1M4UA 1FYJA 2E74B 1VQLV 2W0XA 3J80N 2W6IG 5KLVH 4TSFG 1NH2D 2UXBO 1FPOA 2UXBB 4JI7B 2GUZA 1Q6UA 4UVAA 3SPHA 3ZS8C 2EIMB 2RDCA 3SJQC 1D5AA 1F7YA 1SKVA 1Y67A 3WG7B 4ZOLA 1BT8A 3RN4A 3CCQV 3F7YC 4UCVA 2Q5ZA 3EFFK 3LDDA 4GKKB 2OIGA 5CBHA 1URFA 4E2LA 2PZSA 1L1FA 1UPGA 4UVBA 5BMVA 4GX2A 4IIJB 5J2TB 1SC5B 3SGIA 3AG3B 3L73H 1JCHA 2QDOA 4FM2A 2PI4A 3SJCC 1OCZC 3HB3B 3L71H 5IJ9B 4JI5B 3ABMB 3B8NA 3IGAC 2XT9A 3B8MA 1IZ3A 2Z5UA 4PDRA 2XNDG 4K35A 1S5JA 5CA0B 3JAKB 4FLZA 2KKWA 4FFBA 4JTAB 2CH7B 1RP3B 5L3CA 3RYCB 4LCUC 1BGYH 2ARHA 3E8FA 3LDEA 1S76D 3N2KB 3P3PA 1M93A 4P9OA 3ETQA 3T4ZA 2WAMA 4DR6B 3RYHB 4BW9A 4W4LA 2HHHB 2YEVA 4PA6A 3CCSV 4O2BA 4DV3O 1KYOF 1M56B 2NN4A 4I9QA 1HWYA 2Q69A 4I5SA 2BOCC 2XASA 2B1GA 2EIKC 2XAGA 3CCUV 3OTFA 1N32O 4NTXA 3TCUA 1JJ2U 2Q67A 1OCCC 1EN4A 2F43G 1IBLO 4RWUA 2Z0AA 4LC1A 4O2AA 4LF7B 2WLJA 5KMGB 2CUGA 2E5LO 3VQVA 1H38A 1AI7A 4X9QA 1KBHA 2EIMC 1GM7A 1TVKB 1QQCA 3E83A 3JATB 1I7FA 4JI0O 3WG7C 4DK0A 2Y48A 1V9PA 4JI0B 2E76B 3Q4HB 3ZRWB 1GM9A
chains in the Genus database with same CATH topology
1FPOA 1BQ0A 2DN9A 3BVOA 2QWQB 2Y4UA 2GUZA 2L6LA 1BQZA 3APQA 1XBLA 2N05A 2QWRB 2QWNB 4RWUA 2EJ7A 1FAFA 3UO3A 2KQXA 1GH6A 3APOA 1HDJA 2PF4E 3UO2A 2CTPA 2CUGA 4J7ZA 2OCHA 2GUZB 3UCSC 2YUAA 1IURA 2LO1A 3AG7A 2Y4TA 2LGWA 2CTRA 2M6YA 2N04A 2QWPB 4IT5A 2CTQA 2YS8A 2CTWA 1WJZA 2QSAA 1NZ6A 2DMXA 2QWOB 4J80A 1N4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPO A;  1BQ0 A;  2DN9 A;  3BVO A;  2QWQ B;  2Y4U A;  2GUZ A;  2L6L A;  1BQZ A;  3APQ A;  1XBL A;  2N05 A;  2QWR B;  2QWN B;  4RWU A;  2EJ7 A;  1FAF A;  3UO3 A;  2KQX A;  1GH6 A;  3APO A;  1HDJ A;  2PF4 E;  3UO2 A;  2CTP A;  2CUG A;  4J7Z A;  2OCH A;  2GUZ B;  3UCS C;  2YUA A;  1IUR A;  2LO1 A;  3AG7 A;  2Y4T A;  2LGW A;  2CTR A;  2M6Y A;  2N04 A;  2QWP B;  4IT5 A;  2CTQ A;  2YS8 A;  2CTW A;  1WJZ A;  2QSA A;  1NZ6 A;  2DMX A;  2QWO B;  4J80 A;  1N4C A; 
#chains in the Genus database with same CATH topology
 4DR1 O;  2VRZ A;  4JYA B;  4NXN O;  4QGP A;  3FYI B;  2YDE A;  4NXN B;  1T5E A;  5IY5 B;  3SJB C;  3RW0 A;  3ZHS A;  4H0L B;  1I5X A;  3ML0 A;  1TGO A;  3G67 A;  2Q9L A;  3BEH A;  2P6J A;  2LGQ A;  1SQG A;  1PP9 H;  4W4K A;  4PA7 A;  5FNV B;  1SER A;  1JX9 A;  1FXK A;  2IW5 A;  5JJE B;  2LQT A;  4AIL C;  3CS5 A;  4ZHQ A;  5KA6 A;  1Y76 B;  4X1Y B;  1EN6 A;  3JAL B;  1WB8 A;  1R1B A;  2JDI G;  2P22 C;  3B40 A;  1W0K G;  3JD0 A;  4JI6 B;  4DRX B;  3F5T A;  1WA8 A;  4IL6 Z;  1XOU A;  4B7E A;  4MT8 A;  2Y0I A;  1IBM O;  4I55 A;  2QR4 A;  3QVN A;  3J81 N;  4N21 A;  3OE7 G;  1W59 A;  4LFC B;  1LR1 A;  1CPY A;  1NQT A;  3C3T A;  1DK1 A;  1M56 C;  4DV1 O;  4DV1 B;  2HKO A;  4FIP C;  1S5H C;  2WA3 A;  1Q43 A;  4H44 B;  1PM9 A;  3RWR D;  2ETN A;  2F23 A;  4NYK A;  1AP6 A;  2OCH A;  1ZL8 A;  2Y69 B;  3HKE B;  3HKB A;  2XAQ A;  1R6T A;  4IGG A;  1WLE A;  2KG7 B;  1NH2 B;  1GN6 A;  3T1C A;  4FLT A;  1PL4 A;  4R7C A;  3LDC A;  2Z3Y A;  2AZ0 A;  5KUK A;  4YY3 B;  3B4S A;  3I5D A;  1F23 A;  3BCC H;  1Y66 A;  3ICX A;  1FFT B;  1R3J C;  2DE0 X;  4DUZ B;  5LP6 B;  5L3D A;  2ZCE A;  2FB5 A;  4UV9 A;  4OX9 O;  5KHG A;  1E1R G;  2LO1 A;  3JAR B;  3DXR A;  4X1K A;  4X62 B;  1PV0 A;  3JSL A;  5IY5 C;  2AHY A;  3K5L A;  5F2V O;  2ZIN A;  2P5O A;  4FLV A;  4FLU A;  3K9S A;  5H5N A;  2QKA A;  3N2G B;  4TOI A;  2Q68 A;  4K8X A;  4UFZ A;  2XHB A;  1Q82 W;  1ARO P;  1GM8 A;  4LF6 O;  1HP8 A;  1XRE A;  4O4J A;  3T1Y B;  2WA4 A;  2JS3 A;  4UB6 Z;  3VQX A;  3ZHR A;  3KCX A;  1U96 A;  2Q7E A;  3D36 C;  1R73 A;  3P32 A;  4O4H A;  4X66 O;  1XL6 A;  4JYY A;  1MSD A;  5EBM C;  1Y74 A;  2GSM B;  4B3M O;  2KB1 A;  5J2U A;  3ZHQ A;  3ETD A;  1HNX O;  3STZ C;  3UT5 A;  2QWP B;  2IU3 A;  4IT5 A;  2VS0 A;  1RPR A;  1TUB A;  5CA1 A;  3L75 H;  3ZMZ A;  2IJK A;  4LFA O;  3HKD B;  2P4K A;  1B3Q A;  1JOY A;  4WFF A;  3APQ A;  5KHK A;  1ZX3 A;  1SQB H;  1G4Y B;  4O4L B;  3SPC A;  4DR5 O;  4MW8 A;  2AZ2 A;  2YI9 A;  4FLY A;  3JAW B;  2GHY A;  1XMO O;  5IE9 A;  3M7M X;  1XMO B;  2HR3 A;  2ITD C;  4JV5 O;  2ODM A;  1ROP A;  1HW7 A;  3OM3 B;  4R8C A;  1SQQ H;  1JA8 A;  1HNZ B;  2ZR3 A;  3CJH A;  1XMQ B;  1F4N A;  1D5N A;  2ZXW B;  1MSW D;  1QCE A;  1K92 A;  3A0H Z;  4MTF A;  4N23 A;  3EVK A;  5LP6 C;  1L8D A;  2DOS A;  3VOU A;  2UXD O;  1LUW A;  3F7V C;  3D3Q A;  4UXN A;  1DLB A;  4X65 B;  3KG2 A;  5ITZ B;  4K0K O;  4DYL A;  2CDY A;  2Q0A A;  5GTH Z;  2A79 B;  3ABU A;  4AQY O;  1CP9 A;  4AQY B;  4GKJ B;  1VF6 C;  5IYZ A;  3ASO C;  4NTW A;  3ZIA G;  1S77 D;  1HR0 B;  1GTO A;  1NKD A;  1O9H A;  3MD0 A;  5JVD A;  2QJ1 A;  3K0D A;  2UUC B;  2YIC A;  1EBO A;  1MAB G;  3DC6 A;  2A7W A;  1H2G A;  1AJP A;  2UUA O;  4QE7 A;  3IC7 A;  5KHJ A;  1VQM V;  1HNW B;  4IYI A;  4EFB A;  4JI2 O;  4JI2 B;  2WPD G;  4DR4 O;  2W0F C;  5LBQ A;  2DYR B;  2ITC C;  2WWW A;  5LXT B;  1VQP V;  2VWJ A;  1BCC H;  3BVO A;  3CMA V;  2WSS G;  1GN4 A;  1R6K A;  3UKM A;  1YF2 A;  5FL7 G;  4FM1 A;  2UU9 O;  2VWK A;  4IHJ B;  4DV6 O;  1FXK C;  4WF9 V;  2ZNJ A;  3OT7 A;  2WLI A;  3OTO O;  3W7X A;  2HLD G;  1I08 A;  1U97 A;  5L3F A;  3U11 A;  4Z1V A;  1AIL A;  3CE2 A;  1VEW A;  1IXM A;  4ZI7 A;  4D7T A;  2EIJ C;  4JYC A;  1Q6I A;  2UXC O;  4DR3 O;  2UXC B;  3JD1 A;  3CCE V;  2LFS A;  2F66 C;  3D3I A;  3K9A A;  4KXR A;  5L3G A;  2HFE C;  3RYI B;  4MVQ A;  2PY5 A;  1N33 B;  5KUM A;  4B3T O;  1QLE B;  4B3T B;  4X64 B;  3RYC A;  2ZIO A;  4TQF A;  1SET A;  1H2K A;  2A06 H;  3A2F A;  4G27 B;  1MA1 A;  1THZ A;  1OCZ B;  2AXT Z;  1CEZ A;  1SZT A;  1J5E B;  2DW4 A;  4LFB B;  1IDS A;  2DWE C;  3IAY A;  1XL4 A;  3ZRS A;  1K73 W;  4J7K A;  3G71 V;  3BAB A;  4I50 B;  3FAV B;  1YZB A;  1N36 O;  1G8M A;  1NTZ H;  2PUS A;  1N36 B;  2QEX V;  4FZ0 A;  3JD4 A;  2Q8V A;  3M8A A;  4FVM A;  3MHH C;  1FJG B;  4PDL A;  3JAS A;  4TV8 B;  3FD9 A;  5K1X A;  4UV8 A;  5LOV B;  4I9W A;  1FFX B;  3G4S V;  5KAI Z;  2QTS A;  5JH7 A;  3ZCC A;  1N8R W;  3NXS A;  5IT9 N;  1N4C A;  1NTM H;  2DYR C;  4QJF B;  2YI8 A;  2BSK B;  1JPX A;  2XUM A;  1NR7 A;  2M7W A;  2UUB O;  1I0H A;  1L0L H;  2VQF B;  5JQG B;  2EIK B;  3P3N A;  5CBF A;  1UFI A;  4JTD B;  4WFG A;  1XDC A;  1OCC B;  3VQW A;  1KB9 F;  2GTS A;  4B3S O;  2VQE O;  4LNU B;  4B3S B;  1TAE A;  2VQE B;  4BWA A;  1KP2 A;  3SDL A;  5IWA O;  2CTP A;  4TWK A;  4DV5 O;  3UQ8 A;  4X20 A;  3OUF A;  2Q4P A;  2CGO A;  1VQO V;  1Q6H A;  2L35 A;  2QSA A;  4BIU A;  2QKS A;  1Q81 W;  1AI4 A;  3QNE A;  1YHQ V;  1US6 A;  3OR7 C;  1P7B A;  2YID A;  4YIP A;  1KP3 A;  3AG4 B;  1QLE C;  1ZTE A;  4XDK A;  3F5W C;  3CXC U;  2EIN C;  4DV7 O;  1VAR A;  4ZBM A;  4O4I A;  2ZDI C;  2CTQ A;  1H2N A;  3QO8 A;  4L87 A;  4F6R A;  3DSQ A;  1YTF D;  4DUY O;  4ABM A;  2X6B A;  1K9M W;  3K3W A;  2XOK G;  1P7G A;  3BA9 A;  5LA6 B;  1YIT V;  2Q6A A;  4A5U B;  1F51 A;  3B77 A;  5CB4 A;  5EZY B;  4MVU A;  4EB6 B;  4J80 A;  1ZSP A;  1D2D A;  3RYF B;  3S3W A;  4MTX A;  1WPB A;  4HNA A;  5LMN O;  4DV2 O;  4DV2 B;  1JMK C;  1AJN A;  3QO7 A;  4DV3 B;  1DGS A;  2EX3 A;  1K4C C;  4FMT A;  4J10 A;  1JFF B;  5LGU A;  3E22 B;  5IDJ A;  2OTJ V;  2R72 A;  3J7A U;  1N32 B;  2P7T C;  3QO5 A;  2ZQM A;  1HDJ A;  2PF4 E;  1IBL B;  4WBN A;  3SYP A;  4I4T B;  3ZX6 A;  2YUA A;  2E5L B;  1BHB A;  5B5E Z;  3H1L H;  3IFX A;  2E75 B;  2PYL A;  1SF9 A;  3BA8 A;  3CHX A;  3BHP A;  3CPW U;  2QGN A;  1GAX A;  3G6B A;  1RSO A;  4CC5 A;  4UCU A;  3ASN C;  4DR1 B;  4UUJ C;  5D5Q A;  1V55 B;  2CE4 A;  1X59 A;  4PD4 F;  5C8Y A;  1JQ0 A;  2A9H A;  2ZE7 A;  3FB7 C;  3SYA A;  4YHH O;  4B7K A;  4TV9 B;  4K8Z A;  2LGW A;  1GN3 A;  3AG4 C;  5FLX N;  2MW2 B;  4WFB V;  2PYJ A;  4X1I A;  3TXQ A;  1NZ6 A;  2RN9 A;  2YIA A;  1EN5 A;  1B04 A;  4JI1 O;  5A9G A;  3W7S A;  4BW5 A;  2B9Z A;  3ZMU A;  4ASU G;  1SA0 A;  5DEC A;  3K79 A;  3THO A;  1NVP B;  4CS3 A;  4MW3 A;  4NTY A;  3BRC A;  1S5L Z;  4JYB A;  2IU0 A;  4H37 A;  2JK5 C;  2WLM A;  5C93 A;  1XUQ A;  1QVG U;  1VQ5 V;  4UB8 Z;  2FYU H;  2XAJ A;  4ZOL B;  4YJ2 B;  4DXW A;  1RM1 C;  2IH1 C;  1KKC A;  1OCO B;  3E35 A;  4U7O A;  2WLH A;  3M99 B;  2OYQ A;  1W0J G;  3ZBH A;  3CRR A;  4LF5 O;  4CBC A;  1YCI A;  2ZE5 A;  2IJJ A;  1YEW A;  3ZMS A;  5JCO A;  1IBM B;  5BMV B;  3ABL B;  4QIW F;  1GRJ A;  1VQN V;  5LYJ B;  2DJV A;  3L70 H;  2JJ2 G;  2UXN A;  1XNR O;  3CB2 A;  1YSC A;  2X0L A;  2QWN B;  1XNR B;  1QBZ A;  1G1X B;  5KX5 A;  1FAF A;  2GDS A;  3MHS C;  4J41 A;  3SYQ A;  1PNL A;  5B1O A;  5B1B C;  4JI8 O;  4JZ2 A;  1WB7 A;  4FFB B;  2JEX A;  2ADQ B;  4GZR B;  3T4D A;  1K7D A;  3ZHU A;  4KP4 A;  2HJD A;  5J9P C;  5K1P A;  3MAQ A;  4LWS A;  1SS3 A;  1QU7 A;  1BE3 H;  3UO3 A;  3K59 A;  4TQD A;  3RGB A;  4OX9 B;  1TA8 A;  1V55 C;  4DV4 O;  1E79 G;  4JAV A;  1VQK V;  1Z5W A;  3OMA B;  2YEV B;  1FXV A;  4HBN A;  2JEU A;  4O2B B;  3K03 A;  5CBG A;  3BY6 A;  2AW9 A;  3RVY A;  3VBB A;  1VQ8 V;  5IYB O;  1GO3 F;  3BAA A;  4RQF A;  1P4R A;  3HKC A;  1VIB A;  4BR6 A;  4LF6 B;  3G80 A;  4GYC B;  3KCY A;  3ASO B;  4O2A B;  3CRC A;  1YJN V;  2UXX A;  4FPP A;  2IJI A;  3CCM V;  1YTF B;  1SES A;  4LP8 A;  4LF8 O;  4Q20 A;  1VP7 A;  1R3K C;  5JJN B;  2OTL V;  4X66 B;  3K04 A;  3QG5 A;  3T1H O;  1OCO C;  1R3L C;  1P84 F;  1KC8 W;  3FX7 A;  2V7Q G;  4B3M B;  3N27 A;  4JGS A;  1HNX B;  1N34 O;  4J42 A;  2YS8 A;  2A0L A;  4I0X A;  3ABL C;  5B1N A;  3IC9 A;  4LFA B;  2G38 A;  4R50 A;  4J7J A;  1L0N H;  4QPJ A;  1H8E G;  5IJ0 A;  3OEE G;  4J7Z A;  5EIB D;  4DR5 B;  1FXK B;  2JRI A;  3IJ4 A;  2WLL A;  2ATK C;  1Q5O A;  2BTQ A;  5CA3 A;  4QNH B;  4ZHQ B;  5L3E A;  1WJZ A;  1M5I A;  5GON A;  2YIB A;  4JV5 B;  2C2A A;  3JD2 A;  2R9A A;  3K58 A;  3AK2 A;  2QWQ B;  3AEI A;  3CRM A;  3TJT A;  4JTC B;  2EIJ B;  2JGD A;  1BL8 A;  4U3J A;  4CH4 A;  1WA8 B;  2H94 A;  1KD1 W;  2FKX A;  1WP7 A;  4I55 B;  4NB5 A;  4DK1 A;  3OUS A;  1YDX A;  5GW7 A;  1SQX H;  4CC6 A;  1VF5 B;  2UXD B;  3CSX A;  4DV0 O;  3P30 A;  4DV0 B;  3ABK B;  2CAZ C;  4TUY B;  2ZM6 O;  5BR8 O;  4YJ3 B;  3OW2 U;  1M1K W;  1ENV A;  1H2L A;  4K0K B;  4P30 A;  1GN2 A;  1Q3E A;  4EFE A;  1ZL8 B;  4DW0 A;  2W6J G;  3HKB B;  4NVP A;  1BQ0 A;  1JVM A;  4MVS A;  3ZRV A;  4LF4 O;  3ABT A;  1ORQ C;  4RUE A;  4LBE C;  2UUA B;  2NLJ C;  3EHB B;  4TT3 G;  1KEC A;  4J9Y B;  3AK1 A;  4DR4 B;  2X7R B;  3I55 V;  3SPJ A;  3DXR B;  4X1K B;  3VQY A;  2IM9 A;  4GX5 A;  2BOB C;  4RO2 A;  2R70 A;  4H13 B;  3K5N A;  2EIL B;  1Z2G A;  2UU9 B;  4NXM O;  3OD4 A;  1Q7Y W;  4O4J B;  4OPA A;  4DV6 B;  4HZ3 A;  4PI0 A;  4IIJ A;  4DR2 O;  5J2T A;  3T2M A;  4DR2 B;  1XNQ O;  4DO2 A;  4FZ1 A;  3ZMT A;  3OTO B;  1K4D C;  2GBO A;  3K08 A;  3CYO A;  3FB8 C;  3CX5 F;  4O4H B;  4KUM A;  2HVJ C;  3OAA G;  4J11 A;  1Y74 B;  3LNN A;  4LH6 A;  5IJ9 A;  2EJR A;  4DR3 B;  3PJS K;  3K06 A;  5J2U B;  2ZKO A;  3CC4 V;  2K1E A;  4MTO A;  4C7U A;  2V4D A;  3OGC C;  5CA0 A;  3JAK A;  3U10 A;  1KUQ A;  2ADP A;  1TUB B;  5CA1 B;  2CH7 A;  4DR7 O;  5EC2 C;  4DR7 B;  1M57 C;  1W2B U;  3OMI B;  2EIN B;  1SQP H;  2LW1 A;  3N2K A;  1QLN A;  3OGI B;  5EZY A;  3ABK C;  3ZN0 A;  4CS2 A;  2AHZ A;  2M6Y A;  5E79 Z;  4YIO A;  2ZR2 A;  3A8T A;  1KMI Z;  1A32 A;  1N0N A;  3OEH G;  3RYH A;  1NTK H;  3O65 A;  1MNG A;  4BIO A;  1J95 A;  4WFA V;  3TK1 A;  1Y4M A;  2ZE6 A;  1AR1 B;  1UJW B;  1VQ4 V;  1NT2 B;  3CJH B;  2Q7G A;  1K5S A;  1JR9 A;  1FXH A;  3ZN1 A;  1PD3 A;  1X4T A;  1VQ6 V;  5LL6 Y;  1AI5 A;  5KMG A;  1NS1 A;  2L6L A;  5LMU O;  1XHX A;  2QWR B;  3CCJ V;  3G6E V;  1KQS U;  3LNM B;  1TVK A;  3JAT A;  5A2Q N;  3OR6 C;  3CRQ A;  1XI1 A;  1AP5 A;  2UUB B;  3Q4H A;  4HYO A;  3ZRW A;  2EBO A;  3BFR A;  2D3O W;  4JF3 A;  1FD9 A;  2O57 A;  1K97 A;  2EIL C;  1FKA O;  3FB5 C;  4UCO A;  1OZ0 A;  5CMU A;  5IYZ B;  1MZE A;  2WLK A;  2PI5 A;  3B09 A;  3X2Q B;  2HEP A;  3H1I H;  1SQV H;  5JVD B;  5IWA B;  3L9D A;  1PPJ H;  1VF7 A;  2JGU A;  4DV5 B;  2N74 A;  3SJA C;  1R3I C;  1AI6 A;  3S3X A;  4PEL A;  2GTA A;  4GLX A;  5FNV A;  3TGU H;  1PNM A;  3ASN B;  4Q6G A;  4JI7 O;  5EYP B;  2V1D A;  4X88 A;  1YJW V;  4FFK A;  3D36 A;  1Y76 A;  2EUL A;  4X1Y A;  2LFR A;  3LSQ A;  1F4M A;  3WU2 Z;  2ZE8 A;  3JAL A;  4YJ2 A;  4LF9 O;  4LF9 B;  3H01 A;  4DRX A;  2P06 A;  1YI2 V;  4GKK O;  4DV7 B;  3LSU A;  4EEQ A;  4WFE A;  3R66 A;  1EFR G;  3DC5 A;  1BQZ A;  4DUY B;  1OCR B;  4K3A A;  1VMG A;  1B06 A;  2WLI B;  4MVZ A;  4KL1 A;  2ZNI A;  2HG5 C;  1E1Q G;  5LYJ A;  1FS0 G;  2ZIM A;  2DYS C;  1RM1 B;  1IXB A;  4CS4 A;  2ILM A;  1AVM A;  1YIJ V;  5IYD O;  4ZI7 B;  4JI5 O;  2RJZ A;  3JD3 A;  3L72 H;  1MOF A;  4H33 A;  3AG2 B;  1QHT A;  3HKE A;  1WP8 A;  1IBK O;  3CCV V;  1IBK B;  4RUF A;  4AI8 A;  5LMN B;  2KG7 A;  4ZIB A;  5KHH A;  3AG7 A;  1TUE B;  1SQF A;  5EC1 C;  4MVR A;  2QM8 A;  2R9R B;  4U3F H;  2F95 B;  4ICG A;  4OGQ B;  3RVZ A;  3ZJZ A;  3K0G A;  5LP6 A;  4FJC C;  4UCT A;  2XTA A;  4DR6 O;  3A0B Z;  1QNM A;  4OXS A;  2A3Q A;  3JAR A;  1NI8 A;  3RBZ A;  2HHH O;  4CH6 A;  4F4L A;  5B1B B;  1QR8 A;  2JJ1 G;  1WAZ A;  1OJH A;  2QA4 V;  3RT3 C;  3X2Q C;  4CH5 A;  5EIB C;  4FLW A;  2K9P A;  3JAS B;  3N2G A;  3CC2 V;  1EZJ A;  5GTI Z;  1S0V A;  5D5P A;  2P90 A;  1BS3 A;  5JH7 B;  4LF7 O;  5LGT A;  1VF6 A;  1QR9 A;  5FPR A;  2KQX A;  2JS5 A;  2BCC H;  4PA4 A;  3ZRX A;  4UVC A;  4YHH B;  2RMK B;  5JJJ B;  3E2E A;  1BZK A;  4JAA A;  3FKS G;  2OWO A;  4JYA O;  1K34 A;  4JI1 B;  2FTK A;  2Y4U A;  4CZZ A;  1R6N A;  1NJI W;  1EZV H;  1VQ7 V;  4PDV A;  1GK9 A;  2YXY A;  3AK3 A;  2KSD A;  2GUZ B;  1OCR C;  1K5Q A;  3AG3 C;  4QE9 A;  3CCL V;  4X20 B;  2XAH A;  3HKD A;  3H1K H;  1V54 B;  4GCZ A;  3A0R A;  4O4L A;  3C3S A;  3SYC A;  1VQ9 V;  1RFY A;  5DED A;  3FB6 C;  4JAU A;  3ABM C;  3JAW A;  3AG2 C;  4LF5 B;  3D8C A;  3UO2 A;  3TET A;  1ZWI C;  2IBZ H;  2JVD A;  4J9Z B;  3PN1 A;  1BSM A;  4JI6 O;  4ZKI A;  1S3J A;  4NR1 A;  2D2C B;  2Q73 A;  5H9C A;  4O4I B;  4CH3 A;  3ZED A;  2FL4 A;  4F6R B;  1DF4 A;  1P49 A;  3ZMV A;  5B1A B;  2MK3 A;  3W7W A;  2DQ0 A;  5B3S B;  3H1J H;  2AGA A;  4PDM A;  4LFC O;  2HJF C;  4F6E A;  5KHI A;  2YSU B;  4JI8 B;  1NR1 A;  3K5O A;  1OV9 A;  2QWO B;  4MVM A;  4TUY A;  2EZO A;  4BIZ A;  4YJ3 A;  5ITZ A;  3C90 A;  4OPH A;  3ETG A;  5CB4 B;  5EK0 A;  2OIE A;  3K57 A;  2E3C A;  4X89 A;  4P2Z A;  1O9G A;  2RQ6 A;  3H1H H;  3OMN B;  4HNA B;  4DV4 B;  4B08 A;  3SPI A;  5DM6 V;  2ZD9 A;  3SYO A;  3GWK C;  3E86 A;  3E8B A;  2OCC B;  4YY3 O;  1G6U A;  1SZX A;  5LHH A;  4FM0 A;  2PTM A;  2QM4 A;  3MDS A;  5H2F Z;  2Y0P A;  4DUZ O;  3ZHV A;  4JI3 O;  3NR7 A;  4JI3 B;  4NKG B;  2HVK C;  3TXS A;  2YIB D;  4Z1M G;  5LGN A;  3GVM A;  2B1I A;  5L3B A;  4X62 O;  2Y4T A;  2N04 A;  5LXT A;  4WBN B;  1Q8I A;  2QE7 G;  4G28 B;  2DMX A;  2FML A;  3FFQ A;  1COW G;  2F93 B;  4PA9 A;  4LF8 B;  1V54 C;  3JCZ A;  3JAM N;  2GV9 A;  3E8H A;  2EJ7 A;  2Q7H A;  3GWO A;  3T1H B;  3RFR A;  4IHJ A;  3T1Y O;  1JJO A;  1RSO B;  1AJQ A;  2NNU A;  5BZB A;  4RQE A;  5C8Y B;  4RAI A;  5DN6 G;  3KKY A;  1N34 B;  4MVO A;  4GUN A;  1K33 A;  1PKX A;  4WCE V;  2DQ3 A;  2LW7 A;  4X1I B;  4GT1 A;  3BPZ A;  1H2M A;  2BE3 A;  4LR3 A;  1XQ8 A;  1SA0 B;  4XBF A;  3U0Z A;  5BXZ A;  3HPL C;  4IYH A;  1PNK A;  5KAF Z;  3RYI A;  5B1A C;  4E4E A;  1K3E A;  5B3S C;  2WLN A;  1GKF A;  4UCR A;  2H3O A;  2DN9 A;  1LNQ A;  2ZDI A;  1Y6X A;  3WFV A;  3APO A;  2CK3 G;  3AG1 B;  1NBM G;  3CEI A;  3QF7 A;  5AG2 A;  5LHG A;  1XEQ A;  1BMF G;  1IX9 A;  2ZT9 B;  1RPO A;  1IUR A;  4I50 A;  3FAV A;  2CTR A;  2F1M A;  2R9I A;  1MMM A;  3HR0 A;  2Y69 C;  1IVS A;  4PHZ A;  2LP7 A;  1M90 W;  1M57 B;  4DW1 A;  2CGN A;  1HNZ O;  4TV8 A;  2QM7 A;  1XBL A;  4MS2 A;  3O9O A;  1XMQ O;  5LOV A;  1H2S B;  2OCC C;  1FFX A;  3E8G A;  1YVW A;  2ZM6 B;  1ZAU A;  5BR8 B;  5KX5 B;  2LJ2 A;  3DTU B;  4MTG A;  1OHH G;  4X8A A;  1WN7 A;  4LH7 A;  5CN0 A;  3ETE A;  2B5U A;  3OFN G;  1DF5 A;  2BSK A;  1Q90 D;  2RCV A;  4X65 O;  1AR4 A;  1I94 O;  2IH3 C;  4PI2 A;  1I94 B;  5BY1 A;  5JQG A;  4LF4 B;  3JSN A;  3ZHT A;  4FK5 C;  4LWS B;  4GKJ O;  1WPX A;  2P67 A;  2RNB A;  4LNU A;  3GB7 C;  1HR0 O;  1MG1 A;  5FPO A;  1LUV A;  2H8P C;  3FYE B;  1M9N A;  2X6A A;  2UUC O;  4D7S A;  3WB0 A;  2N05 A;  3CD6 V;  3WB1 A;  3L74 H;  1HNW O;  3STL C;  1SRY A;  2YXL A;  3CRA A;  3SPG A;  5HFL A;  3HKC B;  5EYP A;  1BHA A;  5EBW C;  4U7N A;  3I56 V;  1GMG A;  3CP1 A;  4QPK A;  4NXM B;  1YXB A;  1XHZ A;  1B6Q A;  2BTO A;  1MZF A;  1WNS A;  2P4V A;  5TIS Z;  1ZUQ A;  1ZLZ A;  1XNQ B;  4GX1 A;  1Z5V A;  3QTC A;  1S72 V;  1YJ9 V;  4PV1 B;  5LHI A;  1XIL A;  2X6C A;  3R65 A;  5IYC O;  2PGG A;  2F4V O;  1I5Y A;  2HP8 A;  3EXA A;  2F4V B;  4Z2W A;  3AG1 C;  3JCU Z;  3JYC A;  4P9P A;  4XDJ A;  3CWB H;  4EKW A;  2YXH A;  3CME V;  1AR5 A;  3UT5 B;  3CCR V;  4PA3 A;  5HFM A;  2OT5 A;  5LA6 A;  4JAS A;  5JCO C;  4I0X B;  4JI4 O;  2IJH A;  1KU9 A;  4JI4 B;  1GH6 A;  5EBL C;  1DTO A;  2JIZ G;  3E89 A;  3W7T A;  2QKC A;  4UCS A;  4EB6 A;  2ZXW C;  5IJ0 B;  3RYF A;  3W7U A;  4YXW G;  2EZP A;  1N33 O;  2WLL B;  4XDL A;  5H6R A;  4R6Z A;  4X64 O;  2BTQ B;  1KKD A;  4JZG A;  1PL0 A;  3LUT B;  5GON B;  2DYS B;  3WB2 A;  1NU1 H;  5H6Q A;  4HAM A;  4L8J A;  1NVP D;  1J5E O;  1JFF A;  4BAY A;  1QVF U;  4LFB O;  5KA5 A;  2JGD B;  4U3J B;  3E22 A;  4PJ0 Z;  2CTW A;  2XAF A;  2QTO A;  3DGE A;  5JWP A;  2DWD C;  5B66 Z;  2Q0O C;  3UM7 A;  3K5M A;  4JPR A;  1K8A W;  2NR5 A;  4I4T A;  4B3R O;  1FJG O;  3KZI Z;  5LMU B;  4B3R B;  4KFM A;  3B2E E;  4KHP O;  4KHP B;  5E1A C;  2YC0 A;  4GX0 A;  1EM1 A;  1Q86 W;  3CC7 V;  3CXH F;  4AHC A;  1AB3 A;  3LSS A;  1H8H G;  4WFH A;  1CXZ B;  4G2K A;  4TV9 A;  4I7Z B;  1N0J A;  3SR2 C;  3H9V A;  4MSW C;  3UCS C;  4D6T H;  2VQF O;  4FLX A;  1M4U A;  1FYJ A;  2E74 B;  1VQL V;  2W0X A;  3J80 N;  2W6I G;  5KLV H;  4TSF G;  1NH2 D;  2UXB O;  1FPO A;  2UXB B;  4JI7 B;  2GUZ A;  1Q6U A;  4UVA A;  3SPH A;  3ZS8 C;  2EIM B;  2RDC A;  3SJQ C;  1D5A A;  1F7Y A;  1SKV A;  1Y67 A;  3WG7 B;  4ZOL A;  1BT8 A;  3RN4 A;  3CCQ V;  3F7Y C;  4UCV A;  2Q5Z A;  3EFF K;  3LDD A;  4GKK B;  2OIG A;  5CBH A;  1URF A;  4E2L A;  2PZS A;  1L1F A;  1UPG A;  4UVB A;  5BMV A;  4GX2 A;  4IIJ B;  5J2T B;  1SC5 B;  3SGI A;  3AG3 B;  3L73 H;  1JCH A;  2QDO A;  4FM2 A;  2PI4 A;  3SJC C;  1OCZ C;  3HB3 B;  3L71 H;  5IJ9 B;  4JI5 B;  3ABM B;  3B8N A;  3IGA C;  2XT9 A;  3B8M A;  1IZ3 A;  2Z5U A;  4PDR A;  2XND G;  4K35 A;  1S5J A;  5CA0 B;  3JAK B;  4FLZ A;  2KKW A;  4FFB A;  4JTA B;  2CH7 B;  1RP3 B;  5L3C A;  3RYC B;  4LCU C;  1BGY H;  2ARH A;  3E8F A;  3LDE A;  1S76 D;  3N2K B;  3P3P A;  1M93 A;  4P9O A;  3ETQ A;  3T4Z A;  2WAM A;  4DR6 B;  3RYH B;  4BW9 A;  4W4L A;  2HHH B;  2YEV A;  4PA6 A;  3CCS V;  4O2B A;  4DV3 O;  1KYO F;  1M56 B;  2NN4 A;  4I9Q A;  1HWY A;  2Q69 A;  4I5S A;  2BOC C;  2XAS A;  2B1G A;  2EIK C;  2XAG A;  3CCU V;  3OTF A;  1N32 O;  4NTX A;  3TCU A;  1JJ2 U;  2Q67 A;  1OCC C;  1EN4 A;  2F43 G;  1IBL O;  4RWU A;  2Z0A A;  4LC1 A;  4O2A A;  4LF7 B;  2WLJ A;  5KMG B;  2CUG A;  2E5L O;  3VQV A;  1H38 A;  1AI7 A;  4X9Q A;  1KBH A;  2EIM C;  1GM7 A;  1TVK B;  1QQC A;  3E83 A;  3JAT B;  1I7F A;  4JI0 O;  3WG7 C;  4DK0 A;  2Y48 A;  1V9P A;  4JI0 B;  2E76 B;  3Q4H B;  3ZRW B;  1GM9 A; 
#chains in the Genus database with same CATH homology
 1FPO A;  1BQ0 A;  2DN9 A;  3BVO A;  2QWQ B;  2Y4U A;  2GUZ A;  2L6L A;  1BQZ A;  3APQ A;  1XBL A;  2N05 A;  2QWR B;  2QWN B;  4RWU A;  2EJ7 A;  1FAF A;  3UO3 A;  2KQX A;  1GH6 A;  3APO A;  1HDJ A;  2PF4 E;  3UO2 A;  2CTP A;  2CUG A;  4J7Z A;  2OCH A;  2GUZ B;  3UCS C;  2YUA A;  1IUR A;  2LO1 A;  3AG7 A;  2Y4T A;  2LGW A;  2CTR A;  2M6Y A;  2N04 A;  2QWP B;  4IT5 A;  2CTQ A;  2YS8 A;  2CTW A;  1WJZ A;  2QSA A;  1NZ6 A;  2DMX A;  2QWO B;  4J80 A;  1N4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...