2QWRB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the amppnp intact form
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
92
structure length
92
Chain Sequence
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
total genus 29
structure length 92
sequence length 92
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwrB00
2LO1A 2QWQB 1BQZA 2CTQA 1IURA 3UCSC 1FAFA 2DMXA 3BVOA 4RWUA 2CTPA 3AG7A 1N4CA 1WJZA 4J80A 2PF4E 2N04A 2YS8A 2L6LA 3APQA 2QSAA 2LGWA 2CUGA 1HDJA 4IT5A 2QWNB 2GUZB 1FPOA 2OCHA 2Y4UA 3UO3A 1GH6A 1NZ6A 2QWPB 2YUAA 2EJ7A 2GUZA 1XBLA 4J7ZA 1BQ0A 2Y4TA 2CTWA 2N05A 2QWRB 2KQXA 3APOA 3UO2A 2M6YA 2CTRA 2DN9A 2QWOB
chains in the Genus database with same CATH superfamily
4K8ZA 2ADQB 2EIJC 3JALA 2HFEC 3CE2A 3RN4A 2LGWA 3CEIA 3ETQA 1Z5WA 4Q20A 5CN0A 1RM1B 2JGDB 4JTAB 5KHGA 5B66Z 1JFFB 4J10A 3K9AA 4DW1A 5CB4B 3SYOA 3OR7C 3ZMTA 2B1IA 2E3CA 2A3QA 4PI2A 5LP6B 5J9PC 2CTPA 2GHYA 3AG3B 4IT5A 5F2VO 1WA8B 2HJFC 2RCVA 3JATB 4QGPA 4NKGB 5DECA 4HYOA 3J7AU 3CCRV 2V1DA 3APOA 4AHCA 4K0KO 3E22B 4JPRA 4JTCB 1MOFA 5KHJA 3D3IA 4RUEA 3H1HH 4NYKA 1BQZA 2XHBA 4LP8A 2CK3G 2P4KA 4I50B 4FLYA 2NN4A 1L0LH 1TA8A 4J11A 5H5NA 3SPCA 1KP3A 1US6A 4CH6A 5CBHA 2ZR3A 4DRXA 4FLTA 5JH7A 2YC0A 3E89A 4LFBO 2QM8A 2ZIMA 4X20A 4NXNB 3HKCB 4DV7B 4Z2WA 3H1JH 2ZNJA 2PF4E 2YIAA 3LUTB 1IX9A 4RO2A 5AG2A 4ZHQB 2Q5ZA 3EVKA 2Q8VA 3QO8A 2HVJC 2QJ1A 3FB8C 2DWEC 2EILC 2WLLB 3EHBB 1OCZC 5EK0A 1K92A 4OX9B 3KKYA 1SZTA 2BTQB 4FJCC 1V54C 4NXNO 4TUYB 1S0VA 1NBMG 1L1FA 4DV2B 4LR3A 4KXRA 2EULA 1GTOA 3CRAA 4CH3A 4PV1B 4JI2B 4DV6B 2XTAA 5IJ9B 2WA3A 4NXMB 4XDJA 1XMQB 1ZWIC 5LHIA 3RYHA 4ZKIA 4B08A 2JVDA 4NVPA 3CJHB 4EB6A 4B3SB 4IYHA 1AJPA 1XI1A 4FFBB 1ZUQA 2ZE7A 1CXZB 1NI8A 5B1OA 1AP6A 3LDDA 3BCCH 1M56B 3RYCB 1UPGA 4KUMA 5JQGB 5EYPB 4RWUA 1X4TA 4PDRA 2UUAB 3ASOB 4BIOA 4D7SA 2CUGA 1RPOA 4U7NA 1D2DA 1B3QA 1XQ8A 1PL4A 1WP7A 4LFAO 4H33A 3OEHG 3W7UA 1V9PA 4PA7A 3JD2A 1I5YA 3SYAA 3VQWA 1EN4A 2XAHA 1TUEB 1P4RA 5IY5B 3ML0A 4UCSA 4O2BA 1AI5A 3CC7V 4GT1A 1COWG 4DR1B 3ABKC 4DW0A 1M57C 3OUSA 1BE3H 3M99B 3CRMA 5K1PA 4DR7B 4PA4A 5IYZB 1NVPD 3JARB 2YUAA 1SQFA 4O4LA 3GVMA 4TOIA 4KFMA 5BXZA 4X65B 1K33A 4H37A 4IGGA 2OWOA 2DMXA 3ZN0A 4B3RO 4MTGA 1DF5A 1R6KA 3ABMB 1TGOA 1QNMA 2H94A 2JJ1G 3I55V 3CMEV 3AK2A 3L72H 1XEQA 3RFRA 1NT2B 2JGUA 4JI0O 2EBOA 4P30A 5KX5B 5H6QA 3SPHA 4GX0A 4RUFA 3D36A 1H8EG 1KKCA 3LNMB 1NTZH 2X7RB 3L71H 1GRJA 5B1BC 4LF6O 4QE9A 3DC5A 4PDLA 5EZYB 2W6JG 5KHHA 1Q86W 1NU1H 3CWBH 2XT9A 1K7DA 3UT5B 2YIBA 1PNLA 4JYAB 4FZ1A 1EZJA 3AG1C 2F93B 1AJNA 1SRYA 2R9IA 2QWRB 4X9QA 4I0XA 2EINC 1VARA 1GO3F 1FXVA 4ZOLA 4L87A 5GONB 2BOCC 3CRRA 1I08A 1ZX3A 1M5IA 3P3NA 1FAFA 1GM7A 3HR0A 4BIUA 2JJ2G 1FXKB 4TT3G 4TV8A 3SGIA 1HP8A 1SETA 5TISZ 5KMGB 3CC2V 3HKEB 2DOSA 3ZEDA 3CCVV 2ZT9B 3UKMA 1JX9A 4FM1A 3JD3A 4D7TA 3K08A 3CD6V 1Y76B 4JV5O 3K5MA 2F4VO 4YIOA 4JI5O 3N2GA 4CH4A 4X1IB 2KKWA 1MMMA 4O4IA 3QNEA 3UM7A 5IWAB 1Y6XA 4TV9A 1IXMA 1L8DA 4AILC 1KUQA 1AB3A 1NKDA 4PA9A 3Q4HA 3ZRWA 1WPBA 3RYFB 2P4VA 2Q4PA 1E79G 4QE7A 5LOVB 4IYIA 1UJWB 3T1HB 5IWAO 4CS3A 1MSDA 1F4MA 1AVMA 4HNAA 1PP9H 4AQYB 1NR1A 1N36O 2QDOA 1J5EO 2JRIA 3CCQV 2XAJA 1B06A 2QR4A 3W7XA 4IHJB 3B2EE 4JAAA 2UUBB 2QWQB 4OPAA 3TK1A 2Q6AA 3UCSC 1AR1B 4JTDB 1KBHA 3JYCA 5LGTA 2QEXV 3J81N 2ADPA 3SPGA 2UXXA 3G71V 2YDEA 1FFTB 2ZXWC 1FXHA 2LGQA 2D2CB 3ZCCA 5LXTA 2N05A 2ZM6O 3ETGA 4F6RB 1VF5B 3HPLC 2UUBO 2AXTZ 3RYIB 4FMTA 4G2KA 1MZFA 1ZAUA 5LA6B 2R70A 2MK3A 4GKJO 2JDIG 1PV0A 1HR0O 3VQYA 3P32A 1AR4A 1FYJA 4HBNA 1YTFB 1HNWB 2FYUH 3NXSA 5LYJA 4ZBMA 3QO5A 2ZCEA 2DYSB 4PHZA 4JI4B 5KAIZ 5L3DA 4X1YB 2QWPB 2BSKB 3A8TA 1GN2A 5DEDA 5J2UA 3BEHA 1ZL8A 1UFIA 3I56V 3X2QC 2E5LB 2Q0OC 4DV4B 4DK1A 1WJZA 3RGBA 5LMUB 1YJWV 4LF9B 1H38A 3M7MX 1GN4A 4GX5A 3ZHUA 2RN9A 4B7KA 2Q7HA 3E86A 5GW7A 4MW3A 1AI6A 4MTOA 4B3TB 4B3MB 2BCCH 3SDLA 2QKCA 2R72A 3WG7B 1K34A 4X62B 4WBNA 3ABTA 1U96A 2L35A 3MDSA 5IE9A 5ITZA 1IBMO 1Q6UA 3OMAB 3JASA 3OTOB 2VWJA 5LMUO 4I4TB 4YJ2A 3GB7C 3OM3B 5JVDA 4QNHB 4DR4B 2HP8A 1YCIA 3T4ZA 1ORQC 1JJ2U 1QLEC 4B3TO 3CS5A 1XOUA 2EIKC 1K4CC 1HW7A 2LP7A 4LNUA 4B3MO 2Y69B 5B1AB 4CS4A 4DR2O 4X1KA 2ETNA 2HVKC 1YJNV 4L8JA 1SQVH 4X62O 3RWRD 4GX2A 4DV0O 4JI7B 2P7TC 3B8MA 1SERA 1IXBA 4LF7B 1GMGA 4KHPB 4XDKA 3SYQA 3BAAA 4BW9A 3STLC 1H2LA 1MSWD 2W0FC 1NQTA 4CZZA 2BE3A 1Q90D 2IU0A 3OD4A 3CSXA 1VQ6V 4JI7O 1XNQO 4DRXB 1I94B 4N23A 2OCHA 4GZRB 3ASNC 1VQ9V 1ENVA 4AI8A 4KHPO 5FLXN 5CA0A 1KECA 1M93A 3HKDA 4X20B 1FFXA 1SS3A 2RQ6A 4K35A 4ZI7A 4BIZA 5FPOA 2A7WA 3FKSG 3FX7A 4DR6B 1S72V 1TVKB 1VQ8V 1EZVH 3STZC 2OT5A 1SQPH 2GTAA 1GH6A 2AHYA 3JAKA 3EXAA 4DO2A 3DXRA 4U3FH 3KCYA 3JAMN 5CBFA 3K3WA 3R66A 3FAVA 1YJ9V 4WFGA 4LFCO 1OCOB 1OHHG 4X8AA 4BAYA 4UCUA 2PY5A 3JAWA 4N21A 4O2AA 1R1BA 4J7ZA 3C90A 4F6EA 3K58A 3VOUA 5IT9N 5CMUA 1VQLV 3ZMVA 2V7QG 4I7ZB 3RYHB 4K3AA 3W7SA 3E8HA 1BZKA 1DLBA 2HG5C 4UVBA 4JI8B 4O4JA 3W7WA 4GX1A 5L3CA 5LMNB 5LGUA 1XDCA 4EB6B 3TETA 5L3GA 1RSOA 1NS1A 3SR2C 3H1KH 2IW5A 1I5XA 4JAUA 3ZHSA 2EZOA 3AEIA 4JZGA 2JS5A 3K06A 1OCCB 5CA1A 2ATKC 4MW8A 1SQGA 4FPPA 1BL8A 1Y74A 1Q82W 3QG5A 3M8AA 4I9QA 1EM1A 3BHPA 3FYEB 2UXBB 1BHBA 1Q6HA 3EFFK 5LMNO 2CH7B 1IZ3A 3MHHC 4EFBA 3JCZA 3BPZA 2ZKOA 2KG7B 2OTLV 3ZHRA 1AI4A 4I9WA 2CTWA 2HHHB 1N0NA 4X88A 2AZ0A 2FMLA 4UCOA 3LSUA 3FB5C 5JJJB 1Q43A 4UB8Z 2F1MA 1RM1C 2PTMA 2KSDA 1XILA 4DV7O 4WFFA 1K73W 4JI3B 2UXBO 4MVQA 4P2ZA 3TGUH 1Q81W 3QO7A 1VQ7V 1PL0A 2X0LA 2JGDA 2GUZA 4O2BB 2DQ3A 1HNZB 4FIPC 1WB8A 4DUZB 2HHHO 5LP6C 1NR7A 3ZHTA 2YICA 4OX9O 1VIBA 3KZIZ 3AG3C 5LHGA 5CB4A 1J95A 1OCRB 2EJRA 1KD1W 2WLHA 4JI3O 3CXCU 4DV2O 2OIEA 3CB2A 2GTSA 2ZE8A 1PPJH 4O4LB 4DV5B 1JVMA 3DSQA 3JATA 4FLWA 4JASA 4JI2O 2XAQA 4DV6O 3CCJV 3T1YB 4TQDA 2Y0IA 2IJKA 4OGQB 1QHTA 4NXMO 1NVPB 2QKSA 1LR1A 1XMQO 4BWAA 4TQFA 1LUWA 4FFKA 4I50A 4UV8A 5EC2C 5D5QA 4B3SO 2HR3A 4YJ3B 1RPRA 4QPKA 4DV5O 1EN5A 1V55B 4DV1B 3H9VA 1S77D 4A5UB 3T1YO 5DN6G 4IIJA 2F95B 4WCEV 4GKKB 2Q73A 3HKCA 2YEVB 2K9PA 2M7WA 2N04A 2IJIA 2N74A 2UUAO 4NTWA 3C3TA 1NZ6A 3OW2U 3ABUA 3E8BA 2DYRB 3HKBA 3ZMUA 1H2MA 4F4LA 4TSFG 4ZOLB 2WLLA 3I5DA 1MA1A 4WFEA 1AP5A 4GKKO 1F51A 2P22C 1OV9A 2PGGA 1A32A 3O65A 4PA3A 2YSUB 4IL6Z 3ZRVA 2ZINA 4ASUG 5GTIZ 2GBOA 3FYIB 5BR8B 5IJ0B 2IJJA 2Q69A 1EN6A 5L3FA 2WLKA 5FNVB 3UO2A 1R73A 3K03A 3N2GB 5E79Z 5C8YB 4O4IB 5H9CA 5B3SB 5J2TA 3FB6C 4KP4A 2KB1A 4Q6GA 4WFHA 4DR1O 4PA6A 3AK1A 1K97A 1P7BA 4TV9B 1W0KG 4UCTA 1I0HA 2L6LA 2ZE5A 4DR7O 3Q4HB 3ZRWB 4FM0A 4DUYB 3LSSA 1M56C 5BR8O 4G28B 2YIBD 4MTFA 1N8RW 3ASOC 5HFLA 4J7KA 4X65O 5FL7G 3ZHQA 2PUSA 2Q7EA 3ZMZA 3RYCA 5JQGA 5EYPA 4JI1B 2LQTA 1VQKV 2B9ZA 2WAMA 1RFYA 3ABLB 2EJ7A 5LL6Y 2BOBC 3UQ8A 4DUYO 3E8GA 4MVSA 1VEWA 1TUBB 1O9HA 2VWKA 2WLJA 4LBEC 3AG2B 5IY5C 5LXTB 3SJQC 4Z1VA 5KAFZ 4JYAO 3K5NA 3CCLV 1QU7A 2ITDC 1SA0A 1Q6IA 2Y4TA 1T5EA 1NH2B 1Y66A 2Q68A 1GN6A 4CC6A 2CGOA 4CBCA 2LO1A 2XUMA 4UB6Z 3CCEV 2ZD9A 1PD3A 2Q0AA 3K79A 2O57A 2PI4A 1IBLB 1JOYA 5IYZA 3U0ZA 2Z5UA 4LWSB 1OZ0A 1N0JA 4UXNA 3K0DA 1S5HC 1XHXA 3CPWU 1DK1A 2EIMB 4ZIBA 5E1AC 3ABMC 3GWOA 5C93A 1PNKA 2PYJA 5IYBO 1WN7A 3K57A 3BRCA 2DJVA 1PKXA 2FTKA 1S76D 3LDEA 5J2UB 3L73H 5KA6A 1ZL8B 5KX5A 4LH6A 1Y67A 3FB7C 2IU3A 2WSSG 3IAYA 3A2FA 3CRCA 5EZYA 2WA4A 1M90W 1NH2D 1XL6A 4U3JA 1SQXH 1IBKB 2QSAA 1GM8A 3KCXA 3OT7A 4NTXA 3UT5A 1VQOV 1XHZA 1L0NH 2XAFA 3T1HO 1MNGA 5K1XA 4AQYO 2A79B 1KU9A 2HKOA 1D5NA 2RJZA 1YITV 3D3QA 1FXKC 4ABMA 3BABA 4MS2A 4MVUA 1BGYH 4WBNB 4QPJA 1VMGA 2Q7GA 1P84F 2DQ0A 4J9ZB 5ITZB 1M1KW 5KHKA 1FXKA 5JVDB 4R6ZA 3HB3B 3IC7A 3K5LA 3OGIB 1R6TA 4R7CA 3HKEA 1Q5OA 1D5AA 4Z1MG 4DR5B 4TWKA 1W59A 3J80N 4X1KB 2YXHA 1Y76A 5KA5A 2CDYA 3TXQA 1BCCH 2EIKB 4R8CA 4H0LB 3CRQA 4HAMA 2YI8A 3E8FA 4LF4B 3OAAG 1QBZA 3NR7A 2IJHA 5CBGA 3SYCA 2IH3C 4DYLA 3LNNA 2P67A 2ILMA 1KMIZ 1K9MW 2MW2B 4JYBA 2EX3A 2VS0A 5EC1C 4D6TH 1E1QG 3ZRSA 3RYFA 4EFEA 3SJAC 1HNWO 5LHHA 5LOVA 3DGEA 1FPOA 4LF4O 1CEZA 1SZXA 3DTUB 4JI4O 2P5OA 3HKDB 5LBQA 2WLIB 3ASNB 2AGAA 2VQFB 2E76B 4PDVA 4BW5A 1VF6C 2Q9LA 1KQSU 4JI6B 1YI2V 3BVOA 3LDCA 2E5LO 3MD0A 3JALB 1VQPV 4DV4O 1WLEA 4WF9V 2ZNIA 3QTCA 4UV9A 5BZBA 1VF6A 4LF9O 2JEXA 1K3EA 4JGSA 2EIJB 2WLNA 3LSQA 2XOKG 4EEQA 4JAVA 2IH1C 2WLMA 4K8XA 3C3SA 1R3KC 2R9RB 2F43G 2M6YA 4P9OA 1H2NA 1YXBA 2QTSA 3BFRA 1AJQA 4I55A 2QKAA 2OCCC 1VQNV 4YHHB 4O2AB 5LA6A 5LGNA 3OTOO 4FLUA 3ZIAG 3JSLA 2YI9A 4RQFA 4CH5A 2XASA 4DR4O 1U97A 1P49A 5EBWC 2CTRA 4JYYA 4O4HA 1IDSA 3AG4C 1AI7A 4R50A 2WWWA 1K5QA 2DYSC 4O4JB 2RNBA 3A0BZ 4B7EA 4DV3B 5IDJA 1K8AW 1M9NA 4DXWA 1RSOB 1B6QA 1QR8A 3RVYA 2UXCB 4OPHA 2Y0PA 5JH7B 3FD9A 3U11A 4LF7O 4X1YA 1VQ4V 3CP1A 5CA1B 2BSKA 1CPYA 2WPDG 4MVMA 1Y74B 3CCMV 1GAXA 4J9YB 1G1XB 2QGNA 4W4KA 1DF4A 1LNQA 2A9HA 1S5JA 1ROPA 1URFA 3DC6A 1I94O 1AROP 4YIPA 3WG7C 3G67A 5KLVH 5IYDO 3TXSA 5EIBC 1JJOA 5A9GA 3ZBHA 1R3JC 2DW4A 1JCHA 2EILB 1EBOA 3AG7A 1OCZB 4FK5C 3JD0A 4U7OA 2B5UA 4DR6O 2PI5A 2E74B 2GUZB 1V54B 4GCZA 4I4TA 4WFAV 2Y69C 5B1AC 1JMKC 3L75H 4K0KB 1AILA 4J7JA 4NR1A 3L70H 4GLXA 3KG2A 3E35A 2Q67A 2PZSA 2YS8A 2XAGA 2F66C 4LFBB 1M4UA 3BA9A 5L3BA 3K0GA 2D3OW 1WP8A 1G6UA 1MABG 2AHZA 3F7VC 2UXNA 1WNSA 3RT3C 5L3EA 4LF8B 1ZSPA 3F7YC 4P9PA 4JI8O 2YXYA 3N2KA 2JS3A 3P3PA 3R65A 2JEUA 2RMKB 3G4SV 2Y4UA 1N33B 1QLNA 3K5OA 2ARHA 3H01A 2AW9A 4IIJB 1SQBH 3OFNG 4WFBV 5BMVA 2NLJC 1YHQV 4LF8O 2QA4V 4BR6A 5JCOC 1TVKA 1EFRG 4LH7A 1KB9F 1N33O 1OCOC 3HKBB 1XMOB 1W0JG 3BA8A 2YIDA 1JFFA 3WU2Z 4PDMA 5JCOA 4ICGA 1FS0G 2A06H 2OIGA 1QR9A 2NR5A 2LW7A 2UXDB 4JYCA 1AR5A 3OUFA 5LP6A 4QIWF 3ABKB 5A2QN 2FL4A 1M57B 1RP3B 2XNDG 3ETEA 1XMOO 1XBLA 1WA8A 1KP2A 2CAZC 2Z0AA 1HNZO 1Q7YW 4DUZO 1XUQA 5J2TB 3B77A 2OYQA 2QWNB 3E22A 1ZTEA 1YIJV 5IYCO 3G6BA 1SQQH 2UXDO 1SC5B 3A0HZ 4PD4F 4X64B 1OCCC 1Z5VA 4KL1A 5B1NA 3K9SA 5B5EZ 4GYCB 3W7TA 1I7FA 4OXSA 1VP7A 1NTMH 1KYOF 2B1GA 4GUNA 3D8CA 2R9AA 2VQEB 4LFAB 5BY1A 2H3OA 5JJNB 1GK9A 3G80A 3S3WA 3CMAV 3CX5F 2H8PC 2GSMB 1QCEA 5B1BB 3JCUZ 3PN1A 1Y4MA 1YZBA 2CH7A 4X64O 1MZEA 1SF9A 2KG7A 4ZHQA 3ZRXA 4I0XB 2EZPA 4FZ0A 2W6IG 5DM6V 3AG1B 4DV1O 2HEPA 3B40A 4UUJC 2ZE6A 2X6AA 4LC1A 3IFXA 3G6EV 2VQEO 2EINB 3OTFA 1KKDA 4J80A 2BTQA 4TV8B 5CA3A 4TUYA 1N34B 1SA0B 3CCUV 2GV9A 2ZDIC 1VQMV 2AZ2A 3N27A 1OCRC 5IJ9A 2DWDC 2RDCA 2G38A 2ZDIA 2CE4A 4XDLA 4B3RB 3ZX6A 4HZ3A 2ZIOA 5JWPA 1G4YB 5EBLC 1N34O 2IBZH 1NJIW 3ZHVA 3CJHA 1QQCA 1FJGB 2PYLA 3ZMSA 4JI0B 5EBMC 3WB2A 1WPXA 1JA8A 2W0XA 4CC5A 4FFBA 1BMFG 3S3XA 1MG1A 2ODMA 3SPIA 4PI0A 4LF6B 3O9OA 3F5TA 4X66B 2LW1A 2K1EA 4LCUC 1SKVA 3VQXA 3K04A 1V55C 2HJDA 4HNAB 3D36C 1Z2GA 3ZN1A 1FJGO 3OGCC 1YVWA 3B09A 2E75B 4YJ3A 4FLZA 4CS2A 1Q3EA 2FB5A 2FKXA 3OR6C 1P7GA 2UUCB 1THZA 3WB0A 1JPXA 3L74H 3E83A 2DE0X 4U3JB 4X66O 2QM4A 1OJHA 2YEVA 2DYRC 4YY3B 4JI1O 4X89A 3SJCC 1WB7A 2V4DA 1BQ0A 3BY6A 4PJ0Z 2Z3YA 4JV5B 2F4VB 4JI5B 2F23A 1G8MA 2ZXWB 2UUCO 2NNUA 1F4NA 3RBZA 3T1CA 4JF3A 4JZ2A 3T4DA 1BHAA 2LFRA 1Q8IA 2ITCC 4MVOA 1R6NA 4YY3O 3SPJA 3OEEG 5B3SC 2BTOA 3JARA 5IJ0A 1GKFA 2OTJV 3OMIB 5FNVA 2LFSA 3SYPA 1KC8W 5C8YA 4EKWA 4MTXA 3IC9A 5LYJB 4H13B 1WAZA 1F7YA 1N36B 1BSMA 1J5EB 4FLVA 1XREA 2C2AA 1IBLO 1QVGU 2X6CA 3QF7A 2ZR2A 1TAEA 3ZJZA 2CGNA 3CCSV 2A0LA 3ABLC 1YEWA 3X2QB 5KHIA 5KUMA 4MSWC 4FVMA 4C7UA 1IVSA 1DTOA 1S5LZ 3H1IH 2ZM6B 4UVAA 3AG2C 3MHSC 1W2BU 3JD4A 3E2EA 1TUBA 1IURA 5GONA 1BT8A 2LJ2A 3JASB 2QE7G 4YJ2B 4QJFB 3F5WC 4GKJB 3P30A 4E4EA 2UU9B 5D5PA 1R3IC 1IBKO 1H2SB 3RW0A 4I5SA 5KMGA 1H2KA 3B8NA 1HR0B 4J42A 4LNUB 4I55B 4FM2A 1JR9A 1QLEB 1PM9A 4X1IA 3OE7G 1JQ0A 2VRZA 3MAQA 1HDJA 1XNRB 2HLDG 3L9DA 4PELA 5HFMA 2UU9O 1SESA 2OCCB 1BS3A 3SJBC 2EIMC 4J41A 2ZQMA 4LWSA 1FKAO 4O4HB 3H1LH 3TJTA 3WB1A 3JSNA 4DR5O 2JIZG 3JD1A 1YF2A 1H2GA 1N4CA 1VQ5V 3AG4B 1K4DC 3FFQA 4W4LA 1O9GA 1XNRO 3A0RA 1S3JA 5CA0B 3PJSK 3CC4V 1FFXB 4E2LA 3QVNA 2P06A 3RVZA 4ZI7B 4IHJA 2QWOB 3CXHF 4XBFA 3GWKC 2GDSA 4UCVA 1IBMB 5FPRA 1CP9A 3OMNB 3WFVA 3AK3A 4NTYA 3JAKB 1NTKH 4DK0A 3DXRB 3ICXA 1HNXB 4NB5A 2QM7A 3FAVB 1LUVA 4YXWG 1GM9A 1XL4A 4FLXA 2DN9A 4DR2B 1YDXA 4F6RA 2VQFO 2QTOA 2Y48A 1K5SA 3ETDA 4DV0B 4JI6O 3RYIA 1GN3A 4MT8A 3T2MA 3B4SA 3JAWB 3VQVA 3U10A 4LF5B 1VF7A 1N32B 1HNXO 1YTFD 1E1RG 2P6JA 1HWYA 4RQEA 3CYOA 1QVFU 1X59A 4UFZA 1R3LC 4G27B 2IM9A 4MVZA 1B04A 3IGAC 2X6BA 1H8HG 4RAIA 5KUKA 2JK5C 5GTHZ 3CHXA 1XNQB 3IJ4A 1FD9A 4YHHO 3THOA 3UO3A 3VBBA 4LF5O 1N32O 4UCRA 1DGSA 2KQXA 4UVCA 2YXLA 5JJEB 3ZS8C 4DR3B 3K59A 5H6RA 3N2KB 2CTQA 4DV3O 3APQA 4MVRA 1YSCA 1F23A 1PNMA 2UXCO 3TCUA 1ZLZA 2WLIA 5EIBD 4LFCB 4H44B 5BMVB 2P90A 5H2FZ 4DR3O
chains in the Genus database with same CATH topology
2LO1A 2QWQB 1BQZA 2CTQA 1IURA 3UCSC 1FAFA 2DMXA 3BVOA 4RWUA 2CTPA 3AG7A 1N4CA 1WJZA 4J80A 2PF4E 2N04A 2YS8A 2L6LA 3APQA 2QSAA 2LGWA 2CUGA 1HDJA 4IT5A 2QWNB 2GUZB 1FPOA 2OCHA 2Y4UA 3UO3A 1GH6A 1NZ6A 2QWPB 2YUAA 2EJ7A 2GUZA 1XBLA 4J7ZA 1BQ0A 2Y4TA 2CTWA 2N05A 2QWRB 2KQXA 3APOA 3UO2A 2M6YA 2CTRA 2DN9A 2QWOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LO1 A;  2QWQ B;  1BQZ A;  2CTQ A;  1IUR A;  3UCS C;  1FAF A;  2DMX A;  3BVO A;  4RWU A;  2CTP A;  3AG7 A;  1N4C A;  1WJZ A;  4J80 A;  2PF4 E;  2N04 A;  2YS8 A;  2L6L A;  3APQ A;  2QSA A;  2LGW A;  2CUG A;  1HDJ A;  4IT5 A;  2QWN B;  2GUZ B;  1FPO A;  2OCH A;  2Y4U A;  3UO3 A;  1GH6 A;  1NZ6 A;  2QWP B;  2YUA A;  2EJ7 A;  2GUZ A;  1XBL A;  4J7Z A;  1BQ0 A;  2Y4T A;  2CTW A;  2N05 A;  2QWR B;  2KQX A;  3APO A;  3UO2 A;  2M6Y A;  2CTR A;  2DN9 A;  2QWO B; 
#chains in the Genus database with same CATH topology
 4K8Z A;  2ADQ B;  2EIJ C;  3JAL A;  2HFE C;  3CE2 A;  3RN4 A;  2LGW A;  3CEI A;  3ETQ A;  1Z5W A;  4Q20 A;  5CN0 A;  1RM1 B;  2JGD B;  4JTA B;  5KHG A;  5B66 Z;  1JFF B;  4J10 A;  3K9A A;  4DW1 A;  5CB4 B;  3SYO A;  3OR7 C;  3ZMT A;  2B1I A;  2E3C A;  2A3Q A;  4PI2 A;  5LP6 B;  5J9P C;  2CTP A;  2GHY A;  3AG3 B;  4IT5 A;  5F2V O;  1WA8 B;  2HJF C;  2RCV A;  3JAT B;  4QGP A;  4NKG B;  5DEC A;  4HYO A;  3J7A U;  3CCR V;  2V1D A;  3APO A;  4AHC A;  4K0K O;  3E22 B;  4JPR A;  4JTC B;  1MOF A;  5KHJ A;  3D3I A;  4RUE A;  3H1H H;  4NYK A;  1BQZ A;  2XHB A;  4LP8 A;  2CK3 G;  2P4K A;  4I50 B;  4FLY A;  2NN4 A;  1L0L H;  1TA8 A;  4J11 A;  5H5N A;  3SPC A;  1KP3 A;  1US6 A;  4CH6 A;  5CBH A;  2ZR3 A;  4DRX A;  4FLT A;  5JH7 A;  2YC0 A;  3E89 A;  4LFB O;  2QM8 A;  2ZIM A;  4X20 A;  4NXN B;  3HKC B;  4DV7 B;  4Z2W A;  3H1J H;  2ZNJ A;  2PF4 E;  2YIA A;  3LUT B;  1IX9 A;  4RO2 A;  5AG2 A;  4ZHQ B;  2Q5Z A;  3EVK A;  2Q8V A;  3QO8 A;  2HVJ C;  2QJ1 A;  3FB8 C;  2DWE C;  2EIL C;  2WLL B;  3EHB B;  1OCZ C;  5EK0 A;  1K92 A;  4OX9 B;  3KKY A;  1SZT A;  2BTQ B;  4FJC C;  1V54 C;  4NXN O;  4TUY B;  1S0V A;  1NBM G;  1L1F A;  4DV2 B;  4LR3 A;  4KXR A;  2EUL A;  1GTO A;  3CRA A;  4CH3 A;  4PV1 B;  4JI2 B;  4DV6 B;  2XTA A;  5IJ9 B;  2WA3 A;  4NXM B;  4XDJ A;  1XMQ B;  1ZWI C;  5LHI A;  3RYH A;  4ZKI A;  4B08 A;  2JVD A;  4NVP A;  3CJH B;  4EB6 A;  4B3S B;  4IYH A;  1AJP A;  1XI1 A;  4FFB B;  1ZUQ A;  2ZE7 A;  1CXZ B;  1NI8 A;  5B1O A;  1AP6 A;  3LDD A;  3BCC H;  1M56 B;  3RYC B;  1UPG A;  4KUM A;  5JQG B;  5EYP B;  4RWU A;  1X4T A;  4PDR A;  2UUA B;  3ASO B;  4BIO A;  4D7S A;  2CUG A;  1RPO A;  4U7N A;  1D2D A;  1B3Q A;  1XQ8 A;  1PL4 A;  1WP7 A;  4LFA O;  4H33 A;  3OEH G;  3W7U A;  1V9P A;  4PA7 A;  3JD2 A;  1I5Y A;  3SYA A;  3VQW A;  1EN4 A;  2XAH A;  1TUE B;  1P4R A;  5IY5 B;  3ML0 A;  4UCS A;  4O2B A;  1AI5 A;  3CC7 V;  4GT1 A;  1COW G;  4DR1 B;  3ABK C;  4DW0 A;  1M57 C;  3OUS A;  1BE3 H;  3M99 B;  3CRM A;  5K1P A;  4DR7 B;  4PA4 A;  5IYZ B;  1NVP D;  3JAR B;  2YUA A;  1SQF A;  4O4L A;  3GVM A;  4TOI A;  4KFM A;  5BXZ A;  4X65 B;  1K33 A;  4H37 A;  4IGG A;  2OWO A;  2DMX A;  3ZN0 A;  4B3R O;  4MTG A;  1DF5 A;  1R6K A;  3ABM B;  1TGO A;  1QNM A;  2H94 A;  2JJ1 G;  3I55 V;  3CME V;  3AK2 A;  3L72 H;  1XEQ A;  3RFR A;  1NT2 B;  2JGU A;  4JI0 O;  2EBO A;  4P30 A;  5KX5 B;  5H6Q A;  3SPH A;  4GX0 A;  4RUF A;  3D36 A;  1H8E G;  1KKC A;  3LNM B;  1NTZ H;  2X7R B;  3L71 H;  1GRJ A;  5B1B C;  4LF6 O;  4QE9 A;  3DC5 A;  4PDL A;  5EZY B;  2W6J G;  5KHH A;  1Q86 W;  1NU1 H;  3CWB H;  2XT9 A;  1K7D A;  3UT5 B;  2YIB A;  1PNL A;  4JYA B;  4FZ1 A;  1EZJ A;  3AG1 C;  2F93 B;  1AJN A;  1SRY A;  2R9I A;  2QWR B;  4X9Q A;  4I0X A;  2EIN C;  1VAR A;  1GO3 F;  1FXV A;  4ZOL A;  4L87 A;  5GON B;  2BOC C;  3CRR A;  1I08 A;  1ZX3 A;  1M5I A;  3P3N A;  1FAF A;  1GM7 A;  3HR0 A;  4BIU A;  2JJ2 G;  1FXK B;  4TT3 G;  4TV8 A;  3SGI A;  1HP8 A;  1SET A;  5TIS Z;  5KMG B;  3CC2 V;  3HKE B;  2DOS A;  3ZED A;  3CCV V;  2ZT9 B;  3UKM A;  1JX9 A;  4FM1 A;  3JD3 A;  4D7T A;  3K08 A;  3CD6 V;  1Y76 B;  4JV5 O;  3K5M A;  2F4V O;  4YIO A;  4JI5 O;  3N2G A;  4CH4 A;  4X1I B;  2KKW A;  1MMM A;  4O4I A;  3QNE A;  3UM7 A;  5IWA B;  1Y6X A;  4TV9 A;  1IXM A;  1L8D A;  4AIL C;  1KUQ A;  1AB3 A;  1NKD A;  4PA9 A;  3Q4H A;  3ZRW A;  1WPB A;  3RYF B;  2P4V A;  2Q4P A;  1E79 G;  4QE7 A;  5LOV B;  4IYI A;  1UJW B;  3T1H B;  5IWA O;  4CS3 A;  1MSD A;  1F4M A;  1AVM A;  4HNA A;  1PP9 H;  4AQY B;  1NR1 A;  1N36 O;  2QDO A;  1J5E O;  2JRI A;  3CCQ V;  2XAJ A;  1B06 A;  2QR4 A;  3W7X A;  4IHJ B;  3B2E E;  4JAA A;  2UUB B;  2QWQ B;  4OPA A;  3TK1 A;  2Q6A A;  3UCS C;  1AR1 B;  4JTD B;  1KBH A;  3JYC A;  5LGT A;  2QEX V;  3J81 N;  2ADP A;  3SPG A;  2UXX A;  3G71 V;  2YDE A;  1FFT B;  2ZXW C;  1FXH A;  2LGQ A;  2D2C B;  3ZCC A;  5LXT A;  2N05 A;  2ZM6 O;  3ETG A;  4F6R B;  1VF5 B;  3HPL C;  2UUB O;  2AXT Z;  3RYI B;  4FMT A;  4G2K A;  1MZF A;  1ZAU A;  5LA6 B;  2R70 A;  2MK3 A;  4GKJ O;  2JDI G;  1PV0 A;  1HR0 O;  3VQY A;  3P32 A;  1AR4 A;  1FYJ A;  4HBN A;  1YTF B;  1HNW B;  2FYU H;  3NXS A;  5LYJ A;  4ZBM A;  3QO5 A;  2ZCE A;  2DYS B;  4PHZ A;  4JI4 B;  5KAI Z;  5L3D A;  4X1Y B;  2QWP B;  2BSK B;  3A8T A;  1GN2 A;  5DED A;  5J2U A;  3BEH A;  1ZL8 A;  1UFI A;  3I56 V;  3X2Q C;  2E5L B;  2Q0O C;  4DV4 B;  4DK1 A;  1WJZ A;  3RGB A;  5LMU B;  1YJW V;  4LF9 B;  1H38 A;  3M7M X;  1GN4 A;  4GX5 A;  3ZHU A;  2RN9 A;  4B7K A;  2Q7H A;  3E86 A;  5GW7 A;  4MW3 A;  1AI6 A;  4MTO A;  4B3T B;  4B3M B;  2BCC H;  3SDL A;  2QKC A;  2R72 A;  3WG7 B;  1K34 A;  4X62 B;  4WBN A;  3ABT A;  1U96 A;  2L35 A;  3MDS A;  5IE9 A;  5ITZ A;  1IBM O;  1Q6U A;  3OMA B;  3JAS A;  3OTO B;  2VWJ A;  5LMU O;  4I4T B;  4YJ2 A;  3GB7 C;  3OM3 B;  5JVD A;  4QNH B;  4DR4 B;  2HP8 A;  1YCI A;  3T4Z A;  1ORQ C;  1JJ2 U;  1QLE C;  4B3T O;  3CS5 A;  1XOU A;  2EIK C;  1K4C C;  1HW7 A;  2LP7 A;  4LNU A;  4B3M O;  2Y69 B;  5B1A B;  4CS4 A;  4DR2 O;  4X1K A;  2ETN A;  2HVK C;  1YJN V;  4L8J A;  1SQV H;  4X62 O;  3RWR D;  4GX2 A;  4DV0 O;  4JI7 B;  2P7T C;  3B8M A;  1SER A;  1IXB A;  4LF7 B;  1GMG A;  4KHP B;  4XDK A;  3SYQ A;  3BAA A;  4BW9 A;  3STL C;  1H2L A;  1MSW D;  2W0F C;  1NQT A;  4CZZ A;  2BE3 A;  1Q90 D;  2IU0 A;  3OD4 A;  3CSX A;  1VQ6 V;  4JI7 O;  1XNQ O;  4DRX B;  1I94 B;  4N23 A;  2OCH A;  4GZR B;  3ASN C;  1VQ9 V;  1ENV A;  4AI8 A;  4KHP O;  5FLX N;  5CA0 A;  1KEC A;  1M93 A;  3HKD A;  4X20 B;  1FFX A;  1SS3 A;  2RQ6 A;  4K35 A;  4ZI7 A;  4BIZ A;  5FPO A;  2A7W A;  3FKS G;  3FX7 A;  4DR6 B;  1S72 V;  1TVK B;  1VQ8 V;  1EZV H;  3STZ C;  2OT5 A;  1SQP H;  2GTA A;  1GH6 A;  2AHY A;  3JAK A;  3EXA A;  4DO2 A;  3DXR A;  4U3F H;  3KCY A;  3JAM N;  5CBF A;  3K3W A;  3R66 A;  3FAV A;  1YJ9 V;  4WFG A;  4LFC O;  1OCO B;  1OHH G;  4X8A A;  4BAY A;  4UCU A;  2PY5 A;  3JAW A;  4N21 A;  4O2A A;  1R1B A;  4J7Z A;  3C90 A;  4F6E A;  3K58 A;  3VOU A;  5IT9 N;  5CMU A;  1VQL V;  3ZMV A;  2V7Q G;  4I7Z B;  3RYH B;  4K3A A;  3W7S A;  3E8H A;  1BZK A;  1DLB A;  2HG5 C;  4UVB A;  4JI8 B;  4O4J A;  3W7W A;  4GX1 A;  5L3C A;  5LMN B;  5LGU A;  1XDC A;  4EB6 B;  3TET A;  5L3G A;  1RSO A;  1NS1 A;  3SR2 C;  3H1K H;  2IW5 A;  1I5X A;  4JAU A;  3ZHS A;  2EZO A;  3AEI A;  4JZG A;  2JS5 A;  3K06 A;  1OCC B;  5CA1 A;  2ATK C;  4MW8 A;  1SQG A;  4FPP A;  1BL8 A;  1Y74 A;  1Q82 W;  3QG5 A;  3M8A A;  4I9Q A;  1EM1 A;  3BHP A;  3FYE B;  2UXB B;  1BHB A;  1Q6H A;  3EFF K;  5LMN O;  2CH7 B;  1IZ3 A;  3MHH C;  4EFB A;  3JCZ A;  3BPZ A;  2ZKO A;  2KG7 B;  2OTL V;  3ZHR A;  1AI4 A;  4I9W A;  2CTW A;  2HHH B;  1N0N A;  4X88 A;  2AZ0 A;  2FML A;  4UCO A;  3LSU A;  3FB5 C;  5JJJ B;  1Q43 A;  4UB8 Z;  2F1M A;  1RM1 C;  2PTM A;  2KSD A;  1XIL A;  4DV7 O;  4WFF A;  1K73 W;  4JI3 B;  2UXB O;  4MVQ A;  4P2Z A;  3TGU H;  1Q81 W;  3QO7 A;  1VQ7 V;  1PL0 A;  2X0L A;  2JGD A;  2GUZ A;  4O2B B;  2DQ3 A;  1HNZ B;  4FIP C;  1WB8 A;  4DUZ B;  2HHH O;  5LP6 C;  1NR7 A;  3ZHT A;  2YIC A;  4OX9 O;  1VIB A;  3KZI Z;  3AG3 C;  5LHG A;  5CB4 A;  1J95 A;  1OCR B;  2EJR A;  1KD1 W;  2WLH A;  4JI3 O;  3CXC U;  4DV2 O;  2OIE A;  3CB2 A;  2GTS A;  2ZE8 A;  1PPJ H;  4O4L B;  4DV5 B;  1JVM A;  3DSQ A;  3JAT A;  4FLW A;  4JAS A;  4JI2 O;  2XAQ A;  4DV6 O;  3CCJ V;  3T1Y B;  4TQD A;  2Y0I A;  2IJK A;  4OGQ B;  1QHT A;  4NXM O;  1NVP B;  2QKS A;  1LR1 A;  1XMQ O;  4BWA A;  4TQF A;  1LUW A;  4FFK A;  4I50 A;  4UV8 A;  5EC2 C;  5D5Q A;  4B3S O;  2HR3 A;  4YJ3 B;  1RPR A;  4QPK A;  4DV5 O;  1EN5 A;  1V55 B;  4DV1 B;  3H9V A;  1S77 D;  4A5U B;  3T1Y O;  5DN6 G;  4IIJ A;  2F95 B;  4WCE V;  4GKK B;  2Q73 A;  3HKC A;  2YEV B;  2K9P A;  2M7W A;  2N04 A;  2IJI A;  2N74 A;  2UUA O;  4NTW A;  3C3T A;  1NZ6 A;  3OW2 U;  3ABU A;  3E8B A;  2DYR B;  3HKB A;  3ZMU A;  1H2M A;  4F4L A;  4TSF G;  4ZOL B;  2WLL A;  3I5D A;  1MA1 A;  4WFE A;  1AP5 A;  4GKK O;  1F51 A;  2P22 C;  1OV9 A;  2PGG A;  1A32 A;  3O65 A;  4PA3 A;  2YSU B;  4IL6 Z;  3ZRV A;  2ZIN A;  4ASU G;  5GTI Z;  2GBO A;  3FYI B;  5BR8 B;  5IJ0 B;  2IJJ A;  2Q69 A;  1EN6 A;  5L3F A;  2WLK A;  5FNV B;  3UO2 A;  1R73 A;  3K03 A;  3N2G B;  5E79 Z;  5C8Y B;  4O4I B;  5H9C A;  5B3S B;  5J2T A;  3FB6 C;  4KP4 A;  2KB1 A;  4Q6G A;  4WFH A;  4DR1 O;  4PA6 A;  3AK1 A;  1K97 A;  1P7B A;  4TV9 B;  1W0K G;  4UCT A;  1I0H A;  2L6L A;  2ZE5 A;  4DR7 O;  3Q4H B;  3ZRW B;  4FM0 A;  4DUY B;  3LSS A;  1M56 C;  5BR8 O;  4G28 B;  2YIB D;  4MTF A;  1N8R W;  3ASO C;  5HFL A;  4J7K A;  4X65 O;  5FL7 G;  3ZHQ A;  2PUS A;  2Q7E A;  3ZMZ A;  3RYC A;  5JQG A;  5EYP A;  4JI1 B;  2LQT A;  1VQK V;  2B9Z A;  2WAM A;  1RFY A;  3ABL B;  2EJ7 A;  5LL6 Y;  2BOB C;  3UQ8 A;  4DUY O;  3E8G A;  4MVS A;  1VEW A;  1TUB B;  1O9H A;  2VWK A;  2WLJ A;  4LBE C;  3AG2 B;  5IY5 C;  5LXT B;  3SJQ C;  4Z1V A;  5KAF Z;  4JYA O;  3K5N A;  3CCL V;  1QU7 A;  2ITD C;  1SA0 A;  1Q6I A;  2Y4T A;  1T5E A;  1NH2 B;  1Y66 A;  2Q68 A;  1GN6 A;  4CC6 A;  2CGO A;  4CBC A;  2LO1 A;  2XUM A;  4UB6 Z;  3CCE V;  2ZD9 A;  1PD3 A;  2Q0A A;  3K79 A;  2O57 A;  2PI4 A;  1IBL B;  1JOY A;  5IYZ A;  3U0Z A;  2Z5U A;  4LWS B;  1OZ0 A;  1N0J A;  4UXN A;  3K0D A;  1S5H C;  1XHX A;  3CPW U;  1DK1 A;  2EIM B;  4ZIB A;  5E1A C;  3ABM C;  3GWO A;  5C93 A;  1PNK A;  2PYJ A;  5IYB O;  1WN7 A;  3K57 A;  3BRC A;  2DJV A;  1PKX A;  2FTK A;  1S76 D;  3LDE A;  5J2U B;  3L73 H;  5KA6 A;  1ZL8 B;  5KX5 A;  4LH6 A;  1Y67 A;  3FB7 C;  2IU3 A;  2WSS G;  3IAY A;  3A2F A;  3CRC A;  5EZY A;  2WA4 A;  1M90 W;  1NH2 D;  1XL6 A;  4U3J A;  1SQX H;  1IBK B;  2QSA A;  1GM8 A;  3KCX A;  3OT7 A;  4NTX A;  3UT5 A;  1VQO V;  1XHZ A;  1L0N H;  2XAF A;  3T1H O;  1MNG A;  5K1X A;  4AQY O;  2A79 B;  1KU9 A;  2HKO A;  1D5N A;  2RJZ A;  1YIT V;  3D3Q A;  1FXK C;  4ABM A;  3BAB A;  4MS2 A;  4MVU A;  1BGY H;  4WBN B;  4QPJ A;  1VMG A;  2Q7G A;  1P84 F;  2DQ0 A;  4J9Z B;  5ITZ B;  1M1K W;  5KHK A;  1FXK A;  5JVD B;  4R6Z A;  3HB3 B;  3IC7 A;  3K5L A;  3OGI B;  1R6T A;  4R7C A;  3HKE A;  1Q5O A;  1D5A A;  4Z1M G;  4DR5 B;  4TWK A;  1W59 A;  3J80 N;  4X1K B;  2YXH A;  1Y76 A;  5KA5 A;  2CDY A;  3TXQ A;  1BCC H;  2EIK B;  4R8C A;  4H0L B;  3CRQ A;  4HAM A;  2YI8 A;  3E8F A;  4LF4 B;  3OAA G;  1QBZ A;  3NR7 A;  2IJH A;  5CBG A;  3SYC A;  2IH3 C;  4DYL A;  3LNN A;  2P67 A;  2ILM A;  1KMI Z;  1K9M W;  2MW2 B;  4JYB A;  2EX3 A;  2VS0 A;  5EC1 C;  4D6T H;  1E1Q G;  3ZRS A;  3RYF A;  4EFE A;  3SJA C;  1HNW O;  5LHH A;  5LOV A;  3DGE A;  1FPO A;  4LF4 O;  1CEZ A;  1SZX A;  3DTU B;  4JI4 O;  2P5O A;  3HKD B;  5LBQ A;  2WLI B;  3ASN B;  2AGA A;  2VQF B;  2E76 B;  4PDV A;  4BW5 A;  1VF6 C;  2Q9L A;  1KQS U;  4JI6 B;  1YI2 V;  3BVO A;  3LDC A;  2E5L O;  3MD0 A;  3JAL B;  1VQP V;  4DV4 O;  1WLE A;  4WF9 V;  2ZNI A;  3QTC A;  4UV9 A;  5BZB A;  1VF6 A;  4LF9 O;  2JEX A;  1K3E A;  4JGS A;  2EIJ B;  2WLN A;  3LSQ A;  2XOK G;  4EEQ A;  4JAV A;  2IH1 C;  2WLM A;  4K8X A;  3C3S A;  1R3K C;  2R9R B;  2F43 G;  2M6Y A;  4P9O A;  1H2N A;  1YXB A;  2QTS A;  3BFR A;  1AJQ A;  4I55 A;  2QKA A;  2OCC C;  1VQN V;  4YHH B;  4O2A B;  5LA6 A;  5LGN A;  3OTO O;  4FLU A;  3ZIA G;  3JSL A;  2YI9 A;  4RQF A;  4CH5 A;  2XAS A;  4DR4 O;  1U97 A;  1P49 A;  5EBW C;  2CTR A;  4JYY A;  4O4H A;  1IDS A;  3AG4 C;  1AI7 A;  4R50 A;  2WWW A;  1K5Q A;  2DYS C;  4O4J B;  2RNB A;  3A0B Z;  4B7E A;  4DV3 B;  5IDJ A;  1K8A W;  1M9N A;  4DXW A;  1RSO B;  1B6Q A;  1QR8 A;  3RVY A;  2UXC B;  4OPH A;  2Y0P A;  5JH7 B;  3FD9 A;  3U11 A;  4LF7 O;  4X1Y A;  1VQ4 V;  3CP1 A;  5CA1 B;  2BSK A;  1CPY A;  2WPD G;  4MVM A;  1Y74 B;  3CCM V;  1GAX A;  4J9Y B;  1G1X B;  2QGN A;  4W4K A;  1DF4 A;  1LNQ A;  2A9H A;  1S5J A;  1ROP A;  1URF A;  3DC6 A;  1I94 O;  1ARO P;  4YIP A;  3WG7 C;  3G67 A;  5KLV H;  5IYD O;  3TXS A;  5EIB C;  1JJO A;  5A9G A;  3ZBH A;  1R3J C;  2DW4 A;  1JCH A;  2EIL B;  1EBO A;  3AG7 A;  1OCZ B;  4FK5 C;  3JD0 A;  4U7O A;  2B5U A;  4DR6 O;  2PI5 A;  2E74 B;  2GUZ B;  1V54 B;  4GCZ A;  4I4T A;  4WFA V;  2Y69 C;  5B1A C;  1JMK C;  3L75 H;  4K0K B;  1AIL A;  4J7J A;  4NR1 A;  3L70 H;  4GLX A;  3KG2 A;  3E35 A;  2Q67 A;  2PZS A;  2YS8 A;  2XAG A;  2F66 C;  4LFB B;  1M4U A;  3BA9 A;  5L3B A;  3K0G A;  2D3O W;  1WP8 A;  1G6U A;  1MAB G;  2AHZ A;  3F7V C;  2UXN A;  1WNS A;  3RT3 C;  5L3E A;  4LF8 B;  1ZSP A;  3F7Y C;  4P9P A;  4JI8 O;  2YXY A;  3N2K A;  2JS3 A;  3P3P A;  3R65 A;  2JEU A;  2RMK B;  3G4S V;  2Y4U A;  1N33 B;  1QLN A;  3K5O A;  2ARH A;  3H01 A;  2AW9 A;  4IIJ B;  1SQB H;  3OFN G;  4WFB V;  5BMV A;  2NLJ C;  1YHQ V;  4LF8 O;  2QA4 V;  4BR6 A;  5JCO C;  1TVK A;  1EFR G;  4LH7 A;  1KB9 F;  1N33 O;  1OCO C;  3HKB B;  1XMO B;  1W0J G;  3BA8 A;  2YID A;  1JFF A;  3WU2 Z;  4PDM A;  5JCO A;  4ICG A;  1FS0 G;  2A06 H;  2OIG A;  1QR9 A;  2NR5 A;  2LW7 A;  2UXD B;  4JYC A;  1AR5 A;  3OUF A;  5LP6 A;  4QIW F;  3ABK B;  5A2Q N;  2FL4 A;  1M57 B;  1RP3 B;  2XND G;  3ETE A;  1XMO O;  1XBL A;  1WA8 A;  1KP2 A;  2CAZ C;  2Z0A A;  1HNZ O;  1Q7Y W;  4DUZ O;  1XUQ A;  5J2T B;  3B77 A;  2OYQ A;  2QWN B;  3E22 A;  1ZTE A;  1YIJ V;  5IYC O;  3G6B A;  1SQQ H;  2UXD O;  1SC5 B;  3A0H Z;  4PD4 F;  4X64 B;  1OCC C;  1Z5V A;  4KL1 A;  5B1N A;  3K9S A;  5B5E Z;  4GYC B;  3W7T A;  1I7F A;  4OXS A;  1VP7 A;  1NTM H;  1KYO F;  2B1G A;  4GUN A;  3D8C A;  2R9A A;  2VQE B;  4LFA B;  5BY1 A;  2H3O A;  5JJN B;  1GK9 A;  3G80 A;  3S3W A;  3CMA V;  3CX5 F;  2H8P C;  2GSM B;  1QCE A;  5B1B B;  3JCU Z;  3PN1 A;  1Y4M A;  1YZB A;  2CH7 A;  4X64 O;  1MZE A;  1SF9 A;  2KG7 A;  4ZHQ A;  3ZRX A;  4I0X B;  2EZP A;  4FZ0 A;  2W6I G;  5DM6 V;  3AG1 B;  4DV1 O;  2HEP A;  3B40 A;  4UUJ C;  2ZE6 A;  2X6A A;  4LC1 A;  3IFX A;  3G6E V;  2VQE O;  2EIN B;  3OTF A;  1KKD A;  4J80 A;  2BTQ A;  4TV8 B;  5CA3 A;  4TUY A;  1N34 B;  1SA0 B;  3CCU V;  2GV9 A;  2ZDI C;  1VQM V;  2AZ2 A;  3N27 A;  1OCR C;  5IJ9 A;  2DWD C;  2RDC A;  2G38 A;  2ZDI A;  2CE4 A;  4XDL A;  4B3R B;  3ZX6 A;  4HZ3 A;  2ZIO A;  5JWP A;  1G4Y B;  5EBL C;  1N34 O;  2IBZ H;  1NJI W;  3ZHV A;  3CJH A;  1QQC A;  1FJG B;  2PYL A;  3ZMS A;  4JI0 B;  5EBM C;  3WB2 A;  1WPX A;  1JA8 A;  2W0X A;  4CC5 A;  4FFB A;  1BMF G;  3S3X A;  1MG1 A;  2ODM A;  3SPI A;  4PI0 A;  4LF6 B;  3O9O A;  3F5T A;  4X66 B;  2LW1 A;  2K1E A;  4LCU C;  1SKV A;  3VQX A;  3K04 A;  1V55 C;  2HJD A;  4HNA B;  3D36 C;  1Z2G A;  3ZN1 A;  1FJG O;  3OGC C;  1YVW A;  3B09 A;  2E75 B;  4YJ3 A;  4FLZ A;  4CS2 A;  1Q3E A;  2FB5 A;  2FKX A;  3OR6 C;  1P7G A;  2UUC B;  1THZ A;  3WB0 A;  1JPX A;  3L74 H;  3E83 A;  2DE0 X;  4U3J B;  4X66 O;  2QM4 A;  1OJH A;  2YEV A;  2DYR C;  4YY3 B;  4JI1 O;  4X89 A;  3SJC C;  1WB7 A;  2V4D A;  1BQ0 A;  3BY6 A;  4PJ0 Z;  2Z3Y A;  4JV5 B;  2F4V B;  4JI5 B;  2F23 A;  1G8M A;  2ZXW B;  2UUC O;  2NNU A;  1F4N A;  3RBZ A;  3T1C A;  4JF3 A;  4JZ2 A;  3T4D A;  1BHA A;  2LFR A;  1Q8I A;  2ITC C;  4MVO A;  1R6N A;  4YY3 O;  3SPJ A;  3OEE G;  5B3S C;  2BTO A;  3JAR A;  5IJ0 A;  1GKF A;  2OTJ V;  3OMI B;  5FNV A;  2LFS A;  3SYP A;  1KC8 W;  5C8Y A;  4EKW A;  4MTX A;  3IC9 A;  5LYJ B;  4H13 B;  1WAZ A;  1F7Y A;  1N36 B;  1BSM A;  1J5E B;  4FLV A;  1XRE A;  2C2A A;  1IBL O;  1QVG U;  2X6C A;  3QF7 A;  2ZR2 A;  1TAE A;  3ZJZ A;  2CGN A;  3CCS V;  2A0L A;  3ABL C;  1YEW A;  3X2Q B;  5KHI A;  5KUM A;  4MSW C;  4FVM A;  4C7U A;  1IVS A;  1DTO A;  1S5L Z;  3H1I H;  2ZM6 B;  4UVA A;  3AG2 C;  3MHS C;  1W2B U;  3JD4 A;  3E2E A;  1TUB A;  1IUR A;  5GON A;  1BT8 A;  2LJ2 A;  3JAS B;  2QE7 G;  4YJ2 B;  4QJF B;  3F5W C;  4GKJ B;  3P30 A;  4E4E A;  2UU9 B;  5D5P A;  1R3I C;  1IBK O;  1H2S B;  3RW0 A;  4I5S A;  5KMG A;  1H2K A;  3B8N A;  1HR0 B;  4J42 A;  4LNU B;  4I55 B;  4FM2 A;  1JR9 A;  1QLE B;  1PM9 A;  4X1I A;  3OE7 G;  1JQ0 A;  2VRZ A;  3MAQ A;  1HDJ A;  1XNR B;  2HLD G;  3L9D A;  4PEL A;  5HFM A;  2UU9 O;  1SES A;  2OCC B;  1BS3 A;  3SJB C;  2EIM C;  4J41 A;  2ZQM A;  4LWS A;  1FKA O;  4O4H B;  3H1L H;  3TJT A;  3WB1 A;  3JSN A;  4DR5 O;  2JIZ G;  3JD1 A;  1YF2 A;  1H2G A;  1N4C A;  1VQ5 V;  3AG4 B;  1K4D C;  3FFQ A;  4W4L A;  1O9G A;  1XNR O;  3A0R A;  1S3J A;  5CA0 B;  3PJS K;  3CC4 V;  1FFX B;  4E2L A;  3QVN A;  2P06 A;  3RVZ A;  4ZI7 B;  4IHJ A;  2QWO B;  3CXH F;  4XBF A;  3GWK C;  2GDS A;  4UCV A;  1IBM B;  5FPR A;  1CP9 A;  3OMN B;  3WFV A;  3AK3 A;  4NTY A;  3JAK B;  1NTK H;  4DK0 A;  3DXR B;  3ICX A;  1HNX B;  4NB5 A;  2QM7 A;  3FAV B;  1LUV A;  4YXW G;  1GM9 A;  1XL4 A;  4FLX A;  2DN9 A;  4DR2 B;  1YDX A;  4F6R A;  2VQF O;  2QTO A;  2Y48 A;  1K5S A;  3ETD A;  4DV0 B;  4JI6 O;  3RYI A;  1GN3 A;  4MT8 A;  3T2M A;  3B4S A;  3JAW B;  3VQV A;  3U10 A;  4LF5 B;  1VF7 A;  1N32 B;  1HNX O;  1YTF D;  1E1R G;  2P6J A;  1HWY A;  4RQE A;  3CYO A;  1QVF U;  1X59 A;  4UFZ A;  1R3L C;  4G27 B;  2IM9 A;  4MVZ A;  1B04 A;  3IGA C;  2X6B A;  1H8H G;  4RAI A;  5KUK A;  2JK5 C;  5GTH Z;  3CHX A;  1XNQ B;  3IJ4 A;  1FD9 A;  4YHH O;  3THO A;  3UO3 A;  3VBB A;  4LF5 O;  1N32 O;  4UCR A;  1DGS A;  2KQX A;  4UVC A;  2YXL A;  5JJE B;  3ZS8 C;  4DR3 B;  3K59 A;  5H6R A;  3N2K B;  2CTQ A;  4DV3 O;  3APQ A;  4MVR A;  1YSC A;  1F23 A;  1PNM A;  2UXC O;  3TCU A;  1ZLZ A;  2WLI A;  5EIB D;  4LFC B;  4H44 B;  5BMV B;  2P90 A;  5H2F Z;  4DR3 O; 
#chains in the Genus database with same CATH homology
 2LO1 A;  2QWQ B;  1BQZ A;  2CTQ A;  1IUR A;  3UCS C;  1FAF A;  2DMX A;  3BVO A;  4RWU A;  2CTP A;  3AG7 A;  1N4C A;  1WJZ A;  4J80 A;  2PF4 E;  2N04 A;  2YS8 A;  2L6L A;  3APQ A;  2QSA A;  2LGW A;  2CUG A;  1HDJ A;  4IT5 A;  2QWN B;  2GUZ B;  1FPO A;  2OCH A;  2Y4U A;  3UO3 A;  1GH6 A;  1NZ6 A;  2QWP B;  2YUA A;  2EJ7 A;  2GUZ A;  1XBL A;  4J7Z A;  1BQ0 A;  2Y4T A;  2CTW A;  2N05 A;  2QWR B;  2KQX A;  3APO A;  3UO2 A;  2M6Y A;  2CTR A;  2DN9 A;  2QWO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...