2QWRB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the amppnp intact form
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
92
structure length
92
Chain Sequence
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
total genus 29
structure length 92
sequence length 92
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwrB00
2DN9A 2GUZB 2OCHA 2QWRB 2QSAA 2QWOB 1BQ0A 3UO2A 3AG7A 3UO3A 2KQXA 1WJZA 2GUZA 1XBLA 1BQZA 2EJ7A 2N04A 1NZ6A 2LO1A 1GH6A 1HDJA 2QWNB 2Y4TA 2QWQB 2DMXA 4J80A 1IURA 4RWUA 1FPOA 2CTRA 3BVOA 1N4CA 2N05A 2YS8A 2L6LA 2QWPB 2CTQA 3UCSC 2CTPA 2M6YA 2PF4E 4J7ZA 2YUAA 2LGWA 3APOA 4IT5A 1FAFA 2Y4UA 3APQA 2CUGA 2CTWA
chains in the Genus database with same CATH superfamily
1RP3B 2QSAA 2QWOB 4PA4A 2GDSA 4LNUA 4I55B 3JARB 3BCCH 1SQGA 1P7BA 3HB3B 3ETQA 5FNVB 2WWWA 2RDCA 5LA6B 3H1IH 3H01A 3L73H 1FXHA 2Q7HA 3OUFA 2WLLB 5IE9A 3RWRD 1QHTA 3ZEDA 2UXDO 5GONB 1XMOB 1VQMV 4JI1O 4JZGA 3RT3C 3TGUH 4DUYB 1HDJA 4QPKA 2A7WA 5GTHZ 2Y69B 2X6AA 1URFA 3F5WC 4BW9A 4K8ZA 3SYOA 4QE9A 1KC8W 2HFEC 1YSCA 1N32B 1Q6UA 1JCHA 1E79G 5KUMA 5A2QN 2Q67A 3JCZA 3OW2U 4DV3O 4FLWA 2OCHA 1XILA 3D3IA 1NTMH 4O4JB 1I5XA 2DWDC 2LJ2A 1S72V 1PP9H 4P9PA 2Y4TA 4EFBA 1CP9A 2RJZA 4IIJA 3ZHUA 2Q69A 3W7XA 4HBNA 2JEXA 3RYHB 4G28B 2LFSA 3CB2A 3OEHG 1HW7A 2UUBB 4LF6O 3FB5C 2EULA 4JI5B 1AR1B 2B1GA 2ODMA 2IJKA 2DMXA 2C2AA 3CS5A 1X59A 5L3FA 4L87A 4X20A 4QIWF 1MMMA 3Q4HB 2BOCC 5KAIZ 3T1YO 1LNQA 1QLEB 4CH4A 3BA8A 3CPWU 1DF4A 5KA5A 5B66Z 1OCRC 3AG1B 3H1KH 3E22A 5DECA 3T1CA 1W0KG 4FM2A 1KQSU 4KHPO 3L9DA 3SR2C 2M6YA 1YXBA 3OD4A 4LC1A 4X66O 5LP6B 1NVPD 1M90W 4K8XA 1UJWB 3SYQA 3X2QB 4OX9B 3AG3B 4TV9A 2LFRA 1RM1C 3FFQA 4JYAB 1BL8A 4W4KA 3JD3A 4TWKA 4ZOLA 1S5HC 2XAHA 2EBOA 5E1AC 1JJ2U 3JAWA 1VQ4V 3RYIB 1RPRA 4J10A 1Z5VA 1E1QG 2F1MA 1G1XB 3ZHVA 3BEHA 2UXDB 5B1AC 1K97A 2P22C 2ATKC 4X65B 3IC9A 3PJSK 4IIJB 2B1IA 4FMTA 1XQ8A 4NVPA 1OCOC 2ZE5A 4N23A 5JVDB 1O9HA 4UB6Z 1H8HG 4IYHA 4PJ0Z 5KA6A 1I0HA 5C8YA 2X7RB 3AG7A 5JCOA 1NH2D 3FYIB 1YTFB 4LF7O 4QJFB 3ZHRA 1WA8B 2ILMA 3CSXA 3SDLA 5KLVH 4BW5A 4F6RB 4LF6B 3OUSA 4PDLA 3IJ4A 2XASA 4TUYA 2FMLA 4AILC 1XMQO 3CE2A 3J81N 3BY6A 3H1LH 4BR6A 4O2AA 2ZDIA 3RVZA 2XT9A 1AROP 1H2LA 3JD2A 1ZWIC 2RNBA 4ZIBA 1Y76B 4FLYA 4LNUB 3E89A 1I94B 4D7TA 2EIJB 1PL4A 3CMAV 4MW3A 5F2VO 2YC0A 2DE0X 1W59A 4MTGA 1N32O 3K57A 1UPGA 2XNDG 2JS5A 5KMGB 3OT7A 2DWEC 4YJ2B 3SGIA 4AI8A 1HP8A 5GONA 4ABMA 1V9PA 4FLVA 4JZ2A 3BVOA 2V1DA 2QJ1A 2NN4A 2DOSA 4G2KA 2PI4A 3N2GB 3A0HZ 3AK1A 4EEQA 3OTOB 4MVQA 2XAQA 2CAZC 1I7FA 3SJAC 1YIJV 2KQXA 4Z1VA 1FJGB 2N74A 3CCSV 3LUTB 2VQEO 2WAMA 3ZX6A 1SERA 2CTRA 4WFAV 4BIUA 1Q82W 1I5YA 3H9VA 5HFMA 2K1EA 5EIBC 1AI4A 1YJ9V 4X65O 1EM1A 1Q7YW 3VQWA 2L35A 2Q8VA 2QTSA 2P5OA 3GWOA 1THZA 3P30A 2AHZA 5JJEB 2P7TC 2QWQB 2ZNJA 3CC7V 4X1YB 3L75H 1DGSA 1OCCB 3L70H 4O4LA 3IAYA 4U3FH 1Z2GA 1JFFB 4LFCO 1TUEB 3CX5F 3WB2A 4L8JA 4O4HA 3AG4C 4JI0B 3BAAA 1YEWA 4N21A 2VQEB 1MSWD 4FFBB 4B7KA 2Q0AA 2GHYA 4CS4A 3CWBH 5LMUB 2FTKA 4X1KB 3ABMB 5CMUA 1XREA 2EINC 5KX5A 1HNZO 1VQ7V 4JI1B 1HWYA 1US6A 4ICGA 4I7ZB 4J9YB 4I9QA 2R9IA 2JRIA 4DR6B 3R66A 4TV9B 2EIKC 1K5QA 1QBZA 1P84F 2X0LA 2Y48A 3ZMUA 3OR6C 3B2EE 1ZTEA 2NR5A 3QO8A 1VQ6V 4LF5B 2UXBB 2DYSC 5DEDA 4JTAB 4GKKO 3ZRXA 2ARHA 3TCUA 2CGOA 1IBLO 1GRJA 1NR1A 2EJRA 3CXCU 4WBNA 3ZIAG 1YCIA 1WP8A 5LOVA 4IHJB 2ETNA 3ASOB 2UUAO 4PD4F 4XBFA 2F4VB 5BMVB 2PZSA 1ZL8A 5LHIA 1GN3A 2KG7B 4ZHQB 4U3JA 2HHHO 2QEXV 1V55C 4JYCA 3APQA 4NB5A 4PDRA 2IJIA 3ABTA 5KHGA 3J80N 1SQFA 3JAMN 4TQDA 5C8YB 1R6TA 2ZT9B 5LYJA 1PD3A 2OCCC 2Q4PA 2WLHA 4WFFA 1YVWA 4O4IB 1SQXH 1PV0A 3SJCC 2H8PC 1EZJA 1TGOA 4TV8B 4LF4B 2PF4E 2G38A 4X88A 4RUEA 1P7GA 1SZXA 4J7KA 4RQFA 3D8CA 2ITCC 1B06A 4QE7A 4DV5B 3K5MA 4LBEC 1XNQO 4J80A 2HHHB 3U10A 1MOFA 4CH3A 2K9PA 1ZX3A 1FXKB 5J2UA 4JI3B 1D5AA 2QKAA 4RAIA 1IX9A 5IJ9A 2CTPA 1CPYA 3H1HH 2E76B 3CCEV 2P06A 1XBLA 1LUWA 2YICA 1M1KW 2QDOA 4UV9A 2JGDB 1N36B 1KP3A 4XDJA 4DO2A 1XI1A 1SF9A 3ZS8C 4J7JA 1L8DA 1A32A 3HR0A 1IXMA 4DV6B 4X64O 1R3IC 5EBWC 1XNRB 4D6TH 4DW1A 3CCQV 3FB7C 4GX2A 1MZFA 1K7DA 2BTOA 3CYOA 1W0JG 3MDSA 1TUBB 2RCVA 1ZL8B 4ZHQA 4JAAA 2PY5A 3CJHA 3LDDA 3RYHA 2PGGA 2NLJC 1TVKA 3A0RA 3E8BA 1SQVH 4OPHA 5CBHA 3M7MX 1J95A 3W7UA 5LYJB 4UCRA 1S5JA 3JYCA 2N04A 2WLJA 1KKDA 3UT5A 2VWJA 2ZIMA 2ZINA 5TISZ 1DLBA 1N33B 4I50A 3ZRVA 4PI0A 4GX1A 1I08A 1R6KA 2OIGA 5KHHA 5K1PA 2OT5A 1VQ5V 1ZLZA 1IBMB 1JFFA 2QM7A 2Q68A 3T4DA 4DK1A 2XHBA 5LP6C 1JX9A 3CCVV 4ASUG 4J42A 1LR1A 2VQFB 4B3RB 2AZ0A 5L3EA 4YY3O 1H2NA 4X1IB 4WFGA 2JDIG 4MVZA 1VF6C 1OV9A 2HVKC 5CB4A 1SESA 1JVMA 4LR3A 1NJIW 5BZBA 3ZN0A 4H33A 2Q7EA 3AG2C 2R9RB 2WA3A 3ABLB 1P49A 4ZBMA 2IJHA 1M57C 3TXSA 1Q81W 3JAWB 3CCUV 1NTZH 1XMOO 4KFMA 4F6EA 2UXCB 4I9WA 3OMAB 4YHHB 2JGUA 2IH3C 3FD9A 1NI8A 2EILB 2DJVA 5CN0A 3G6EV 4DW0A 2QWNB 1BS3A 4WBNB 4DR4O 4BIOA 1HNXO 5BMVA 3LNMB 3P3NA 1OZ0A 3O65A 4CH5A 4U3JB 4TSFG 1WA8A 1SKVA 1QQCA 5LMNO 2FL4A 2Q9LA 2ZE6A 1WP7A 4I50B 1WAZA 2V4DA 1JPXA 4DR7B 2Y0PA 4JI4B 1AI5A 4O4IA 4B3MO 1WPBA 1H2SB 2CUGA 2A79B 4JI8O 4UFZA 1BHAA 4DUZB 3K3WA 3K0GA 3CP1A 4UXNA 3BA9A 3K0DA 4TQFA 3JD1A 5LGTA 1F23A 4Z1MG 5LHGA 1BT8A 5ITZA 2IM9A 5IY5C 4DYLA 2UUCB 2YI8A 1MNGA 4KL1A 3RBZA 5J9PC 4FJCC 4DV4B 3W7SA 1R73A 1K3EA 4X89A 3ETGA 5CA0A 4GX5A 2XAJA 1K4CC 4QPJA 1K92A 1AR4A 2Q7GA 2NNUA 5K1XA 1V54C 5GW7A 3ZMSA 2AHYA 2X6CA 5CA1A 3GWKC 1NKDA 2HEPA 1EBOA 4JAVA 2HKOA 5JQGB 3N27A 2AW9A 3RW0A 4PA9A 4GX0A 4NXNB 3CXHF 2IH1C 5L3DA 1DF5A 1E1RG 3DXRB 3G4SV 1Q6IA 4JYYA 3FX7A 2E74B 2CK3G 1KYOF 4B3TO 4D7SA 5EYPB 2XAGA 4FIPC 3AG1C 2ZXWC 2XUMA 4X1YA 3CCRV 1FD9A 1VQ9V 2E5LB 4FZ0A 1ZSPA 2EX3A 3KZIZ 4O4LB 4UCVA 4BWAA 3ZJZA 3ZBHA 3ZHQA 3D36A 3K5OA 2Q6AA 2JK5C 4GLXA 1XHZA 1MABG 1XUQA 1VF6A 4I55A 2QM4A 1U96A 1KU9A 4JV5O 3UO2A 3K59A 3HKCA 4UVCA 1YJNV 2WLNA 1K5SA 4FFBA 4DV7B 2YXHA 2OCCB 4XDLA 1W2BU 2EIMC 3OGCC 3VBBA 2WLLA 5KX5B 5LL6Y 2ZM6B 1H2GA 1AB3A 4YIPA 4GCZA 3A8TA 4X1IA 1FXVA 2ZR2A 4JI0O 2BTQB 3QG5A 3K08A 5CB4B 1K4DC 2XOKG 1H8EG 1TA8A 3QTCA 1KMIZ 5CA0B 2F4VO 4B3SB 2JJ2G 5EK0A 2Q73A 4LFCB 2LGWA 2GV9A 3SYPA 2VS0A 1AJQA 1RSOA 3RVYA 1ROPA 5JQGA 1H38A 1BQZA 3RYCA 3HKEA 3F5TA 2Z0AA 2Y69C 4DRXB 2V7QG 4KXRA 3J7AU 1NU1H 3KCXA 2A0LA 2GTSA 3OM3B 1R3KC 3JD0A 5EYPA 1YF2A 3N2KA 4R7CA 4A5UB 1N33O 1YITV 1R1BA 2F95B 2ZDIC 4NTWA 1ENVA 4JI2O 3K5LA 3E8HA 1WB8A 1PPJH 3ZMTA 2F66C 4E4EA 4F4LA 3ZRWA 3OEEG 1Y66A 3NR7A 4PA6A 1J5EO 2DYRC 3BABA 1D2DA 3B8NA 4DV0B 3CRMA 3AK2A 2CDYA 1RFYA 1S5LZ 1WJZA 4LF9B 2ZIOA 3U11A 4DUZO 1O9GA 3MAQA 3JASB 3VQVA 5IJ9B 2HJFC 4LH7A 3UKMA 3JATA 4BIZA 1SRYA 2WPDG 1GM8A 1Q8IA 4DR2B 4DR5B 2BTQA 4H44B 3MHSC 1F4NA 1Q6HA 2DYSB 5LGUA 2EZPA 1I94O 4FZ1A 1XNQB 5IYDO 1FJGO 2P4KA 2N05A 5H5NA 1MZEA 1IDSA 5BXZA 3RYIA 2UXCO 1NH2B 2JIZG 3OTFA 5LXTB 4YJ3B 4PHZA 1HNXB 1GN2A 1KKCA 3HKBA 2GUZA 3ABKC 5JWPA 4JI7B 1TUBA 3AG3C 2H3OA 3OAAG 1U97A 1HR0B 4UCTA 3AEIA 1TVKB 2W0FC 3WG7B 4R8CA 3WB1A 5L3BA 1S77D 2PTMA 3K58A 3D36C 4NR1A 1XHXA 4LF7B 5B3SB 3DTUB 3JSLA 4UVAA 4H0LB 4P2ZA 3UT5B 4LFBB 5IYZA 3LDEA 2JS3A 3BHPA 1BSMA 1BGYH 2IW5A 3ETEA 4LP8A 3FKSG 3MD0A 2WLMA 1YJWV 4DV1B 1B3QA 2O57A 4WFBV 4UUJC 4E2LA 4XDKA 4CH6A 4LCUC 3G80A 3NXSA 3SPIA 1NTKH 1Y76A 1H2MA 1SQQH 2DW4A 3JASA 3HKCB 4Q6GA 1M9NA 1SETA 2B9ZA 1VF7A 4DV0O 2RMKB 4K0KO 4PELA 3CRCA 3RYFA 4MTFA 2Y4UA 5DN6G 3CRAA 2QR4A 3ASNB 2F43G 2AGAA 2R9AA 2PI5A 3CRQA 3EHBB 1YTFD 3OTOO 3I5DA 4I4TB 4RUFA 3G71V 1FFTB 1IURA 5EIBD 2ZCEA 1ORQC 3WFVA 3B8MA 4FLZA 1RM1B 1JQ0A 4GUNA 4IL6Z 2R70A 1RSOB 4FVMA 2D3OW 2Z3YA 4K3AA 3JALA 3IGAC 1MG1A 2GSMB 4X66B 4GYCB 2AZ2A 3F7VC 1BE3H 1QLNA 1JOYA 1R6NA 1ZUQA 3KG2A 1K73W 4LWSB 2OTJV 4JF3A 2YDEA 1VEWA 4IGGA 3S3XA 4LFAB 2E75B 5D5PA 2JVDA 3VOUA 1G4YB 1NT2B 1OCRB 4PV1B 5B1NA 3SPCA 5CBFA 4LF8B 2ZR3A 1FKAO 5J2TA 5FPOA 5DM6V 3P32A 5IDJA 4FM1A 2YSUB 4O4HB 3F7YC 4MVUA 3OMIB 2QA4V 1BQ0A 2CH7A 5BY1A 2JEUA 4FK5C 1GK9A 5B1BC 3ABUA 2DQ0A 3QO5A 4U7NA 4CC6A 5KHIA 5IYCO 4U7OA 2KKWA 4X1KA 2MW2B 3SJBC 3E22B 5EC1C 3RYFB 1KECA 2W0XA 3E83A 4DR6O 2VWKA 5BR8O 3JATB 1GKFA 2Y0IA 2PYJA 4DV2O 4P30A 2BSKB 1PNLA 2EZOA 4WFHA 1MSDA 2OIEA 1GO3F 2YIAA 2LQTA 4FM0A 4MSWC 4GKKB 1X4TA 2E5LO 1YI2V 4B7EA 4YY3B 4PDVA 1NBMG 1XEQA 4JYBA 1IBLB 5JJNB 3EFFK 3JALB 5LXTA 1Q90D 5IJ0A 1XNRO 2QTOA 1SQBH 5LOVB 2HVJC 4IHJA 3GVMA 4KUMA 2VRZA 3CRRA 1Y6XA 5BR8B 4LWSA 1M56C 3ETDA 4DV2B 3L71H 3PN1A 1Q86W 3LDCA 3HPLC 2YIBD 4I5SA 3T1HO 4LFBO 4W4LA 1M5IA 2CTWA 3CHXA 4MTOA 2ADPA 5KUKA 5FL7G 3G67A 3FAVB 4Z2WA 1FS0G 1VQLV 5GTIZ 2OYQA 1P4RA 3JCUZ 2LO1A 2A9HA 1AJPA 5IYZB 4RWUA 2WA4A 1SC5B 3ASOC 1JJOA 5LHHA 3BPZA 1QR8A 4EB6B 3HKDB 4F6RA 2A3QA 1SA0A 4HNAB 4H13B 4K0KB 1XL6A 2P67A 1S76D 3VQXA 2DN9A 4Q20A 1QR9A 4MS2A 3W7TA 1EN6A 4O2AB 3KKYA 2P90A 5A9GA 1NR7A 4UCSA 1OHHG 3K9SA 5IY5B 2A06H 5J2UB 3SJQC 2FKXA 2QWPB 1FYJA 4QNHB 3TETA 4LF8O 4B3RO 1DTOA 4I0XA 1VQKV 5LGNA 3WB0A 3I55V 4OX9O 1WPXA 4CZZA 5FLXN 3OE7G 4B3TB 3C3TA 2GBOA 5KMGA 1F51A 2JGDA 1QLEC 1Q5OA 2EJ7A 4J41A 1OCZC 3BFRA 3CCLV 4NKGB 2HLDG 1AP5A 4I4TA 1R3LC 4OPAA 1R3JC 1FXKC 1M56B 3CEIA 5H6RA 4GKJB 1GM7A 1T5EA 4B08A 3CCMV 4EKWA 4HYOA 4JGSA 5EC2C 2WLIA 2QWRB 1AI7A 1SZTA 4JV5B 1VQ8V 1YHQV 2YIBA 4R50A 3CJHB 1S0VA 4IYIA 3H1JH 4DRXA 2LW1A 1BZKA 2ZXWB 2W6JG 2OWOA 3KCYA 3N2KB 2KSDA 1GTOA 4CBCA 4JTCB 1XL4A 1Z5WA 2BCCH 2RN9A 1BMFG 1BHBA 5B5EZ 3ABKB 3L72H 4ZKIA 3W7WA 4JPRA 3HKDA 4K35A 4H37A 1OCOB 4AQYO 1B6QA 2P4VA 4LFAO 1JMKC 2F93B 1N36O 5EBLC 4LF5O 4O2BB 5JCOC 4UVBA 1PNKA 5B3SC 1EN5A 1KUQA 4JI8B 1GMGA 1QVFU 1VF5B 3E86A 3JARA 2MK3A 3TXQA 1RPOA 1QVGU 3SYAA 4ZI7B 1XOUA 1OCZB 4I0XB 1GN6A 3ZCCA 4DR1B 4JI2B 4DV7O 1WNSA 1WB7A 2ITDC 4GZRB 3DGEA 2YIDA 3ICXA 4PI2A 1KBHA 4FPPA 3LSUA 3K04A 3C90A 1N8RW 2ZM6O 3LSQA 1J5EB 1ZAUA 2RQ6A 4PA3A 3WG7C 4LH6A 1Y4MA 4IT5A 3X2QC 1Q43A 1PM9A 2GUZB 2UUCO 1QU7A 4X62B 4EFEA 4OGQB 2CE4A 1AJNA 1GAXA 4KP4A 4O4JA 2UU9O 5IJ0B 1PL0A 2LW7A 1EZVH 3ABLC 4JI4O 1N4CA 1IZ3A 1YZBA 2QM8A 5B1OA 2UUAB 3T1HB 2HR3A 5IWAO 4DV6O 3ZHSA 5HFLA 4DV1O 3E35A 4X64B 2KG7A 3JAKA 5L3CA 4DR7O 4KHPB 4QGPA 2IU0A 3ZMVA 3L74H 2DYRB 3OGIB 3R65A 3RN4A 3B09A 2F23A 3FYEB 3FAVA 1VIBA 2FYUH 4JYAO 3SPGA 3TK1A 2EIMB 1OJHA 2DQ3A 2IU3A 2IJJA 4UCOA 1VQPV 3ABMC 1H2KA 1HNWO 3CMEV 4EB6A 1Y67A 4TV8A 4CS3A 4WF9V 1PKXA 1SA0B 4HNAA 4MVRA 3B40A 3Q4HA 5FPRA 3FB8C 4J11A 2ZQMA 1CXZB 2H94A 1FFXA 2BE3A 1N0JA 4ZI7A 2ZE7A 4X9QA 5IYBO 2WSSG 1SS3A 3BRCA 3ZRSA 2L6LA 4TOIA 2UUBO 2PUSA 1AP6A 4JTDB 1HNZB 1N0NA 2WLKA 1FXKA 4DV5O 3LNNA 3OMNB 3U0ZA 4LF4O 5AG2A 5LP6A 1M93A 5C93A 4YHHO 1IXBA 3AG4B 4WCEV 3O9OA 4FLTA 1N34O 5H2FZ 4NXMO 2QKSA 4J9ZB 3CC4V 1EFRG 1DK1A 1K34A 5H9CA 4JI6B 1L0LH 1NS1A 2EILC 5JJJB 2JJ1G 4RO2A 4MVOA 1V55B 4UB8Z 1K33A 1IBKO 4ZOLB 1HNWB 4FLXA 5CA1B 3IC7A 2R72A 2YEVB 3D3QA 3DC5A 4DV3B 2WLIB 3K06A 1F4MA 1Q3EA 1XMQB 1UFIA 4R6ZA 1S3JA 4GT1A 4DUYO 1F7YA 2EIKB 5KHKA 3ZHTA 3SYCA 1KP2A 3JAKB 2YXLA 4J7ZA 2YUAA 5JVDA 5JH7A 5EZYB 3JSNA 1NQTA 5B1AB 3I56V 4YXWG 2X6BA 4RQEA 3G6BA 5IWAB 2ADQB 2B5UA 3STLC 3DSQA 5J2TB 5LMUO 4DR4B 2LGQA 3TJTA 2P6JA 1COWG 4PDMA 3E8GA 4DV4O 3M8AA 2CH7B 5D5QA 3IFXA 1FFXB 4O2BA 3S3WA 3T1YB 3ML0A 2BOBC 3ASNC 3QVNA 5LA6A 5H6QA 5IT9N 3K9AA 4HZ3A 4BAYA 4CC5A 4TT3G 2ZD9A 2YS8A 5EBMC 2HG5C 4X8AA 1AILA 4DR2O 4C7UA 3EVKA 1FAFA 1EN4A 1VARA 2BSKA 4LF9O 3T2MA 2EIJC 1QCEA 2GTAA 4HAMA 4X62O 3ZMZA 1WN7A 4YJ2A 2ZNIA 3DC6A 4NYKA 1JA8A 4UV8A 4JI3O 1AI6A 2Q0OC 4DK0A 1L0NH 3CCJV 1VQOV 3UQ8A 3EXAA 5CBGA 4PA7A 4CS2A 1Y74B 1AR5A 3N2GA 3RYCB 3HKEB 4UCUA 3UM7A 2XTAA 2CGNA 4G27B 3WU2Z 1G6UA 4JASA 4JI5O 1N34B 4NXMB 1LUVA 4AHCA 5CA3A 2KB1A 3K03A 4JI6O 1HR0O 3STZC 5JH7B 3QO7A 1KD1W 1V54B 5KAFZ 3M99B 4MTXA 2PYLA 3OR7C 2QKCA 3A0BZ 3C3SA 1MA1A 3A2FA 1VMGA 3QF7A 2M7WA 2QGNA 4MVSA 1SQPH 1M4UA 3ZRWB 1FPOA 3CC2V 4AQYB 4B3SO 3E8FA 4DR5O 1QNMA 4GKJO 2UXNA 4JAUA 4P9OA 1VQNV 4NXNO 4OXSA 4DXWA 1IBMO 3THOA 3AG2B 1VP7A 2QE7G 3LSSA 1K9MW 1PNMA 3GB7C 4B3MB 1M57B 2AXTZ 3VQYA 2W6IG 3CD6V 1GM9A 5FNVA 3UCSC 1IVSA 1TAEA 3B77A 3K79A 4WFEA 4FFKA 2UXBO 1D5NA 2FB5A 1IBKB 3QNEA 2UXXA 4JI7O 1L1FA 2OTLV 2ZKOA 3OFNG 3P3PA 3K5NA 5ITZB 1NZ6A 1GH6A 1GN4A 1G8MA 2EINB 3RFRA 1Y74A 2UU9B 5KHJA 4NTYA 2D2CB 4DR3B 4YIOA 1AVMA 4YJ3A 1JR9A 3SPHA 3AK3A 3HKBB 2IBZH 1YDXA 2YXYA 1WLEA 2YEVA 1CEZA 3JD4A 1K8AW 3E2EA 4MW8A 2ZE8A 1OCCC 2Q5ZA 5LBQA 2Z5UA 2CTQA 2LP7A 4MVMA 4NTXA 3DXRA 4MT8A 5L3GA 1BCCH 2HJDA 1XDCA 3B4SA 3UO3A 3FB6C 5EZYA 2YI9A 3SPJA 5B1BB 3RGBA 4DR1O 5E79Z 3MHHC 4FLUA 2XAFA 5LMNB 1NVPB 4TUYB 2HP8A 1KB9F 2E3CA 3ZN1A 2VQFO 3T4ZA 4X20B 1B04A 3APOA 4DR3O
chains in the Genus database with same CATH topology
2DN9A 2GUZB 2OCHA 2QWRB 2QSAA 2QWOB 1BQ0A 3UO2A 3AG7A 3UO3A 2KQXA 1WJZA 2GUZA 1XBLA 1BQZA 2EJ7A 2N04A 1NZ6A 2LO1A 1GH6A 1HDJA 2QWNB 2Y4TA 2QWQB 2DMXA 4J80A 1IURA 4RWUA 1FPOA 2CTRA 3BVOA 1N4CA 2N05A 2YS8A 2L6LA 2QWPB 2CTQA 3UCSC 2CTPA 2M6YA 2PF4E 4J7ZA 2YUAA 2LGWA 3APOA 4IT5A 1FAFA 2Y4UA 3APQA 2CUGA 2CTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DN9 A;  2GUZ B;  2OCH A;  2QWR B;  2QSA A;  2QWO B;  1BQ0 A;  3UO2 A;  3AG7 A;  3UO3 A;  2KQX A;  1WJZ A;  2GUZ A;  1XBL A;  1BQZ A;  2EJ7 A;  2N04 A;  1NZ6 A;  2LO1 A;  1GH6 A;  1HDJ A;  2QWN B;  2Y4T A;  2QWQ B;  2DMX A;  4J80 A;  1IUR A;  4RWU A;  1FPO A;  2CTR A;  3BVO A;  1N4C A;  2N05 A;  2YS8 A;  2L6L A;  2QWP B;  2CTQ A;  3UCS C;  2CTP A;  2M6Y A;  2PF4 E;  4J7Z A;  2YUA A;  2LGW A;  3APO A;  4IT5 A;  1FAF A;  2Y4U A;  3APQ A;  2CUG A;  2CTW A; 
#chains in the Genus database with same CATH topology
 1RP3 B;  2QSA A;  2QWO B;  4PA4 A;  2GDS A;  4LNU A;  4I55 B;  3JAR B;  3BCC H;  1SQG A;  1P7B A;  3HB3 B;  3ETQ A;  5FNV B;  2WWW A;  2RDC A;  5LA6 B;  3H1I H;  3H01 A;  3L73 H;  1FXH A;  2Q7H A;  3OUF A;  2WLL B;  5IE9 A;  3RWR D;  1QHT A;  3ZED A;  2UXD O;  5GON B;  1XMO B;  1VQM V;  4JI1 O;  4JZG A;  3RT3 C;  3TGU H;  4DUY B;  1HDJ A;  4QPK A;  2A7W A;  5GTH Z;  2Y69 B;  2X6A A;  1URF A;  3F5W C;  4BW9 A;  4K8Z A;  3SYO A;  4QE9 A;  1KC8 W;  2HFE C;  1YSC A;  1N32 B;  1Q6U A;  1JCH A;  1E79 G;  5KUM A;  5A2Q N;  2Q67 A;  3JCZ A;  3OW2 U;  4DV3 O;  4FLW A;  2OCH A;  1XIL A;  3D3I A;  1NTM H;  4O4J B;  1I5X A;  2DWD C;  2LJ2 A;  1S72 V;  1PP9 H;  4P9P A;  2Y4T A;  4EFB A;  1CP9 A;  2RJZ A;  4IIJ A;  3ZHU A;  2Q69 A;  3W7X A;  4HBN A;  2JEX A;  3RYH B;  4G28 B;  2LFS A;  3CB2 A;  3OEH G;  1HW7 A;  2UUB B;  4LF6 O;  3FB5 C;  2EUL A;  4JI5 B;  1AR1 B;  2B1G A;  2ODM A;  2IJK A;  2DMX A;  2C2A A;  3CS5 A;  1X59 A;  5L3F A;  4L87 A;  4X20 A;  4QIW F;  1MMM A;  3Q4H B;  2BOC C;  5KAI Z;  3T1Y O;  1LNQ A;  1QLE B;  4CH4 A;  3BA8 A;  3CPW U;  1DF4 A;  5KA5 A;  5B66 Z;  1OCR C;  3AG1 B;  3H1K H;  3E22 A;  5DEC A;  3T1C A;  1W0K G;  4FM2 A;  1KQS U;  4KHP O;  3L9D A;  3SR2 C;  2M6Y A;  1YXB A;  3OD4 A;  4LC1 A;  4X66 O;  5LP6 B;  1NVP D;  1M90 W;  4K8X A;  1UJW B;  3SYQ A;  3X2Q B;  4OX9 B;  3AG3 B;  4TV9 A;  2LFR A;  1RM1 C;  3FFQ A;  4JYA B;  1BL8 A;  4W4K A;  3JD3 A;  4TWK A;  4ZOL A;  1S5H C;  2XAH A;  2EBO A;  5E1A C;  1JJ2 U;  3JAW A;  1VQ4 V;  3RYI B;  1RPR A;  4J10 A;  1Z5V A;  1E1Q G;  2F1M A;  1G1X B;  3ZHV A;  3BEH A;  2UXD B;  5B1A C;  1K97 A;  2P22 C;  2ATK C;  4X65 B;  3IC9 A;  3PJS K;  4IIJ B;  2B1I A;  4FMT A;  1XQ8 A;  4NVP A;  1OCO C;  2ZE5 A;  4N23 A;  5JVD B;  1O9H A;  4UB6 Z;  1H8H G;  4IYH A;  4PJ0 Z;  5KA6 A;  1I0H A;  5C8Y A;  2X7R B;  3AG7 A;  5JCO A;  1NH2 D;  3FYI B;  1YTF B;  4LF7 O;  4QJF B;  3ZHR A;  1WA8 B;  2ILM A;  3CSX A;  3SDL A;  5KLV H;  4BW5 A;  4F6R B;  4LF6 B;  3OUS A;  4PDL A;  3IJ4 A;  2XAS A;  4TUY A;  2FML A;  4AIL C;  1XMQ O;  3CE2 A;  3J81 N;  3BY6 A;  3H1L H;  4BR6 A;  4O2A A;  2ZDI A;  3RVZ A;  2XT9 A;  1ARO P;  1H2L A;  3JD2 A;  1ZWI C;  2RNB A;  4ZIB A;  1Y76 B;  4FLY A;  4LNU B;  3E89 A;  1I94 B;  4D7T A;  2EIJ B;  1PL4 A;  3CMA V;  4MW3 A;  5F2V O;  2YC0 A;  2DE0 X;  1W59 A;  4MTG A;  1N32 O;  3K57 A;  1UPG A;  2XND G;  2JS5 A;  5KMG B;  3OT7 A;  2DWE C;  4YJ2 B;  3SGI A;  4AI8 A;  1HP8 A;  5GON A;  4ABM A;  1V9P A;  4FLV A;  4JZ2 A;  3BVO A;  2V1D A;  2QJ1 A;  2NN4 A;  2DOS A;  4G2K A;  2PI4 A;  3N2G B;  3A0H Z;  3AK1 A;  4EEQ A;  3OTO B;  4MVQ A;  2XAQ A;  2CAZ C;  1I7F A;  3SJA C;  1YIJ V;  2KQX A;  4Z1V A;  1FJG B;  2N74 A;  3CCS V;  3LUT B;  2VQE O;  2WAM A;  3ZX6 A;  1SER A;  2CTR A;  4WFA V;  4BIU A;  1Q82 W;  1I5Y A;  3H9V A;  5HFM A;  2K1E A;  5EIB C;  1AI4 A;  1YJ9 V;  4X65 O;  1EM1 A;  1Q7Y W;  3VQW A;  2L35 A;  2Q8V A;  2QTS A;  2P5O A;  3GWO A;  1THZ A;  3P30 A;  2AHZ A;  5JJE B;  2P7T C;  2QWQ B;  2ZNJ A;  3CC7 V;  4X1Y B;  3L75 H;  1DGS A;  1OCC B;  3L70 H;  4O4L A;  3IAY A;  4U3F H;  1Z2G A;  1JFF B;  4LFC O;  1TUE B;  3CX5 F;  3WB2 A;  4L8J A;  4O4H A;  3AG4 C;  4JI0 B;  3BAA A;  1YEW A;  4N21 A;  2VQE B;  1MSW D;  4FFB B;  4B7K A;  2Q0A A;  2GHY A;  4CS4 A;  3CWB H;  5LMU B;  2FTK A;  4X1K B;  3ABM B;  5CMU A;  1XRE A;  2EIN C;  5KX5 A;  1HNZ O;  1VQ7 V;  4JI1 B;  1HWY A;  1US6 A;  4ICG A;  4I7Z B;  4J9Y B;  4I9Q A;  2R9I A;  2JRI A;  4DR6 B;  3R66 A;  4TV9 B;  2EIK C;  1K5Q A;  1QBZ A;  1P84 F;  2X0L A;  2Y48 A;  3ZMU A;  3OR6 C;  3B2E E;  1ZTE A;  2NR5 A;  3QO8 A;  1VQ6 V;  4LF5 B;  2UXB B;  2DYS C;  5DED A;  4JTA B;  4GKK O;  3ZRX A;  2ARH A;  3TCU A;  2CGO A;  1IBL O;  1GRJ A;  1NR1 A;  2EJR A;  3CXC U;  4WBN A;  3ZIA G;  1YCI A;  1WP8 A;  5LOV A;  4IHJ B;  2ETN A;  3ASO B;  2UUA O;  4PD4 F;  4XBF A;  2F4V B;  5BMV B;  2PZS A;  1ZL8 A;  5LHI A;  1GN3 A;  2KG7 B;  4ZHQ B;  4U3J A;  2HHH O;  2QEX V;  1V55 C;  4JYC A;  3APQ A;  4NB5 A;  4PDR A;  2IJI A;  3ABT A;  5KHG A;  3J80 N;  1SQF A;  3JAM N;  4TQD A;  5C8Y B;  1R6T A;  2ZT9 B;  5LYJ A;  1PD3 A;  2OCC C;  2Q4P A;  2WLH A;  4WFF A;  1YVW A;  4O4I B;  1SQX H;  1PV0 A;  3SJC C;  2H8P C;  1EZJ A;  1TGO A;  4TV8 B;  4LF4 B;  2PF4 E;  2G38 A;  4X88 A;  4RUE A;  1P7G A;  1SZX A;  4J7K A;  4RQF A;  3D8C A;  2ITC C;  1B06 A;  4QE7 A;  4DV5 B;  3K5M A;  4LBE C;  1XNQ O;  4J80 A;  2HHH B;  3U10 A;  1MOF A;  4CH3 A;  2K9P A;  1ZX3 A;  1FXK B;  5J2U A;  4JI3 B;  1D5A A;  2QKA A;  4RAI A;  1IX9 A;  5IJ9 A;  2CTP A;  1CPY A;  3H1H H;  2E76 B;  3CCE V;  2P06 A;  1XBL A;  1LUW A;  2YIC A;  1M1K W;  2QDO A;  4UV9 A;  2JGD B;  1N36 B;  1KP3 A;  4XDJ A;  4DO2 A;  1XI1 A;  1SF9 A;  3ZS8 C;  4J7J A;  1L8D A;  1A32 A;  3HR0 A;  1IXM A;  4DV6 B;  4X64 O;  1R3I C;  5EBW C;  1XNR B;  4D6T H;  4DW1 A;  3CCQ V;  3FB7 C;  4GX2 A;  1MZF A;  1K7D A;  2BTO A;  3CYO A;  1W0J G;  3MDS A;  1TUB B;  2RCV A;  1ZL8 B;  4ZHQ A;  4JAA A;  2PY5 A;  3CJH A;  3LDD A;  3RYH A;  2PGG A;  2NLJ C;  1TVK A;  3A0R A;  3E8B A;  1SQV H;  4OPH A;  5CBH A;  3M7M X;  1J95 A;  3W7U A;  5LYJ B;  4UCR A;  1S5J A;  3JYC A;  2N04 A;  2WLJ A;  1KKD A;  3UT5 A;  2VWJ A;  2ZIM A;  2ZIN A;  5TIS Z;  1DLB A;  1N33 B;  4I50 A;  3ZRV A;  4PI0 A;  4GX1 A;  1I08 A;  1R6K A;  2OIG A;  5KHH A;  5K1P A;  2OT5 A;  1VQ5 V;  1ZLZ A;  1IBM B;  1JFF A;  2QM7 A;  2Q68 A;  3T4D A;  4DK1 A;  2XHB A;  5LP6 C;  1JX9 A;  3CCV V;  4ASU G;  4J42 A;  1LR1 A;  2VQF B;  4B3R B;  2AZ0 A;  5L3E A;  4YY3 O;  1H2N A;  4X1I B;  4WFG A;  2JDI G;  4MVZ A;  1VF6 C;  1OV9 A;  2HVK C;  5CB4 A;  1SES A;  1JVM A;  4LR3 A;  1NJI W;  5BZB A;  3ZN0 A;  4H33 A;  2Q7E A;  3AG2 C;  2R9R B;  2WA3 A;  3ABL B;  1P49 A;  4ZBM A;  2IJH A;  1M57 C;  3TXS A;  1Q81 W;  3JAW B;  3CCU V;  1NTZ H;  1XMO O;  4KFM A;  4F6E A;  2UXC B;  4I9W A;  3OMA B;  4YHH B;  2JGU A;  2IH3 C;  3FD9 A;  1NI8 A;  2EIL B;  2DJV A;  5CN0 A;  3G6E V;  4DW0 A;  2QWN B;  1BS3 A;  4WBN B;  4DR4 O;  4BIO A;  1HNX O;  5BMV A;  3LNM B;  3P3N A;  1OZ0 A;  3O65 A;  4CH5 A;  4U3J B;  4TSF G;  1WA8 A;  1SKV A;  1QQC A;  5LMN O;  2FL4 A;  2Q9L A;  2ZE6 A;  1WP7 A;  4I50 B;  1WAZ A;  2V4D A;  1JPX A;  4DR7 B;  2Y0P A;  4JI4 B;  1AI5 A;  4O4I A;  4B3M O;  1WPB A;  1H2S B;  2CUG A;  2A79 B;  4JI8 O;  4UFZ A;  1BHA A;  4DUZ B;  3K3W A;  3K0G A;  3CP1 A;  4UXN A;  3BA9 A;  3K0D A;  4TQF A;  3JD1 A;  5LGT A;  1F23 A;  4Z1M G;  5LHG A;  1BT8 A;  5ITZ A;  2IM9 A;  5IY5 C;  4DYL A;  2UUC B;  2YI8 A;  1MNG A;  4KL1 A;  3RBZ A;  5J9P C;  4FJC C;  4DV4 B;  3W7S A;  1R73 A;  1K3E A;  4X89 A;  3ETG A;  5CA0 A;  4GX5 A;  2XAJ A;  1K4C C;  4QPJ A;  1K92 A;  1AR4 A;  2Q7G A;  2NNU A;  5K1X A;  1V54 C;  5GW7 A;  3ZMS A;  2AHY A;  2X6C A;  5CA1 A;  3GWK C;  1NKD A;  2HEP A;  1EBO A;  4JAV A;  2HKO A;  5JQG B;  3N27 A;  2AW9 A;  3RW0 A;  4PA9 A;  4GX0 A;  4NXN B;  3CXH F;  2IH1 C;  5L3D A;  1DF5 A;  1E1R G;  3DXR B;  3G4S V;  1Q6I A;  4JYY A;  3FX7 A;  2E74 B;  2CK3 G;  1KYO F;  4B3T O;  4D7S A;  5EYP B;  2XAG A;  4FIP C;  3AG1 C;  2ZXW C;  2XUM A;  4X1Y A;  3CCR V;  1FD9 A;  1VQ9 V;  2E5L B;  4FZ0 A;  1ZSP A;  2EX3 A;  3KZI Z;  4O4L B;  4UCV A;  4BWA A;  3ZJZ A;  3ZBH A;  3ZHQ A;  3D36 A;  3K5O A;  2Q6A A;  2JK5 C;  4GLX A;  1XHZ A;  1MAB G;  1XUQ A;  1VF6 A;  4I55 A;  2QM4 A;  1U96 A;  1KU9 A;  4JV5 O;  3UO2 A;  3K59 A;  3HKC A;  4UVC A;  1YJN V;  2WLN A;  1K5S A;  4FFB A;  4DV7 B;  2YXH A;  2OCC B;  4XDL A;  1W2B U;  2EIM C;  3OGC C;  3VBB A;  2WLL A;  5KX5 B;  5LL6 Y;  2ZM6 B;  1H2G A;  1AB3 A;  4YIP A;  4GCZ A;  3A8T A;  4X1I A;  1FXV A;  2ZR2 A;  4JI0 O;  2BTQ B;  3QG5 A;  3K08 A;  5CB4 B;  1K4D C;  2XOK G;  1H8E G;  1TA8 A;  3QTC A;  1KMI Z;  5CA0 B;  2F4V O;  4B3S B;  2JJ2 G;  5EK0 A;  2Q73 A;  4LFC B;  2LGW A;  2GV9 A;  3SYP A;  2VS0 A;  1AJQ A;  1RSO A;  3RVY A;  1ROP A;  5JQG A;  1H38 A;  1BQZ A;  3RYC A;  3HKE A;  3F5T A;  2Z0A A;  2Y69 C;  4DRX B;  2V7Q G;  4KXR A;  3J7A U;  1NU1 H;  3KCX A;  2A0L A;  2GTS A;  3OM3 B;  1R3K C;  3JD0 A;  5EYP A;  1YF2 A;  3N2K A;  4R7C A;  4A5U B;  1N33 O;  1YIT V;  1R1B A;  2F95 B;  2ZDI C;  4NTW A;  1ENV A;  4JI2 O;  3K5L A;  3E8H A;  1WB8 A;  1PPJ H;  3ZMT A;  2F66 C;  4E4E A;  4F4L A;  3ZRW A;  3OEE G;  1Y66 A;  3NR7 A;  4PA6 A;  1J5E O;  2DYR C;  3BAB A;  1D2D A;  3B8N A;  4DV0 B;  3CRM A;  3AK2 A;  2CDY A;  1RFY A;  1S5L Z;  1WJZ A;  4LF9 B;  2ZIO A;  3U11 A;  4DUZ O;  1O9G A;  3MAQ A;  3JAS B;  3VQV A;  5IJ9 B;  2HJF C;  4LH7 A;  3UKM A;  3JAT A;  4BIZ A;  1SRY A;  2WPD G;  1GM8 A;  1Q8I A;  4DR2 B;  4DR5 B;  2BTQ A;  4H44 B;  3MHS C;  1F4N A;  1Q6H A;  2DYS B;  5LGU A;  2EZP A;  1I94 O;  4FZ1 A;  1XNQ B;  5IYD O;  1FJG O;  2P4K A;  2N05 A;  5H5N A;  1MZE A;  1IDS A;  5BXZ A;  3RYI A;  2UXC O;  1NH2 B;  2JIZ G;  3OTF A;  5LXT B;  4YJ3 B;  4PHZ A;  1HNX B;  1GN2 A;  1KKC A;  3HKB A;  2GUZ A;  3ABK C;  5JWP A;  4JI7 B;  1TUB A;  3AG3 C;  2H3O A;  3OAA G;  1U97 A;  1HR0 B;  4UCT A;  3AEI A;  1TVK B;  2W0F C;  3WG7 B;  4R8C A;  3WB1 A;  5L3B A;  1S77 D;  2PTM A;  3K58 A;  3D36 C;  4NR1 A;  1XHX A;  4LF7 B;  5B3S B;  3DTU B;  3JSL A;  4UVA A;  4H0L B;  4P2Z A;  3UT5 B;  4LFB B;  5IYZ A;  3LDE A;  2JS3 A;  3BHP A;  1BSM A;  1BGY H;  2IW5 A;  3ETE A;  4LP8 A;  3FKS G;  3MD0 A;  2WLM A;  1YJW V;  4DV1 B;  1B3Q A;  2O57 A;  4WFB V;  4UUJ C;  4E2L A;  4XDK A;  4CH6 A;  4LCU C;  3G80 A;  3NXS A;  3SPI A;  1NTK H;  1Y76 A;  1H2M A;  1SQQ H;  2DW4 A;  3JAS A;  3HKC B;  4Q6G A;  1M9N A;  1SET A;  2B9Z A;  1VF7 A;  4DV0 O;  2RMK B;  4K0K O;  4PEL A;  3CRC A;  3RYF A;  4MTF A;  2Y4U A;  5DN6 G;  3CRA A;  2QR4 A;  3ASN B;  2F43 G;  2AGA A;  2R9A A;  2PI5 A;  3CRQ A;  3EHB B;  1YTF D;  3OTO O;  3I5D A;  4I4T B;  4RUF A;  3G71 V;  1FFT B;  1IUR A;  5EIB D;  2ZCE A;  1ORQ C;  3WFV A;  3B8M A;  4FLZ A;  1RM1 B;  1JQ0 A;  4GUN A;  4IL6 Z;  2R70 A;  1RSO B;  4FVM A;  2D3O W;  2Z3Y A;  4K3A A;  3JAL A;  3IGA C;  1MG1 A;  2GSM B;  4X66 B;  4GYC B;  2AZ2 A;  3F7V C;  1BE3 H;  1QLN A;  1JOY A;  1R6N A;  1ZUQ A;  3KG2 A;  1K73 W;  4LWS B;  2OTJ V;  4JF3 A;  2YDE A;  1VEW A;  4IGG A;  3S3X A;  4LFA B;  2E75 B;  5D5P A;  2JVD A;  3VOU A;  1G4Y B;  1NT2 B;  1OCR B;  4PV1 B;  5B1N A;  3SPC A;  5CBF A;  4LF8 B;  2ZR3 A;  1FKA O;  5J2T A;  5FPO A;  5DM6 V;  3P32 A;  5IDJ A;  4FM1 A;  2YSU B;  4O4H B;  3F7Y C;  4MVU A;  3OMI B;  2QA4 V;  1BQ0 A;  2CH7 A;  5BY1 A;  2JEU A;  4FK5 C;  1GK9 A;  5B1B C;  3ABU A;  2DQ0 A;  3QO5 A;  4U7N A;  4CC6 A;  5KHI A;  5IYC O;  4U7O A;  2KKW A;  4X1K A;  2MW2 B;  3SJB C;  3E22 B;  5EC1 C;  3RYF B;  1KEC A;  2W0X A;  3E83 A;  4DR6 O;  2VWK A;  5BR8 O;  3JAT B;  1GKF A;  2Y0I A;  2PYJ A;  4DV2 O;  4P30 A;  2BSK B;  1PNL A;  2EZO A;  4WFH A;  1MSD A;  2OIE A;  1GO3 F;  2YIA A;  2LQT A;  4FM0 A;  4MSW C;  4GKK B;  1X4T A;  2E5L O;  1YI2 V;  4B7E A;  4YY3 B;  4PDV A;  1NBM G;  1XEQ A;  4JYB A;  1IBL B;  5JJN B;  3EFF K;  3JAL B;  5LXT A;  1Q90 D;  5IJ0 A;  1XNR O;  2QTO A;  1SQB H;  5LOV B;  2HVJ C;  4IHJ A;  3GVM A;  4KUM A;  2VRZ A;  3CRR A;  1Y6X A;  5BR8 B;  4LWS A;  1M56 C;  3ETD A;  4DV2 B;  3L71 H;  3PN1 A;  1Q86 W;  3LDC A;  3HPL C;  2YIB D;  4I5S A;  3T1H O;  4LFB O;  4W4L A;  1M5I A;  2CTW A;  3CHX A;  4MTO A;  2ADP A;  5KUK A;  5FL7 G;  3G67 A;  3FAV B;  4Z2W A;  1FS0 G;  1VQL V;  5GTI Z;  2OYQ A;  1P4R A;  3JCU Z;  2LO1 A;  2A9H A;  1AJP A;  5IYZ B;  4RWU A;  2WA4 A;  1SC5 B;  3ASO C;  1JJO A;  5LHH A;  3BPZ A;  1QR8 A;  4EB6 B;  3HKD B;  4F6R A;  2A3Q A;  1SA0 A;  4HNA B;  4H13 B;  4K0K B;  1XL6 A;  2P67 A;  1S76 D;  3VQX A;  2DN9 A;  4Q20 A;  1QR9 A;  4MS2 A;  3W7T A;  1EN6 A;  4O2A B;  3KKY A;  2P90 A;  5A9G A;  1NR7 A;  4UCS A;  1OHH G;  3K9S A;  5IY5 B;  2A06 H;  5J2U B;  3SJQ C;  2FKX A;  2QWP B;  1FYJ A;  4QNH B;  3TET A;  4LF8 O;  4B3R O;  1DTO A;  4I0X A;  1VQK V;  5LGN A;  3WB0 A;  3I55 V;  4OX9 O;  1WPX A;  4CZZ A;  5FLX N;  3OE7 G;  4B3T B;  3C3T A;  2GBO A;  5KMG A;  1F51 A;  2JGD A;  1QLE C;  1Q5O A;  2EJ7 A;  4J41 A;  1OCZ C;  3BFR A;  3CCL V;  4NKG B;  2HLD G;  1AP5 A;  4I4T A;  1R3L C;  4OPA A;  1R3J C;  1FXK C;  1M56 B;  3CEI A;  5H6R A;  4GKJ B;  1GM7 A;  1T5E A;  4B08 A;  3CCM V;  4EKW A;  4HYO A;  4JGS A;  5EC2 C;  2WLI A;  2QWR B;  1AI7 A;  1SZT A;  4JV5 B;  1VQ8 V;  1YHQ V;  2YIB A;  4R50 A;  3CJH B;  1S0V A;  4IYI A;  3H1J H;  4DRX A;  2LW1 A;  1BZK A;  2ZXW B;  2W6J G;  2OWO A;  3KCY A;  3N2K B;  2KSD A;  1GTO A;  4CBC A;  4JTC B;  1XL4 A;  1Z5W A;  2BCC H;  2RN9 A;  1BMF G;  1BHB A;  5B5E Z;  3ABK B;  3L72 H;  4ZKI A;  3W7W A;  4JPR A;  3HKD A;  4K35 A;  4H37 A;  1OCO B;  4AQY O;  1B6Q A;  2P4V A;  4LFA O;  1JMK C;  2F93 B;  1N36 O;  5EBL C;  4LF5 O;  4O2B B;  5JCO C;  4UVB A;  1PNK A;  5B3S C;  1EN5 A;  1KUQ A;  4JI8 B;  1GMG A;  1QVF U;  1VF5 B;  3E86 A;  3JAR A;  2MK3 A;  3TXQ A;  1RPO A;  1QVG U;  3SYA A;  4ZI7 B;  1XOU A;  1OCZ B;  4I0X B;  1GN6 A;  3ZCC A;  4DR1 B;  4JI2 B;  4DV7 O;  1WNS A;  1WB7 A;  2ITD C;  4GZR B;  3DGE A;  2YID A;  3ICX A;  4PI2 A;  1KBH A;  4FPP A;  3LSU A;  3K04 A;  3C90 A;  1N8R W;  2ZM6 O;  3LSQ A;  1J5E B;  1ZAU A;  2RQ6 A;  4PA3 A;  3WG7 C;  4LH6 A;  1Y4M A;  4IT5 A;  3X2Q C;  1Q43 A;  1PM9 A;  2GUZ B;  2UUC O;  1QU7 A;  4X62 B;  4EFE A;  4OGQ B;  2CE4 A;  1AJN A;  1GAX A;  4KP4 A;  4O4J A;  2UU9 O;  5IJ0 B;  1PL0 A;  2LW7 A;  1EZV H;  3ABL C;  4JI4 O;  1N4C A;  1IZ3 A;  1YZB A;  2QM8 A;  5B1O A;  2UUA B;  3T1H B;  2HR3 A;  5IWA O;  4DV6 O;  3ZHS A;  5HFL A;  4DV1 O;  3E35 A;  4X64 B;  2KG7 A;  3JAK A;  5L3C A;  4DR7 O;  4KHP B;  4QGP A;  2IU0 A;  3ZMV A;  3L74 H;  2DYR B;  3OGI B;  3R65 A;  3RN4 A;  3B09 A;  2F23 A;  3FYE B;  3FAV A;  1VIB A;  2FYU H;  4JYA O;  3SPG A;  3TK1 A;  2EIM B;  1OJH A;  2DQ3 A;  2IU3 A;  2IJJ A;  4UCO A;  1VQP V;  3ABM C;  1H2K A;  1HNW O;  3CME V;  4EB6 A;  1Y67 A;  4TV8 A;  4CS3 A;  4WF9 V;  1PKX A;  1SA0 B;  4HNA A;  4MVR A;  3B40 A;  3Q4H A;  5FPR A;  3FB8 C;  4J11 A;  2ZQM A;  1CXZ B;  2H94 A;  1FFX A;  2BE3 A;  1N0J A;  4ZI7 A;  2ZE7 A;  4X9Q A;  5IYB O;  2WSS G;  1SS3 A;  3BRC A;  3ZRS A;  2L6L A;  4TOI A;  2UUB O;  2PUS A;  1AP6 A;  4JTD B;  1HNZ B;  1N0N A;  2WLK A;  1FXK A;  4DV5 O;  3LNN A;  3OMN B;  3U0Z A;  4LF4 O;  5AG2 A;  5LP6 A;  1M93 A;  5C93 A;  4YHH O;  1IXB A;  3AG4 B;  4WCE V;  3O9O A;  4FLT A;  1N34 O;  5H2F Z;  4NXM O;  2QKS A;  4J9Z B;  3CC4 V;  1EFR G;  1DK1 A;  1K34 A;  5H9C A;  4JI6 B;  1L0L H;  1NS1 A;  2EIL C;  5JJJ B;  2JJ1 G;  4RO2 A;  4MVO A;  1V55 B;  4UB8 Z;  1K33 A;  1IBK O;  4ZOL B;  1HNW B;  4FLX A;  5CA1 B;  3IC7 A;  2R72 A;  2YEV B;  3D3Q A;  3DC5 A;  4DV3 B;  2WLI B;  3K06 A;  1F4M A;  1Q3E A;  1XMQ B;  1UFI A;  4R6Z A;  1S3J A;  4GT1 A;  4DUY O;  1F7Y A;  2EIK B;  5KHK A;  3ZHT A;  3SYC A;  1KP2 A;  3JAK B;  2YXL A;  4J7Z A;  2YUA A;  5JVD A;  5JH7 A;  5EZY B;  3JSN A;  1NQT A;  5B1A B;  3I56 V;  4YXW G;  2X6B A;  4RQE A;  3G6B A;  5IWA B;  2ADQ B;  2B5U A;  3STL C;  3DSQ A;  5J2T B;  5LMU O;  4DR4 B;  2LGQ A;  3TJT A;  2P6J A;  1COW G;  4PDM A;  3E8G A;  4DV4 O;  3M8A A;  2CH7 B;  5D5Q A;  3IFX A;  1FFX B;  4O2B A;  3S3W A;  3T1Y B;  3ML0 A;  2BOB C;  3ASN C;  3QVN A;  5LA6 A;  5H6Q A;  5IT9 N;  3K9A A;  4HZ3 A;  4BAY A;  4CC5 A;  4TT3 G;  2ZD9 A;  2YS8 A;  5EBM C;  2HG5 C;  4X8A A;  1AIL A;  4DR2 O;  4C7U A;  3EVK A;  1FAF A;  1EN4 A;  1VAR A;  2BSK A;  4LF9 O;  3T2M A;  2EIJ C;  1QCE A;  2GTA A;  4HAM A;  4X62 O;  3ZMZ A;  1WN7 A;  4YJ2 A;  2ZNI A;  3DC6 A;  4NYK A;  1JA8 A;  4UV8 A;  4JI3 O;  1AI6 A;  2Q0O C;  4DK0 A;  1L0N H;  3CCJ V;  1VQO V;  3UQ8 A;  3EXA A;  5CBG A;  4PA7 A;  4CS2 A;  1Y74 B;  1AR5 A;  3N2G A;  3RYC B;  3HKE B;  4UCU A;  3UM7 A;  2XTA A;  2CGN A;  4G27 B;  3WU2 Z;  1G6U A;  4JAS A;  4JI5 O;  1N34 B;  4NXM B;  1LUV A;  4AHC A;  5CA3 A;  2KB1 A;  3K03 A;  4JI6 O;  1HR0 O;  3STZ C;  5JH7 B;  3QO7 A;  1KD1 W;  1V54 B;  5KAF Z;  3M99 B;  4MTX A;  2PYL A;  3OR7 C;  2QKC A;  3A0B Z;  3C3S A;  1MA1 A;  3A2F A;  1VMG A;  3QF7 A;  2M7W A;  2QGN A;  4MVS A;  1SQP H;  1M4U A;  3ZRW B;  1FPO A;  3CC2 V;  4AQY B;  4B3S O;  3E8F A;  4DR5 O;  1QNM A;  4GKJ O;  2UXN A;  4JAU A;  4P9O A;  1VQN V;  4NXN O;  4OXS A;  4DXW A;  1IBM O;  3THO A;  3AG2 B;  1VP7 A;  2QE7 G;  3LSS A;  1K9M W;  1PNM A;  3GB7 C;  4B3M B;  1M57 B;  2AXT Z;  3VQY A;  2W6I G;  3CD6 V;  1GM9 A;  5FNV A;  3UCS C;  1IVS A;  1TAE A;  3B77 A;  3K79 A;  4WFE A;  4FFK A;  2UXB O;  1D5N A;  2FB5 A;  1IBK B;  3QNE A;  2UXX A;  4JI7 O;  1L1F A;  2OTL V;  2ZKO A;  3OFN G;  3P3P A;  3K5N A;  5ITZ B;  1NZ6 A;  1GH6 A;  1GN4 A;  1G8M A;  2EIN B;  3RFR A;  1Y74 A;  2UU9 B;  5KHJ A;  4NTY A;  2D2C B;  4DR3 B;  4YIO A;  1AVM A;  4YJ3 A;  1JR9 A;  3SPH A;  3AK3 A;  3HKB B;  2IBZ H;  1YDX A;  2YXY A;  1WLE A;  2YEV A;  1CEZ A;  3JD4 A;  1K8A W;  3E2E A;  4MW8 A;  2ZE8 A;  1OCC C;  2Q5Z A;  5LBQ A;  2Z5U A;  2CTQ A;  2LP7 A;  4MVM A;  4NTX A;  3DXR A;  4MT8 A;  5L3G A;  1BCC H;  2HJD A;  1XDC A;  3B4S A;  3UO3 A;  3FB6 C;  5EZY A;  2YI9 A;  3SPJ A;  5B1B B;  3RGB A;  4DR1 O;  5E79 Z;  3MHH C;  4FLU A;  2XAF A;  5LMN B;  1NVP B;  4TUY B;  2HP8 A;  1KB9 F;  2E3C A;  3ZN1 A;  2VQF O;  3T4Z A;  4X20 B;  1B04 A;  3APO A;  4DR3 O; 
#chains in the Genus database with same CATH homology
 2DN9 A;  2GUZ B;  2OCH A;  2QWR B;  2QSA A;  2QWO B;  1BQ0 A;  3UO2 A;  3AG7 A;  3UO3 A;  2KQX A;  1WJZ A;  2GUZ A;  1XBL A;  1BQZ A;  2EJ7 A;  2N04 A;  1NZ6 A;  2LO1 A;  1GH6 A;  1HDJ A;  2QWN B;  2Y4T A;  2QWQ B;  2DMX A;  4J80 A;  1IUR A;  4RWU A;  1FPO A;  2CTR A;  3BVO A;  1N4C A;  2N05 A;  2YS8 A;  2L6L A;  2QWP B;  2CTQ A;  3UCS C;  2CTP A;  2M6Y A;  2PF4 E;  4J7Z A;  2YUA A;  2LGW A;  3APO A;  4IT5 A;  1FAF A;  2Y4U A;  3APQ A;  2CUG A;  2CTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...