2QWRB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the amppnp intact form
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
92
structure length
92
Chain Sequence
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
molecule keywords Heat shock cognate 71 kDa protein
molecule tags Chaperone
source organism Bos taurus
total genus 29
structure length 92
sequence length 92
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwrB00
2Y4UA 1IURA 3BVOA 2GUZB 1HDJA 1FPOA 2M6YA 2CUGA 2QWOB 4IT5A 2DMXA 2PF4E 2EJ7A 2QSAA 1FAFA 3AG7A 4RWUA 3APOA 2QWNB 2CTQA 1NZ6A 1BQ0A 1XBLA 2KQXA 2Y4TA 2OCHA 2YUAA 3UO3A 2DN9A 3UCSC 1BQZA 2GUZA 2CTWA 2YS8A 1N4CA 4J7ZA 2QWPB 3APQA 2LO1A 2LGWA 2CTRA 2CTPA 2N04A 3UO2A 2QWRB 4J80A 2L6LA 1GH6A 1WJZA 2QWQB 2N05A
chains in the Genus database with same CATH superfamily
4BIUA 2WA4A 1O9GA 5KMGA 2M6YA 4FLTA 3CYOA 3SPCA 2WLMA 3SJQC 4ZKIA 3CCUV 3I55V 4PHZA 4YIPA 1IDSA 3W7WA 1H8HG 1VIBA 2OTJV 5LA6B 2A3QA 3E8HA 3OTFA 4YXWG 1KKCA 5EBLC 4OGQB 1A32A 4X65B 3UKMA 5EK0A 1Q81W 4DR6O 3OD4A 4DUZB 4B3RB 2ZE8A 5JCOA 1VQMV 2DN9A 3JD2A 4JV5B 2M7WA 2CTWA 3VBBA 3B8NA 2FMLA 4JTDB 3VQVA 1ZUQA 1AR5A 3CXCU 4LFAB 2VS0A 4FIPC 2GTAA 1Q6HA 2CH7B 3L75H 4DR4B 1IBLB 4NR1A 1WB7A 4TSFG 3O65A 2IJHA 2WSSG 4I4TA 5ITZB 1W2BU 4TV9B 1KD1W 4HNAB 4RAIA 3DXRA 1M1KW 4JI5O 1NI8A 1YDXA 1WLEA 3TXSA 1XEQA 4L8JA 1KKDA 3CCVV 3OW2U 3K57A 1TAEA 3A2FA 1TUBB 1K92A 2EILC 2QE7G 4I9QA 1FXKB 5H2FZ 1NVPB 1AP6A 4X20B 5AG2A 4H33A 3H1IH 4FFBB 4K8XA 1KMIZ 2DYSB 1N33B 2RCVA 3B40A 4B3MO 4O4LA 5EYPA 1XNRO 2RQ6A 4AILC 2UUBB 1JOYA 4DV5O 3DC6A 4X1KA 1YSCA 5D5QA 1GK9A 1K7DA 1IX9A 3BA9A 3ZMVA 1U96A 4QIWF 5GONB 4MW8A 3K5LA 3CJHB 5FPOA 1P84F 2XUMA 4PI0A 5KX5A 5J2UA 4ZIBA 2JJ1G 3HKDA 4WBNA 2QEXV 1KBHA 1ZSPA 1WJZA 4JI2O 1OCOB 3CS5A 4UCRA 1YI2V 3ETGA 2IW5A 3IC9A 1BL8A 5B5EZ 3E86A 1VP7A 2A9HA 1VARA 1F4MA 2BOCC 1NH2D 1VQNV 2YIBA 3JALA 3G80A 3RW0A 1ROPA 1DF4A 1S72V 2R9AA 2ZIOA 3CCMV 3OUSA 2FL4A 3T2MA 1SA0B 1YTFB 4NXMB 1SS3A 3SYQA 1VQ5V 3RYCA 3JD4A 5CA1B 2PF4E 3Q4HB 4LP8A 3SJBC 2Q4PA 1OV9A 1K73W 4FPPA 1LUWA 3K03A 3AG2B 1F51A 4UCSA 4PDVA 4X65O 3TCUA 1WA8A 4NYKA 2UXDB 5KHJA 5LYJA 4GLXA 4X8AA 1XDCA 1JA8A 4BIZA 2QWNB 3A0BZ 2N74A 2WLLB 4ZOLA 4WFBV 1FYJA 5HFMA 1R6KA 4HYOA 4J7ZA 4I50B 1IBLO 3TK1A 3GVMA 3SPJA 2QKSA 2LGWA 4FM2A 3BY6A 1PV0A 1P49A 2Y0IA 1PM9A 4FJCC 3K5OA 4DV1O 3GB7C 1MSDA 3CMEV 5LGNA 3AG3B 3SYPA 3CCQV 4JI0B 4D7SA 3AG1B 2EILB 4JI3B 2UUAO 2Q73A 2X6BA 1KYOF 2GHYA 1GM8A 2QTSA 3KG2A 1Q7YW 1K8AW 2Q0OC 1CP9A 4NKGB 2ZD9A 3HKBA 4TV8B 5IWAO 2XHBA 2IH3C 4RQEA 1E1RG 1M57C 3M99B 1H2GA 2F93B 2E74B 1ZWIC 4DR2B 2B9ZA 3N2GA 1VEWA 4TQFA 1DF5A 2F4VO 4FLXA 1YF2A 3ASNC 1G8MA 1GAXA 1O9HA 2LW1A 3B09A 5KHIA 3KKYA 4FK5C 4Z2WA 5B1BB 5FPRA 4EFBA 3STLC 3GWOA 2Q5ZA 1Y4MA 2Q9LA 2G38A 5KUMA 1S76D 3MHSC 2JK5C 2LJ2A 2P6JA 4B7KA 2DYRC 3QNEA 4PDLA 4E4EA 1D5AA 4CH4A 3N2KB 4MTFA 2ZDIA 2N05A 3L74H 1AVMA 3LDCA 3CMAV 1FAFA 4JAUA 3UT5B 2P5OA 4JASA 1HNWO 3AG4B 5HFLA 3O9OA 2D3OW 4B7EA 1K4CC 1L0NH 3G6BA 5CB4A 3SYOA 5B1AB 2EBOA 1Y66A 4TUYA 4LF9B 3D36C 2JDIG 4H44B 4AQYB 2YI9A 2EIMB 1I94B 4LBEC 2XASA 2IM9A 4LWSB 2F95B 4RO2A 2D2CB 1U97A 1BMFG 4K0KB 3JD1A 4JTCB 2RDCA 4DR3B 1R73A 4K8ZA 4WCEV 3LSSA 1N32B 2OCCB 4JI4B 3U11A 1GM9A 1L0LH 3ZRSA 1K3EA 1X4TA 3OTOB 5JWPA 1Q6UA 2CE4A 4B3TO 3ZHTA 2W6JG 1FPOA 1NS1A 5LHHA 1US6A 3W7XA 2YUAA 3CX5F 5L3DA 1I5YA 5H5NA 3TXQA 3ZMTA 4U3JA 4PJ0Z 4JZGA 4LNUA 3LDEA 1JCHA 3ASNB 5L3GA 1KUQA 2YXLA 1HDJA 4DR2O 2LFRA 4G2KA 5F2VO 1M5IA 4O4JA 4JPRA 3GWKC 2EIKC 3M7MX 3OFNG 1YJWV 3IC7A 3ZHRA 3BAAA 4FMTA 2JEUA 2LO1A 2QA4V 3FB5C 2VQEO 5IYZA 1VF7A 4DRXA 4ZHQB 3CP1A 3N27A 4JYCA 5LBQA 2EINC 2WAMA 4PA3A 2XNDG 5GTIZ 4XDLA 1MOFA 4EEQA 5LOVA 1NTKH 2JS3A 4BW9A 2HHHO 3ZHUA 2P90A 2ZE6A 4DR6B 4MW3A 5EZYA 3CB2A 2NNUA 4I0XB 1Y74B 5CA0B 3JARB 5FNVB 5IYDO 1JFFB 2ITDC 1SQQH 4Q6GA 5JVDA 2IH1C 3MHHC 2EZOA 3ZRWA 3K0DA 1YITV 3RYIB 1K33A 2X6AA 1BQZA 1MZEA 3B77A 3SPGA 3ZBHA 3J7AU 4JYAO 2B5UA 3ZJZA 3J80N 2OT5A 2QKCA 2ATKC 2KKWA 3AG7A 4JI5B 1NJIW 3ASOB 1PPJH 4J9ZB 1I94O 1SZTA 2EIJC 3CWBH 1S5JA 3OAAG 1QQCA 2H8PC 4Q20A 3H1KH 4LF8B 2JGDA 4EKWA 4DR3O 4O4IA 1VQ6V 2X6CA 4KXRA 3I5DA 1UPGA 4LF4O 1V9PA 1M93A 3OGCC 4GX1A 4JI4O 1AI7A 3JAMN 2ZNIA 3ABLB 5CMUA 2NR5A 4B3MB 1E1QG 3APOA 2BTQA 3H1JH 3QO8A 3OTOO 1CPYA 3CSXA 3K04A 4R50A 4DV5B 2CGOA 1GN3A 4ZI7A 1AR1B 2PTMA 3TJTA 4MSWC 4UB8Z 3G71V 1SESA 4OX9B 1Z5WA 1MSWD 2HEPA 3ZRXA 2ADPA 3HR0A 2OIGA 1QVFU 3BFRA 5L3CA 4GYCB 4RWUA 2ODMA 3RWRD 4CH5A 4DV7B 4DUYB 4JI2B 4DV6B 1VF5B 3ZIAG 3C3SA 4D7TA 4EB6A 5K1PA 1EM1A 3ZHVA 5KA5A 1MMMA 4UCTA 3ZMUA 4PA9A 2VRZA 2QSAA 1W0KG 1WB8A 1WP8A 1NZ6A 3HKEB 1YVWA 5FLXN 4UCUA 2JS5A 3RVYA 5JJJB 1KU9A 1XUQA 2N04A 1JMKC 4J80A 1YXBA 1GH6A 1XMQB 1Y76B 1VQKV 1N36B 1H2MA 2PUSA 4RUFA 5KUKA 2GDSA 2UXCO 3E89A 1FFXA 4X1IB 4CH3A 3ZRVA 1SQBH 1V55B 4LCUC 2Q8VA 3J81N 4UVAA 4X20A 1QR8A 2WLIA 2CUGA 4LH7A 3ICXA 5TISZ 1S77D 3KZIZ 2MK3A 1EN6A 4DV1B 4KUMA 4QE7A 3SJCC 5KMGB 3JCUZ 2F1MA 2UUAB 2BSKA 3BRCA 2AW9A 3JAWA 3K5NA 3CPWU 3ZMSA 1FXHA 4NB5A 1G6UA 3EXAA 4EFEA 1AROP 2UUCO 4LF8O 3MDSA 2RNBA 1H2NA 1BHBA 5LMUB 4W4LA 4G28B 5LXTA 4MVQA 4J7JA 4LF6O 5IWAB 2YSUB 5K1XA 3L70H 1R1BA 1AI5A 1XMOO 4UXNA 3BEHA 2ZQMA 4NXNB 3OEEG 4X64O 3WFVA 3FB8C 2VQFB 1YJ9V 2BCCH 2P06A 2QWOB 1VQ7V 3RYFB 2UU9O 2F4VB 1SA0A 2Y4TA 2Y0PA 4OX9O 3OUFA 1HWYA 1OCCC 2PYLA 2IU3A 1HR0O 2YS8A 5JQGA 3DC5A 4YJ3A 4JI8O 3ABMC 4LF7B 3ML0A 3NXSA 1FKAO 1ORQC 2HJFC 1M90W 4DV7O 4I4TB 3CRMA 4XDKA 1JQ0A 4DUYO 3MAQA 3ZEDA 2DW4A 2DE0X 3DXRB 4DV6O 4JZ2A 3K59A 1LNQA 3B8MA 1N8RW 4ZBMA 4U7NA 4P9OA 1AJQA 1BCCH 1B3QA 5A9GA 1LUVA 2RJZA 2HJDA 1S5LZ 3A8TA 3IGAC 2W0FC 5GW7A 4DK0A 3FYEB 1HNWB 1JJ2U 4DO2A 5H9CA 4KHPB 2Z5UA 5EYPB 1M9NA 1XMQO 5CA3A 5BMVA 4X1KB 5JJNB 2LW7A 2P4KA 4PA7A 4DV3O 1N36O 3ABKC 4A5UB 3QTCA 1H2LA 3FB7C 5DECA 3E83A 4IGGA 5IJ0A 3CCEV 1QU7A 4YIOA 1BZKA 5KX5B 5J2UB 1OZ0A 3HKDB 4E2LA 4WBNB 3T1HB 2IBZH 4IIJA 3RVZA 3F5TA 1BT8A 1KP3A 2XOKG 1NKDA 4LFBB 3K79A 4YJ2A 5LMNB 4FZ0A 3H01A 4TWKA 1UJWB 4JI1O 2W0XA 3WU2Z 2L6LA 3E8GA 3FYIB 4F6RA 1P7GA 1VQLV 3JALB 1I08A 3K0GA 2P7TC 1ZLZA 4X1YA 2ARHA 4PD4F 2XT9A 1Q90D 4DW1A 3IFXA 2ZXWC 4B3TB 2ZDIC 1KB9F 3RYCB 1WPXA 3G6EV 1VQPV 4MVMA 3QF7A 2JIZG 3E35A 4X89A 5LMUO 1XL6A 3BVOA 3C3TA 2X7RB 4O2AA 4B3SO 4OPAA 4NXNO 1WA8B 5LGUA 5LYJB 5A2QN 2VWKA 3RGBA 3ETDA 1R3JC 2CK3G 2VQFO 2FTKA 3EVKA 4QGPA 3ABMB 5EBMC 3L71H 2KG7A 4DK1A 3OM3B 3JASA 2K9PA 2Q67A 4XBFA 4DR1B 5LHGA 3OMAB 4ZOLB 1HNZB 1GO3F 4GX2A 1PKXA 3F7VC 4UCOA 2VQEB 1NR1A 4LF7O 2BOBC 3X2QC 1HP8A 4OXSA 2P22C 4J11A 1BGYH 2WWWA 3PJSK 4IHJA 2CGNA 3SR2C 1X59A 4MT8A 4JTAB 4FLZA 1TVKA 4FFKA 5B1NA 4PELA 1QLNA 4AHCA 4I5SA 3ABUA 5CN0A 2HHHB 4QPKA 2BTOA 5LP6C 5B3SC 1PNLA 3L9DA 3HKBB 4Z1MG 1XBLA 2ZCEA 3RYHB 4X88A 2PZSA 3R65A 4MTXA 5IYCO 4KHPO 2RN9A 4NTYA 4I55A 5DN6G 1OCRC 1EN4A 1M56C 3N2GB 3ZN0A 4JYAB 3K9SA 3FAVA 3L72H 4J9YB 3FX7A 2K1EA 1TA8A 1GMGA 3T1CA 1VQ9V 1IBMO 4FM1A 2QM8A 3D3IA 1FJGB 1S3JA 1JVMA 3E22A 4BAYA 3LSQA 3T1HO 2QWRB 2OTLV 4DW0A 1MG1A 2A0LA 4DV0O 1UFIA 2V7QG 4LFBO 1IVSA 3OR7C 2ILMA 5LMNO 1ZL8A 4DV4O 3BABA 3AK2A 1XREA 1PP9H 3P3NA 4HBNA 2ZNJA 2KSDA 1P4RA 4LF4B 3K9AA 3UO3A 3OEHG 4O2BA 2E75B 1F7YA 4BWAA 3W7UA 5LP6A 2F23A 3JAKB 1RM1C 3KCXA 2PI5A 1QLEC 1BHAA 2Q69A 3CE2A 4ASUG 1NT2B 1M57B 2QR4A 1ENVA 3F5WC 2QGNA 4L87A 4NTXA 3QVNA 2LQTA 2Y69C 5IJ9B 2FYUH 5CB4B 2IJJA 4BIOA 2VWJA 2AZ0A 5LHIA 4CH6A 2UXBO 1N34B 4TUYB 4LR3A 5KAIZ 2Y4UA 1Q3EA 2P67A 2JGUA 3T1YB 1VMGA 2ZT9B 4GKJO 4DR1O 1AJNA 1PNKA 5CA0A 3D8CA 5FNVA 3ZHSA 1NR7A 2ZE5A 4MVOA 1HNZO 1R6NA 2RMKB 1R6TA 4MS2A 2DYRB 3WB2A 5IY5C 2ZM6O 1SKVA 1S5HC 2EJRA 1YCIA 1QCEA 5BY1A 5JH7A 3CC2V 2AHYA 1I0HA 2XAGA 3CRCA 5C8YA 2LGQA 2JRIA 4CS2A 3LSUA 1XNQO 5EIBD 5BXZA 2L35A 2CTPA 3UO2A 3SYCA 1XI1A 2UXCB 1AJPA 3HKCA 2PYJA 4J42A 2HLDG 4XDJA 1XHXA 2HP8A 2YICA 4U3JB 4GUNA 1ZX3A 2DMXA 4KP4A 1Z2GA 3RN4A 1XL4A 5J9PC 4LNUB 3EHBB 5KA6A 4FLWA 4DXWA 1OCZC 1OJHA 3H9VA 4X62O 1ZTEA 4PDMA 1XILA 3HB3B 4O4JB 1B06A 3D3QA 3S3XA 1FFTB 4CC6A 3C90A 3FD9A 3RT3C 1P7BA 4P30A 1GRJA 3JSLA 1FJGO 1Q86W 4CC5A 4FM0A 1DGSA 3OE7G 2YIDA 4DRXB 5IYZB 3E8BA 4GX0A 1HW7A 2QWPB 1SQFA 2UUCB 3JATA 3BA8A 4JF3A 1RM1B 4KFMA 4JYBA 4LF6B 2OIEA 1JJOA 5LOVB 5J2TA 1I5XA 4WFEA 4LFCB 2W6IG 2EJ7A 1XMOB 4I7ZB 4X64B 1K5SA 1B04A 1WPBA 5EZYB 1PL4A 3A0HZ 4PA4A 4F4LA 2Y69B 5JVDB 1KECA 2UU9B 5EBWC 3ZRWB 2JVDA 1HR0B 4R7CA 2YEVB 1SETA 4JI8B 3OMNB 1FXKC 3ZMZA 5L3BA 5LA6A 2EIKB 4HZ3A 4N23A 5CBFA 2R9IA 4GX5A 5B1OA 1N34O 2DYSC 2GTSA 5L3EA 1IBKO 3ETEA 1YHQV 4X1IA 3T1YO 3WB1A 2H3OA 2WA3A 2IJIA 2MW2B 1H38A 3I56V 3B2EE 2JGDB 2QM7A 2EINB 2HFEC 3WB0A 3F7YC 4O4IB 2KQXA 2XAQA 1H2KA 2CH7A 1NQTA 3SPIA 1XHZA 4PI2A 1XOUA 3K3WA 3WG7C 1Z5VA 2Q68A 5ITZA 4TV9A 1VF6C 1WNSA 5GTHZ 1OCOC 5KLVH 4HNAA 1TUEB 5E1AC 2P4VA 4ZI7B 4DV3B 4X66B 4YY3B 3P3PA 3LDDA 4LF5O 1FXVA 3SYAA 1NTMH 1OCZB 1W59A 2B1IA 1K9MW 1DLBA 2OYQA 1TUBA 2CAZC 2GV9A 5JJEB 1FXKA 1URFA 3K5MA 2JJ2G 4R8CA 5DM6V 1Q5OA 4MVRA 5BR8O 1RSOB 4O4HB 4FFBA 3LUTB 2GUZB 3SGIA 4EB6B 3BPZA 1GTOA 4JI1B 1SQVH 1MABG 2XAFA 1Q82W 2EIJB 2DJVA 3T4DA 3FFQA 3HPLC 4PA6A 3AG2C 3RYFA 4ICGA 2HVJC 5GONA 1PL0A 3MD0A 4D6TH 1QBZA 3CJHA 3FKSG 2WPDG 4IL6Z 1D5NA 3BCCH 2AXTZ 2YDEA 1D2DA 4J7KA 1I7FA 3DGEA 1VF6A 2Q7EA 1K34A 2V4DA 1MZFA 3VOUA 3U0ZA 2JEXA 4P9PA 4JI7B 3G67A 4LFCO 3CCRV 4JI6O 4B3SB 4DYLA 1FFXB 2EZPA 4P2ZA 1L1FA 1SF9A 2YXHA 3AG3C 3AG1C 5KHGA 1QR9A 3JD0A 1RP3B 2LP7A 3IAYA 2QJ1A 1PNMA 1SZXA 1NBMG 2B1GA 5CA1A 1G1XB 2EX3A 2WLIB 3Q4HA 3BHPA 1JX9A 4H13B 1NH2B 4CBCA 2H94A 5IYBO 4JAVA 3STZC 2KB1A 1AI4A 4FVMA 1NVPD 4J10A 4BR6A 1SQPH 2BSKB 3JAWB 4DR7O 4AI8A 3UCSC 2X0LA 2YXYA 3H1LH 3OGIB 1Y6XA 3ABTA 3WG7B 2WLLA 5LXTB 1QHTA 5CBHA 3VQYA 2O57A 4I50A 2IU0A 2WLJA 5B1BC 4O4LB 1B6QA 2ADQB 1J95A 3AEIA 2UXNA 2UXXA 5EC1C 2F43G 1IXMA 1KC8W 4X9QA 4X66O 4YY3O 3P30A 3KCYA 3K06A 4MTGA 4B08A 1GN4A 2R70A 1LR1A 3DSQA 1IBMB 1L8DA 2DOSA 5JQGB 4YJ3B 4N21A 2XTAA 4W4KA 1AILA 3OR6C 4DV0B 3EFFK 4TV8A 3AG4C 2Z0AA 3W7TA 4FLUA 1YTFD 2YIAA 5KAFZ 1FS0G 4DV4B 1H8EG 4DR5B 4C7UA 4DUZO 1ZAUA 1JR9A 4B3RO 3CC7V 1EBOA 4JV5O 1AI6A 3OT7A 3CRAA 5B1AC 2YC0A 4TT3G 4LFAO 3G4SV 1F4NA 2OCHA 4H0LB 1T5EA 3ZHQA 4UB6Z 4DR4O 5EC2C 2A7WA 4WFGA 4TOIA 3ZS8C 2EIMC 4WFAV 4TQDA 2YI8A 5BMVB 4DV2B 5C93A 1WAZA 4JI7O 1GM7A 2E5LB 1AB3A 4HAMA 3N2KA 3M8AA 1J5EB 2UXBB 2Q7HA 5IJ0B 2OCCC 1OCCB 4F6EA 2AGAA 1EN5A 3APQA 2YIBD 4GKJB 3RYHA 4IIJB 3CXHF 3UT5A 4WF9V 2ZIMA 3AK1A 4YJ2B 1N33O 4CZZA 4IT5A 3K58A 4JYYA 3E2EA 4YHHB 2UUBO 2E76B 4GT1A 2ZM6B 4GCZA 5KHKA 4F6RB 4QNHB 1EFRG 3P32A 3H1HH 4X1YB 1G4YB 4GKKB 2DWEC 5EIBC 2ZR3A 2WLNA 3VQXA 1M4UA 4QJFB 4UVBA 3JCZA 4CS3A 4IYIA 2AZ2A 1XNQB 3U10A 1WN7A 2E3CA 4J41A 4IYHA 3CCSV 2Q6AA 1HNXB 3JYCA 4FLVA 4UUJC 4UCVA 4LWSA 1N4CA 5IE9A 3TGUH 3CRRA 1DK1A 5LL6Y 3ABKB 5DEDA 4O2AB 1Q6IA 2QDOA 4RQFA 1RPRA 3JSNA 2QWQB 2Q7GA 4X62B 2IJKA 3JAKA 2HG5C 3CC4V 2KG7B 5E79Z 3JASB 3THOA 4NXMO 4ABMA 2XAJA 1CEZA 2ETNA 1IZ3A 1BS3A 2DWDC 4LH6A 1FD9A 1V54C 3VQWA 2CTRA 3TETA 1F23A 4CS4A 2DQ0A 1SQGA 5KHHA 1EZJA 5L3FA 3JD3A 5IJ9A 4IHJB 1THZA 4FLYA 4DR5O 2UXDO 3OMIB 1TVKB 4UVCA 1OHHG 2ZXWB 4KL1A 1VQOV 3QO5A 3E8FA 4JGSA 5IDJA 1QVGU 2Q0AA 3ZX6A 1R3KC 2WLHA 3QG5A 2HR3A 1YIJV 1RPOA 4NTWA 3R66A 3T4ZA 2FB5A 1COWG 1IXBA 1N0JA 2GSMB 3ASOC 1K5QA 1H2SB 1AR4A 1JPXA 4I55B 1WP7A 5IT9N 4PDRA 4ZHQA 4R6ZA 4DV2O 4JI0O 4JI3O 3FAVB 2E5LO 1SC5B 4JAAA 1VQ8V 1J5EO 1SRYA 1SERA 3SJAC 2A79B 2OWOA 5BZBA 1IBKB 3ABLC 2ZINA 3E22B 2XAHA 2QM4A 5H6RA 1KQSU 1R3LC 3UQ8A 3X2QB 4I0XA 1Y74A 3JARA 1K97A 4I9WA 2PI4A 1JFFA 1EZVH 1ZL8B 1XQ8A 4WFHA 4YHHO 1MA1A 3L73H 3RYIA 3CCLV 3D36A 4O2BB 4NVPA 2LFSA 3PN1A 3AK3A 3A0RA 5LP6B 2R72A 4GKKO 5B3SB 3NR7A 3W7SA 1SQXH 3ETQA 2QKAA 4U3FH 1HNXO 4LF5B 2Z3YA 2F66C 3UM7A 2CDYA 1OCRB 1R3IC 1IURA 2ZR2A 3CEIA 4Z1VA 1MNGA 1M56B 2V1DA 3QO7A 2HVKC 4H37A 2EULA 5BR8B 4BW5A 2R9RB 1YEWA 1V54B 4MTOA 4QPJA 5LGTA 3S3WA 2HKOA 1BE3H 4MVZA 1NTZH 1TGOA 3RBZA 4QE9A 4WFFA 1PD3A 3SPHA 4GZRB 2PY5A 2BE3A 4K35A 3RFRA 4U7OA 2YEVA 5JH7B 1V55C 2AHZA 1K4DC 2GBOA 5C8YB 1DTOA 2FKXA 1GKFA 1KP2A 3LNNA 1QLEB 4LF9O 2QTOA 3CHXA 4G27B 3IJ4A 5B66Z 1BSMA 4AQYO 3FB6C 4JI6B 1N0NA 1BQ0A 3HKCB 4PV1B 1CXZB 4MVUA 1Q8IA 1S0VA 5FL7G 4K0KO 5CBGA 1Q43A 1Y67A 1AP5A 3HKEA 2Y48A 1YJNV 4UV8A 2DQ3A 1N32O 4UFZA 2ZKOA 2C2AA 5H6QA 1XNRB 2CTQA 3ZN1A 1GN2A 1Y76A 1GN6A 4MVSA 4K3AA 2NN4A 3B4SA 3CCJV 3DTUB 4OPHA 3LNMB 2NLJC 2A06H 1VQ4V 3CRQA 5IY5B 5JCOC 4DR7B 3CD6V 1RFYA 5D5PA 4RUEA 3JATB 3K08A 1YZBA 1W0JG 1RSOA 4O4HA 2PGGA 2GUZA 4UV9A 1NU1H 1E79G 5J2TB 1QNMA 2ZE7A 4FZ1A 2BTQB 4LC1A 3ZCCA 3SDLA 2WLKA 2ITCC
chains in the Genus database with same CATH topology
2Y4UA 1IURA 3BVOA 2GUZB 1HDJA 1FPOA 2M6YA 2CUGA 2QWOB 4IT5A 2DMXA 2PF4E 2EJ7A 2QSAA 1FAFA 3AG7A 4RWUA 3APOA 2QWNB 2CTQA 1NZ6A 1BQ0A 1XBLA 2KQXA 2Y4TA 2OCHA 2YUAA 3UO3A 2DN9A 3UCSC 1BQZA 2GUZA 2CTWA 2YS8A 1N4CA 4J7ZA 2QWPB 3APQA 2LO1A 2LGWA 2CTRA 2CTPA 2N04A 3UO2A 2QWRB 4J80A 2L6LA 1GH6A 1WJZA 2QWQB 2N05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4U A;  1IUR A;  3BVO A;  2GUZ B;  1HDJ A;  1FPO A;  2M6Y A;  2CUG A;  2QWO B;  4IT5 A;  2DMX A;  2PF4 E;  2EJ7 A;  2QSA A;  1FAF A;  3AG7 A;  4RWU A;  3APO A;  2QWN B;  2CTQ A;  1NZ6 A;  1BQ0 A;  1XBL A;  2KQX A;  2Y4T A;  2OCH A;  2YUA A;  3UO3 A;  2DN9 A;  3UCS C;  1BQZ A;  2GUZ A;  2CTW A;  2YS8 A;  1N4C A;  4J7Z A;  2QWP B;  3APQ A;  2LO1 A;  2LGW A;  2CTR A;  2CTP A;  2N04 A;  3UO2 A;  2QWR B;  4J80 A;  2L6L A;  1GH6 A;  1WJZ A;  2QWQ B;  2N05 A; 
#chains in the Genus database with same CATH topology
 4BIU A;  2WA4 A;  1O9G A;  5KMG A;  2M6Y A;  4FLT A;  3CYO A;  3SPC A;  2WLM A;  3SJQ C;  4ZKI A;  3CCU V;  3I55 V;  4PHZ A;  4YIP A;  1IDS A;  3W7W A;  1H8H G;  1VIB A;  2OTJ V;  5LA6 B;  2A3Q A;  3E8H A;  3OTF A;  4YXW G;  1KKC A;  5EBL C;  4OGQ B;  1A32 A;  4X65 B;  3UKM A;  5EK0 A;  1Q81 W;  4DR6 O;  3OD4 A;  4DUZ B;  4B3R B;  2ZE8 A;  5JCO A;  1VQM V;  2DN9 A;  3JD2 A;  4JV5 B;  2M7W A;  2CTW A;  3VBB A;  3B8N A;  2FML A;  4JTD B;  3VQV A;  1ZUQ A;  1AR5 A;  3CXC U;  4LFA B;  2VS0 A;  4FIP C;  2GTA A;  1Q6H A;  2CH7 B;  3L75 H;  4DR4 B;  1IBL B;  4NR1 A;  1WB7 A;  4TSF G;  3O65 A;  2IJH A;  2WSS G;  4I4T A;  5ITZ B;  1W2B U;  4TV9 B;  1KD1 W;  4HNA B;  4RAI A;  3DXR A;  1M1K W;  4JI5 O;  1NI8 A;  1YDX A;  1WLE A;  3TXS A;  1XEQ A;  4L8J A;  1KKD A;  3CCV V;  3OW2 U;  3K57 A;  1TAE A;  3A2F A;  1TUB B;  1K92 A;  2EIL C;  2QE7 G;  4I9Q A;  1FXK B;  5H2F Z;  1NVP B;  1AP6 A;  4X20 B;  5AG2 A;  4H33 A;  3H1I H;  4FFB B;  4K8X A;  1KMI Z;  2DYS B;  1N33 B;  2RCV A;  3B40 A;  4B3M O;  4O4L A;  5EYP A;  1XNR O;  2RQ6 A;  4AIL C;  2UUB B;  1JOY A;  4DV5 O;  3DC6 A;  4X1K A;  1YSC A;  5D5Q A;  1GK9 A;  1K7D A;  1IX9 A;  3BA9 A;  3ZMV A;  1U96 A;  4QIW F;  5GON B;  4MW8 A;  3K5L A;  3CJH B;  5FPO A;  1P84 F;  2XUM A;  4PI0 A;  5KX5 A;  5J2U A;  4ZIB A;  2JJ1 G;  3HKD A;  4WBN A;  2QEX V;  1KBH A;  1ZSP A;  1WJZ A;  4JI2 O;  1OCO B;  3CS5 A;  4UCR A;  1YI2 V;  3ETG A;  2IW5 A;  3IC9 A;  1BL8 A;  5B5E Z;  3E86 A;  1VP7 A;  2A9H A;  1VAR A;  1F4M A;  2BOC C;  1NH2 D;  1VQN V;  2YIB A;  3JAL A;  3G80 A;  3RW0 A;  1ROP A;  1DF4 A;  1S72 V;  2R9A A;  2ZIO A;  3CCM V;  3OUS A;  2FL4 A;  3T2M A;  1SA0 B;  1YTF B;  4NXM B;  1SS3 A;  3SYQ A;  1VQ5 V;  3RYC A;  3JD4 A;  5CA1 B;  2PF4 E;  3Q4H B;  4LP8 A;  3SJB C;  2Q4P A;  1OV9 A;  1K73 W;  4FPP A;  1LUW A;  3K03 A;  3AG2 B;  1F51 A;  4UCS A;  4PDV A;  4X65 O;  3TCU A;  1WA8 A;  4NYK A;  2UXD B;  5KHJ A;  5LYJ A;  4GLX A;  4X8A A;  1XDC A;  1JA8 A;  4BIZ A;  2QWN B;  3A0B Z;  2N74 A;  2WLL B;  4ZOL A;  4WFB V;  1FYJ A;  5HFM A;  1R6K A;  4HYO A;  4J7Z A;  4I50 B;  1IBL O;  3TK1 A;  3GVM A;  3SPJ A;  2QKS A;  2LGW A;  4FM2 A;  3BY6 A;  1PV0 A;  1P49 A;  2Y0I A;  1PM9 A;  4FJC C;  3K5O A;  4DV1 O;  3GB7 C;  1MSD A;  3CME V;  5LGN A;  3AG3 B;  3SYP A;  3CCQ V;  4JI0 B;  4D7S A;  3AG1 B;  2EIL B;  4JI3 B;  2UUA O;  2Q73 A;  2X6B A;  1KYO F;  2GHY A;  1GM8 A;  2QTS A;  3KG2 A;  1Q7Y W;  1K8A W;  2Q0O C;  1CP9 A;  4NKG B;  2ZD9 A;  3HKB A;  4TV8 B;  5IWA O;  2XHB A;  2IH3 C;  4RQE A;  1E1R G;  1M57 C;  3M99 B;  1H2G A;  2F93 B;  2E74 B;  1ZWI C;  4DR2 B;  2B9Z A;  3N2G A;  1VEW A;  4TQF A;  1DF5 A;  2F4V O;  4FLX A;  1YF2 A;  3ASN C;  1G8M A;  1GAX A;  1O9H A;  2LW1 A;  3B09 A;  5KHI A;  3KKY A;  4FK5 C;  4Z2W A;  5B1B B;  5FPR A;  4EFB A;  3STL C;  3GWO A;  2Q5Z A;  1Y4M A;  2Q9L A;  2G38 A;  5KUM A;  1S76 D;  3MHS C;  2JK5 C;  2LJ2 A;  2P6J A;  4B7K A;  2DYR C;  3QNE A;  4PDL A;  4E4E A;  1D5A A;  4CH4 A;  3N2K B;  4MTF A;  2ZDI A;  2N05 A;  3L74 H;  1AVM A;  3LDC A;  3CMA V;  1FAF A;  4JAU A;  3UT5 B;  2P5O A;  4JAS A;  1HNW O;  3AG4 B;  5HFL A;  3O9O A;  2D3O W;  4B7E A;  1K4C C;  1L0N H;  3G6B A;  5CB4 A;  3SYO A;  5B1A B;  2EBO A;  1Y66 A;  4TUY A;  4LF9 B;  3D36 C;  2JDI G;  4H44 B;  4AQY B;  2YI9 A;  2EIM B;  1I94 B;  4LBE C;  2XAS A;  2IM9 A;  4LWS B;  2F95 B;  4RO2 A;  2D2C B;  1U97 A;  1BMF G;  4K0K B;  3JD1 A;  4JTC B;  2RDC A;  4DR3 B;  1R73 A;  4K8Z A;  4WCE V;  3LSS A;  1N32 B;  2OCC B;  4JI4 B;  3U11 A;  1GM9 A;  1L0L H;  3ZRS A;  1K3E A;  1X4T A;  3OTO B;  5JWP A;  1Q6U A;  2CE4 A;  4B3T O;  3ZHT A;  2W6J G;  1FPO A;  1NS1 A;  5LHH A;  1US6 A;  3W7X A;  2YUA A;  3CX5 F;  5L3D A;  1I5Y A;  5H5N A;  3TXQ A;  3ZMT A;  4U3J A;  4PJ0 Z;  4JZG A;  4LNU A;  3LDE A;  1JCH A;  3ASN B;  5L3G A;  1KUQ A;  2YXL A;  1HDJ A;  4DR2 O;  2LFR A;  4G2K A;  5F2V O;  1M5I A;  4O4J A;  4JPR A;  3GWK C;  2EIK C;  3M7M X;  3OFN G;  1YJW V;  3IC7 A;  3ZHR A;  3BAA A;  4FMT A;  2JEU A;  2LO1 A;  2QA4 V;  3FB5 C;  2VQE O;  5IYZ A;  1VF7 A;  4DRX A;  4ZHQ B;  3CP1 A;  3N27 A;  4JYC A;  5LBQ A;  2EIN C;  2WAM A;  4PA3 A;  2XND G;  5GTI Z;  4XDL A;  1MOF A;  4EEQ A;  5LOV A;  1NTK H;  2JS3 A;  4BW9 A;  2HHH O;  3ZHU A;  2P90 A;  2ZE6 A;  4DR6 B;  4MW3 A;  5EZY A;  3CB2 A;  2NNU A;  4I0X B;  1Y74 B;  5CA0 B;  3JAR B;  5FNV B;  5IYD O;  1JFF B;  2ITD C;  1SQQ H;  4Q6G A;  5JVD A;  2IH1 C;  3MHH C;  2EZO A;  3ZRW A;  3K0D A;  1YIT V;  3RYI B;  1K33 A;  2X6A A;  1BQZ A;  1MZE A;  3B77 A;  3SPG A;  3ZBH A;  3J7A U;  4JYA O;  2B5U A;  3ZJZ A;  3J80 N;  2OT5 A;  2QKC A;  2ATK C;  2KKW A;  3AG7 A;  4JI5 B;  1NJI W;  3ASO B;  1PPJ H;  4J9Z B;  1I94 O;  1SZT A;  2EIJ C;  3CWB H;  1S5J A;  3OAA G;  1QQC A;  2H8P C;  4Q20 A;  3H1K H;  4LF8 B;  2JGD A;  4EKW A;  4DR3 O;  4O4I A;  1VQ6 V;  2X6C A;  4KXR A;  3I5D A;  1UPG A;  4LF4 O;  1V9P A;  1M93 A;  3OGC C;  4GX1 A;  4JI4 O;  1AI7 A;  3JAM N;  2ZNI A;  3ABL B;  5CMU A;  2NR5 A;  4B3M B;  1E1Q G;  3APO A;  2BTQ A;  3H1J H;  3QO8 A;  3OTO O;  1CPY A;  3CSX A;  3K04 A;  4R50 A;  4DV5 B;  2CGO A;  1GN3 A;  4ZI7 A;  1AR1 B;  2PTM A;  3TJT A;  4MSW C;  4UB8 Z;  3G71 V;  1SES A;  4OX9 B;  1Z5W A;  1MSW D;  2HEP A;  3ZRX A;  2ADP A;  3HR0 A;  2OIG A;  1QVF U;  3BFR A;  5L3C A;  4GYC B;  4RWU A;  2ODM A;  3RWR D;  4CH5 A;  4DV7 B;  4DUY B;  4JI2 B;  4DV6 B;  1VF5 B;  3ZIA G;  3C3S A;  4D7T A;  4EB6 A;  5K1P A;  1EM1 A;  3ZHV A;  5KA5 A;  1MMM A;  4UCT A;  3ZMU A;  4PA9 A;  2VRZ A;  2QSA A;  1W0K G;  1WB8 A;  1WP8 A;  1NZ6 A;  3HKE B;  1YVW A;  5FLX N;  4UCU A;  2JS5 A;  3RVY A;  5JJJ B;  1KU9 A;  1XUQ A;  2N04 A;  1JMK C;  4J80 A;  1YXB A;  1GH6 A;  1XMQ B;  1Y76 B;  1VQK V;  1N36 B;  1H2M A;  2PUS A;  4RUF A;  5KUK A;  2GDS A;  2UXC O;  3E89 A;  1FFX A;  4X1I B;  4CH3 A;  3ZRV A;  1SQB H;  1V55 B;  4LCU C;  2Q8V A;  3J81 N;  4UVA A;  4X20 A;  1QR8 A;  2WLI A;  2CUG A;  4LH7 A;  3ICX A;  5TIS Z;  1S77 D;  3KZI Z;  2MK3 A;  1EN6 A;  4DV1 B;  4KUM A;  4QE7 A;  3SJC C;  5KMG B;  3JCU Z;  2F1M A;  2UUA B;  2BSK A;  3BRC A;  2AW9 A;  3JAW A;  3K5N A;  3CPW U;  3ZMS A;  1FXH A;  4NB5 A;  1G6U A;  3EXA A;  4EFE A;  1ARO P;  2UUC O;  4LF8 O;  3MDS A;  2RNB A;  1H2N A;  1BHB A;  5LMU B;  4W4L A;  4G28 B;  5LXT A;  4MVQ A;  4J7J A;  4LF6 O;  5IWA B;  2YSU B;  5K1X A;  3L70 H;  1R1B A;  1AI5 A;  1XMO O;  4UXN A;  3BEH A;  2ZQM A;  4NXN B;  3OEE G;  4X64 O;  3WFV A;  3FB8 C;  2VQF B;  1YJ9 V;  2BCC H;  2P06 A;  2QWO B;  1VQ7 V;  3RYF B;  2UU9 O;  2F4V B;  1SA0 A;  2Y4T A;  2Y0P A;  4OX9 O;  3OUF A;  1HWY A;  1OCC C;  2PYL A;  2IU3 A;  1HR0 O;  2YS8 A;  5JQG A;  3DC5 A;  4YJ3 A;  4JI8 O;  3ABM C;  4LF7 B;  3ML0 A;  3NXS A;  1FKA O;  1ORQ C;  2HJF C;  1M90 W;  4DV7 O;  4I4T B;  3CRM A;  4XDK A;  1JQ0 A;  4DUY O;  3MAQ A;  3ZED A;  2DW4 A;  2DE0 X;  3DXR B;  4DV6 O;  4JZ2 A;  3K59 A;  1LNQ A;  3B8M A;  1N8R W;  4ZBM A;  4U7N A;  4P9O A;  1AJQ A;  1BCC H;  1B3Q A;  5A9G A;  1LUV A;  2RJZ A;  2HJD A;  1S5L Z;  3A8T A;  3IGA C;  2W0F C;  5GW7 A;  4DK0 A;  3FYE B;  1HNW B;  1JJ2 U;  4DO2 A;  5H9C A;  4KHP B;  2Z5U A;  5EYP B;  1M9N A;  1XMQ O;  5CA3 A;  5BMV A;  4X1K B;  5JJN B;  2LW7 A;  2P4K A;  4PA7 A;  4DV3 O;  1N36 O;  3ABK C;  4A5U B;  3QTC A;  1H2L A;  3FB7 C;  5DEC A;  3E83 A;  4IGG A;  5IJ0 A;  3CCE V;  1QU7 A;  4YIO A;  1BZK A;  5KX5 B;  5J2U B;  1OZ0 A;  3HKD B;  4E2L A;  4WBN B;  3T1H B;  2IBZ H;  4IIJ A;  3RVZ A;  3F5T A;  1BT8 A;  1KP3 A;  2XOK G;  1NKD A;  4LFB B;  3K79 A;  4YJ2 A;  5LMN B;  4FZ0 A;  3H01 A;  4TWK A;  1UJW B;  4JI1 O;  2W0X A;  3WU2 Z;  2L6L A;  3E8G A;  3FYI B;  4F6R A;  1P7G A;  1VQL V;  3JAL B;  1I08 A;  3K0G A;  2P7T C;  1ZLZ A;  4X1Y A;  2ARH A;  4PD4 F;  2XT9 A;  1Q90 D;  4DW1 A;  3IFX A;  2ZXW C;  4B3T B;  2ZDI C;  1KB9 F;  3RYC B;  1WPX A;  3G6E V;  1VQP V;  4MVM A;  3QF7 A;  2JIZ G;  3E35 A;  4X89 A;  5LMU O;  1XL6 A;  3BVO A;  3C3T A;  2X7R B;  4O2A A;  4B3S O;  4OPA A;  4NXN O;  1WA8 B;  5LGU A;  5LYJ B;  5A2Q N;  2VWK A;  3RGB A;  3ETD A;  1R3J C;  2CK3 G;  2VQF O;  2FTK A;  3EVK A;  4QGP A;  3ABM B;  5EBM C;  3L71 H;  2KG7 A;  4DK1 A;  3OM3 B;  3JAS A;  2K9P A;  2Q67 A;  4XBF A;  4DR1 B;  5LHG A;  3OMA B;  4ZOL B;  1HNZ B;  1GO3 F;  4GX2 A;  1PKX A;  3F7V C;  4UCO A;  2VQE B;  1NR1 A;  4LF7 O;  2BOB C;  3X2Q C;  1HP8 A;  4OXS A;  2P22 C;  4J11 A;  1BGY H;  2WWW A;  3PJS K;  4IHJ A;  2CGN A;  3SR2 C;  1X59 A;  4MT8 A;  4JTA B;  4FLZ A;  1TVK A;  4FFK A;  5B1N A;  4PEL A;  1QLN A;  4AHC A;  4I5S A;  3ABU A;  5CN0 A;  2HHH B;  4QPK A;  2BTO A;  5LP6 C;  5B3S C;  1PNL A;  3L9D A;  3HKB B;  4Z1M G;  1XBL A;  2ZCE A;  3RYH B;  4X88 A;  2PZS A;  3R65 A;  4MTX A;  5IYC O;  4KHP O;  2RN9 A;  4NTY A;  4I55 A;  5DN6 G;  1OCR C;  1EN4 A;  1M56 C;  3N2G B;  3ZN0 A;  4JYA B;  3K9S A;  3FAV A;  3L72 H;  4J9Y B;  3FX7 A;  2K1E A;  1TA8 A;  1GMG A;  3T1C A;  1VQ9 V;  1IBM O;  4FM1 A;  2QM8 A;  3D3I A;  1FJG B;  1S3J A;  1JVM A;  3E22 A;  4BAY A;  3LSQ A;  3T1H O;  2QWR B;  2OTL V;  4DW0 A;  1MG1 A;  2A0L A;  4DV0 O;  1UFI A;  2V7Q G;  4LFB O;  1IVS A;  3OR7 C;  2ILM A;  5LMN O;  1ZL8 A;  4DV4 O;  3BAB A;  3AK2 A;  1XRE A;  1PP9 H;  3P3N A;  4HBN A;  2ZNJ A;  2KSD A;  1P4R A;  4LF4 B;  3K9A A;  3UO3 A;  3OEH G;  4O2B A;  2E75 B;  1F7Y A;  4BWA A;  3W7U A;  5LP6 A;  2F23 A;  3JAK B;  1RM1 C;  3KCX A;  2PI5 A;  1QLE C;  1BHA A;  2Q69 A;  3CE2 A;  4ASU G;  1NT2 B;  1M57 B;  2QR4 A;  1ENV A;  3F5W C;  2QGN A;  4L87 A;  4NTX A;  3QVN A;  2LQT A;  2Y69 C;  5IJ9 B;  2FYU H;  5CB4 B;  2IJJ A;  4BIO A;  2VWJ A;  2AZ0 A;  5LHI A;  4CH6 A;  2UXB O;  1N34 B;  4TUY B;  4LR3 A;  5KAI Z;  2Y4U A;  1Q3E A;  2P67 A;  2JGU A;  3T1Y B;  1VMG A;  2ZT9 B;  4GKJ O;  4DR1 O;  1AJN A;  1PNK A;  5CA0 A;  3D8C A;  5FNV A;  3ZHS A;  1NR7 A;  2ZE5 A;  4MVO A;  1HNZ O;  1R6N A;  2RMK B;  1R6T A;  4MS2 A;  2DYR B;  3WB2 A;  5IY5 C;  2ZM6 O;  1SKV A;  1S5H C;  2EJR A;  1YCI A;  1QCE A;  5BY1 A;  5JH7 A;  3CC2 V;  2AHY A;  1I0H A;  2XAG A;  3CRC A;  5C8Y A;  2LGQ A;  2JRI A;  4CS2 A;  3LSU A;  1XNQ O;  5EIB D;  5BXZ A;  2L35 A;  2CTP A;  3UO2 A;  3SYC A;  1XI1 A;  2UXC B;  1AJP A;  3HKC A;  2PYJ A;  4J42 A;  2HLD G;  4XDJ A;  1XHX A;  2HP8 A;  2YIC A;  4U3J B;  4GUN A;  1ZX3 A;  2DMX A;  4KP4 A;  1Z2G A;  3RN4 A;  1XL4 A;  5J9P C;  4LNU B;  3EHB B;  5KA6 A;  4FLW A;  4DXW A;  1OCZ C;  1OJH A;  3H9V A;  4X62 O;  1ZTE A;  4PDM A;  1XIL A;  3HB3 B;  4O4J B;  1B06 A;  3D3Q A;  3S3X A;  1FFT B;  4CC6 A;  3C90 A;  3FD9 A;  3RT3 C;  1P7B A;  4P30 A;  1GRJ A;  3JSL A;  1FJG O;  1Q86 W;  4CC5 A;  4FM0 A;  1DGS A;  3OE7 G;  2YID A;  4DRX B;  5IYZ B;  3E8B A;  4GX0 A;  1HW7 A;  2QWP B;  1SQF A;  2UUC B;  3JAT A;  3BA8 A;  4JF3 A;  1RM1 B;  4KFM A;  4JYB A;  4LF6 B;  2OIE A;  1JJO A;  5LOV B;  5J2T A;  1I5X A;  4WFE A;  4LFC B;  2W6I G;  2EJ7 A;  1XMO B;  4I7Z B;  4X64 B;  1K5S A;  1B04 A;  1WPB A;  5EZY B;  1PL4 A;  3A0H Z;  4PA4 A;  4F4L A;  2Y69 B;  5JVD B;  1KEC A;  2UU9 B;  5EBW C;  3ZRW B;  2JVD A;  1HR0 B;  4R7C A;  2YEV B;  1SET A;  4JI8 B;  3OMN B;  1FXK C;  3ZMZ A;  5L3B A;  5LA6 A;  2EIK B;  4HZ3 A;  4N23 A;  5CBF A;  2R9I A;  4GX5 A;  5B1O A;  1N34 O;  2DYS C;  2GTS A;  5L3E A;  1IBK O;  3ETE A;  1YHQ V;  4X1I A;  3T1Y O;  3WB1 A;  2H3O A;  2WA3 A;  2IJI A;  2MW2 B;  1H38 A;  3I56 V;  3B2E E;  2JGD B;  2QM7 A;  2EIN B;  2HFE C;  3WB0 A;  3F7Y C;  4O4I B;  2KQX A;  2XAQ A;  1H2K A;  2CH7 A;  1NQT A;  3SPI A;  1XHZ A;  4PI2 A;  1XOU A;  3K3W A;  3WG7 C;  1Z5V A;  2Q68 A;  5ITZ A;  4TV9 A;  1VF6 C;  1WNS A;  5GTH Z;  1OCO C;  5KLV H;  4HNA A;  1TUE B;  5E1A C;  2P4V A;  4ZI7 B;  4DV3 B;  4X66 B;  4YY3 B;  3P3P A;  3LDD A;  4LF5 O;  1FXV A;  3SYA A;  1NTM H;  1OCZ B;  1W59 A;  2B1I A;  1K9M W;  1DLB A;  2OYQ A;  1TUB A;  2CAZ C;  2GV9 A;  5JJE B;  1FXK A;  1URF A;  3K5M A;  2JJ2 G;  4R8C A;  5DM6 V;  1Q5O A;  4MVR A;  5BR8 O;  1RSO B;  4O4H B;  4FFB A;  3LUT B;  2GUZ B;  3SGI A;  4EB6 B;  3BPZ A;  1GTO A;  4JI1 B;  1SQV H;  1MAB G;  2XAF A;  1Q82 W;  2EIJ B;  2DJV A;  3T4D A;  3FFQ A;  3HPL C;  4PA6 A;  3AG2 C;  3RYF A;  4ICG A;  2HVJ C;  5GON A;  1PL0 A;  3MD0 A;  4D6T H;  1QBZ A;  3CJH A;  3FKS G;  2WPD G;  4IL6 Z;  1D5N A;  3BCC H;  2AXT Z;  2YDE A;  1D2D A;  4J7K A;  1I7F A;  3DGE A;  1VF6 A;  2Q7E A;  1K34 A;  2V4D A;  1MZF A;  3VOU A;  3U0Z A;  2JEX A;  4P9P A;  4JI7 B;  3G67 A;  4LFC O;  3CCR V;  4JI6 O;  4B3S B;  4DYL A;  1FFX B;  2EZP A;  4P2Z A;  1L1F A;  1SF9 A;  2YXH A;  3AG3 C;  3AG1 C;  5KHG A;  1QR9 A;  3JD0 A;  1RP3 B;  2LP7 A;  3IAY A;  2QJ1 A;  1PNM A;  1SZX A;  1NBM G;  2B1G A;  5CA1 A;  1G1X B;  2EX3 A;  2WLI B;  3Q4H A;  3BHP A;  1JX9 A;  4H13 B;  1NH2 B;  4CBC A;  2H94 A;  5IYB O;  4JAV A;  3STZ C;  2KB1 A;  1AI4 A;  4FVM A;  1NVP D;  4J10 A;  4BR6 A;  1SQP H;  2BSK B;  3JAW B;  4DR7 O;  4AI8 A;  3UCS C;  2X0L A;  2YXY A;  3H1L H;  3OGI B;  1Y6X A;  3ABT A;  3WG7 B;  2WLL A;  5LXT B;  1QHT A;  5CBH A;  3VQY A;  2O57 A;  4I50 A;  2IU0 A;  2WLJ A;  5B1B C;  4O4L B;  1B6Q A;  2ADQ B;  1J95 A;  3AEI A;  2UXN A;  2UXX A;  5EC1 C;  2F43 G;  1IXM A;  1KC8 W;  4X9Q A;  4X66 O;  4YY3 O;  3P30 A;  3KCY A;  3K06 A;  4MTG A;  4B08 A;  1GN4 A;  2R70 A;  1LR1 A;  3DSQ A;  1IBM B;  1L8D A;  2DOS A;  5JQG B;  4YJ3 B;  4N21 A;  2XTA A;  4W4K A;  1AIL A;  3OR6 C;  4DV0 B;  3EFF K;  4TV8 A;  3AG4 C;  2Z0A A;  3W7T A;  4FLU A;  1YTF D;  2YIA A;  5KAF Z;  1FS0 G;  4DV4 B;  1H8E G;  4DR5 B;  4C7U A;  4DUZ O;  1ZAU A;  1JR9 A;  4B3R O;  3CC7 V;  1EBO A;  4JV5 O;  1AI6 A;  3OT7 A;  3CRA A;  5B1A C;  2YC0 A;  4TT3 G;  4LFA O;  3G4S V;  1F4N A;  2OCH A;  4H0L B;  1T5E A;  3ZHQ A;  4UB6 Z;  4DR4 O;  5EC2 C;  2A7W A;  4WFG A;  4TOI A;  3ZS8 C;  2EIM C;  4WFA V;  4TQD A;  2YI8 A;  5BMV B;  4DV2 B;  5C93 A;  1WAZ A;  4JI7 O;  1GM7 A;  2E5L B;  1AB3 A;  4HAM A;  3N2K A;  3M8A A;  1J5E B;  2UXB B;  2Q7H A;  5IJ0 B;  2OCC C;  1OCC B;  4F6E A;  2AGA A;  1EN5 A;  3APQ A;  2YIB D;  4GKJ B;  3RYH A;  4IIJ B;  3CXH F;  3UT5 A;  4WF9 V;  2ZIM A;  3AK1 A;  4YJ2 B;  1N33 O;  4CZZ A;  4IT5 A;  3K58 A;  4JYY A;  3E2E A;  4YHH B;  2UUB O;  2E76 B;  4GT1 A;  2ZM6 B;  4GCZ A;  5KHK A;  4F6R B;  4QNH B;  1EFR G;  3P32 A;  3H1H H;  4X1Y B;  1G4Y B;  4GKK B;  2DWE C;  5EIB C;  2ZR3 A;  2WLN A;  3VQX A;  1M4U A;  4QJF B;  4UVB A;  3JCZ A;  4CS3 A;  4IYI A;  2AZ2 A;  1XNQ B;  3U10 A;  1WN7 A;  2E3C A;  4J41 A;  4IYH A;  3CCS V;  2Q6A A;  1HNX B;  3JYC A;  4FLV A;  4UUJ C;  4UCV A;  4LWS A;  1N4C A;  5IE9 A;  3TGU H;  3CRR A;  1DK1 A;  5LL6 Y;  3ABK B;  5DED A;  4O2A B;  1Q6I A;  2QDO A;  4RQF A;  1RPR A;  3JSN A;  2QWQ B;  2Q7G A;  4X62 B;  2IJK A;  3JAK A;  2HG5 C;  3CC4 V;  2KG7 B;  5E79 Z;  3JAS B;  3THO A;  4NXM O;  4ABM A;  2XAJ A;  1CEZ A;  2ETN A;  1IZ3 A;  1BS3 A;  2DWD C;  4LH6 A;  1FD9 A;  1V54 C;  3VQW A;  2CTR A;  3TET A;  1F23 A;  4CS4 A;  2DQ0 A;  1SQG A;  5KHH A;  1EZJ A;  5L3F A;  3JD3 A;  5IJ9 A;  4IHJ B;  1THZ A;  4FLY A;  4DR5 O;  2UXD O;  3OMI B;  1TVK B;  4UVC A;  1OHH G;  2ZXW B;  4KL1 A;  1VQO V;  3QO5 A;  3E8F A;  4JGS A;  5IDJ A;  1QVG U;  2Q0A A;  3ZX6 A;  1R3K C;  2WLH A;  3QG5 A;  2HR3 A;  1YIJ V;  1RPO A;  4NTW A;  3R66 A;  3T4Z A;  2FB5 A;  1COW G;  1IXB A;  1N0J A;  2GSM B;  3ASO C;  1K5Q A;  1H2S B;  1AR4 A;  1JPX A;  4I55 B;  1WP7 A;  5IT9 N;  4PDR A;  4ZHQ A;  4R6Z A;  4DV2 O;  4JI0 O;  4JI3 O;  3FAV B;  2E5L O;  1SC5 B;  4JAA A;  1VQ8 V;  1J5E O;  1SRY A;  1SER A;  3SJA C;  2A79 B;  2OWO A;  5BZB A;  1IBK B;  3ABL C;  2ZIN A;  3E22 B;  2XAH A;  2QM4 A;  5H6R A;  1KQS U;  1R3L C;  3UQ8 A;  3X2Q B;  4I0X A;  1Y74 A;  3JAR A;  1K97 A;  4I9W A;  2PI4 A;  1JFF A;  1EZV H;  1ZL8 B;  1XQ8 A;  4WFH A;  4YHH O;  1MA1 A;  3L73 H;  3RYI A;  3CCL V;  3D36 A;  4O2B B;  4NVP A;  2LFS A;  3PN1 A;  3AK3 A;  3A0R A;  5LP6 B;  2R72 A;  4GKK O;  5B3S B;  3NR7 A;  3W7S A;  1SQX H;  3ETQ A;  2QKA A;  4U3F H;  1HNX O;  4LF5 B;  2Z3Y A;  2F66 C;  3UM7 A;  2CDY A;  1OCR B;  1R3I C;  1IUR A;  2ZR2 A;  3CEI A;  4Z1V A;  1MNG A;  1M56 B;  2V1D A;  3QO7 A;  2HVK C;  4H37 A;  2EUL A;  5BR8 B;  4BW5 A;  2R9R B;  1YEW A;  1V54 B;  4MTO A;  4QPJ A;  5LGT A;  3S3W A;  2HKO A;  1BE3 H;  4MVZ A;  1NTZ H;  1TGO A;  3RBZ A;  4QE9 A;  4WFF A;  1PD3 A;  3SPH A;  4GZR B;  2PY5 A;  2BE3 A;  4K35 A;  3RFR A;  4U7O A;  2YEV A;  5JH7 B;  1V55 C;  2AHZ A;  1K4D C;  2GBO A;  5C8Y B;  1DTO A;  2FKX A;  1GKF A;  1KP2 A;  3LNN A;  1QLE B;  4LF9 O;  2QTO A;  3CHX A;  4G27 B;  3IJ4 A;  5B66 Z;  1BSM A;  4AQY O;  3FB6 C;  4JI6 B;  1N0N A;  1BQ0 A;  3HKC B;  4PV1 B;  1CXZ B;  4MVU A;  1Q8I A;  1S0V A;  5FL7 G;  4K0K O;  5CBG A;  1Q43 A;  1Y67 A;  1AP5 A;  3HKE A;  2Y48 A;  1YJN V;  4UV8 A;  2DQ3 A;  1N32 O;  4UFZ A;  2ZKO A;  2C2A A;  5H6Q A;  1XNR B;  2CTQ A;  3ZN1 A;  1GN2 A;  1Y76 A;  1GN6 A;  4MVS A;  4K3A A;  2NN4 A;  3B4S A;  3CCJ V;  3DTU B;  4OPH A;  3LNM B;  2NLJ C;  2A06 H;  1VQ4 V;  3CRQ A;  5IY5 B;  5JCO C;  4DR7 B;  3CD6 V;  1RFY A;  5D5P A;  4RUE A;  3JAT B;  3K08 A;  1YZB A;  1W0J G;  1RSO A;  4O4H A;  2PGG A;  2GUZ A;  4UV9 A;  1NU1 H;  1E79 G;  5J2T B;  1QNM A;  2ZE7 A;  4FZ1 A;  2BTQ B;  4LC1 A;  3ZCC A;  3SDL A;  2WLK A;  2ITC C; 
#chains in the Genus database with same CATH homology
 2Y4U A;  1IUR A;  3BVO A;  2GUZ B;  1HDJ A;  1FPO A;  2M6Y A;  2CUG A;  2QWO B;  4IT5 A;  2DMX A;  2PF4 E;  2EJ7 A;  2QSA A;  1FAF A;  3AG7 A;  4RWU A;  3APO A;  2QWN B;  2CTQ A;  1NZ6 A;  1BQ0 A;  1XBL A;  2KQX A;  2Y4T A;  2OCH A;  2YUA A;  3UO3 A;  2DN9 A;  3UCS C;  1BQZ A;  2GUZ A;  2CTW A;  2YS8 A;  1N4C A;  4J7Z A;  2QWP B;  3APQ A;  2LO1 A;  2LGW A;  2CTR A;  2CTP A;  2N04 A;  3UO2 A;  2QWR B;  4J80 A;  2L6L A;  1GH6 A;  1WJZ A;  2QWQ B;  2N05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...