2QWSA

Neutron and x-ray structural studies of short hydrogen bonds in photoactive yellow protein (pyp)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Neutron and X-ray structural studies of short hydrogen bonds in photoactive yellow protein (PYP)
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qwsA00
5HZHA 1OTAA 4GHIB 2YKHA 1UWNX 4F3LA 2CMNA 1DP8A 1V9ZA 2D01A 3IS2B 3ICYA 4XT2A 2L1MA 1S1ZA 3LIAA 4EERA 3HJKA 3VE4A 2V9AA 3D72A 1JNUA 4KUKA 3B33A 3VE3A 2V0WA 3G6OA 4DJ3A 4LRZE 3F1PA 1GSWA 5F68A 4E04A 3UE6A 1LL8A 4GCZA 4GW9A 3H7WA 2VLGA 3H82B 1OJ5A 1ODVA 1S4SA 4GHIA 4L9EA 5TBMB 2VV8A 5KIZA 2B02A 4MN6A 2OOLA 2JHEA 3EWKA 4I39A 3IS2A 2PYRA 4MN5A 4HH3A 1XFQA 4JGQA 4JGRA 3NJAA 5HD3A 3NOTC 4HH2A 4LPZA 4JGOA 1XJ3A 5A8BA 3IBRA 3H9WA 4HNBA 3HJIA 5HWTA 3H82A 3VOLA 4RQ9A 3LYXA 3KX0X 4WUJA 3OLOA 2YKFA 5TBMA 4XT2B 2ZOIA 5DJUA 2H28A 4GS9A 3BY9A 1N9LA 2K7SA 2INWA 4NXBA 3A0SA 1OTDA 4LRXC 1T18A 2V1AA 4EETB 4WF0A 4L9GA 1P97A 4EW7A 4JGPA 3BWLA 2QJ5A 3F1NB 2PYPA 2OWHA 3FG8A 3PHYA 5HSQA 1F9IA 4WN5A 5DKLA 1NWZA 5EFWA 2V0UA 1S66L 5F69A 4M4XA 1T1CA 2ZBBA 1S67L 1XJ2A 3E4PA 1DP6A 1N9NA 1BYWA 5J3WA 4R38A 1D06A 2PD8A 4KQDA 3CLOA 1OTEA 3LICA 2A24B 1OTBA 4HIAA 3ULFA 2Z6CA 5AVEA 2OWJA 2ZOHA 2PHYA 1TS8A 3F1NA 3NOUC 3MXQA 2D02A 1D7EA 1P0ZA 4LRYC 3LI8A 3BY8A 1XFNA 4BBUA 3CWFA 4YWZA 2PR6A 4GS9B 1UGUA 2GJ3A 4HOIA 4HP4A 4I38A 4NXGA 5IS1A 4B9OA 1KOUA 4K08A 2QWSA 4DJ2A 4EESA 1TS6A 2QJ7A 3C2WA 4WLAA 4HJ6A 2A24A 4R6LA 3A0RA 1DP9A 2W0NA 2R78A 3F1OB 3LIDA 3EEHA 5HD5A 1VB6A 4L9FA 1F98A 1X0OA 5I5LA 5G4YA 5J4EA 5J7EA 2L0WA 3E4QA 2HV1A 1OT6A 1S4RA 5DJTA 1UWPX 2J80A 2W27A 4EEUA 4H6JB 2M1CA 4I3JA 3UB7A 3PYPA 2PDRA 3F1OA 3E4OA 2PR5A 1XJ4A 4PKYA 2VV6A 1LSXA 5AVFA 4I5SA 2VV7A 3T50A 3LI9A 1OTIA 3MFXA 1OT9A 3MQQA 1WA9A 2KDKA 1XJ6A 3UB6A 2P7JA 3A0VA 3MJQA 4HJ4A 3FC7A 4H6JA 5G4ZA 1TS0A 2Z6DA 4NXEA 2VEAA 3CAXA 3UB8A 2WKPA 1TS7A 3ZQ5A 2PD7A 1LSVA 4WL9A 5HDDA 1Y28A 3UMEA 4HHDA 3P7NA 1OJGA 2V1BA 3K3CA 1EW0A 1S1YA 1LSWA 3UMDA 1N9OA 4R3AA 3RTYA 1GSXA 1T1BA 3GDIA 1V9YA 4HY8A 5IU1A 4HJ3A 2L4RA 3LIFA 1MZUA 1T1AA 4HP9A 3MR0A 4EQ1A 3LIBA 3GECA 1T19A 4EEPA 5HDSA 4HI4A 5DKKA 3MQOA 4EXOA 5HWWA 4F3LB 4I3IA 4BBVA 1G28A 1DRMA 4LLOB 2WKRA 2I9VA 4R70A 2QKPA 4PKYG 2BASA 3UB9A 3K3DA 1LT0A 3LIEA 1GSVA 3NHQA 2EA9A 4KUOA 5F6AA 2QHKA 4BBTA 3SW1A 5F5YA 3NOPC 4HQAA 2WKQA 5HWVA 3F1PB 2KX6A 3C8CA 4I3AA 3H7WB 3LUQA 4NXFA 2JN7A 5HDCA 3RH8B
chains in the Genus database with same CATH superfamily
1PFLA 4CLCB 4KZ3A 1ES5A 1VETA 2OSUA 4UHUA 2OLUA 2W1TB 1Z6FA 2HDRA 1H5XA 2V20A 5HW3A 2EX8A 2D01A 4O01A 2H5SA 3ICYA 5GLCA 2QMIA 1S1ZA 4EERA 5AQBA 3WS4A 2V1ZA 1ZG4A 1L0FA 5FQKA 3VOYA 1BULA 4KUKA 4YNRA 3S4XA 1GSWA 5F68A 4LCLA 1LL8A 4GCZA 3H7WA 3ZG5A 4R1GA 3WS2A 3KSIA 1ODVA 2P04A 3IWOA 1NXYA 3T4KA 4KQQA 5TBMB 3IX3A 3TE8A 4QY6A 1JTDA 2VV8A 3LO7A 3N7WA 2M7VA 2Y2HA 1SKOB 2Y79A 3LR3A 2Y2OA 4I39A 1MC0A 4DXBA 4JXWA 3IS2A 3MBZA 3LY4A 5MC7A 3IBJA 3NJAA 2W1RA 1YMXA 1GHIA 3OBFA 4ETZA 3KSGA 4E3OA 3B3XA 1O07A 1LHYA 1VETB 3IBRA 1N9BA 3H9WA 1YAXA 5IT5A 5GLAA 1SZVA 2PAVP 4DDSA 5JYOA 4IUHA 4DN0A 3BM6A 1FR6A 3OLOA 4Y0TA 4BQMA 3PR6A 2XD1A 3S7PA 1MY8A 4GS9A 3WWXA 3LY3A 5HL6A 2EX6A 3E0YA 1NYMA 5AQ9A 1FSYA 2V1AA 4WF0A 3KYZA 2E8IA 3BWLA 2V8CA 5EOEA 3V50A 4DF6A 5DF9A 3M2JA 3IXHA 1NLYA 5CEBA 4WN5A 4E3JA 3IHBA 5DKLA 5EFWA 3W4OA 1VM1A 2MJ6A 4N9KA 3DWZA 3MS6A 5CEDA 3V3SA 2B5RA 1DP6A 5CTMA 2VKSA 4QU3A 1VHMA 1ZHHB 3LR4A 1JWVA 1TF1A 2VA0A 3C4PA 1Y54A 3CLOA 3VP3A 4QY5A 4P6ZS 4HIAA 2LB5A 4R3JA 5AVEA 1OMEA 1HLUP 2OWJA 2Y2QA 2D02A 4U0TA 4QD4A 2WAEA 4WZ4A 5EVLA 5CECA 3LI8A 2RCXA 1IFQA 2WKIA 3E2LA 2PR6A 4GS9B 2M7UA 2G2UA 1UGUA 3IF6A 3VFHA 4HOIA 1ALQA 1MWRA 1K6SA 3IQAA 3Q82A 4NXGA 5IS1A 1KOUA 2WAFA 4EU0A 3BQAA 4NKPA 4DJ2A 3JVUA 1TS6A 1HZOA 1K56D 1EI5A 4UA9A 5HX9A 1PW8A 2QJ7A 5FAQA 4R6LA 1YM1A 4PM7A 3UE3A 4EBPA 1DP9A 2W0NA 2R78A 1IYQA 4MDZA 3HBRA 4OOYA 5FI7A 5HD5A 1E4DA 4ZAMA 1XX2A 3G31A 4AFIA 4L9FA 1F98A 4S2LA 1J3WA 5I5LA 4EUZA 3NC8A 5J4EA 4OP5A 3BFCA 4S2OA 3D4FA 2HV1A 1FIKA 1OT6A 3I7JA 5CHUA 3EGDC 3VOZA 3ZG0A 3A3DA 4XUXA 3MSHA 1UWPX 2ZLYA 4DKIA 2XR0A 4H6JB 2HJEA 2GNXA 3PBNA 1KDWA 4IJGA 4I3JA 5FAOA 3VP2A 1GA9A 3PYPA 3F1OA 2ZQ8A 1CI9A 4PAUA 1YLZA 3DTMA 4WYYA 3RXXA 1CEFA 1XJ4A 2DRWA 4PKYA 5E2GA 4DE2A 2Y2IA 3PXPA 4LV1A 4MMNA 1W79A 4XUZA 1L0EA 4WZ5A 2Q0OA 4PM5A 4Y0UA 3UB6A 1SDEA 2O9BA 4HBUA 3MF0A 3BJNA 2Y2KA 3T4LA 1FQGA 2B18A 4NXEA 1G68A 2WKPA 1XP4A 1MWUA 2DCFA 2PD7A 5FI2A 3TSGA 1D1JA 1U60A 5HL1A 1BTLA 1YPRA 1Y28A 2Y2GA 4OQGA 5FSRA 4HHDA 4OQHA 3CHWP 2ZMAA 3UPOA 2V1BA 5A91A 5HAQA 1LSWA 4RX3A 3G35A 3OCLA 1GSXA 1MKIA 2XA7S 1T1BA 3UY6A 4HY8A 3HLCA 1ZKJA 5LBRA 3WRZA 1H3QA 2P08A 3A3JA 5GLDA 3HL9A 3HUOA 4A5RA 4NG2A 3NIAA 3BLMA 1T19A 2G2WA 4RA7A 4WELA 5HDSA 1ERQA 3T1QB 4Y13A 5FAPA 2UWXA 4Z9QA 5HWWA 4I3IA 4FCFA 3G32A 4R70A 2WADA 3LEZA 5TGFA 3CPTA 2CC1A 3RFBA 1BZAA 1ES3A 4O7DA 3O87A 4ID4A 3T12B 2ZMFA 4BD1A 1IYSA 1YSPA 5F5YA 3UE0A 4S2NC 5HWVA 1BLPA 1NJ4A 2Y2PA 1W8QA 2Q9NA 4IUKA 3HREA 3LUQA 3UB5P 2JN7A 1YQSA 4GHIB 3WRTA 2YKHA 2P74A 1UWNX 3DTKA 1K6RA 2WGIA 1BSGA 3FPWA 2ZL1B 3UDXA 3P01A 2WK0A 2XFTA 3T4TA 1KGEA 3BEBA 3VE4A 2AVXA 1YT4A 1XA7A 3D72A 4QB8A 3FWLA 3HLBA 3QP5A 3VE3A 3QP4A 1DJAA 3ZFZA 3BLSA 1YLWA 4B93A 2P9VB 5EOOA 3NDEA 3UE6A 3CMZA 3TW8A 4WZ5C 3KYEA 3O3VA 1MKMA 2A49A 2VLGA 1PNEA 2K31A 1E25A 5M1AA 4CLCA 4L9EA 1BLHA 3MKFA 3CZDA 2W1TA 4KZBA 2OOLA 2OLVA 5DFYA 3EWKA 4MLLA 2ACGA 3GMWA 4WMCA 3NBLA 2FFYA 2XGNA 2PYRA 4MN5A 1XKZA 3BFGA 3OCNA 5HD3A 3PBSA 4G3KA 4HH2A 5KZHA 2HDSA 1DJBA 4JGOA 1M6KA 1XJ3A 3A3IA 2WKEA 4HNBA 2ZQAA 2JBFA 4JF5A 3N6IA 2JCHA 5TR7A 3G2ZA 5TBMA 1HVBA 4DMZA 2DMWA 2H28A 2Z2LB 1SKOA 3BY9A 1A0KA 1N9LA 2Y2NA 1AXBA 2PU4A 3A0SA 1OTDA 5U47A 4IHQA 3RXWA 1H8ZA 4BMWA 4EETB 2HGVA 1P97A 4EW7A 1BLCA 3C7UA 3Q07A 3QP2A 2ZM0A 2QJ5A 1JTGA 4LGWA 4N92A 2OAQ1 4NEED 1NLZA 5FQQA 4GJ4A 5FQIA 1NWZA 2V0UA 4BL3A 3Q81A 3ZNTA 4R3BA 3EOIA 1XJ2A 4PMAA 5CGXA 1BYWA 5J3WA 2A3UA 5DTKA 1K0KA 1D06A 1QMFA 2QZ6A 3W4PA 2WYXA 2EWVA 1L3LA 1OTEA 1PI5A 3IH9A 2A24B 1OTBA 3ULFA 3MZDA 3G30A 3B47A 1S0WA 2Z6CA 4DE1A 3T1SA 1PRQA 2JKTM 2ZOHA 4NETA 2FFFB 1D7EA 4K0WA 3PBOA 1XFNA 2BTFP 3W2ZA 3GVBA 5EM0A 2X01A 1ESUA 4ZJ2A 5GHZA 4S2MA 4OH0A 3FV7A 4K08A 1PWCA 2ZC4B 2NUPC 3BYDA 2QWSA 1K54A 4CLCC 3C2WA 4WLAA 3T4JA 4EQIA 4HJ6A 4Y2FA 4JPMA 3A0RA 4MN7A 5GHYA 2XSSA 2ZQDA 4BL2A 4S2IA 4Q8IA 2EXAA 3AGEA 2OV5A 4UA6A 4QJGA 3O5YA 3V39A 3AGDA 3ZDJA 1ONGA 3ZGAB 5A92A 5KSHA 3ZVTA 4OPRA 1BLSA 3P09A 4Z1WA 2VJWA 1VEUA 4KG2A 3NI9A 4H8RA 5IHVA 5DJTA 3C4OA 5HARA 2I72A 1ACFA 2WKHA 1FILA 4KZ7A 4LCMA 1RGYA 4RX2A 3UB7A 2LB9A 2DNSA 1SHVA 4OPZA 4ZJ1A 1FCNA 2PR5A 1EROA 4K0XA 1AWIA 3MXRA 4UEYA 2Y4AA 1W63Q 3BFFA 2VV7A 3VP1A 4BD0A 3LI9A 1OTIA 4KZAA 2J3WA 4EUVA 4QPRA 4KZ9A 2P7JA 3A0VA 4RYEA 3IXGA 4HJ4A 2ZC5B 3UN7A 3CG5A 1N4OA 4H6JA 1TS0A 2Z6DA 4PM6A 4DXCA 4GDBA 3KO6A 3R4KA 2XEPA 3G34A 1TS7A 2HF6A 5FEGA 4WL9A 2ZC7A 3IHAA 4P6BA 1VEUB 4LV2A 1OJGA 3DTEA 2R9XA 4ARZB 4U0XA 1EW0A 1S1YA 2O9CA 2XDMA 2XD5A 1N9OA 4R3AA 3U4LP 2C6WB 4C3QA 4B4XA 4Q0JA 3GDIA 1XGJA 1CK3A 2WGWB 3T1XA 2EX9A 2JKFA 5IU1A 1IKIA 1MZUA 1T1AA 4KQOA 2XQZA 1WE4A 4EQ1A 3PBRA 4KQRA 1LLBA 4EEPA 5EVIB 1K54C 4KZ4A 4F3LB 4BBVA 4BENA 2Y2MA 4C6YA 4MEZA 2QKPA 4PKYG 1LT0A 4FUWA 4ZBEA 4CLCD 1YLPA 1K55A 1GSVA 2IA2A 4WM9A 2Y2LA 5AQAA 3OC2A 2J8YA 3VP0A 2UV0E 3CITA 3BQ8A 3NOPC 3D9YA 1GCEA 3TJZC 3F1PB 1Q2QA 5CHMA 1FR1A 4OKPA 3JVVA 4I3AA 4EBLA 5DFXA 5L09A 1YLYA 2KLIA 5HDCA 1MBLA 2HP6A 2R9WA 3V5MA 3AGFA 3VFFA 4IEDA 3IH8A 4FH4A 2XROA 1L2SA 5HAIA 2CMNA 4U3TA 1TDLA 4LFUA 2QYBA 4CPKA 4BWIA 3ZG8B 5FATA 4XT2A 1QMEA 1LI9A 3HLEA 3CUEA 3SH8A 3U2AA 2V9AA 1JNUA 3B33A 3V3RA 2V0WA 5HPFA 4OQIA 3LEQA 4E04A 3LFVA 3O86A 1PI4A 2XK1A 3H82B 4O8GA 4F94A 2J3TC 4ZTKA 1XPBA 3BECA 2ZM8A 1S4SA 4GHIA 4S2PA 1SDNA 3DWKA 5KIZA 2J9OA 3C5AA 4S2KA 5HAPA 5J8XA 3LGOA 4EBNA 2JHEA 3UDIA 4MBHA 2ZL1A 3Q7VB 1NZOA 3IF6C 5GHXA 3ZG7B 1YMSA 3DTIA 4JGQA 4JGRA 2KOIA 4Q0IA 3E2KA 3N4IA 4JXGA 4QHCA 3NOTC 4LV0A 4IVIA 5EVEA 2ZQCA 4E3LA 3T4SA 3OZHA 1L0DA 4E3NA 2P9VA 5A8BA 3ITBA 1XXMA 2VGJA 3QP8A 3LR5A 2W3GA 4JF6A 3NECA 2Y2JA 3VOLA 4KENB 4RQ9A 3LYXA 3HUNA 3V67A 4WBGA 4WUJA 4XT2B 2ZOIA 4DE3A 1ES2A 4HEFA 1JVJA 2PRFA 2Y8HA 2INWA 4LRXC 1T18A 2HJ9C 3SS4A 2VGKA 2VK3A 4UQIM 2W3EA 4R23A 3BRMA 5EUAA 2RL3A 5JYPA 4OOMA 4Y0OA 2ZD8A 3ZVWA 3F1NB 3PHYA 2WGVA 5M18A 4FD8A 1S66L 5F69A 4M4XA 5BOHA 3N8LA 2H0YA 4ETXA 1KDSA 3E4PA 2JKRM 1N9NA 4X68A 1SKFA 2BLSA 4X56A 1W63M 1F5MA 3DBAA 3IXBA 4KQDA 3E98A 1M40A 4Y15A 3SH9A 3GSGA 3KSHA 4GZBA 4R4SA 2W3FA 1ZG6A 2FH5A 1TS8A 2ZM2A 4JXVA 3PTEA 3SH7A 2JE5A 3W8KA 4OQ0A 3BY8A 4DE0A 5TFQA 1G6OA 3CWFA 4YWZA 4UAAA 1MWTA 2GJ3A 3EGXC 4L0LA 4IBRA 4GDNA 2VX8A 1JWPA 3ZCZA 4I38A 4KZ5A 1ZC2A 4GKUA 1CEGA 4B9OA 1EWZA 3S7NA 3S7OA 3QNCA 1CF0A 5DVAA 5EPHA 4EESA 5E2FA 3BW6A 4GLQA 1NRFA 5L2FA 4GOGA 2Z2MB 2A24A 2J3TD 2EXBA 1K57A 2X71A 2EFXA 4DDYA 4KZ8A 1H8MA 2JKTI 5CTNA 3S1YA 1IEMA 1X0OA 2XLNA 5FL3A 1ZTUA 5J7EA 1FCOA 2B95A 3LR0A 2L0WA 3NDGA 2HDUA 2X02A 3R7WB 1YKDA 5KSCA 3HCYA 4ZRRA 2HZ5A 4EEUA 1LI0A 1KE4A 3FZCA 2O99A 2M1CA 4YOFA 3SS3A 2VGLM 2Y91A 2PDRA 3MMHA 2GX5A 3HUMA 4X1LA 2W3DA 4CLCE 5CXWA 1ESIA 2VV6A 1LSXA 4CQHA 4NK3A 1FCMA 4ZDXA 1LL9A 4FSFA 4GB7A 2V8FA 1WA9A 2EFUA 2KDKA 1F2KA 1XJ6A 2FZ0A 2GZAA 1GA0A 2WZZA 3MJQA 3FC7A 3WS1A 5G4ZA 3TRCA 4KZ6A 2PU2A 2VEAA 3ISGA 4WEJA 4JF4A 3ZQ5A 2ZQ7A 1LSVA 5D3OA 4IVKA 3GR2A 1I2WA 3UPNA 3UMEA 3GV9A 3P7NA 1XGIA 1S6RA 1WYBA 3FKWA 1NYYA 2HP9A 3HVFA 3BFDA 3M6HA 3N8SA 4Y17A 3VP4A 1CJFA 3RTYA 3UNWA 2C5WB 3OOVA 4OLDA 5M19A 2ZJ9A 2K2NA 2Y59A 3O88A 3K2NA 1PWDA 3LIFA 4HP9A 4LENA 5A93A 1NY0A 1YSQA 5FDHA 3S7QA 3LIBA 3RJUA 5DF7A 3QHYA 3ITAA 2JKGA 1W8YA 4HI4A 1ERMA 3IT9A 5DKKA 3HLDA 4EXOA 3MKEA 1G28A 3EQVA 1K57C 4GD8A 1CI8A 2BASA 5FASA 3K3DA 1MPLA 1E3UA 5FEFA 4ARZA 3Q1FA 3EEAA 3SZTA 3NHQA 5F83A 2EA9A 3TOIA 2QHKA 1OPXA 3B42A 3SW1A 1I5QA 2WGWA 4FTXA 1WYCA 2O9AA 2KX6A 3H7WB 1Y4OA 4NXFA 2JC7A 4X6TA 3PBTA 1K4EA 5HFOA 5F82A 5HZHA 5CGWA 1RCJA 3MFDA 1OTAA 1G5UA 5EVIA 1FSWA 5CX7A 5EECA 4OPQA 4F3LA 2OAP1 3IXDA 1Q2PA 1STZA 3FKVA 1DJCA 3NULA 1DP8A 1V9ZA 4E3MA 3PAGA 3IS2B 5I94A 4ZJ3A 4II7A 2L1MA 3LIAA 3HJKA 4D2OA 4LV3A 1K4FA 4BJPA 4KG6A 3G6OA 4GN2A 4XXRA 4DJ3A 4LRZE 4E3KA 3F1PA 3C38A 1GHMA 4X53A 1C3BA 4GW9A 3GTCA 1CQAA 3DW0A 3FYZA 1Z09A 3LCEA 4Y7PA 4FOFA 1OJ5A 2NUTC 5GLBA 1IOUA 5GL9A 1HD8A 2EWWA 1G6AA 2V2FF 4MNRA 2B02A 4MN6A 3CJMA 1PYYA 2VZWA 1W7FA 5FDSA 4C75A 4PPRA 5K5BA 1PZPA 4HH3A 1XFQA 3MXSA 5F1FA 3ZYTA 4GNUA 4DRTA 4KG5A 3CI6A 3VSLA 3ZG9B 3WS5A 4CJNA 4LPZA 3WS0A 1YLJA 4G3WA 4Y3IA 2W3HA 4R0QA 3HJIA 4HBTA 5HWTA 1KGFA 3H82A 2HDQA 3A3FA 5EM1A 3UE1A 4UQIS 2PBDP 2IWCA 3KX0X 1ONHA 2YKFA 5DJUA 5FI6A 2ZMVA 1KGGA 3G4PA 4S2NA 5FQ9A 2WUQA 5G18A 3QNBA 3IX4A 4N9LA 3KSFA 2K7SA 2PT7A 4NXBA 4WMCD 3Q7VA 1NRJA 3VSKA 3TG9A 4L9GA 4YFMA 3IF5A 1FOFA 4B4ZA 2BG1A 4JGPA 1YLTA 2H0TA 5FQJA 2PYPA 3MZFA 2OWHA 4PM9A 3FG8A 3NY4A 2J9PA 1F9IA 1NZUA 5HSQA 4JXSA 5FA7A 4MBKA 3QP6A 4EV4A 5DTTA 1IYOA 3GQZA 5FQMA 5E43A 1HTZA 1TEMA 3IF6B 1GHPA 4EWFA 1T1CA 3GRJA 2ZBBA 1K25A 1TD5A 1S67L 3OPRA 4P87A 1O7EA 4Q0HA 4R38A 2PD8A 2H10A 5AQ7A 3JPUA 1PW1A 5EVIC 1LL5A 3M6BA 3IX8A 5HPIA 3LICA 1ES4A 4PM8A 5CRFA 2XF3A 2PHYA 5L8MA 3F1NA 3NOUC 3MXQA 1P0ZA 3DAVA 3QP1A 3NCKA 4LRYC 4X69A 4YINA 4P6ZM 4BBUA 2PBYA 4P0MA 3L7HA 4HP4A 2ZC3B 1TVFA 2IWDA 3HLGA 4G3VA 2Q9MA 3IWIA 2E8JA 4S2JA 4GD6A 2JKRI 4JKTA 1SCWA 3C30A 2XFSA 3KYQA 4OP8A 1IELA 3W4QA 2XH9A 1IKGA 3T1RA 1DY6A 4O0PA 4X55A 3F1OB 1P9RA 4ESPA 3LIDA 3EEHA 3Q7ZA 2EX2A 1PWGA 1VB6A 1J9MA 5DF8A 3OPHA 4IBXA 2WZXA 4Y5FA 3UO9A 2QPNA 5G4YA 5EE8A 4QWOA 2VGLS 3T4OA 3E4QA 1JWZA 5DTSA 4P85A 1S4RA 1K38A 4RVAA 4WEKA 3MQ0A 3SOIA 1KE0A 2J80A 2W27A 2ZC6B 5E2EA 4M3KA 5AJGA 1K55C 4X1MA 3VMAA 4JLFA 3VV4A 1PIOA 2ZQ9A 4N1HA 3E4OA 2XRNA 3OPLA 3L9KA 3HLWA 5CHJA 1KE3A 3S22A 1I2SA 4MCWA 4ME4A 5L07A 5AVFA 3T4QA 4I5SA 3T50A 2J7VA 3MFXA 1K56A 5L10A 3C7VA 1E3UD 1OT9A 1L0GA 3MQQA 2O0YA 3EQUA 5A90A 1TDGA 3P98A 3R7WA 2Y55A 5F1GA 5KMWA 5CGSA 4OOLA 3ZHHA 3SS5A 3CAXA 3CUEC 3UB8A 1BT5A 1W5DA 4OPYA 4R4RA 4JBFA 5HDDA 5E2HA 1P9WA 3UDFA 4N1XA 3CPTB 4D60A 4HESA 5EVID 3K3CA 2IWBA 3UMDA 3HLFA 4E3IA 4OLGA 2HP5A 4UA7A 2GDNA 1RP5A 1PZOA 1V9YA 4FH2A 3N8RA 5TJJA 4HJ3A 2L4RA 1VQQA 3M2KA 3PAEA 1KVLA 2G7UA 3PBQA 4E6WA 3UPPA 3D3OA 1H0MA 3IWQA 3MR0A 3GECA 4K91A 5EV0A 4B88A 3OPPA 2XA7M 3MQOA 1KVMA 5C5KA 1DRMA 4LLOB 1H8YA 2WKRA 2I9VA 4OVDA 3UB9A 4MBFA 1BUEA 3LIEA 2HPBA 1IYPA 5CERA 1XA1A 4KUOA 5F6AA 3JYIA 4BBTA 4OONA 4E6XA 4X25A 1MXOA 3BFEA 3MZEA 4HQAA 3A3EA 2WKQA 3ZNYA 4BLMA 4PHTA 1RGZA 3C8CA 3G2YA 1MWSA 3FPVA 2A2LA 3RH8B
chains in the Genus database with same CATH topology
5HZHA 1OTAA 4GHIB 4CLCB 2YKHA 5CX7A 1UWNX 2OAP1 4F3LA 2XROA 2W1TB 1STZA 2CMNA 1DP8A 1V9ZA 3FPWA 2D01A 2QYBA 4O01A 4BWIA 3IS2B 3ICYA 3P01A 4II7A 3T4TA 4XT2A 2L1MA 1S1ZA 3LIAA 4EERA 3HJKA 3VE4A 3CUEA 3U2AA 2V9AA 3D72A 1JNUA 4BJPA 4KUKA 3B33A 3VE3A 4YNRA 2V0WA 3G6OA 4DJ3A 4LRZE 5HPFA 4B93A 3F1PA 1GSWA 3C38A 5F68A 4E04A 3UE6A 3LFVA 1LL8A 4GCZA 4GW9A 3TW8A 3H7WA 1MKMA 2VLGA 3H82B 4O8GA 2J3TC 3KSIA 4FOFA 1OJ5A 1ODVA 2NUTC 2P04A 2K31A 1S4SA 1IOUA 4GHIA 4CLCA 4L9EA 3T4KA 5TBMB 2EWWA 3TE8A 2VV8A 5KIZA 2W1TA 2M7VA 2B02A 2OOLA 2Y79A 3LR3A 4MN6A 5DFYA 2JHEA 1MC0A 3EWKA 4I39A 2VZWA 3IS2A 5K5BA 2PYRA 4MN5A 4HH3A 1XFQA 5MC7A 4JGQA 4JGRA 2KOIA 3ZYTA 3IBJA 4Q0IA 3OCNA 3NJAA 5HD3A 2W1RA 3PBSA 3NOTC 4G3KA 3CI6A 4HH2A 3OBFA 4ETZA 4LPZA 4JGOA 3KSGA 3T4SA 4G3WA 1XJ3A 5A8BA 3IBRA 4Y3IA 2W3HA 3LR5A 3H9WA 4HNBA 2W3GA 3HJIA 5HWTA 1YAXA 5IT5A 3H82A 3VOLA 4RQ9A 4UQIS 3LYXA 3KX0X 4IUHA 4DN0A 3V67A 4WUJA 3OLOA 2YKFA 5TBMA 3PR6A 4XT2B 2ZOIA 5DJUA 4DMZA 2ZMVA 2DMWA 2H28A 3S7PA 4GS9A 3BY9A 1N9LA 5HL6A 3KSFA 2K7SA 2PT7A 2Y8HA 3E0YA 2INWA 4NXBA 3A0SA 1OTDA 4LRXC 1T18A 2HJ9C 4IHQA 1NRJA 2V1AA 4UQIM 2W3EA 4BMWA 4EETB 4WF0A 4L9GA 2HGVA 1P97A 3KYZA 4EW7A 4OOMA 4JGPA 3BWLA 2QJ5A 3F1NB 5DF9A 2PYPA 2OWHA 1NLYA 3FG8A 3PHYA 2OAQ1 1F9IA 5HSQA 4NEED 4WN5A 1NLZA 5DKLA 4GJ4A 1NWZA 5EFWA 2V0UA 1S66L 5F69A 4M4XA 2MJ6A 1T1CA 2ZBBA 1TD5A 3EOIA 4ETXA 1S67L 1XJ2A 3E4PA 2JKRM 1DP6A 1N9NA 1BYWA 5J3WA 2VKSA 4Q0HA 1VHMA 4R38A 1ZHHB 1D06A 1W63M 1F5MA 2PD8A 3DBAA 3LR4A 1TF1A 2VA0A 4KQDA 3E98A 3CLOA 2EWVA 4P6ZS 5HPIA 1OTEA 3LICA 2A24B 1OTBA 4HIAA 3ULFA 2LB5A 3B47A 2Z6CA 5AVEA 3KSHA 2JKTM 2OWJA 2W3FA 2FH5A 2ZOHA 2PHYA 1TS8A 5L8MA 3F1NA 3NOUC 3MXQA 2D02A 1D7EA 1P0ZA 4LRYC 3LI8A 3PBOA 3BY8A 4P6ZM 1IFQA 1XFNA 1G6OA 4BBUA 3CWFA 4YWZA 3W2ZA 2PR6A 4GS9B 2M7UA 1UGUA 2GJ3A 3EGXC 4L0LA 2VX8A 4HOIA 4HP4A 4I38A 4NXGA 5IS1A 4B9OA 1KOUA 4G3VA 3S7NA 3S7OA 4K08A 2JKRI 2NUPC 4EU0A 3BQAA 2QWSA 4NKPA 4DJ2A 3JVUA 4EESA 1TS6A 3BW6A 4GLQA 3C30A 3KYQA 4CLCC 2QJ7A 3C2WA 4WLAA 3T4JA 4HJ6A 2A24A 2J3TD 4Y2FA 4R6LA 3A0RA 4MN7A 4O0PA 3UE3A 1DP9A 2W0NA 2R78A 2XSSA 3F1OB 1P9RA 4MDZA 3LIDA 3EEHA 5HD5A 1H8MA 2JKTI 1VB6A 3O5YA 5KSHA 4AFIA 4L9FA 1F98A 1X0OA 5I5LA 4Y5FA 5FL3A 1ZTUA 5G4YA 5J4EA 5J7EA 3LR0A 2VGLS 2L0WA 2VJWA 4Z1WA 3T4OA 3E4QA 2HV1A 1OT6A 1S4RA 3EGDC 4WEKA 3R7WB 1YKDA 3MQ0A 5DJTA 3HCYA 4ZRRA 1UWPX 2J80A 2W27A 4EEUA 4H6JB 5AJGA 2HJEA 2GNXA 2O99A 2M1CA 3PBNA 4YOFA 4IJGA 3VV4A 4I3JA 2VGLM 3UB7A 2LB9A 3PYPA 2PDRA 3MMHA 3F1OA 3E4OA 2GX5A 4PAUA 2W3DA 2XRNA 2PR5A 4CLCE 1XJ4A 4PKYA 4UEYA 2VV6A 1LSXA 4MCWA 4ME4A 4CQHA 1W63Q 5AVFA 3T4QA 4I5SA 2VV7A 3T50A 3LI9A 3PXPA 4MMNA 1OTIA 3MFXA 2J3WA 4FSFA 1OT9A 4EUVA 3MQQA 1WA9A 2O0YA 3EQUA 4QPRA 2KDKA 1XJ6A 3UB6A 2O9BA 3R7WA 2P7JA 3MF0A 3A0VA 2FZ0A 2GZAA 3MJQA 4HJ4A 3BJNA 3FC7A 3T4LA 4OOLA 4H6JA 5G4ZA 1TS0A 2Z6DA 3TRCA 2B18A 4NXEA 3KO6A 3R4KA 2VEAA 3CAXA 3CUEC 3UB8A 2WKPA 4WEJA 1TS7A 2HF6A 3ZQ5A 2PD7A 1LSVA 4WL9A 5HDDA 1Y28A 3UMEA 4HHDA 3P7NA 1P9WA 1OJGA 4ARZB 2V1BA 3K3CA 1EW0A 1S1YA 1LSWA 2O9CA 3UMDA 1N9OA 4R3AA 3OCLA 3RTYA 1GSXA 3OOVA 2XA7S 1T1BA 4Q0JA 3GDIA 1V9YA 4HY8A 2K2NA 5IU1A 5TJJA 4HJ3A 5LBRA 2L4RA 1H3QA 3K2NA 2P08A 3LIFA 2G7UA 3PBQA 1MZUA 1T1AA 4HP9A 4KQOA 3D3OA 1YSQA 3MR0A 4EQ1A 3S7QA 3LIBA 3PBRA 3GECA 1T19A 4EEPA 4WELA 5HDSA 2XA7M 4HI4A 5DKKA 3MQOA 4EXOA 5HWWA 4F3LB 4I3IA 4BBVA 5C5KA 1G28A 1DRMA 4LLOB 2WKRA 3EQVA 2I9VA 4R70A 2QKPA 4PKYG 2BASA 3UB9A 3K3DA 1LT0A 4CLCD 4ARZA 3LIEA 3RFBA 3EEAA 1GSVA 3NHQA 2IA2A 2EA9A 4KUOA 5F6AA 2QHKA 4BBTA 1OPXA 3OC2A 2ZMFA 3B42A 1YSPA 3SW1A 5F5YA 3CITA 3BQ8A 3NOPC 4HQAA 2WKQA 5HWVA 4PHTA 3TJZC 3F1PB 2O9AA 2KX6A 3C8CA 3JVVA 4I3AA 4IUKA 3H7WB 3LUQA 4NXFA 3FPVA 2A2LA 2JN7A 5DFXA 2KLIA 5HDCA 3RH8B 3PBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HZH A;  1OTA A;  4GHI B;  2YKH A;  1UWN X;  4F3L A;  2CMN A;  1DP8 A;  1V9Z A;  2D01 A;  3IS2 B;  3ICY A;  4XT2 A;  2L1M A;  1S1Z A;  3LIA A;  4EER A;  3HJK A;  3VE4 A;  2V9A A;  3D72 A;  1JNU A;  4KUK A;  3B33 A;  3VE3 A;  2V0W A;  3G6O A;  4DJ3 A;  4LRZ E;  3F1P A;  1GSW A;  5F68 A;  4E04 A;  3UE6 A;  1LL8 A;  4GCZ A;  4GW9 A;  3H7W A;  2VLG A;  3H82 B;  1OJ5 A;  1ODV A;  1S4S A;  4GHI A;  4L9E A;  5TBM B;  2VV8 A;  5KIZ A;  2B02 A;  4MN6 A;  2OOL A;  2JHE A;  3EWK A;  4I39 A;  3IS2 A;  2PYR A;  4MN5 A;  4HH3 A;  1XFQ A;  4JGQ A;  4JGR A;  3NJA A;  5HD3 A;  3NOT C;  4HH2 A;  4LPZ A;  4JGO A;  1XJ3 A;  5A8B A;  3IBR A;  3H9W A;  4HNB A;  3HJI A;  5HWT A;  3H82 A;  3VOL A;  4RQ9 A;  3LYX A;  3KX0 X;  4WUJ A;  3OLO A;  2YKF A;  5TBM A;  4XT2 B;  2ZOI A;  5DJU A;  2H28 A;  4GS9 A;  3BY9 A;  1N9L A;  2K7S A;  2INW A;  4NXB A;  3A0S A;  1OTD A;  4LRX C;  1T18 A;  2V1A A;  4EET B;  4WF0 A;  4L9G A;  1P97 A;  4EW7 A;  4JGP A;  3BWL A;  2QJ5 A;  3F1N B;  2PYP A;  2OWH A;  3FG8 A;  3PHY A;  5HSQ A;  1F9I A;  4WN5 A;  5DKL A;  1NWZ A;  5EFW A;  2V0U A;  1S66 L;  5F69 A;  4M4X A;  1T1C A;  2ZBB A;  1S67 L;  1XJ2 A;  3E4P A;  1DP6 A;  1N9N A;  1BYW A;  5J3W A;  4R38 A;  1D06 A;  2PD8 A;  4KQD A;  3CLO A;  1OTE A;  3LIC A;  2A24 B;  1OTB A;  4HIA A;  3ULF A;  2Z6C A;  5AVE A;  2OWJ A;  2ZOH A;  2PHY A;  1TS8 A;  3F1N A;  3NOU C;  3MXQ A;  2D02 A;  1D7E A;  1P0Z A;  4LRY C;  3LI8 A;  3BY8 A;  1XFN A;  4BBU A;  3CWF A;  4YWZ A;  2PR6 A;  4GS9 B;  1UGU A;  2GJ3 A;  4HOI A;  4HP4 A;  4I38 A;  4NXG A;  5IS1 A;  4B9O A;  1KOU A;  4K08 A;  2QWS A;  4DJ2 A;  4EES A;  1TS6 A;  2QJ7 A;  3C2W A;  4WLA A;  4HJ6 A;  2A24 A;  4R6L A;  3A0R A;  1DP9 A;  2W0N A;  2R78 A;  3F1O B;  3LID A;  3EEH A;  5HD5 A;  1VB6 A;  4L9F A;  1F98 A;  1X0O A;  5I5L A;  5G4Y A;  5J4E A;  5J7E A;  2L0W A;  3E4Q A;  2HV1 A;  1OT6 A;  1S4R A;  5DJT A;  1UWP X;  2J80 A;  2W27 A;  4EEU A;  4H6J B;  2M1C A;  4I3J A;  3UB7 A;  3PYP A;  2PDR A;  3F1O A;  3E4O A;  2PR5 A;  1XJ4 A;  4PKY A;  2VV6 A;  1LSX A;  5AVF A;  4I5S A;  2VV7 A;  3T50 A;  3LI9 A;  1OTI A;  3MFX A;  1OT9 A;  3MQQ A;  1WA9 A;  2KDK A;  1XJ6 A;  3UB6 A;  2P7J A;  3A0V A;  3MJQ A;  4HJ4 A;  3FC7 A;  4H6J A;  5G4Z A;  1TS0 A;  2Z6D A;  4NXE A;  2VEA A;  3CAX A;  3UB8 A;  2WKP A;  1TS7 A;  3ZQ5 A;  2PD7 A;  1LSV A;  4WL9 A;  5HDD A;  1Y28 A;  3UME A;  4HHD A;  3P7N A;  1OJG A;  2V1B A;  3K3C A;  1EW0 A;  1S1Y A;  1LSW A;  3UMD A;  1N9O A;  4R3A A;  3RTY A;  1GSX A;  1T1B A;  3GDI A;  1V9Y A;  4HY8 A;  5IU1 A;  4HJ3 A;  2L4R A;  3LIF A;  1MZU A;  1T1A A;  4HP9 A;  3MR0 A;  4EQ1 A;  3LIB A;  3GEC A;  1T19 A;  4EEP A;  5HDS A;  4HI4 A;  5DKK A;  3MQO A;  4EXO A;  5HWW A;  4F3L B;  4I3I A;  4BBV A;  1G28 A;  1DRM A;  4LLO B;  2WKR A;  2I9V A;  4R70 A;  2QKP A;  4PKY G;  2BAS A;  3UB9 A;  3K3D A;  1LT0 A;  3LIE A;  1GSV A;  3NHQ A;  2EA9 A;  4KUO A;  5F6A A;  2QHK A;  4BBT A;  3SW1 A;  5F5Y A;  3NOP C;  4HQA A;  2WKQ A;  5HWV A;  3F1P B;  2KX6 A;  3C8C A;  4I3A A;  3H7W B;  3LUQ A;  4NXF A;  2JN7 A;  5HDC A;  3RH8 B; 
#chains in the Genus database with same CATH topology
 1PFL A;  4CLC B;  4KZ3 A;  1ES5 A;  1VET A;  2OSU A;  4UHU A;  2OLU A;  2W1T B;  1Z6F A;  2HDR A;  1H5X A;  2V20 A;  5HW3 A;  2EX8 A;  2D01 A;  4O01 A;  2H5S A;  3ICY A;  5GLC A;  2QMI A;  1S1Z A;  4EER A;  5AQB A;  3WS4 A;  2V1Z A;  1ZG4 A;  1L0F A;  5FQK A;  3VOY A;  1BUL A;  4KUK A;  4YNR A;  3S4X A;  1GSW A;  5F68 A;  4LCL A;  1LL8 A;  4GCZ A;  3H7W A;  3ZG5 A;  4R1G A;  3WS2 A;  3KSI A;  1ODV A;  2P04 A;  3IWO A;  1NXY A;  3T4K A;  4KQQ A;  5TBM B;  3IX3 A;  3TE8 A;  4QY6 A;  1JTD A;  2VV8 A;  3LO7 A;  3N7W A;  2M7V A;  2Y2H A;  1SKO B;  2Y79 A;  3LR3 A;  2Y2O A;  4I39 A;  1MC0 A;  4DXB A;  4JXW A;  3IS2 A;  3MBZ A;  3LY4 A;  5MC7 A;  3IBJ A;  3NJA A;  2W1R A;  1YMX A;  1GHI A;  3OBF A;  4ETZ A;  3KSG A;  4E3O A;  3B3X A;  1O07 A;  1LHY A;  1VET B;  3IBR A;  1N9B A;  3H9W A;  1YAX A;  5IT5 A;  5GLA A;  1SZV A;  2PAV P;  4DDS A;  5JYO A;  4IUH A;  4DN0 A;  3BM6 A;  1FR6 A;  3OLO A;  4Y0T A;  4BQM A;  3PR6 A;  2XD1 A;  3S7P A;  1MY8 A;  4GS9 A;  3WWX A;  3LY3 A;  5HL6 A;  2EX6 A;  3E0Y A;  1NYM A;  5AQ9 A;  1FSY A;  2V1A A;  4WF0 A;  3KYZ A;  2E8I A;  3BWL A;  2V8C A;  5EOE A;  3V50 A;  4DF6 A;  5DF9 A;  3M2J A;  3IXH A;  1NLY A;  5CEB A;  4WN5 A;  4E3J A;  3IHB A;  5DKL A;  5EFW A;  3W4O A;  1VM1 A;  2MJ6 A;  4N9K A;  3DWZ A;  3MS6 A;  5CED A;  3V3S A;  2B5R A;  1DP6 A;  5CTM A;  2VKS A;  4QU3 A;  1VHM A;  1ZHH B;  3LR4 A;  1JWV A;  1TF1 A;  2VA0 A;  3C4P A;  1Y54 A;  3CLO A;  3VP3 A;  4QY5 A;  4P6Z S;  4HIA A;  2LB5 A;  4R3J A;  5AVE A;  1OME A;  1HLU P;  2OWJ A;  2Y2Q A;  2D02 A;  4U0T A;  4QD4 A;  2WAE A;  4WZ4 A;  5EVL A;  5CEC A;  3LI8 A;  2RCX A;  1IFQ A;  2WKI A;  3E2L A;  2PR6 A;  4GS9 B;  2M7U A;  2G2U A;  1UGU A;  3IF6 A;  3VFH A;  4HOI A;  1ALQ A;  1MWR A;  1K6S A;  3IQA A;  3Q82 A;  4NXG A;  5IS1 A;  1KOU A;  2WAF A;  4EU0 A;  3BQA A;  4NKP A;  4DJ2 A;  3JVU A;  1TS6 A;  1HZO A;  1K56 D;  1EI5 A;  4UA9 A;  5HX9 A;  1PW8 A;  2QJ7 A;  5FAQ A;  4R6L A;  1YM1 A;  4PM7 A;  3UE3 A;  4EBP A;  1DP9 A;  2W0N A;  2R78 A;  1IYQ A;  4MDZ A;  3HBR A;  4OOY A;  5FI7 A;  5HD5 A;  1E4D A;  4ZAM A;  1XX2 A;  3G31 A;  4AFI A;  4L9F A;  1F98 A;  4S2L A;  1J3W A;  5I5L A;  4EUZ A;  3NC8 A;  5J4E A;  4OP5 A;  3BFC A;  4S2O A;  3D4F A;  2HV1 A;  1FIK A;  1OT6 A;  3I7J A;  5CHU A;  3EGD C;  3VOZ A;  3ZG0 A;  3A3D A;  4XUX A;  3MSH A;  1UWP X;  2ZLY A;  4DKI A;  2XR0 A;  4H6J B;  2HJE A;  2GNX A;  3PBN A;  1KDW A;  4IJG A;  4I3J A;  5FAO A;  3VP2 A;  1GA9 A;  3PYP A;  3F1O A;  2ZQ8 A;  1CI9 A;  4PAU A;  1YLZ A;  3DTM A;  4WYY A;  3RXX A;  1CEF A;  1XJ4 A;  2DRW A;  4PKY A;  5E2G A;  4DE2 A;  2Y2I A;  3PXP A;  4LV1 A;  4MMN A;  1W79 A;  4XUZ A;  1L0E A;  4WZ5 A;  2Q0O A;  4PM5 A;  4Y0U A;  3UB6 A;  1SDE A;  2O9B A;  4HBU A;  3MF0 A;  3BJN A;  2Y2K A;  3T4L A;  1FQG A;  2B18 A;  4NXE A;  1G68 A;  2WKP A;  1XP4 A;  1MWU A;  2DCF A;  2PD7 A;  5FI2 A;  3TSG A;  1D1J A;  1U60 A;  5HL1 A;  1BTL A;  1YPR A;  1Y28 A;  2Y2G A;  4OQG A;  5FSR A;  4HHD A;  4OQH A;  3CHW P;  2ZMA A;  3UPO A;  2V1B A;  5A91 A;  5HAQ A;  1LSW A;  4RX3 A;  3G35 A;  3OCL A;  1GSX A;  1MKI A;  2XA7 S;  1T1B A;  3UY6 A;  4HY8 A;  3HLC A;  1ZKJ A;  5LBR A;  3WRZ A;  1H3Q A;  2P08 A;  3A3J A;  5GLD A;  3HL9 A;  3HUO A;  4A5R A;  4NG2 A;  3NIA A;  3BLM A;  1T19 A;  2G2W A;  4RA7 A;  4WEL A;  5HDS A;  1ERQ A;  3T1Q B;  4Y13 A;  5FAP A;  2UWX A;  4Z9Q A;  5HWW A;  4I3I A;  4FCF A;  3G32 A;  4R70 A;  2WAD A;  3LEZ A;  5TGF A;  3CPT A;  2CC1 A;  3RFB A;  1BZA A;  1ES3 A;  4O7D A;  3O87 A;  4ID4 A;  3T12 B;  2ZMF A;  4BD1 A;  1IYS A;  1YSP A;  5F5Y A;  3UE0 A;  4S2N C;  5HWV A;  1BLP A;  1NJ4 A;  2Y2P A;  1W8Q A;  2Q9N A;  4IUK A;  3HRE A;  3LUQ A;  3UB5 P;  2JN7 A;  1YQS A;  4GHI B;  3WRT A;  2YKH A;  2P74 A;  1UWN X;  3DTK A;  1K6R A;  2WGI A;  1BSG A;  3FPW A;  2ZL1 B;  3UDX A;  3P01 A;  2WK0 A;  2XFT A;  3T4T A;  1KGE A;  3BEB A;  3VE4 A;  2AVX A;  1YT4 A;  1XA7 A;  3D72 A;  4QB8 A;  3FWL A;  3HLB A;  3QP5 A;  3VE3 A;  3QP4 A;  1DJA A;  3ZFZ A;  3BLS A;  1YLW A;  4B93 A;  2P9V B;  5EOO A;  3NDE A;  3UE6 A;  3CMZ A;  3TW8 A;  4WZ5 C;  3KYE A;  3O3V A;  1MKM A;  2A49 A;  2VLG A;  1PNE A;  2K31 A;  1E25 A;  5M1A A;  4CLC A;  4L9E A;  1BLH A;  3MKF A;  3CZD A;  2W1T A;  4KZB A;  2OOL A;  2OLV A;  5DFY A;  3EWK A;  4MLL A;  2ACG A;  3GMW A;  4WMC A;  3NBL A;  2FFY A;  2XGN A;  2PYR A;  4MN5 A;  1XKZ A;  3BFG A;  3OCN A;  5HD3 A;  3PBS A;  4G3K A;  4HH2 A;  5KZH A;  2HDS A;  1DJB A;  4JGO A;  1M6K A;  1XJ3 A;  3A3I A;  2WKE A;  4HNB A;  2ZQA A;  2JBF A;  4JF5 A;  3N6I A;  2JCH A;  5TR7 A;  3G2Z A;  5TBM A;  1HVB A;  4DMZ A;  2DMW A;  2H28 A;  2Z2L B;  1SKO A;  3BY9 A;  1A0K A;  1N9L A;  2Y2N A;  1AXB A;  2PU4 A;  3A0S A;  1OTD A;  5U47 A;  4IHQ A;  3RXW A;  1H8Z A;  4BMW A;  4EET B;  2HGV A;  1P97 A;  4EW7 A;  1BLC A;  3C7U A;  3Q07 A;  3QP2 A;  2ZM0 A;  2QJ5 A;  1JTG A;  4LGW A;  4N92 A;  2OAQ 1;  4NEE D;  1NLZ A;  5FQQ A;  4GJ4 A;  5FQI A;  1NWZ A;  2V0U A;  4BL3 A;  3Q81 A;  3ZNT A;  4R3B A;  3EOI A;  1XJ2 A;  4PMA A;  5CGX A;  1BYW A;  5J3W A;  2A3U A;  5DTK A;  1K0K A;  1D06 A;  1QMF A;  2QZ6 A;  3W4P A;  2WYX A;  2EWV A;  1L3L A;  1OTE A;  1PI5 A;  3IH9 A;  2A24 B;  1OTB A;  3ULF A;  3MZD A;  3G30 A;  3B47 A;  1S0W A;  2Z6C A;  4DE1 A;  3T1S A;  1PRQ A;  2JKT M;  2ZOH A;  4NET A;  2FFF B;  1D7E A;  4K0W A;  3PBO A;  1XFN A;  2BTF P;  3W2Z A;  3GVB A;  5EM0 A;  2X01 A;  1ESU A;  4ZJ2 A;  5GHZ A;  4S2M A;  4OH0 A;  3FV7 A;  4K08 A;  1PWC A;  2ZC4 B;  2NUP C;  3BYD A;  2QWS A;  1K54 A;  4CLC C;  3C2W A;  4WLA A;  3T4J A;  4EQI A;  4HJ6 A;  4Y2F A;  4JPM A;  3A0R A;  4MN7 A;  5GHY A;  2XSS A;  2ZQD A;  4BL2 A;  4S2I A;  4Q8I A;  2EXA A;  3AGE A;  2OV5 A;  4UA6 A;  4QJG A;  3O5Y A;  3V39 A;  3AGD A;  3ZDJ A;  1ONG A;  3ZGA B;  5A92 A;  5KSH A;  3ZVT A;  4OPR A;  1BLS A;  3P09 A;  4Z1W A;  2VJW A;  1VEU A;  4KG2 A;  3NI9 A;  4H8R A;  5IHV A;  5DJT A;  3C4O A;  5HAR A;  2I72 A;  1ACF A;  2WKH A;  1FIL A;  4KZ7 A;  4LCM A;  1RGY A;  4RX2 A;  3UB7 A;  2LB9 A;  2DNS A;  1SHV A;  4OPZ A;  4ZJ1 A;  1FCN A;  2PR5 A;  1ERO A;  4K0X A;  1AWI A;  3MXR A;  4UEY A;  2Y4A A;  1W63 Q;  3BFF A;  2VV7 A;  3VP1 A;  4BD0 A;  3LI9 A;  1OTI A;  4KZA A;  2J3W A;  4EUV A;  4QPR A;  4KZ9 A;  2P7J A;  3A0V A;  4RYE A;  3IXG A;  4HJ4 A;  2ZC5 B;  3UN7 A;  3CG5 A;  1N4O A;  4H6J A;  1TS0 A;  2Z6D A;  4PM6 A;  4DXC A;  4GDB A;  3KO6 A;  3R4K A;  2XEP A;  3G34 A;  1TS7 A;  2HF6 A;  5FEG A;  4WL9 A;  2ZC7 A;  3IHA A;  4P6B A;  1VEU B;  4LV2 A;  1OJG A;  3DTE A;  2R9X A;  4ARZ B;  4U0X A;  1EW0 A;  1S1Y A;  2O9C A;  2XDM A;  2XD5 A;  1N9O A;  4R3A A;  3U4L P;  2C6W B;  4C3Q A;  4B4X A;  4Q0J A;  3GDI A;  1XGJ A;  1CK3 A;  2WGW B;  3T1X A;  2EX9 A;  2JKF A;  5IU1 A;  1IKI A;  1MZU A;  1T1A A;  4KQO A;  2XQZ A;  1WE4 A;  4EQ1 A;  3PBR A;  4KQR A;  1LLB A;  4EEP A;  5EVI B;  1K54 C;  4KZ4 A;  4F3L B;  4BBV A;  4BEN A;  2Y2M A;  4C6Y A;  4MEZ A;  2QKP A;  4PKY G;  1LT0 A;  4FUW A;  4ZBE A;  4CLC D;  1YLP A;  1K55 A;  1GSV A;  2IA2 A;  4WM9 A;  2Y2L A;  5AQA A;  3OC2 A;  2J8Y A;  3VP0 A;  2UV0 E;  3CIT A;  3BQ8 A;  3NOP C;  3D9Y A;  1GCE A;  3TJZ C;  3F1P B;  1Q2Q A;  5CHM A;  1FR1 A;  4OKP A;  3JVV A;  4I3A A;  4EBL A;  5DFX A;  5L09 A;  1YLY A;  2KLI A;  5HDC A;  1MBL A;  2HP6 A;  2R9W A;  3V5M A;  3AGF A;  3VFF A;  4IED A;  3IH8 A;  4FH4 A;  2XRO A;  1L2S A;  5HAI A;  2CMN A;  4U3T A;  1TDL A;  4LFU A;  2QYB A;  4CPK A;  4BWI A;  3ZG8 B;  5FAT A;  4XT2 A;  1QME A;  1LI9 A;  3HLE A;  3CUE A;  3SH8 A;  3U2A A;  2V9A A;  1JNU A;  3B33 A;  3V3R A;  2V0W A;  5HPF A;  4OQI A;  3LEQ A;  4E04 A;  3LFV A;  3O86 A;  1PI4 A;  2XK1 A;  3H82 B;  4O8G A;  4F94 A;  2J3T C;  4ZTK A;  1XPB A;  3BEC A;  2ZM8 A;  1S4S A;  4GHI A;  4S2P A;  1SDN A;  3DWK A;  5KIZ A;  2J9O A;  3C5A A;  4S2K A;  5HAP A;  5J8X A;  3LGO A;  4EBN A;  2JHE A;  3UDI A;  4MBH A;  2ZL1 A;  3Q7V B;  1NZO A;  3IF6 C;  5GHX A;  3ZG7 B;  1YMS A;  3DTI A;  4JGQ A;  4JGR A;  2KOI A;  4Q0I A;  3E2K A;  3N4I A;  4JXG A;  4QHC A;  3NOT C;  4LV0 A;  4IVI A;  5EVE A;  2ZQC A;  4E3L A;  3T4S A;  3OZH A;  1L0D A;  4E3N A;  2P9V A;  5A8B A;  3ITB A;  1XXM A;  2VGJ A;  3QP8 A;  3LR5 A;  2W3G A;  4JF6 A;  3NEC A;  2Y2J A;  3VOL A;  4KEN B;  4RQ9 A;  3LYX A;  3HUN A;  3V67 A;  4WBG A;  4WUJ A;  4XT2 B;  2ZOI A;  4DE3 A;  1ES2 A;  4HEF A;  1JVJ A;  2PRF A;  2Y8H A;  2INW A;  4LRX C;  1T18 A;  2HJ9 C;  3SS4 A;  2VGK A;  2VK3 A;  4UQI M;  2W3E A;  4R23 A;  3BRM A;  5EUA A;  2RL3 A;  5JYP A;  4OOM A;  4Y0O A;  2ZD8 A;  3ZVW A;  3F1N B;  3PHY A;  2WGV A;  5M18 A;  4FD8 A;  1S66 L;  5F69 A;  4M4X A;  5BOH A;  3N8L A;  2H0Y A;  4ETX A;  1KDS A;  3E4P A;  2JKR M;  1N9N A;  4X68 A;  1SKF A;  2BLS A;  4X56 A;  1W63 M;  1F5M A;  3DBA A;  3IXB A;  4KQD A;  3E98 A;  1M40 A;  4Y15 A;  3SH9 A;  3GSG A;  3KSH A;  4GZB A;  4R4S A;  2W3F A;  1ZG6 A;  2FH5 A;  1TS8 A;  2ZM2 A;  4JXV A;  3PTE A;  3SH7 A;  2JE5 A;  3W8K A;  4OQ0 A;  3BY8 A;  4DE0 A;  5TFQ A;  1G6O A;  3CWF A;  4YWZ A;  4UAA A;  1MWT A;  2GJ3 A;  3EGX C;  4L0L A;  4IBR A;  4GDN A;  2VX8 A;  1JWP A;  3ZCZ A;  4I38 A;  4KZ5 A;  1ZC2 A;  4GKU A;  1CEG A;  4B9O A;  1EWZ A;  3S7N A;  3S7O A;  3QNC A;  1CF0 A;  5DVA A;  5EPH A;  4EES A;  5E2F A;  3BW6 A;  4GLQ A;  1NRF A;  5L2F A;  4GOG A;  2Z2M B;  2A24 A;  2J3T D;  2EXB A;  1K57 A;  2X71 A;  2EFX A;  4DDY A;  4KZ8 A;  1H8M A;  2JKT I;  5CTN A;  3S1Y A;  1IEM A;  1X0O A;  2XLN A;  5FL3 A;  1ZTU A;  5J7E A;  1FCO A;  2B95 A;  3LR0 A;  2L0W A;  3NDG A;  2HDU A;  2X02 A;  3R7W B;  1YKD A;  5KSC A;  3HCY A;  4ZRR A;  2HZ5 A;  4EEU A;  1LI0 A;  1KE4 A;  3FZC A;  2O99 A;  2M1C A;  4YOF A;  3SS3 A;  2VGL M;  2Y91 A;  2PDR A;  3MMH A;  2GX5 A;  3HUM A;  4X1L A;  2W3D A;  4CLC E;  5CXW A;  1ESI A;  2VV6 A;  1LSX A;  4CQH A;  4NK3 A;  1FCM A;  4ZDX A;  1LL9 A;  4FSF A;  4GB7 A;  2V8F A;  1WA9 A;  2EFU A;  2KDK A;  1F2K A;  1XJ6 A;  2FZ0 A;  2GZA A;  1GA0 A;  2WZZ A;  3MJQ A;  3FC7 A;  3WS1 A;  5G4Z A;  3TRC A;  4KZ6 A;  2PU2 A;  2VEA A;  3ISG A;  4WEJ A;  4JF4 A;  3ZQ5 A;  2ZQ7 A;  1LSV A;  5D3O A;  4IVK A;  3GR2 A;  1I2W A;  3UPN A;  3UME A;  3GV9 A;  3P7N A;  1XGI A;  1S6R A;  1WYB A;  3FKW A;  1NYY A;  2HP9 A;  3HVF A;  3BFD A;  3M6H A;  3N8S A;  4Y17 A;  3VP4 A;  1CJF A;  3RTY A;  3UNW A;  2C5W B;  3OOV A;  4OLD A;  5M19 A;  2ZJ9 A;  2K2N A;  2Y59 A;  3O88 A;  3K2N A;  1PWD A;  3LIF A;  4HP9 A;  4LEN A;  5A93 A;  1NY0 A;  1YSQ A;  5FDH A;  3S7Q A;  3LIB A;  3RJU A;  5DF7 A;  3QHY A;  3ITA A;  2JKG A;  1W8Y A;  4HI4 A;  1ERM A;  3IT9 A;  5DKK A;  3HLD A;  4EXO A;  3MKE A;  1G28 A;  3EQV A;  1K57 C;  4GD8 A;  1CI8 A;  2BAS A;  5FAS A;  3K3D A;  1MPL A;  1E3U A;  5FEF A;  4ARZ A;  3Q1F A;  3EEA A;  3SZT A;  3NHQ A;  5F83 A;  2EA9 A;  3TOI A;  2QHK A;  1OPX A;  3B42 A;  3SW1 A;  1I5Q A;  2WGW A;  4FTX A;  1WYC A;  2O9A A;  2KX6 A;  3H7W B;  1Y4O A;  4NXF A;  2JC7 A;  4X6T A;  3PBT A;  1K4E A;  5HFO A;  5F82 A;  5HZH A;  5CGW A;  1RCJ A;  3MFD A;  1OTA A;  1G5U A;  5EVI A;  1FSW A;  5CX7 A;  5EEC A;  4OPQ A;  4F3L A;  2OAP 1;  3IXD A;  1Q2P A;  1STZ A;  3FKV A;  1DJC A;  3NUL A;  1DP8 A;  1V9Z A;  4E3M A;  3PAG A;  3IS2 B;  5I94 A;  4ZJ3 A;  4II7 A;  2L1M A;  3LIA A;  3HJK A;  4D2O A;  4LV3 A;  1K4F A;  4BJP A;  4KG6 A;  3G6O A;  4GN2 A;  4XXR A;  4DJ3 A;  4LRZ E;  4E3K A;  3F1P A;  3C38 A;  1GHM A;  4X53 A;  1C3B A;  4GW9 A;  3GTC A;  1CQA A;  3DW0 A;  3FYZ A;  1Z09 A;  3LCE A;  4Y7P A;  4FOF A;  1OJ5 A;  2NUT C;  5GLB A;  1IOU A;  5GL9 A;  1HD8 A;  2EWW A;  1G6A A;  2V2F F;  4MNR A;  2B02 A;  4MN6 A;  3CJM A;  1PYY A;  2VZW A;  1W7F A;  5FDS A;  4C75 A;  4PPR A;  5K5B A;  1PZP A;  4HH3 A;  1XFQ A;  3MXS A;  5F1F A;  3ZYT A;  4GNU A;  4DRT A;  4KG5 A;  3CI6 A;  3VSL A;  3ZG9 B;  3WS5 A;  4CJN A;  4LPZ A;  3WS0 A;  1YLJ A;  4G3W A;  4Y3I A;  2W3H A;  4R0Q A;  3HJI A;  4HBT A;  5HWT A;  1KGF A;  3H82 A;  2HDQ A;  3A3F A;  5EM1 A;  3UE1 A;  4UQI S;  2PBD P;  2IWC A;  3KX0 X;  1ONH A;  2YKF A;  5DJU A;  5FI6 A;  2ZMV A;  1KGG A;  3G4P A;  4S2N A;  5FQ9 A;  2WUQ A;  5G18 A;  3QNB A;  3IX4 A;  4N9L A;  3KSF A;  2K7S A;  2PT7 A;  4NXB A;  4WMC D;  3Q7V A;  1NRJ A;  3VSK A;  3TG9 A;  4L9G A;  4YFM A;  3IF5 A;  1FOF A;  4B4Z A;  2BG1 A;  4JGP A;  1YLT A;  2H0T A;  5FQJ A;  2PYP A;  3MZF A;  2OWH A;  4PM9 A;  3FG8 A;  3NY4 A;  2J9P A;  1F9I A;  1NZU A;  5HSQ A;  4JXS A;  5FA7 A;  4MBK A;  3QP6 A;  4EV4 A;  5DTT A;  1IYO A;  3GQZ A;  5FQM A;  5E43 A;  1HTZ A;  1TEM A;  3IF6 B;  1GHP A;  4EWF A;  1T1C A;  3GRJ A;  2ZBB A;  1K25 A;  1TD5 A;  1S67 L;  3OPR A;  4P87 A;  1O7E A;  4Q0H A;  4R38 A;  2PD8 A;  2H10 A;  5AQ7 A;  3JPU A;  1PW1 A;  5EVI C;  1LL5 A;  3M6B A;  3IX8 A;  5HPI A;  3LIC A;  1ES4 A;  4PM8 A;  5CRF A;  2XF3 A;  2PHY A;  5L8M A;  3F1N A;  3NOU C;  3MXQ A;  1P0Z A;  3DAV A;  3QP1 A;  3NCK A;  4LRY C;  4X69 A;  4YIN A;  4P6Z M;  4BBU A;  2PBY A;  4P0M A;  3L7H A;  4HP4 A;  2ZC3 B;  1TVF A;  2IWD A;  3HLG A;  4G3V A;  2Q9M A;  3IWI A;  2E8J A;  4S2J A;  4GD6 A;  2JKR I;  4JKT A;  1SCW A;  3C30 A;  2XFS A;  3KYQ A;  4OP8 A;  1IEL A;  3W4Q A;  2XH9 A;  1IKG A;  3T1R A;  1DY6 A;  4O0P A;  4X55 A;  3F1O B;  1P9R A;  4ESP A;  3LID A;  3EEH A;  3Q7Z A;  2EX2 A;  1PWG A;  1VB6 A;  1J9M A;  5DF8 A;  3OPH A;  4IBX A;  2WZX A;  4Y5F A;  3UO9 A;  2QPN A;  5G4Y A;  5EE8 A;  4QWO A;  2VGL S;  3T4O A;  3E4Q A;  1JWZ A;  5DTS A;  4P85 A;  1S4R A;  1K38 A;  4RVA A;  4WEK A;  3MQ0 A;  3SOI A;  1KE0 A;  2J80 A;  2W27 A;  2ZC6 B;  5E2E A;  4M3K A;  5AJG A;  1K55 C;  4X1M A;  3VMA A;  4JLF A;  3VV4 A;  1PIO A;  2ZQ9 A;  4N1H A;  3E4O A;  2XRN A;  3OPL A;  3L9K A;  3HLW A;  5CHJ A;  1KE3 A;  3S22 A;  1I2S A;  4MCW A;  4ME4 A;  5L07 A;  5AVF A;  3T4Q A;  4I5S A;  3T50 A;  2J7V A;  3MFX A;  1K56 A;  5L10 A;  3C7V A;  1E3U D;  1OT9 A;  1L0G A;  3MQQ A;  2O0Y A;  3EQU A;  5A90 A;  1TDG A;  3P98 A;  3R7W A;  2Y55 A;  5F1G A;  5KMW A;  5CGS A;  4OOL A;  3ZHH A;  3SS5 A;  3CAX A;  3CUE C;  3UB8 A;  1BT5 A;  1W5D A;  4OPY A;  4R4R A;  4JBF A;  5HDD A;  5E2H A;  1P9W A;  3UDF A;  4N1X A;  3CPT B;  4D60 A;  4HES A;  5EVI D;  3K3C A;  2IWB A;  3UMD A;  3HLF A;  4E3I A;  4OLG A;  2HP5 A;  4UA7 A;  2GDN A;  1RP5 A;  1PZO A;  1V9Y A;  4FH2 A;  3N8R A;  5TJJ A;  4HJ3 A;  2L4R A;  1VQQ A;  3M2K A;  3PAE A;  1KVL A;  2G7U A;  3PBQ A;  4E6W A;  3UPP A;  3D3O A;  1H0M A;  3IWQ A;  3MR0 A;  3GEC A;  4K91 A;  5EV0 A;  4B88 A;  3OPP A;  2XA7 M;  3MQO A;  1KVM A;  5C5K A;  1DRM A;  4LLO B;  1H8Y A;  2WKR A;  2I9V A;  4OVD A;  3UB9 A;  4MBF A;  1BUE A;  3LIE A;  2HPB A;  1IYP A;  5CER A;  1XA1 A;  4KUO A;  5F6A A;  3JYI A;  4BBT A;  4OON A;  4E6X A;  4X25 A;  1MXO A;  3BFE A;  3MZE A;  4HQA A;  3A3E A;  2WKQ A;  3ZNY A;  4BLM A;  4PHT A;  1RGZ A;  3C8C A;  3G2Y A;  1MWS A;  3FPV A;  2A2L A;  3RH8 B; 
#chains in the Genus database with same CATH homology
 5HZH A;  1OTA A;  4GHI B;  4CLC B;  2YKH A;  5CX7 A;  1UWN X;  2OAP 1;  4F3L A;  2XRO A;  2W1T B;  1STZ A;  2CMN A;  1DP8 A;  1V9Z A;  3FPW A;  2D01 A;  2QYB A;  4O01 A;  4BWI A;  3IS2 B;  3ICY A;  3P01 A;  4II7 A;  3T4T A;  4XT2 A;  2L1M A;  1S1Z A;  3LIA A;  4EER A;  3HJK A;  3VE4 A;  3CUE A;  3U2A A;  2V9A A;  3D72 A;  1JNU A;  4BJP A;  4KUK A;  3B33 A;  3VE3 A;  4YNR A;  2V0W A;  3G6O A;  4DJ3 A;  4LRZ E;  5HPF A;  4B93 A;  3F1P A;  1GSW A;  3C38 A;  5F68 A;  4E04 A;  3UE6 A;  3LFV A;  1LL8 A;  4GCZ A;  4GW9 A;  3TW8 A;  3H7W A;  1MKM A;  2VLG A;  3H82 B;  4O8G A;  2J3T C;  3KSI A;  4FOF A;  1OJ5 A;  1ODV A;  2NUT C;  2P04 A;  2K31 A;  1S4S A;  1IOU A;  4GHI A;  4CLC A;  4L9E A;  3T4K A;  5TBM B;  2EWW A;  3TE8 A;  2VV8 A;  5KIZ A;  2W1T A;  2M7V A;  2B02 A;  2OOL A;  2Y79 A;  3LR3 A;  4MN6 A;  5DFY A;  2JHE A;  1MC0 A;  3EWK A;  4I39 A;  2VZW A;  3IS2 A;  5K5B A;  2PYR A;  4MN5 A;  4HH3 A;  1XFQ A;  5MC7 A;  4JGQ A;  4JGR A;  2KOI A;  3ZYT A;  3IBJ A;  4Q0I A;  3OCN A;  3NJA A;  5HD3 A;  2W1R A;  3PBS A;  3NOT C;  4G3K A;  3CI6 A;  4HH2 A;  3OBF A;  4ETZ A;  4LPZ A;  4JGO A;  3KSG A;  3T4S A;  4G3W A;  1XJ3 A;  5A8B A;  3IBR A;  4Y3I A;  2W3H A;  3LR5 A;  3H9W A;  4HNB A;  2W3G A;  3HJI A;  5HWT A;  1YAX A;  5IT5 A;  3H82 A;  3VOL A;  4RQ9 A;  4UQI S;  3LYX A;  3KX0 X;  4IUH A;  4DN0 A;  3V67 A;  4WUJ A;  3OLO A;  2YKF A;  5TBM A;  3PR6 A;  4XT2 B;  2ZOI A;  5DJU A;  4DMZ A;  2ZMV A;  2DMW A;  2H28 A;  3S7P A;  4GS9 A;  3BY9 A;  1N9L A;  5HL6 A;  3KSF A;  2K7S A;  2PT7 A;  2Y8H A;  3E0Y A;  2INW A;  4NXB A;  3A0S A;  1OTD A;  4LRX C;  1T18 A;  2HJ9 C;  4IHQ A;  1NRJ A;  2V1A A;  4UQI M;  2W3E A;  4BMW A;  4EET B;  4WF0 A;  4L9G A;  2HGV A;  1P97 A;  3KYZ A;  4EW7 A;  4OOM A;  4JGP A;  3BWL A;  2QJ5 A;  3F1N B;  5DF9 A;  2PYP A;  2OWH A;  1NLY A;  3FG8 A;  3PHY A;  2OAQ 1;  1F9I A;  5HSQ A;  4NEE D;  4WN5 A;  1NLZ A;  5DKL A;  4GJ4 A;  1NWZ A;  5EFW A;  2V0U A;  1S66 L;  5F69 A;  4M4X A;  2MJ6 A;  1T1C A;  2ZBB A;  1TD5 A;  3EOI A;  4ETX A;  1S67 L;  1XJ2 A;  3E4P A;  2JKR M;  1DP6 A;  1N9N A;  1BYW A;  5J3W A;  2VKS A;  4Q0H A;  1VHM A;  4R38 A;  1ZHH B;  1D06 A;  1W63 M;  1F5M A;  2PD8 A;  3DBA A;  3LR4 A;  1TF1 A;  2VA0 A;  4KQD A;  3E98 A;  3CLO A;  2EWV A;  4P6Z S;  5HPI A;  1OTE A;  3LIC A;  2A24 B;  1OTB A;  4HIA A;  3ULF A;  2LB5 A;  3B47 A;  2Z6C A;  5AVE A;  3KSH A;  2JKT M;  2OWJ A;  2W3F A;  2FH5 A;  2ZOH A;  2PHY A;  1TS8 A;  5L8M A;  3F1N A;  3NOU C;  3MXQ A;  2D02 A;  1D7E A;  1P0Z A;  4LRY C;  3LI8 A;  3PBO A;  3BY8 A;  4P6Z M;  1IFQ A;  1XFN A;  1G6O A;  4BBU A;  3CWF A;  4YWZ A;  3W2Z A;  2PR6 A;  4GS9 B;  2M7U A;  1UGU A;  2GJ3 A;  3EGX C;  4L0L A;  2VX8 A;  4HOI A;  4HP4 A;  4I38 A;  4NXG A;  5IS1 A;  4B9O A;  1KOU A;  4G3V A;  3S7N A;  3S7O A;  4K08 A;  2JKR I;  2NUP C;  4EU0 A;  3BQA A;  2QWS A;  4NKP A;  4DJ2 A;  3JVU A;  4EES A;  1TS6 A;  3BW6 A;  4GLQ A;  3C30 A;  3KYQ A;  4CLC C;  2QJ7 A;  3C2W A;  4WLA A;  3T4J A;  4HJ6 A;  2A24 A;  2J3T D;  4Y2F A;  4R6L A;  3A0R A;  4MN7 A;  4O0P A;  3UE3 A;  1DP9 A;  2W0N A;  2R78 A;  2XSS A;  3F1O B;  1P9R A;  4MDZ A;  3LID A;  3EEH A;  5HD5 A;  1H8M A;  2JKT I;  1VB6 A;  3O5Y A;  5KSH A;  4AFI A;  4L9F A;  1F98 A;  1X0O A;  5I5L A;  4Y5F A;  5FL3 A;  1ZTU A;  5G4Y A;  5J4E A;  5J7E A;  3LR0 A;  2VGL S;  2L0W A;  2VJW A;  4Z1W A;  3T4O A;  3E4Q A;  2HV1 A;  1OT6 A;  1S4R A;  3EGD C;  4WEK A;  3R7W B;  1YKD A;  3MQ0 A;  5DJT A;  3HCY A;  4ZRR A;  1UWP X;  2J80 A;  2W27 A;  4EEU A;  4H6J B;  5AJG A;  2HJE A;  2GNX A;  2O99 A;  2M1C A;  3PBN A;  4YOF A;  4IJG A;  3VV4 A;  4I3J A;  2VGL M;  3UB7 A;  2LB9 A;  3PYP A;  2PDR A;  3MMH A;  3F1O A;  3E4O A;  2GX5 A;  4PAU A;  2W3D A;  2XRN A;  2PR5 A;  4CLC E;  1XJ4 A;  4PKY A;  4UEY A;  2VV6 A;  1LSX A;  4MCW A;  4ME4 A;  4CQH A;  1W63 Q;  5AVF A;  3T4Q A;  4I5S A;  2VV7 A;  3T50 A;  3LI9 A;  3PXP A;  4MMN A;  1OTI A;  3MFX A;  2J3W A;  4FSF A;  1OT9 A;  4EUV A;  3MQQ A;  1WA9 A;  2O0Y A;  3EQU A;  4QPR A;  2KDK A;  1XJ6 A;  3UB6 A;  2O9B A;  3R7W A;  2P7J A;  3MF0 A;  3A0V A;  2FZ0 A;  2GZA A;  3MJQ A;  4HJ4 A;  3BJN A;  3FC7 A;  3T4L A;  4OOL A;  4H6J A;  5G4Z A;  1TS0 A;  2Z6D A;  3TRC A;  2B18 A;  4NXE A;  3KO6 A;  3R4K A;  2VEA A;  3CAX A;  3CUE C;  3UB8 A;  2WKP A;  4WEJ A;  1TS7 A;  2HF6 A;  3ZQ5 A;  2PD7 A;  1LSV A;  4WL9 A;  5HDD A;  1Y28 A;  3UME A;  4HHD A;  3P7N A;  1P9W A;  1OJG A;  4ARZ B;  2V1B A;  3K3C A;  1EW0 A;  1S1Y A;  1LSW A;  2O9C A;  3UMD A;  1N9O A;  4R3A A;  3OCL A;  3RTY A;  1GSX A;  3OOV A;  2XA7 S;  1T1B A;  4Q0J A;  3GDI A;  1V9Y A;  4HY8 A;  2K2N A;  5IU1 A;  5TJJ A;  4HJ3 A;  5LBR A;  2L4R A;  1H3Q A;  3K2N A;  2P08 A;  3LIF A;  2G7U A;  3PBQ A;  1MZU A;  1T1A A;  4HP9 A;  4KQO A;  3D3O A;  1YSQ A;  3MR0 A;  4EQ1 A;  3S7Q A;  3LIB A;  3PBR A;  3GEC A;  1T19 A;  4EEP A;  4WEL A;  5HDS A;  2XA7 M;  4HI4 A;  5DKK A;  3MQO A;  4EXO A;  5HWW A;  4F3L B;  4I3I A;  4BBV A;  5C5K A;  1G28 A;  1DRM A;  4LLO B;  2WKR A;  3EQV A;  2I9V A;  4R70 A;  2QKP A;  4PKY G;  2BAS A;  3UB9 A;  3K3D A;  1LT0 A;  4CLC D;  4ARZ A;  3LIE A;  3RFB A;  3EEA A;  1GSV A;  3NHQ A;  2IA2 A;  2EA9 A;  4KUO A;  5F6A A;  2QHK A;  4BBT A;  1OPX A;  3OC2 A;  2ZMF A;  3B42 A;  1YSP A;  3SW1 A;  5F5Y A;  3CIT A;  3BQ8 A;  3NOP C;  4HQA A;  2WKQ A;  5HWV A;  4PHT A;  3TJZ C;  3F1P B;  2O9A A;  2KX6 A;  3C8C A;  3JVV A;  4I3A A;  4IUK A;  3H7W B;  3LUQ A;  4NXF A;  3FPV A;  2A2L A;  2JN7 A;  5DFX A;  2KLI A;  5HDC A;  3RH8 B;  3PBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...