2QWQB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the amppnp hydrolyzed form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
total genus 27
structure length 92
sequence length 92
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwqB00
1WJZA 2Y4TA 2QWPB 2N05A 1IURA 1BQZA 3BVOA 2GUZA 1N4CA 3UCSC 4J80A 2QSAA 2Y4UA 4RWUA 2YUAA 2QWOB 2LGWA 2PF4E 2QWNB 2L6LA 2DN9A 2CTWA 2YS8A 4IT5A 2CTPA 2LO1A 3APOA 3UO3A 2DMXA 2KQXA 1FPOA 3UO2A 1FAFA 1NZ6A 2M6YA 2GUZB 2N04A 1XBLA 2CTRA 1HDJA 2QWRB 3APQA 4J7ZA 1GH6A 1BQ0A 2CUGA 2QWQB 2EJ7A 3AG7A 2OCHA 2CTQA
chains in the Genus database with same CATH superfamily
4PD4F 2N05A 3ZIAG 4DV0O 4MTOA 1KU9A 4LF7O 3VOUA 4B3TB 2Z5UA 3H1IH 1WA8A 1ZAUA 2BTOA 4OXSA 4UVBA 3UKMA 1QU7A 1Q7YW 3ZMSA 3ABKB 3CD6V 4H33A 2NNUA 1BT8A 2JK5C 5J2UB 3L74H 3OMNB 4UCUA 5EBLC 1OCZB 3K5NA 3QNEA 1I5YA 1AI6A 4LF5B 3JD4A 2FB5A 1SS3A 2BTQB 4DK0A 4UCSA 1S5HC 2JIZG 2N74A 3RYIA 3E8BA 1SA0A 3JARB 2OTLV 1PD3A 2IJIA 4CC6A 3SPGA 1SETA 3FAVB 4PELA 4GYCB 1FYJA 3RFRA 4DV5B 1GK9A 4FLTA 1JR9A 1CXZB 5IDJA 1HNWO 5EZYB 2UUCB 2XASA 2WLHA 3BA8A 2ZDIC 5JWPA 3UT5B 2LFSA 3CB2A 4JYAO 4LF9O 5FL7G 4AQYB 4BIOA 4L87A 2CTRA 5EK0A 1EN6A 1PNMA 2QKCA 3ZRWB 3FKSG 2XHBA 1X4TA 4GX2A 4L8JA 5KHJA 2F66C 3BEHA 1VQ4V 5LGNA 2Y4UA 3W7UA 3G6BA 2O57A 3K79A 4PA4A 1K4DC 1N0NA 1GO3F 2H8PC 2Q4PA 3JARA 4X65O 2LGQA 5KHHA 5L3FA 2EX3A 1AR1B 2VWJA 4KXRA 3VQWA 4YJ3A 1VF6A 1EM1A 1COWG 4DV1O 4TUYB 1YF2A 4XDKA 3LSSA 1YTFD 1I0HA 2Q67A 2YEVA 1V54C 2WLMA 5GTIZ 4J9ZB 2Z3YA 3CXCU 5FLXN 3I5DA 4DR7O 3ZS8C 1JX9A 4TV9A 2B1IA 3K58A 1SQGA 4ZHQB 1TUBB 3SYAA 1VQNV 4QE7A 1EN4A 4JYCA 4R8CA 4QPKA 2WSSG 1M93A 2AXTZ 1ZX3A 2XT9A 4U7NA 3PN1A 1Q81W 4OX9B 2E74B 3ZRSA 5LHHA 2A9HA 2LO1A 1KC8W 2DMXA 2EINC 4NB5A 3UO2A 2IW5A 4YXWG 1OCRC 2YIDA 3FB8C 2E5LB 2VWKA 4IIJB 2AW9A 4F6EA 1EZJA 4CH4A 3D36C 2RDCA 4DV6O 5FPRA 2HJFC 3AG2B 3BRCA 1Y67A 4HNAB 3JYCA 4JTDB 4I5SA 1AR4A 3E86A 4GT1A 4X8AA 4LC1A 1HR0O 1UPGA 3E8HA 1IBMB 1OCRB 3IFXA 2EIKC 4FZ1A 1SESA 3K3WA 1JOYA 3SJAC 5B3SB 3FB6C 3WB2A 2AGAA 5B1BB 1MG1A 3CCVV 4DV3O 1R6NA 3APOA 2QM8A 2KB1A 4X20B 1YIJV 1IXMA 3ZEDA 1BZKA 1P7GA 4LF5O 4LF8O 1M4UA 4QGPA 3JALA 4LNUA 4X9QA 1WJZA 3MDSA 4I55B 2QWPB 4TQDA 1D5NA 3VQYA 3CRAA 1MMMA 1YJNV 4DV6B 4EFBA 4LF6O 1JQ0A 4DR6O 1AI5A 3BPZA 5E79Z 4UUJC 5KMGA 1IX9A 3AEIA 1WPXA 4DR3B 3HKDB 1YI2V 1MA1A 3SDLA 1IDSA 2C2AA 5IJ0B 4X64O 4ZBMA 1VP7A 2KKWA 4O4JB 4TV8B 3ASOB 4DV7O 4IYIA 3NXSA 2B5UA 2PTMA 5JCOA 2DE0X 1FKAO 2F4VB 1VIBA 1WPBA 3OEEG 4IHJA 2DYRC 2JGUA 4FPPA 5GONA 5D5PA 3QG5A 2YXHA 4ZKIA 1V55C 5IYZB 2HR3A 5KUMA 4JI1B 2OT5A 2IH3C 2WAMA 2WWWA 4LF6B 4EKWA 5IE9A 4G28B 3OGIB 2JS3A 2HVKC 2JS5A 3IGAC 4CS4A 2L6LA 1L8DA 3A0BZ 4TT3G 1OCCB 1K5SA 5J2TB 2R70A 1Z5VA 4U7OA 1ZLZA 3B8MA 1O9HA 3ASNC 3A8TA 1FFTB 4FJCC 2ZXWB 1KB9F 2RN9A 4O4JA 4J42A 4LH7A 4DXWA 4NTWA 3GWOA 5H5NA 3FX7A 1DGSA 2RJZA 2H94A 2EIJC 2Y48A 1XBLA 1IBMO 3ZJZA 3VQVA 1Q8IA 2P22C 1XMQB 3ZRXA 4XDJA 4D7SA 2ADPA 4EEQA 4NYKA 1QR8A 4QIWF 4CBCA 4LF9B 3STLC 1N8RW 4X1YA 3N2GB 3AK2A 3JD1A 5A9GA 3E2EA 3K5LA 1XMQO 3CRCA 2K9PA 2E5LO 3H1JH 2XNDG 4FVMA 3ZN1A 1BL8A 3K08A 4FLUA 4R6ZA 3UQ8A 2RCVA 5H9CA 3K9AA 3RYHA 5LP6B 2EBOA 1FXKB 3BA9A 4KL1A 3ZX6A 4BR6A 3KCYA 3C3TA 1XNQO 3BABA 1SQBH 3OR6C 1HNXB 2P5OA 5L3DA 3BFRA 4K0KB 3CC7V 1OCCC 3X2QB 1SQXH 2N04A 1FFXB 4IL6Z 4GLXA 1NR1A 2DJVA 3HB3B 1R3KC 3CSXA 3OE7G 3H1HH 4MTFA 3PJSK 1NBMG 4X88A 3JSNA 2UU9B 4YJ2A 5LMUB 3SR2C 2YIBD 1M57B 3TETA 4AILC 2KG7A 3JATA 5EC2C 1G4YB 1SZXA 3HKCB 2FL4A 5H6RA 2DYSC 4LH6A 3EXAA 3D3QA 3ZMZA 3RYCB 1VF6C 3RN4A 2HKOA 1YVWA 2CUGA 3J80N 1XDCA 2QM7A 3FB7C 4DR1O 3CMAV 3ZHVA 2EILB 1V55B 4LF7B 2QTSA 2XAFA 2DYSB 5IYCO 1M1KW 3M8AA 3ZRWA 5K1PA 1H38A 5CA0A 3CCEV 1VQ6V 3OTFA 4AQYO 3ASOC 1AJPA 4RQFA 1WP8A 2UUAO 4KUMA 2JDIG 4MW3A 1ZWIC 3MHHC 5LXTA 1OCOC 3JD2A 3OFNG 3VQXA 5C93A 4I9WA 3N27A 4LF8B 3UM7A 4I4TB 3ZN0A 3AG7A 1SERA 2EZPA 4WBNB 1NS1A 2W6IG 4O4LB 4DV3B 1NJIW 2PZSA 1KBHA 3QF7A 4FM1A 4LBEC 3SYPA 4NXMO 3LDCA 2ZT9B 5JVDB 4JI7B 4PDMA 3LSQA 3JCZA 2YICA 1CPYA 1H8HG 5L3CA 1DK1A 1S3JA 3L71H 4UVAA 4QE9A 1OHHG 3BCCH 4JYYA 4K3AA 3F7VC 2F95B 1Q82W 4EB6B 2UXCB 4ABMA 2AHZA 2RNBA 1RSOB 3ETEA 5LYJB 4WFEA 2CE4A 1I94B 1QHTA 1WB7A 4DV2B 2QWRB 4B3RB 2QR4A 3CCMV 1IBLB 3K03A 1PP9H 1YEWA 1YHQV 1BMFG 1E79G 1NVPB 5FNVB 2PY5A 3ABLC 3ABLB 1Q43A 3ASNB 4GCZA 2GDSA 4JTCB 2OYQA 2ITDC 3CS5A 3CCQV 5B5EZ 1KUQA 4O2BB 1N33B 1NTMH 3NR7A 2X6CA 2NR5A 4X62B 3P3NA 3B40A 2F93B 3WB0A 1G6UA 4XDLA 2OCCC 2YXYA 1ZL8A 3FFQA 4KP4A 3ABTA 2OTJV 4UV9A 2QWQB 1JFFA 1S76D 1N36O 1G8MA 1WNSA 4O2AB 4DUYB 5KX5A 2G38A 3M7MX 1W0KG 5BR8B 2QWOB 4CS2A 4JI2O 2ZIOA 4PI0A 3CCLV 4J7KA 1WP7A 3AG4B 4LFBB 4JAUA 1JA8A 3K9SA 3SPJA 1IBKB 3OR7C 3ZMTA 5JQGB 4O2BA 4X89A 4X1KB 2P4KA 4DR2B 3P30A 3LDDA 1HW7A 2DWDC 4WFFA 2HHHB 2YDEA 2LFRA 3BHPA 3E8FA 3IAYA 3S3XA 4ZI7A 5CMUA 1N34O 1MSDA 1Q6UA 1GAXA 3F5TA 5IT9N 3MHSC 3AK3A 3BAAA 4OPAA 5J2UA 2PUSA 3CX5F 3OMAB 5FPOA 2YIBA 4PDLA 5ITZB 2CH7A 4UCOA 2VRZA 3A2FA 2R9RB 5EC1C 4MT8A 2Q6AA 5JH7A 3DC5A 5B1BC 3TXSA 2JJ2G 4U3FH 2BTQA 1ZUQA 1AJQA 2WLLB 1G1XB 4RAIA 1K8AW 4IYHA 5CA0B 2XTAA 1US6A 4G2KA 3G67A 3B2EE 1I5XA 2QKSA 3FYEB 3JSLA 3R65A 1VQ5V 1K97A 2Q69A 1F51A 5IWAB 1XMOO 4BWAA 3TJTA 1OCZC 3STZC 1NQTA 3FB5C 1OJHA 1FXHA 4U3JA 3JD3A 2CH7B 4IT5A 4NTXA 1EZVH 4YY3B 3T4ZA 2ZCEA 4ZIBA 4FLYA 3N2GA 4GX0A 3J7AU 1IVSA 4B3TO 3RYFB 5BMVA 5LOVB 4WF9V 2A7WA 1R3IC 4DV0B 3ZHRA 4UXNA 5GW7A 4AHCA 1S77D 1KECA 2KQXA 1KMIZ 2ZM6O 5B1OA 2ATKC 1MNGA 3OGCC 1QLEB 1SC5B 4MTGA 3IJ4A 3T1YO 4KHPB 4FFBB 4F6RA 4OPHA 1MABG 1LNQA 2W0FC 4A5UB 4DO2A 1DTOA 3SJBC 2YEVB 2YI9A 1S0VA 1QR9A 2K1EA 1VQPV 3JCUZ 4TUYA 1PPJH 2FYUH 3EVKA 1JVMA 4Q20A 4DUZB 4PHZA 4NXNO 2OIEA 4EFEA 3GWKC 4W4KA 1Y66A 5B66Z 1LUWA 4GZRB 2BCCH 4FIPC 3CC4V 1NI8A 4Z1MG 1QCEA 1BHAA 3RYFA 2EINB 3ETDA 5FNVA 3Q4HB 1H2SB 5LGTA 1Y74B 2CTWA 5IYZA 3O9OA 3DTUB 2HLDG 2GHYA 4JI6O 4LFCB 3ABMC 1VQ7V 3T4DA 1NR7A 4HBNA 4WFGA 4GX1A 2F43G 1F7YA 4JI8B 2LW1A 1QQCA 4GKJO 2AZ2A 4LF4B 3E8GA 5KHKA 3JAKA 3T1HB 4JYBA 3S3WA 1SQVH 5C8YA 2P4VA 1THZA 2GTAA 3T1HO 5K1XA 1VQMV 2CGOA 2Q8VA 3DGEA 1RPOA 2RQ6A 3B4SA 4HNAA 1HDJA 3OM3B 1JFFB 4JI8O 2LJ2A 5LXTB 4I7ZB 2VQEO 2UUBO 1NKDA 3X2QC 1DF5A 2E76B 3SYCA 5LMNO 3M99B 4XBFA 5IJ9B 1GMGA 3T2MA 4H13B 3CYOA 1XL6A 3A0HZ 3AK1A 5EZYA 1VEWA 5JQGA 2QE7G 1R3LC 2NN4A 3UT5A 1J5EB 3QO5A 4X20A 2ADQB 2Y69C 4LNUB 4K35A 1ORQC 3N2KA 1NU1H 4I50B 3AG2C 4BIZA 1AB3A 1YXBA 4OGQB 1QLEC 1QVGU 2E3CA 2WLIB 2MK3A 4PV1B 3R66A 4LWSB 1FXKA 4P9OA 1DLBA 2EJ7A 4B7EA 4I0XA 3RVYA 2HG5C 1S5JA 4EB6A 4QPJA 5KMGB 2WA4A 1RSOA 4JV5B 1NTZH 3K04A 1GM9A 1WN7A 1R73A 1MZFA 2V7QG 4H0LB 5DEDA 4DV4B 3CRQA 4JGSA 4GKKB 1K33A 4IHJB 4YY3O 1RFYA 1TVKB 1ZTEA 2OCHA 1XHZA 1PL0A 4JI3B 2KG7B 2PYLA 3N2KB 4BW5A 4X1IA 3OTOB 2FKXA 2GTSA 5L3GA 1L0NH 4B7KA 5L3EA 1K9MW 2LQTA 4Z1VA 2YC0A 5AG2A 3E89A 4E4EA 4RO2A 2NLJC 2GSMB 1S5LZ 2R9AA 3L72H 1AR5A 1RM1C 1VMGA 1FJGO 3SYOA 2P06A 2YUAA 1KQSU 3FYIB 3CCSV 1GTOA 3DC6A 4W4LA 3RYIB 4TWKA 4DR5B 2A3QA 1SA0B 2JRIA 4DK1A 5KX5B 2ZD9A 1EFRG 2Q9LA 3K5MA 2ZNJA 1XNRB 4X1IB 1N32B 1NVPD 4MVQA 1BHBA 2YIAA 3U10A 2Q7EA 4JI3O 5KA5A 3AG4C 3CP1A 3ZCCA 4DW1A 1OCOB 2ZNIA 5CA3A 3IC9A 2VQFB 3ICXA 5B1NA 1PNLA 4DR4O 2VS0A 4J80A 2F23A 5J9PC 2Q7GA 1HP8A 3JALB 2QWNB 2P90A 1M56C 4PDVA 4JI4O 5DN6G 1SQPH 1FFXA 4E2LA 1VQ8V 3APQA 1Y76A 5JJNB 3H1LH 1WB8A 1JJ2U 1E1QG 3TGUH 2CDYA 1SQQH 3ZRVA 3HKDA 3OUSA 5CB4A 1VQOV 1Z2GA 3RVZA 1R1BA 1FXVA 3K0GA 4LR3A 4ZHQA 5BZBA 4TV8A 2UXNA 4CS3A 3I56V 1AROP 3F7YC 5EYPA 2Q7HA 4JTAB 5GTHZ 2IU0A 5CBFA 1DF4A 2BOBC 3T1YB 3ETQA 2QJ1A 1WAZA 5LP6C 1TUEB 1SKVA 4I9QA 4B3SO 4PA7A 1HNZO 1U97A 4MVOA 3RWRD 1FAFA 2WLKA 3D3IA 3W7TA 3JASA 2WLJA 3OUFA 1GN3A 5KAFZ 3G80A 1PL4A 4FK5C 2VQFO 4B3MB 1BQ0A 1FXKC 4QNHB 1UJWB 1Q86W 1PNKA 4B3RO 2GBOA 5EIBD 1Q6HA 3L73H 4FMTA 4JZ2A 3OEHG 2UXXA 4J7JA 3TK1A 1BCCH 2XAJA 5CA1A 2IJJA 1XREA 2ILMA 1PKXA 1N32O 4GKJB 4FFKA 4P2ZA 4LWSA 3C90A 5LHGA 5EIBC 4MVZA 4I4TA 3E22B 5LL6Y 4JI6B 1XOUA 2Y4TA 4DR5O 2Q0OC 3G6EV 4MTXA 1FJGB 1P7BA 4JI5B 3B77A 4YIPA 3FD9A 3RBZA 3JASB 3CJHB 3CHXA 4NR1A 1P4RA 3DXRA 3KZIZ 4GUNA 2R9IA 4LCUC 3AG3B 4X1YB 4LFAO 3K5OA 2UXDB 4I55A 2Z0AA 4ZI7B 1UFIA 2A0LA 2MW2B 1AP6A 4MSWC 5A2QN 2IU3A 2XAGA 3CCRV 2HHHO 4CH3A 2QTOA 3ZHUA 1AI4A 4FZ0A 1XUQA 3CRRA 4FLVA 2QEXV 3JAKB 4DV4O 4GKKO 1JJOA 1H2LA 4B3MO 2RMKB 3ZHTA 3U0ZA 4MW8A 3ZMUA 1V54B 2EILC 4UVCA 1AJNA 2BSKB 1Z5WA 3H01A 2UXBO 5KHGA 1TUBA 3TXQA 2ZQMA 4YHHB 4JI2B 3CCUV 2UXBB 1AVMA 4B3SB 2EIKB 2DYRB 3RGBA 1WA8B 4TOIA 1K92A 4J7ZA 1XQ8A 1T5EA 2EZOA 2BE3A 1IZ3A 3ETGA 2ITCC 4GX5A 1R6TA 3RYCA 1NT2B 2QSAA 2XUMA 4UCRA 2HEPA 4JAVA 1Q3EA 3GB7C 5CBHA 2PF4E 5J2TA 3ABUA 2FMLA 4X66B 1YITV 2IH1C 3U11A 4D7TA 2QKAA 2QDOA 1YCIA 2WA3A 4JI0O 4RUFA 3E35A 2ZKOA 5H6QA 5B3SC 3ABMB 1L0LH 2H3OA 3KG2A 5CN0A 3C3SA 1IURA 1BS3A 4UV8A 4JI4B 4FLWA 5LMNB 4AI8A 2WPDG 4FLXA 3QO7A 1GN6A 4FM2A 4HZ3A 1XNQB 1YZBA 3L9DA 5BY1A 3WG7C 1XHXA 2YI8A 3A0RA 1W59A 1GM7A 1EN5A 1K7DA 1IBLO 2VQEB 2UUBB 3H9VA 1VQ9V 1PM9A 1FS0G 1M90W 1JMKC 1K3EA 2XAHA 2ZDIA 3JAMN 3MD0A 3SYQA 1S72V 1TVKA 4PA9A 4CC5A 1W2BU 1L1FA 2FTKA 5EYPB 1B04A 2P7TC 2OWOA 1X59A 1MSWD 4LFBO 3G71V 4CH5A 3LDEA 4LFCO 1CP9A 1BQZA 1HNZB 5ITZA 3DSQA 3W7SA 3TCUA 4UCVA 4MS2A 1F4NA 5JH7B 5JJJB 2F1MA 4O4HB 4YJ3B 4JI0B 5EBWC 4UB6Z 4X66O 4LP8A 2JJ1G 1SF9A 1J95A 2X6AA 4NXNB 4YJ2B 4DRXB 2EJRA 5IYBO 4N23A 2WLNA 4DUZO 4TSFG 4WFHA 4Q6GA 3OTOO 3K57A 2GUZB 2V4DA 4D6TH 5IY5B 1VARA 3P3PA 3CWBH 2ZM6B 5LBQA 1TAEA 2CTQA 5IJ9A 1TGOA 5TISZ 5BMVB 5LOVA 4YHHO 1M56B 3UCSC 2Y0IA 3K06A 4DV7B 5F2VO 1SQFA 2V1DA 2ZR3A 3I55V 5L3BA 4X64B 1AI7A 1I08A 2HP8A 4DV2O 2B9ZA 5KAIZ 4FFBA 4F6RB 1YJWV 4G27B 4BIUA 1VQLV 3W7WA 1GM8A 3AG1C 1ZL8B 1XMOB 3ZBHA 3CRMA 3HKBB 5IWAO 3CPWU 4P30A 4RWUA 1SZTA 2UXDO 1KP3A 3L70H 3LNMB 4PA6A 4LFAB 3ABKC 4JZGA 1M57C 1GH6A 2CAZC 5CB4B 3GVMA 4MVSA 1NH2B 2BSKA 1OZ0A 2IJHA 5EBMC 1URFA 3J81N 3D8CA 1RM1B 1H2MA 3JAWB 5HFLA 5JCOC 4NXMB 4JI5O 2HFEC 2ZE7A 1NH2D 1MOFA 5JVDA 2DN9A 1XI1A 4HYOA 1YTFB 4FLZA 3UO3A 3OAAG 3LSUA 5LP6A 3CXHF 3THOA 3K59A 5LHIA 5KLVH 1TA8A 2A06H 3OW2U 1WLEA 1LR1A 4P9PA 2CK3G 3HKBA 3T1CA 1D2DA 1Q5OA 2BOCC 2UUAB 4J10A 2HVJC 3KKYA 1MZEA 5IJ0A 3RT3C 5CA1B 2EIMC 2OIGA 1P49A 4TV9B 1CEZA 2IM9A 3QVNA 3JATB 2B1GA 3KCXA 5GONB 4OX9O 4BAYA 4ASUG 4JV5O 4F4LA 3WG7B 5LA6B 4DR1B 2EIJB 2EULA 2Y0PA 4YIOA 3VBBA 3QO8A 2GV9A 2YXLA 4CZZA 1OV9A 4JASA 1Y6XA 1P84F 4ZOLB 3B09A 1W0JG 1N4CA 1A32A 1GRJA 2Y69B 4IIJA 4U3JB 3OMIB 1H8EG 4R7CA 5LMUO 4X62O 1QBZA 2ZIMA 3QTCA 1U96A 2W0XA 5B1AC 4JI1O 4CH6A 1F23A 4DV1B 4K0KO 4KHPO 5BXZA 2WLIA 4K8ZA 2AHYA 1HNXO 2HJDA 3SGIA 1KD1W 3HKEB 1GKFA 4X65B 2ZE5A 4I0XB 3FAVA 4C7UA 4DR4B 2XAQA 5LA6A 3HPLC 4PI2A 4BW9A 4O4HA 4J41A 4WBNA 2P6JA 1FPOA 4ICGA 4O4LA 1Q6IA 4X1KA 3LNNA 4RQEA 1IXBA 1K4CC 2KSDA 2JEUA 2UXCO 1I94O 2JGDA 2XOKG 3CMEV 1XL4A 2YSUB 4DR6B 4DW0A 1SRYA 1QLNA 5KUKA 1JCHA 2PI5A 5KHIA 4JYAB 3BY6A 4LF4O 3ZHQA 4PDRA 3AG1B 2UUCO 1F4MA 1V9PA 1XNRO 3W7XA 1HWYA 1GN4A 2PYJA 1H2GA 5JJEB 4JI7O 1I7FA 3CE2A 2ZE6A 4UFZA 1Y4MA 3K0DA 3SJCC 3HKEA 2QM4A 3AG3C 2R72A 1N0JA 2YS8A 2ETNA 1NTKH 1PV0A 4H37A 2IBZH 4B08A 3O65A 2PI4A 4FM0A 5DM6V 3JD0A 4NKGB 4JPRA 5B1AB 1YDXA 5D5QA 2JGDB 1VF7A 2DQ3A 1N34B 4IGGA 5H2FZ 1VF5B 4UB8Z 3CEIA 3SPIA 2LGWA 2DW4A 4NTYA 4J11A 2P67A 3D36A 3HKCA 5CBGA 3E22A 2ARHA 2A79B 1B3QA 1XEQA 5E1AC 2DWEC 4R50A 2CGNA 1IBKO 3JAWA 4H44B 5DECA 1RP3B 2F4VO 1KYOF 3E83A 2ODMA 1M9NA 4DUYO 4O2AA 4TQFA 1E1RG 2Q0AA 1N36B 3SPCA 4DR3O 4DYLA 4JAAA 1JPXA 1RPRA 1K34A 3B8NA 2ZINA 1O9GA 3WU2Z 2L35A 3BVOA 1QVFU 1D5AA 1Y76B 4DR7B 2EIMB 3HR0A 1Q90D 4PA3A 2LP7A 1H2NA 3ZHSA 2M7WA 1R6KA 1BSMA 4KFMA 2UU9O 2PGGA 1J5EO 3ZMVA 4DRXA 1AILA 3OT7A 1R3JC 2X6BA 1ZSPA 1EBOA 2GUZA 2ZE8A 1KKCA 3Q4HA 3RYHB 4JF3A 4K8XA 1YSCA 3ML0A 1Y74A 4HAMA 3P32A 2ZXWC 3WFVA 4WCEV 2D3OW 3F5WC 2QGNA 1M5IA 5IY5C 1KP2A 2DQ0A 3SJQC 1HR0B 4O4IB 4ZOLA 2WLLA 3L75H 1LUVA 3EHBB 2IJKA 1YJ9V 5LYJA 3WB1A 2Q5ZA 1QNMA 1K73W 2CTPA 4DR2O 2D2CB 1HNWB 4N21A 5C8YB 3G4SV 1NZ6A 2M6YA 2X0LA 1K5QA 3SPHA 4DV5O 4Z2WA 1H2KA 3CC2V 1ENVA 4WFBV 2LW7A 5IYDO 1ROPA 5HFMA 5BR8O 3MAQA 2AZ0A 3EFFK 3RW0A 1BGYH 1AP5A 4MVUA 5LGUA 1B6QA 2OCCB 1FD9A 4MVRA 1VQKV 2JEXA 1BE3H 2QA4V 4PJ0Z 4QJFB 1XILA 2X7RB 3IC7A 3H1KH 3LUTB 1B06A 4O4IA 3CJHA 4WFAV 4I50A 3DXRB 2DOSA 3OD4A 2Q68A 2Q73A 2W6JG 1GN2A 4UCTA 2E75B 2ZR2A 1N33O 4J9YB 2JVDA 4MVMA 5KA6A 4RUEA 1KKDA 3CCJV 4NVPA
chains in the Genus database with same CATH topology
1WJZA 2Y4TA 2QWPB 2N05A 1IURA 1BQZA 3BVOA 2GUZA 1N4CA 3UCSC 4J80A 2QSAA 2Y4UA 4RWUA 2YUAA 2QWOB 2LGWA 2PF4E 2QWNB 2L6LA 2DN9A 2CTWA 2YS8A 4IT5A 2CTPA 2LO1A 3APOA 3UO3A 2DMXA 2KQXA 1FPOA 3UO2A 1FAFA 1NZ6A 2M6YA 2GUZB 2N04A 1XBLA 2CTRA 1HDJA 2QWRB 3APQA 4J7ZA 1GH6A 1BQ0A 2CUGA 2QWQB 2EJ7A 3AG7A 2OCHA 2CTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJZ A;  2Y4T A;  2QWP B;  2N05 A;  1IUR A;  1BQZ A;  3BVO A;  2GUZ A;  1N4C A;  3UCS C;  4J80 A;  2QSA A;  2Y4U A;  4RWU A;  2YUA A;  2QWO B;  2LGW A;  2PF4 E;  2QWN B;  2L6L A;  2DN9 A;  2CTW A;  2YS8 A;  4IT5 A;  2CTP A;  2LO1 A;  3APO A;  3UO3 A;  2DMX A;  2KQX A;  1FPO A;  3UO2 A;  1FAF A;  1NZ6 A;  2M6Y A;  2GUZ B;  2N04 A;  1XBL A;  2CTR A;  1HDJ A;  2QWR B;  3APQ A;  4J7Z A;  1GH6 A;  1BQ0 A;  2CUG A;  2QWQ B;  2EJ7 A;  3AG7 A;  2OCH A;  2CTQ A; 
#chains in the Genus database with same CATH topology
 4PD4 F;  2N05 A;  3ZIA G;  4DV0 O;  4MTO A;  1KU9 A;  4LF7 O;  3VOU A;  4B3T B;  2Z5U A;  3H1I H;  1WA8 A;  1ZAU A;  2BTO A;  4OXS A;  4UVB A;  3UKM A;  1QU7 A;  1Q7Y W;  3ZMS A;  3ABK B;  3CD6 V;  4H33 A;  2NNU A;  1BT8 A;  2JK5 C;  5J2U B;  3L74 H;  3OMN B;  4UCU A;  5EBL C;  1OCZ B;  3K5N A;  3QNE A;  1I5Y A;  1AI6 A;  4LF5 B;  3JD4 A;  2FB5 A;  1SS3 A;  2BTQ B;  4DK0 A;  4UCS A;  1S5H C;  2JIZ G;  2N74 A;  3RYI A;  3E8B A;  1SA0 A;  3JAR B;  2OTL V;  1PD3 A;  2IJI A;  4CC6 A;  3SPG A;  1SET A;  3FAV B;  4PEL A;  4GYC B;  1FYJ A;  3RFR A;  4DV5 B;  1GK9 A;  4FLT A;  1JR9 A;  1CXZ B;  5IDJ A;  1HNW O;  5EZY B;  2UUC B;  2XAS A;  2WLH A;  3BA8 A;  2ZDI C;  5JWP A;  3UT5 B;  2LFS A;  3CB2 A;  4JYA O;  4LF9 O;  5FL7 G;  4AQY B;  4BIO A;  4L87 A;  2CTR A;  5EK0 A;  1EN6 A;  1PNM A;  2QKC A;  3ZRW B;  3FKS G;  2XHB A;  1X4T A;  4GX2 A;  4L8J A;  5KHJ A;  2F66 C;  3BEH A;  1VQ4 V;  5LGN A;  2Y4U A;  3W7U A;  3G6B A;  2O57 A;  3K79 A;  4PA4 A;  1K4D C;  1N0N A;  1GO3 F;  2H8P C;  2Q4P A;  3JAR A;  4X65 O;  2LGQ A;  5KHH A;  5L3F A;  2EX3 A;  1AR1 B;  2VWJ A;  4KXR A;  3VQW A;  4YJ3 A;  1VF6 A;  1EM1 A;  1COW G;  4DV1 O;  4TUY B;  1YF2 A;  4XDK A;  3LSS A;  1YTF D;  1I0H A;  2Q67 A;  2YEV A;  1V54 C;  2WLM A;  5GTI Z;  4J9Z B;  2Z3Y A;  3CXC U;  5FLX N;  3I5D A;  4DR7 O;  3ZS8 C;  1JX9 A;  4TV9 A;  2B1I A;  3K58 A;  1SQG A;  4ZHQ B;  1TUB B;  3SYA A;  1VQN V;  4QE7 A;  1EN4 A;  4JYC A;  4R8C A;  4QPK A;  2WSS G;  1M93 A;  2AXT Z;  1ZX3 A;  2XT9 A;  4U7N A;  3PN1 A;  1Q81 W;  4OX9 B;  2E74 B;  3ZRS A;  5LHH A;  2A9H A;  2LO1 A;  1KC8 W;  2DMX A;  2EIN C;  4NB5 A;  3UO2 A;  2IW5 A;  4YXW G;  1OCR C;  2YID A;  3FB8 C;  2E5L B;  2VWK A;  4IIJ B;  2AW9 A;  4F6E A;  1EZJ A;  4CH4 A;  3D36 C;  2RDC A;  4DV6 O;  5FPR A;  2HJF C;  3AG2 B;  3BRC A;  1Y67 A;  4HNA B;  3JYC A;  4JTD B;  4I5S A;  1AR4 A;  3E86 A;  4GT1 A;  4X8A A;  4LC1 A;  1HR0 O;  1UPG A;  3E8H A;  1IBM B;  1OCR B;  3IFX A;  2EIK C;  4FZ1 A;  1SES A;  3K3W A;  1JOY A;  3SJA C;  5B3S B;  3FB6 C;  3WB2 A;  2AGA A;  5B1B B;  1MG1 A;  3CCV V;  4DV3 O;  1R6N A;  3APO A;  2QM8 A;  2KB1 A;  4X20 B;  1YIJ V;  1IXM A;  3ZED A;  1BZK A;  1P7G A;  4LF5 O;  4LF8 O;  1M4U A;  4QGP A;  3JAL A;  4LNU A;  4X9Q A;  1WJZ A;  3MDS A;  4I55 B;  2QWP B;  4TQD A;  1D5N A;  3VQY A;  3CRA A;  1MMM A;  1YJN V;  4DV6 B;  4EFB A;  4LF6 O;  1JQ0 A;  4DR6 O;  1AI5 A;  3BPZ A;  5E79 Z;  4UUJ C;  5KMG A;  1IX9 A;  3AEI A;  1WPX A;  4DR3 B;  3HKD B;  1YI2 V;  1MA1 A;  3SDL A;  1IDS A;  2C2A A;  5IJ0 B;  4X64 O;  4ZBM A;  1VP7 A;  2KKW A;  4O4J B;  4TV8 B;  3ASO B;  4DV7 O;  4IYI A;  3NXS A;  2B5U A;  2PTM A;  5JCO A;  2DE0 X;  1FKA O;  2F4V B;  1VIB A;  1WPB A;  3OEE G;  4IHJ A;  2DYR C;  2JGU A;  4FPP A;  5GON A;  5D5P A;  3QG5 A;  2YXH A;  4ZKI A;  1V55 C;  5IYZ B;  2HR3 A;  5KUM A;  4JI1 B;  2OT5 A;  2IH3 C;  2WAM A;  2WWW A;  4LF6 B;  4EKW A;  5IE9 A;  4G28 B;  3OGI B;  2JS3 A;  2HVK C;  2JS5 A;  3IGA C;  4CS4 A;  2L6L A;  1L8D A;  3A0B Z;  4TT3 G;  1OCC B;  1K5S A;  5J2T B;  2R70 A;  1Z5V A;  4U7O A;  1ZLZ A;  3B8M A;  1O9H A;  3ASN C;  3A8T A;  1FFT B;  4FJC C;  2ZXW B;  1KB9 F;  2RN9 A;  4O4J A;  4J42 A;  4LH7 A;  4DXW A;  4NTW A;  3GWO A;  5H5N A;  3FX7 A;  1DGS A;  2RJZ A;  2H94 A;  2EIJ C;  2Y48 A;  1XBL A;  1IBM O;  3ZJZ A;  3VQV A;  1Q8I A;  2P22 C;  1XMQ B;  3ZRX A;  4XDJ A;  4D7S A;  2ADP A;  4EEQ A;  4NYK A;  1QR8 A;  4QIW F;  4CBC A;  4LF9 B;  3STL C;  1N8R W;  4X1Y A;  3N2G B;  3AK2 A;  3JD1 A;  5A9G A;  3E2E A;  3K5L A;  1XMQ O;  3CRC A;  2K9P A;  2E5L O;  3H1J H;  2XND G;  4FVM A;  3ZN1 A;  1BL8 A;  3K08 A;  4FLU A;  4R6Z A;  3UQ8 A;  2RCV A;  5H9C A;  3K9A A;  3RYH A;  5LP6 B;  2EBO A;  1FXK B;  3BA9 A;  4KL1 A;  3ZX6 A;  4BR6 A;  3KCY A;  3C3T A;  1XNQ O;  3BAB A;  1SQB H;  3OR6 C;  1HNX B;  2P5O A;  5L3D A;  3BFR A;  4K0K B;  3CC7 V;  1OCC C;  3X2Q B;  1SQX H;  2N04 A;  1FFX B;  4IL6 Z;  4GLX A;  1NR1 A;  2DJV A;  3HB3 B;  1R3K C;  3CSX A;  3OE7 G;  3H1H H;  4MTF A;  3PJS K;  1NBM G;  4X88 A;  3JSN A;  2UU9 B;  4YJ2 A;  5LMU B;  3SR2 C;  2YIB D;  1M57 B;  3TET A;  4AIL C;  2KG7 A;  3JAT A;  5EC2 C;  1G4Y B;  1SZX A;  3HKC B;  2FL4 A;  5H6R A;  2DYS C;  4LH6 A;  3EXA A;  3D3Q A;  3ZMZ A;  3RYC B;  1VF6 C;  3RN4 A;  2HKO A;  1YVW A;  2CUG A;  3J80 N;  1XDC A;  2QM7 A;  3FB7 C;  4DR1 O;  3CMA V;  3ZHV A;  2EIL B;  1V55 B;  4LF7 B;  2QTS A;  2XAF A;  2DYS B;  5IYC O;  1M1K W;  3M8A A;  3ZRW A;  5K1P A;  1H38 A;  5CA0 A;  3CCE V;  1VQ6 V;  3OTF A;  4AQY O;  3ASO C;  1AJP A;  4RQF A;  1WP8 A;  2UUA O;  4KUM A;  2JDI G;  4MW3 A;  1ZWI C;  3MHH C;  5LXT A;  1OCO C;  3JD2 A;  3OFN G;  3VQX A;  5C93 A;  4I9W A;  3N27 A;  4LF8 B;  3UM7 A;  4I4T B;  3ZN0 A;  3AG7 A;  1SER A;  2EZP A;  4WBN B;  1NS1 A;  2W6I G;  4O4L B;  4DV3 B;  1NJI W;  2PZS A;  1KBH A;  3QF7 A;  4FM1 A;  4LBE C;  3SYP A;  4NXM O;  3LDC A;  2ZT9 B;  5JVD B;  4JI7 B;  4PDM A;  3LSQ A;  3JCZ A;  2YIC A;  1CPY A;  1H8H G;  5L3C A;  1DK1 A;  1S3J A;  3L71 H;  4UVA A;  4QE9 A;  1OHH G;  3BCC H;  4JYY A;  4K3A A;  3F7V C;  2F95 B;  1Q82 W;  4EB6 B;  2UXC B;  4ABM A;  2AHZ A;  2RNB A;  1RSO B;  3ETE A;  5LYJ B;  4WFE A;  2CE4 A;  1I94 B;  1QHT A;  1WB7 A;  4DV2 B;  2QWR B;  4B3R B;  2QR4 A;  3CCM V;  1IBL B;  3K03 A;  1PP9 H;  1YEW A;  1YHQ V;  1BMF G;  1E79 G;  1NVP B;  5FNV B;  2PY5 A;  3ABL C;  3ABL B;  1Q43 A;  3ASN B;  4GCZ A;  2GDS A;  4JTC B;  2OYQ A;  2ITD C;  3CS5 A;  3CCQ V;  5B5E Z;  1KUQ A;  4O2B B;  1N33 B;  1NTM H;  3NR7 A;  2X6C A;  2NR5 A;  4X62 B;  3P3N A;  3B40 A;  2F93 B;  3WB0 A;  1G6U A;  4XDL A;  2OCC C;  2YXY A;  1ZL8 A;  3FFQ A;  4KP4 A;  3ABT A;  2OTJ V;  4UV9 A;  2QWQ B;  1JFF A;  1S76 D;  1N36 O;  1G8M A;  1WNS A;  4O2A B;  4DUY B;  5KX5 A;  2G38 A;  3M7M X;  1W0K G;  5BR8 B;  2QWO B;  4CS2 A;  4JI2 O;  2ZIO A;  4PI0 A;  3CCL V;  4J7K A;  1WP7 A;  3AG4 B;  4LFB B;  4JAU A;  1JA8 A;  3K9S A;  3SPJ A;  1IBK B;  3OR7 C;  3ZMT A;  5JQG B;  4O2B A;  4X89 A;  4X1K B;  2P4K A;  4DR2 B;  3P30 A;  3LDD A;  1HW7 A;  2DWD C;  4WFF A;  2HHH B;  2YDE A;  2LFR A;  3BHP A;  3E8F A;  3IAY A;  3S3X A;  4ZI7 A;  5CMU A;  1N34 O;  1MSD A;  1Q6U A;  1GAX A;  3F5T A;  5IT9 N;  3MHS C;  3AK3 A;  3BAA A;  4OPA A;  5J2U A;  2PUS A;  3CX5 F;  3OMA B;  5FPO A;  2YIB A;  4PDL A;  5ITZ B;  2CH7 A;  4UCO A;  2VRZ A;  3A2F A;  2R9R B;  5EC1 C;  4MT8 A;  2Q6A A;  5JH7 A;  3DC5 A;  5B1B C;  3TXS A;  2JJ2 G;  4U3F H;  2BTQ A;  1ZUQ A;  1AJQ A;  2WLL B;  1G1X B;  4RAI A;  1K8A W;  4IYH A;  5CA0 B;  2XTA A;  1US6 A;  4G2K A;  3G67 A;  3B2E E;  1I5X A;  2QKS A;  3FYE B;  3JSL A;  3R65 A;  1VQ5 V;  1K97 A;  2Q69 A;  1F51 A;  5IWA B;  1XMO O;  4BWA A;  3TJT A;  1OCZ C;  3STZ C;  1NQT A;  3FB5 C;  1OJH A;  1FXH A;  4U3J A;  3JD3 A;  2CH7 B;  4IT5 A;  4NTX A;  1EZV H;  4YY3 B;  3T4Z A;  2ZCE A;  4ZIB A;  4FLY A;  3N2G A;  4GX0 A;  3J7A U;  1IVS A;  4B3T O;  3RYF B;  5BMV A;  5LOV B;  4WF9 V;  2A7W A;  1R3I C;  4DV0 B;  3ZHR A;  4UXN A;  5GW7 A;  4AHC A;  1S77 D;  1KEC A;  2KQX A;  1KMI Z;  2ZM6 O;  5B1O A;  2ATK C;  1MNG A;  3OGC C;  1QLE B;  1SC5 B;  4MTG A;  3IJ4 A;  3T1Y O;  4KHP B;  4FFB B;  4F6R A;  4OPH A;  1MAB G;  1LNQ A;  2W0F C;  4A5U B;  4DO2 A;  1DTO A;  3SJB C;  2YEV B;  2YI9 A;  1S0V A;  1QR9 A;  2K1E A;  1VQP V;  3JCU Z;  4TUY A;  1PPJ H;  2FYU H;  3EVK A;  1JVM A;  4Q20 A;  4DUZ B;  4PHZ A;  4NXN O;  2OIE A;  4EFE A;  3GWK C;  4W4K A;  1Y66 A;  5B66 Z;  1LUW A;  4GZR B;  2BCC H;  4FIP C;  3CC4 V;  1NI8 A;  4Z1M G;  1QCE A;  1BHA A;  3RYF A;  2EIN B;  3ETD A;  5FNV A;  3Q4H B;  1H2S B;  5LGT A;  1Y74 B;  2CTW A;  5IYZ A;  3O9O A;  3DTU B;  2HLD G;  2GHY A;  4JI6 O;  4LFC B;  3ABM C;  1VQ7 V;  3T4D A;  1NR7 A;  4HBN A;  4WFG A;  4GX1 A;  2F43 G;  1F7Y A;  4JI8 B;  2LW1 A;  1QQC A;  4GKJ O;  2AZ2 A;  4LF4 B;  3E8G A;  5KHK A;  3JAK A;  3T1H B;  4JYB A;  3S3W A;  1SQV H;  5C8Y A;  2P4V A;  1THZ A;  2GTA A;  3T1H O;  5K1X A;  1VQM V;  2CGO A;  2Q8V A;  3DGE A;  1RPO A;  2RQ6 A;  3B4S A;  4HNA A;  1HDJ A;  3OM3 B;  1JFF B;  4JI8 O;  2LJ2 A;  5LXT B;  4I7Z B;  2VQE O;  2UUB O;  1NKD A;  3X2Q C;  1DF5 A;  2E76 B;  3SYC A;  5LMN O;  3M99 B;  4XBF A;  5IJ9 B;  1GMG A;  3T2M A;  4H13 B;  3CYO A;  1XL6 A;  3A0H Z;  3AK1 A;  5EZY A;  1VEW A;  5JQG A;  2QE7 G;  1R3L C;  2NN4 A;  3UT5 A;  1J5E B;  3QO5 A;  4X20 A;  2ADQ B;  2Y69 C;  4LNU B;  4K35 A;  1ORQ C;  3N2K A;  1NU1 H;  4I50 B;  3AG2 C;  4BIZ A;  1AB3 A;  1YXB A;  4OGQ B;  1QLE C;  1QVG U;  2E3C A;  2WLI B;  2MK3 A;  4PV1 B;  3R66 A;  4LWS B;  1FXK A;  4P9O A;  1DLB A;  2EJ7 A;  4B7E A;  4I0X A;  3RVY A;  2HG5 C;  1S5J A;  4EB6 A;  4QPJ A;  5KMG B;  2WA4 A;  1RSO A;  4JV5 B;  1NTZ H;  3K04 A;  1GM9 A;  1WN7 A;  1R73 A;  1MZF A;  2V7Q G;  4H0L B;  5DED A;  4DV4 B;  3CRQ A;  4JGS A;  4GKK B;  1K33 A;  4IHJ B;  4YY3 O;  1RFY A;  1TVK B;  1ZTE A;  2OCH A;  1XHZ A;  1PL0 A;  4JI3 B;  2KG7 B;  2PYL A;  3N2K B;  4BW5 A;  4X1I A;  3OTO B;  2FKX A;  2GTS A;  5L3G A;  1L0N H;  4B7K A;  5L3E A;  1K9M W;  2LQT A;  4Z1V A;  2YC0 A;  5AG2 A;  3E89 A;  4E4E A;  4RO2 A;  2NLJ C;  2GSM B;  1S5L Z;  2R9A A;  3L72 H;  1AR5 A;  1RM1 C;  1VMG A;  1FJG O;  3SYO A;  2P06 A;  2YUA A;  1KQS U;  3FYI B;  3CCS V;  1GTO A;  3DC6 A;  4W4L A;  3RYI B;  4TWK A;  4DR5 B;  2A3Q A;  1SA0 B;  2JRI A;  4DK1 A;  5KX5 B;  2ZD9 A;  1EFR G;  2Q9L A;  3K5M A;  2ZNJ A;  1XNR B;  4X1I B;  1N32 B;  1NVP D;  4MVQ A;  1BHB A;  2YIA A;  3U10 A;  2Q7E A;  4JI3 O;  5KA5 A;  3AG4 C;  3CP1 A;  3ZCC A;  4DW1 A;  1OCO B;  2ZNI A;  5CA3 A;  3IC9 A;  2VQF B;  3ICX A;  5B1N A;  1PNL A;  4DR4 O;  2VS0 A;  4J80 A;  2F23 A;  5J9P C;  2Q7G A;  1HP8 A;  3JAL B;  2QWN B;  2P90 A;  1M56 C;  4PDV A;  4JI4 O;  5DN6 G;  1SQP H;  1FFX A;  4E2L A;  1VQ8 V;  3APQ A;  1Y76 A;  5JJN B;  3H1L H;  1WB8 A;  1JJ2 U;  1E1Q G;  3TGU H;  2CDY A;  1SQQ H;  3ZRV A;  3HKD A;  3OUS A;  5CB4 A;  1VQO V;  1Z2G A;  3RVZ A;  1R1B A;  1FXV A;  3K0G A;  4LR3 A;  4ZHQ A;  5BZB A;  4TV8 A;  2UXN A;  4CS3 A;  3I56 V;  1ARO P;  3F7Y C;  5EYP A;  2Q7H A;  4JTA B;  5GTH Z;  2IU0 A;  5CBF A;  1DF4 A;  2BOB C;  3T1Y B;  3ETQ A;  2QJ1 A;  1WAZ A;  5LP6 C;  1TUE B;  1SKV A;  4I9Q A;  4B3S O;  4PA7 A;  1HNZ O;  1U97 A;  4MVO A;  3RWR D;  1FAF A;  2WLK A;  3D3I A;  3W7T A;  3JAS A;  2WLJ A;  3OUF A;  1GN3 A;  5KAF Z;  3G80 A;  1PL4 A;  4FK5 C;  2VQF O;  4B3M B;  1BQ0 A;  1FXK C;  4QNH B;  1UJW B;  1Q86 W;  1PNK A;  4B3R O;  2GBO A;  5EIB D;  1Q6H A;  3L73 H;  4FMT A;  4JZ2 A;  3OEH G;  2UXX A;  4J7J A;  3TK1 A;  1BCC H;  2XAJ A;  5CA1 A;  2IJJ A;  1XRE A;  2ILM A;  1PKX A;  1N32 O;  4GKJ B;  4FFK A;  4P2Z A;  4LWS A;  3C90 A;  5LHG A;  5EIB C;  4MVZ A;  4I4T A;  3E22 B;  5LL6 Y;  4JI6 B;  1XOU A;  2Y4T A;  4DR5 O;  2Q0O C;  3G6E V;  4MTX A;  1FJG B;  1P7B A;  4JI5 B;  3B77 A;  4YIP A;  3FD9 A;  3RBZ A;  3JAS B;  3CJH B;  3CHX A;  4NR1 A;  1P4R A;  3DXR A;  3KZI Z;  4GUN A;  2R9I A;  4LCU C;  3AG3 B;  4X1Y B;  4LFA O;  3K5O A;  2UXD B;  4I55 A;  2Z0A A;  4ZI7 B;  1UFI A;  2A0L A;  2MW2 B;  1AP6 A;  4MSW C;  5A2Q N;  2IU3 A;  2XAG A;  3CCR V;  2HHH O;  4CH3 A;  2QTO A;  3ZHU A;  1AI4 A;  4FZ0 A;  1XUQ A;  3CRR A;  4FLV A;  2QEX V;  3JAK B;  4DV4 O;  4GKK O;  1JJO A;  1H2L A;  4B3M O;  2RMK B;  3ZHT A;  3U0Z A;  4MW8 A;  3ZMU A;  1V54 B;  2EIL C;  4UVC A;  1AJN A;  2BSK B;  1Z5W A;  3H01 A;  2UXB O;  5KHG A;  1TUB A;  3TXQ A;  2ZQM A;  4YHH B;  4JI2 B;  3CCU V;  2UXB B;  1AVM A;  4B3S B;  2EIK B;  2DYR B;  3RGB A;  1WA8 B;  4TOI A;  1K92 A;  4J7Z A;  1XQ8 A;  1T5E A;  2EZO A;  2BE3 A;  1IZ3 A;  3ETG A;  2ITC C;  4GX5 A;  1R6T A;  3RYC A;  1NT2 B;  2QSA A;  2XUM A;  4UCR A;  2HEP A;  4JAV A;  1Q3E A;  3GB7 C;  5CBH A;  2PF4 E;  5J2T A;  3ABU A;  2FML A;  4X66 B;  1YIT V;  2IH1 C;  3U11 A;  4D7T A;  2QKA A;  2QDO A;  1YCI A;  2WA3 A;  4JI0 O;  4RUF A;  3E35 A;  2ZKO A;  5H6Q A;  5B3S C;  3ABM B;  1L0L H;  2H3O A;  3KG2 A;  5CN0 A;  3C3S A;  1IUR A;  1BS3 A;  4UV8 A;  4JI4 B;  4FLW A;  5LMN B;  4AI8 A;  2WPD G;  4FLX A;  3QO7 A;  1GN6 A;  4FM2 A;  4HZ3 A;  1XNQ B;  1YZB A;  3L9D A;  5BY1 A;  3WG7 C;  1XHX A;  2YI8 A;  3A0R A;  1W59 A;  1GM7 A;  1EN5 A;  1K7D A;  1IBL O;  2VQE B;  2UUB B;  3H9V A;  1VQ9 V;  1PM9 A;  1FS0 G;  1M90 W;  1JMK C;  1K3E A;  2XAH A;  2ZDI A;  3JAM N;  3MD0 A;  3SYQ A;  1S72 V;  1TVK A;  4PA9 A;  4CC5 A;  1W2B U;  1L1F A;  2FTK A;  5EYP B;  1B04 A;  2P7T C;  2OWO A;  1X59 A;  1MSW D;  4LFB O;  3G71 V;  4CH5 A;  3LDE A;  4LFC O;  1CP9 A;  1BQZ A;  1HNZ B;  5ITZ A;  3DSQ A;  3W7S A;  3TCU A;  4UCV A;  4MS2 A;  1F4N A;  5JH7 B;  5JJJ B;  2F1M A;  4O4H B;  4YJ3 B;  4JI0 B;  5EBW C;  4UB6 Z;  4X66 O;  4LP8 A;  2JJ1 G;  1SF9 A;  1J95 A;  2X6A A;  4NXN B;  4YJ2 B;  4DRX B;  2EJR A;  5IYB O;  4N23 A;  2WLN A;  4DUZ O;  4TSF G;  4WFH A;  4Q6G A;  3OTO O;  3K57 A;  2GUZ B;  2V4D A;  4D6T H;  5IY5 B;  1VAR A;  3P3P A;  3CWB H;  2ZM6 B;  5LBQ A;  1TAE A;  2CTQ A;  5IJ9 A;  1TGO A;  5TIS Z;  5BMV B;  5LOV A;  4YHH O;  1M56 B;  3UCS C;  2Y0I A;  3K06 A;  4DV7 B;  5F2V O;  1SQF A;  2V1D A;  2ZR3 A;  3I55 V;  5L3B A;  4X64 B;  1AI7 A;  1I08 A;  2HP8 A;  4DV2 O;  2B9Z A;  5KAI Z;  4FFB A;  4F6R B;  1YJW V;  4G27 B;  4BIU A;  1VQL V;  3W7W A;  1GM8 A;  3AG1 C;  1ZL8 B;  1XMO B;  3ZBH A;  3CRM A;  3HKB B;  5IWA O;  3CPW U;  4P30 A;  4RWU A;  1SZT A;  2UXD O;  1KP3 A;  3L70 H;  3LNM B;  4PA6 A;  4LFA B;  3ABK C;  4JZG A;  1M57 C;  1GH6 A;  2CAZ C;  5CB4 B;  3GVM A;  4MVS A;  1NH2 B;  2BSK A;  1OZ0 A;  2IJH A;  5EBM C;  1URF A;  3J81 N;  3D8C A;  1RM1 B;  1H2M A;  3JAW B;  5HFL A;  5JCO C;  4NXM B;  4JI5 O;  2HFE C;  2ZE7 A;  1NH2 D;  1MOF A;  5JVD A;  2DN9 A;  1XI1 A;  4HYO A;  1YTF B;  4FLZ A;  3UO3 A;  3OAA G;  3LSU A;  5LP6 A;  3CXH F;  3THO A;  3K59 A;  5LHI A;  5KLV H;  1TA8 A;  2A06 H;  3OW2 U;  1WLE A;  1LR1 A;  4P9P A;  2CK3 G;  3HKB A;  3T1C A;  1D2D A;  1Q5O A;  2BOC C;  2UUA B;  4J10 A;  2HVJ C;  3KKY A;  1MZE A;  5IJ0 A;  3RT3 C;  5CA1 B;  2EIM C;  2OIG A;  1P49 A;  4TV9 B;  1CEZ A;  2IM9 A;  3QVN A;  3JAT B;  2B1G A;  3KCX A;  5GON B;  4OX9 O;  4BAY A;  4ASU G;  4JV5 O;  4F4L A;  3WG7 B;  5LA6 B;  4DR1 B;  2EIJ B;  2EUL A;  2Y0P A;  4YIO A;  3VBB A;  3QO8 A;  2GV9 A;  2YXL A;  4CZZ A;  1OV9 A;  4JAS A;  1Y6X A;  1P84 F;  4ZOL B;  3B09 A;  1W0J G;  1N4C A;  1A32 A;  1GRJ A;  2Y69 B;  4IIJ A;  4U3J B;  3OMI B;  1H8E G;  4R7C A;  5LMU O;  4X62 O;  1QBZ A;  2ZIM A;  3QTC A;  1U96 A;  2W0X A;  5B1A C;  4JI1 O;  4CH6 A;  1F23 A;  4DV1 B;  4K0K O;  4KHP O;  5BXZ A;  2WLI A;  4K8Z A;  2AHY A;  1HNX O;  2HJD A;  3SGI A;  1KD1 W;  3HKE B;  1GKF A;  4X65 B;  2ZE5 A;  4I0X B;  3FAV A;  4C7U A;  4DR4 B;  2XAQ A;  5LA6 A;  3HPL C;  4PI2 A;  4BW9 A;  4O4H A;  4J41 A;  4WBN A;  2P6J A;  1FPO A;  4ICG A;  4O4L A;  1Q6I A;  4X1K A;  3LNN A;  4RQE A;  1IXB A;  1K4C C;  2KSD A;  2JEU A;  2UXC O;  1I94 O;  2JGD A;  2XOK G;  3CME V;  1XL4 A;  2YSU B;  4DR6 B;  4DW0 A;  1SRY A;  1QLN A;  5KUK A;  1JCH A;  2PI5 A;  5KHI A;  4JYA B;  3BY6 A;  4LF4 O;  3ZHQ A;  4PDR A;  3AG1 B;  2UUC O;  1F4M A;  1V9P A;  1XNR O;  3W7X A;  1HWY A;  1GN4 A;  2PYJ A;  1H2G A;  5JJE B;  4JI7 O;  1I7F A;  3CE2 A;  2ZE6 A;  4UFZ A;  1Y4M A;  3K0D A;  3SJC C;  3HKE A;  2QM4 A;  3AG3 C;  2R72 A;  1N0J A;  2YS8 A;  2ETN A;  1NTK H;  1PV0 A;  4H37 A;  2IBZ H;  4B08 A;  3O65 A;  2PI4 A;  4FM0 A;  5DM6 V;  3JD0 A;  4NKG B;  4JPR A;  5B1A B;  1YDX A;  5D5Q A;  2JGD B;  1VF7 A;  2DQ3 A;  1N34 B;  4IGG A;  5H2F Z;  1VF5 B;  4UB8 Z;  3CEI A;  3SPI A;  2LGW A;  2DW4 A;  4NTY A;  4J11 A;  2P67 A;  3D36 A;  3HKC A;  5CBG A;  3E22 A;  2ARH A;  2A79 B;  1B3Q A;  1XEQ A;  5E1A C;  2DWE C;  4R50 A;  2CGN A;  1IBK O;  3JAW A;  4H44 B;  5DEC A;  1RP3 B;  2F4V O;  1KYO F;  3E83 A;  2ODM A;  1M9N A;  4DUY O;  4O2A A;  4TQF A;  1E1R G;  2Q0A A;  1N36 B;  3SPC A;  4DR3 O;  4DYL A;  4JAA A;  1JPX A;  1RPR A;  1K34 A;  3B8N A;  2ZIN A;  1O9G A;  3WU2 Z;  2L35 A;  3BVO A;  1QVF U;  1D5A A;  1Y76 B;  4DR7 B;  2EIM B;  3HR0 A;  1Q90 D;  4PA3 A;  2LP7 A;  1H2N A;  3ZHS A;  2M7W A;  1R6K A;  1BSM A;  4KFM A;  2UU9 O;  2PGG A;  1J5E O;  3ZMV A;  4DRX A;  1AIL A;  3OT7 A;  1R3J C;  2X6B A;  1ZSP A;  1EBO A;  2GUZ A;  2ZE8 A;  1KKC A;  3Q4H A;  3RYH B;  4JF3 A;  4K8X A;  1YSC A;  3ML0 A;  1Y74 A;  4HAM A;  3P32 A;  2ZXW C;  3WFV A;  4WCE V;  2D3O W;  3F5W C;  2QGN A;  1M5I A;  5IY5 C;  1KP2 A;  2DQ0 A;  3SJQ C;  1HR0 B;  4O4I B;  4ZOL A;  2WLL A;  3L75 H;  1LUV A;  3EHB B;  2IJK A;  1YJ9 V;  5LYJ A;  3WB1 A;  2Q5Z A;  1QNM A;  1K73 W;  2CTP A;  4DR2 O;  2D2C B;  1HNW B;  4N21 A;  5C8Y B;  3G4S V;  1NZ6 A;  2M6Y A;  2X0L A;  1K5Q A;  3SPH A;  4DV5 O;  4Z2W A;  1H2K A;  3CC2 V;  1ENV A;  4WFB V;  2LW7 A;  5IYD O;  1ROP A;  5HFM A;  5BR8 O;  3MAQ A;  2AZ0 A;  3EFF K;  3RW0 A;  1BGY H;  1AP5 A;  4MVU A;  5LGU A;  1B6Q A;  2OCC B;  1FD9 A;  4MVR A;  1VQK V;  2JEX A;  1BE3 H;  2QA4 V;  4PJ0 Z;  4QJF B;  1XIL A;  2X7R B;  3IC7 A;  3H1K H;  3LUT B;  1B06 A;  4O4I A;  3CJH A;  4WFA V;  4I50 A;  3DXR B;  2DOS A;  3OD4 A;  2Q68 A;  2Q73 A;  2W6J G;  1GN2 A;  4UCT A;  2E75 B;  2ZR2 A;  1N33 O;  4J9Y B;  2JVD A;  4MVM A;  5KA6 A;  4RUE A;  1KKD A;  3CCJ V;  4NVP A; 
#chains in the Genus database with same CATH homology
 1WJZ A;  2Y4T A;  2QWP B;  2N05 A;  1IUR A;  1BQZ A;  3BVO A;  2GUZ A;  1N4C A;  3UCS C;  4J80 A;  2QSA A;  2Y4U A;  4RWU A;  2YUA A;  2QWO B;  2LGW A;  2PF4 E;  2QWN B;  2L6L A;  2DN9 A;  2CTW A;  2YS8 A;  4IT5 A;  2CTP A;  2LO1 A;  3APO A;  3UO3 A;  2DMX A;  2KQX A;  1FPO A;  3UO2 A;  1FAF A;  1NZ6 A;  2M6Y A;  2GUZ B;  2N04 A;  1XBL A;  2CTR A;  1HDJ A;  2QWR B;  3APQ A;  4J7Z A;  1GH6 A;  1BQ0 A;  2CUG A;  2QWQ B;  2EJ7 A;  3AG7 A;  2OCH A;  2CTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...