2QWTA

Crystal structure of the tetr transcription regulatory protein from mycobacterium vanbaalenii
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
179
structure length
167
Chain Sequence
PLRADAARNRARVLEVAYDTFAAEGLGVPMDEIARRAGVGAGTVYRHFPTKQALVVAVAEDRVRRIVDHARTLLAAEGPGEALFVFMRDMVRSAAADYGLVDALVGYGLDLEVAAPGAEAAFLATLGELLAAAQRAGTVRADVDVAVIKALLVSERVVRVIEDGLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the TetR transcription regulatory protein from Mycobacterium vanbaalenii.
rcsb
source organism Mycobacterium vanbaalenii pyr-1
molecule tags Transcription
molecule keywords Transcriptional regulator, TetR family
total genus 65
structure length 167
sequence length 179
ec nomenclature
pdb deposition date 2007-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2qwtA00
3IH2A 3ON2A 3FIWA 4NELA 4I6ZA 3CCYA 3VW2A 3ZQGA 2NP3A 5EFYA 3ZQIA 4GCLA 1SGMA 2G3BA 1ZK8A 4M3FA 2ZB9A 3VVZA 2XGEA 4D5CA 4MK6A 1QPIA 2OI8A 1Z77A 3LJLA 3PASA 2OF7A 5J1RA 2UXUA 2FD5A 4NN1A 3S5RA 2G7LA 3VUQA 3HGGA 4D7NA 3B6CA 4XK4A 3VOKA 2HYJA 4JNNA 5H9TA 4AC0A 1T56A 1UI6A 3DCFA 2UXOA 3P9TA 3BQYA 2WUIA 3Q0VA 3QKXA 2Y30A 2IBDA 3F0CA 5HBUA 3BHQA 5GP9A 1RPWA 2XRLA 1RKTA 1A6IA 3BTLA 2XB5A 3G1OA 1ORKA 4KWAA 2GENA 4L62A 2VPRA 2RAEA 1Z0XA 3KKDA 2ID6A 4D7MA 2I10A 3F1BA 2FQ4A 3BR6A 3HTIA 3E7QA 3VOXA 1VI0A 4V2FA 1T33A 2IEKA 1QVTA 2WGBA 2GUHA 5FGLA 3B81A 5F0FA 3NNRA 5IP6A 1JT0A 2GBYA 3PPBA 3RD3A 3JSJA 2HQ5A 5F1JA 2NS7A 1QVUA 2IAIA 2RHAA 2QWTA 3CWRA 5K7FA 5FKNA 2OERA 2XGDA 5D1RA 3Q0WA 2G7SA 3CJDA 2HYTA 2OPTA 3HGYA 2QIBA 2HXIA 3C2BA 2G0EA 5AQCA 3EUPA 2PBXA 4ACIA 3ANGA 3SDGA 3G7RA 3O8HA 3GEUA 2G7GA 2ZOYA 2ZCMA 2X9DA 1JTXA 2WV1A 5K7HA 3Q0UA 3VVYA 3TP3A 4ABZA 3BR5A 5HSZA 2D6YA 2QOPA 3FK6A 4AUXA 3BR2A 3QBMA 4M3BA 2ZCNA 3AQSA 5CXGA 3BRUA 3G56A 4JL3A 3FRQA 1JUMA 2FBQA 5FKLA 2NX4A 5CW8A 3WHBA 2YVEA 1JUSA 2TRTA 4B3AA 3KNWA 3HTAA 2ZOZA 3ZQFA 4GFKA 2DG7A 3IH4A 5GPAA 5FKOA 3AQTA 1JT6A 3TP0A 3CDLA 3WHCA 3RH2A 5DAJA 5F0HA 5J1UA 2YVHA 4YZEA 2VKEA 1BJZA 3BTIA 4I76A 2XGCA 2ID3A 2UXHA 4W97A 4M3GA 5EYRA 2O7TA 5K58A 2IU5A 5IOYA 3NRGA 2XPWA 4B1RA 1ZKGA 5F27A 3LSRA 3V6GA 3IUVA 4AC6A 2Q24A 3IH3A 2ZCXA 3O60A 3BR1A 3MVPA 5F08A 5IOZA 3VIBA 2GFNA 4PXIA 2TCTA 3B6AA 4GCTA 2FJ1A 3DPJA 3BJBA 4JYKA 2NP5A 3GZIA 2DTZA 5C4YA 3QPSA 5IPAA 3DEWA 3QPLA 4W1UA 3BQZA 2QTQA 2DG8A 3BNIA 4HKUA 2FX0A 5D18A 3KZ9A 2NS8A 4M3EA 3MNLA 3QQAA 3V78A 1JTYA 5CXIA 4MXMA 5HAWA 2JJ7A 2XDNA 1RKWA 5GPCA 5FKMA 3SFIA 3NXCA 3BR3A 2XPUA 3LWJA 3VW1A 5J3LA 2JK3A 4DW6A 1JUPA 3LSJA 3LOCA 2XPVA 4D5FA 2W53A 2EH3A 3HIMA 3COLA 3LSPA 3NI7A 3VW0A 5EZHA 3O8GA 4UDSA 4V2GA 2Y2ZA 2UXIA 3CRJA 3BCGA 2REKA 2UXPA 3HE0A 5K7ZA 2HXOA 2QCOA 3BT9A 3Q3SA 3BTCA 4ME9A 3C07A 5FKKA 4GFLA 1U9NA 4G12A 4JKZA 4CGRA 2O7OA 2VKVA 3VVXA 3EGQA 3KKCA 5J1YA 5FHPA 2X6OA 3ZQHA 1U9OA 4GCKA 3FK7A 2QKOA 2Y31A 4X1EA 3LHQA 4M3DA 2PZ9A 3ANPA 3BR0A 3T6NA 3VPRA 5EZGA 3HTJA 5F0CA 5F04A 1UI5A 3PM1A 3VP5A 4AF5A 5FMPA 5D19A 3HTHA 3G1MA 4MO7A 2F07A 3G1LA 3NPIA 2HKUA 3BTJA 4ICHA 2V57A 3ON4A 3ZQLA 2RASA
chains in the Genus database with same CATH superfamily
3IH2A 3ON2A 3FIWA 2R7RA 4NELA 4I6ZA 3CCYA 3VW2A 3ZQGA 4IRVA 3SWHA 2NP3A 5EFYA 3ZQIA 4GCLA 1SGMA 2B1EA 2G3BA 1ZK8A 4M3FA 2ZB9A 3VVZA 2XGEA 4D5CA 4MK6A 1QPIA 2OI8A 1Z77A 3LJLA 3PASA 2OF7A 5J1RA 2UXUA 2FD5A 2R7OA 4NN1A 3S5RA 2G7LA 3VUQA 3HGGA 4D7NA 3B6CA 4XK4A 3VOKA 2HYJA 4JNNA 5H9TA 3DU6A 4AC0A 3K8PC 1T56A 2R7WA 4U9LA 1UI6A 3DCFA 2UXOA 2R7UA 3P9TA 3BQYA 2WUIA 3Q0VA 3QKXA 2Y30A 2IBDA 3F0CA 5HBUA 3BHQA 5GP9A 1RPWA 2XRLA 1RKTA 1A6IA 3BTLA 2XB5A 3G1OA 1ORKA 4KWAA 2GENA 4L62A 2VPRA 2RAEA 1Z0XA 3KKDA 2ID6A 4D7MA 2I10A 3F1BA 2FQ4A 3BR6A 3HTIA 3E7QA 3VOXA 2R7QA 1VI0A 4V2FA 1T33A 2IEKA 1QVTA 4WIBA 2WGBA 2GUHA 5FGLA 3B81A 5F0FA 3NNRA 5IP6A 1JT0A 3NS4A 2GBYA 3PPBA 3RD3A 3FHNA 3JSJA 2HQ5A 5F1JA 2NS7A 1QVUA 2IAIA 2RHAA 2QWTA 3CWRA 5K7FA 5FKNA 2OERA 2XGDA 2A2FX 5D1RA 3Q0WA 3VTIA 2G7SA 3CJDA 2HYTA 2OPTA 3HGYA 2QIBA 2HXIA 3C2BA 2G0EA 5AQCA 3EUPA 2PBXA 4ACIA 3ANGA 3SDGA 3G7RA 3O8HA 3GEUA 2G7GA 2ZOYA 2ZCMA 2X9DA 1JTXA 2WV1A 3KYLA 5K7HA 3Q0UA 3VVYA 3TP3A 4ABZA 3BR5A 5HSZA 2D6YA 2QOPA 3FK6A 4AUXA 3BR2A 3QBMA 4M3BA 2ZCNA 3AQSA 5CXGA 3BRUA 3G56A 4JL3A 3FRQA 1JUMA 2FBQA 5FKLA 2NX4A 5CW8A 3WHBA 2YVEA 1JUSA 2TRTA 4B3AA 3KNWA 2R7VA 3HTAA 2ZOZA 3ZQFA 4GFKA 2DG7A 3IH4A 5GPAA 5FKOA 3AQTA 1JT6A 3TP0A 3CDLA 3WHCA 3RH2A 2R7XA 5DAJA 4C2MA 5F0HA 5J1UA 2YVHA 4YZEA 2VKEA 1BJZA 3BTIA 4I76A 2XGCA 2ID3A 2UXHA 4W97A 4M3GA 5EYRA 2O7TA 5K58A 2IU5A 5IOYA 3NRGA 2XPWA 4B1RA 1ZKGA 5F27A 3LSRA 2R7TA 3V6GA 3IUVA 4OD5A 4AC6A 2Q24A 3IH3A 4OD4A 2ZCXA 3O60A 2R7SA 3BR1A 3MVPA 5F08A 5IOZA 3VIBA 3DU5A 2GFNA 4PXIA 2TCTA 3B6AA 4GCTA 2FJ1A 3DPJA 4DVYP 3BJBA 4JYKA 2NP5A 3GZIA 2DTZA 5C4YA 3QPSA 5IPAA 3DEWA 3QPLA 4W1UA 3BQZA 2QTQA 2DG8A 3BNIA 2PFVA 4HKUA 2FX0A 5D18A 3KZ9A 2NS8A 4M3EA 3MNLA 3QQAA 3V78A 5CQGA 1JTYA 5CXIA 4MXMA 5HAWA 2JJ7A 2XDNA 1RKWA 5GPCA 5FKMA 3SFIA 3NXCA 3BR3A 2XPUA 3LWJA 3VW1A 5J3LA 2JK3A 4DW6A 1JUPA 3LSJA 3LOCA 2XPVA 4D5FA 2W53A 2EH3A 3HIMA 3COLA 3LSPA 3NI7A 3VW0A 5EZHA 3O8GA 4UDSA 2B3WA 4V2GA 2Y2ZA 2UXIA 3CRJA 3BCGA 2REKA 2UXPA 3HE0A 5K7ZA 2YVXA 2HXOA 2QCOA 3BT9A 3Q3SA 3BTCA 4ME9A 2ZY9A 2FJI1 3C07A 5FKKA 4GFLA 1U9NA 4G12A 4JKZA 4CGRA 2O7OA 2VKVA 3VVXA 3EGQA 3KKCA 5J1YA 5FHPA 2X6OA 3ZQHA 1U9OA 4GCKA 3FK7A 2QKOA 2Y31A 4X1EA 3LHQA 4M3DA 2PZ9A 3ANPA 3BR0A 3T6NA 3VPRA 5EZGA 3HTJA 5F0CA 5F04A 1UI5A 3PM1A 3VP5A 4AF5A 5FMPA 5D19A 3HTHA 3G1MA 4MO7A 2F07A 3G1LA 3NPIA 2HKUA 3BTJA 4ICHA 2V57A 3ON4A 4U9NA 3ZQLA 2RASA
chains in the Genus database with same CATH topology
3IH2A 3ON2A 3FIWA 4NELA 4I6ZA 3CCYA 3VW2A 3ZQGA 2NP3A 5EFYA 3ZQIA 4GCLA 1SGMA 2G3BA 1ZK8A 4M3FA 2ZB9A 3VVZA 2XGEA 4D5CA 4MK6A 1QPIA 2OI8A 1Z77A 3LJLA 3PASA 2OF7A 5J1RA 2UXUA 2FD5A 4NN1A 3S5RA 2G7LA 3VUQA 3HGGA 4D7NA 3B6CA 4XK4A 3VOKA 2HYJA 4JNNA 5H9TA 4AC0A 1T56A 1UI6A 3DCFA 2UXOA 3P9TA 3BQYA 2WUIA 3Q0VA 3QKXA 2Y30A 2IBDA 3F0CA 5HBUA 3BHQA 5GP9A 1RPWA 2XRLA 1RKTA 1A6IA 3BTLA 2XB5A 3G1OA 1ORKA 4KWAA 2GENA 4L62A 2VPRA 2RAEA 1Z0XA 3KKDA 2ID6A 4D7MA 2I10A 3F1BA 2FQ4A 3BR6A 3HTIA 3E7QA 3VOXA 1VI0A 4V2FA 1T33A 2IEKA 1QVTA 2WGBA 2GUHA 5FGLA 3B81A 5F0FA 3NNRA 5IP6A 1JT0A 2GBYA 3PPBA 3RD3A 3JSJA 2HQ5A 5F1JA 2NS7A 1QVUA 2IAIA 2RHAA 2QWTA 3CWRA 5K7FA 5FKNA 2OERA 2XGDA 5D1RA 3Q0WA 2G7SA 3CJDA 2HYTA 2OPTA 3HGYA 2QIBA 2HXIA 3C2BA 2G0EA 5AQCA 3EUPA 2PBXA 4ACIA 3ANGA 3SDGA 3G7RA 3O8HA 3GEUA 2G7GA 2ZOYA 2ZCMA 2X9DA 1JTXA 2WV1A 5K7HA 3Q0UA 3VVYA 3TP3A 4ABZA 3BR5A 5HSZA 2D6YA 2QOPA 3FK6A 4AUXA 3BR2A 3QBMA 4M3BA 2ZCNA 3AQSA 5CXGA 3BRUA 3G56A 4JL3A 3FRQA 1JUMA 2FBQA 5FKLA 2NX4A 5CW8A 3WHBA 2YVEA 1JUSA 2TRTA 4B3AA 3KNWA 3HTAA 2ZOZA 3ZQFA 4GFKA 2DG7A 3IH4A 5GPAA 5FKOA 3AQTA 1JT6A 3TP0A 3CDLA 3WHCA 3RH2A 5DAJA 5F0HA 5J1UA 2YVHA 4YZEA 2VKEA 1BJZA 3BTIA 4I76A 2XGCA 2ID3A 2UXHA 4W97A 4M3GA 5EYRA 2O7TA 5K58A 2IU5A 5IOYA 3NRGA 2XPWA 4B1RA 1ZKGA 5F27A 3LSRA 3V6GA 3IUVA 4AC6A 2Q24A 3IH3A 2ZCXA 3O60A 3BR1A 3MVPA 5F08A 5IOZA 3VIBA 2GFNA 4PXIA 2TCTA 3B6AA 4GCTA 2FJ1A 3DPJA 3BJBA 4JYKA 2NP5A 3GZIA 2DTZA 5C4YA 3QPSA 5IPAA 3DEWA 3QPLA 4W1UA 3BQZA 2QTQA 2DG8A 3BNIA 4HKUA 2FX0A 5D18A 3KZ9A 2NS8A 4M3EA 3MNLA 3QQAA 3V78A 1JTYA 5CXIA 4MXMA 5HAWA 2JJ7A 2XDNA 1RKWA 5GPCA 5FKMA 3SFIA 3NXCA 3BR3A 2XPUA 3LWJA 3VW1A 5J3LA 2JK3A 4DW6A 1JUPA 3LSJA 3LOCA 2XPVA 4D5FA 2W53A 2EH3A 3HIMA 3COLA 3LSPA 3NI7A 3VW0A 5EZHA 3O8GA 4UDSA 4V2GA 2Y2ZA 2UXIA 3CRJA 3BCGA 2REKA 2UXPA 3HE0A 5K7ZA 2HXOA 2QCOA 3BT9A 3Q3SA 3BTCA 4ME9A 3C07A 5FKKA 4GFLA 1U9NA 4G12A 4JKZA 4CGRA 2O7OA 2VKVA 3VVXA 3EGQA 3KKCA 5J1YA 5FHPA 2X6OA 3ZQHA 1U9OA 4GCKA 3FK7A 2QKOA 2Y31A 4X1EA 3LHQA 4M3DA 2PZ9A 3ANPA 3BR0A 3T6NA 3VPRA 5EZGA 3HTJA 5F0CA 5F04A 1UI5A 3PM1A 3VP5A 4AF5A 5FMPA 5D19A 3HTHA 3G1MA 4MO7A 2F07A 3G1LA 3NPIA 2HKUA 3BTJA 4ICHA 2V57A 3ON4A 3ZQLA 2RASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH2 A;  3ON2 A;  3FIW A;  4NEL A;  4I6Z A;  3CCY A;  3VW2 A;  3ZQG A;  2NP3 A;  5EFY A;  3ZQI A;  4GCL A;  1SGM A;  2G3B A;  1ZK8 A;  4M3F A;  2ZB9 A;  3VVZ A;  2XGE A;  4D5C A;  4MK6 A;  1QPI A;  2OI8 A;  1Z77 A;  3LJL A;  3PAS A;  2OF7 A;  5J1R A;  2UXU A;  2FD5 A;  4NN1 A;  3S5R A;  2G7L A;  3VUQ A;  3HGG A;  4D7N A;  3B6C A;  4XK4 A;  3VOK A;  2HYJ A;  4JNN A;  5H9T A;  4AC0 A;  1T56 A;  1UI6 A;  3DCF A;  2UXO A;  3P9T A;  3BQY A;  2WUI A;  3Q0V A;  3QKX A;  2Y30 A;  2IBD A;  3F0C A;  5HBU A;  3BHQ A;  5GP9 A;  1RPW A;  2XRL A;  1RKT A;  1A6I A;  3BTL A;  2XB5 A;  3G1O A;  1ORK A;  4KWA A;  2GEN A;  4L62 A;  2VPR A;  2RAE A;  1Z0X A;  3KKD A;  2ID6 A;  4D7M A;  2I10 A;  3F1B A;  2FQ4 A;  3BR6 A;  3HTI A;  3E7Q A;  3VOX A;  1VI0 A;  4V2F A;  1T33 A;  2IEK A;  1QVT A;  2WGB A;  2GUH A;  5FGL A;  3B81 A;  5F0F A;  3NNR A;  5IP6 A;  1JT0 A;  2GBY A;  3PPB A;  3RD3 A;  3JSJ A;  2HQ5 A;  5F1J A;  2NS7 A;  1QVU A;  2IAI A;  2RHA A;  2QWT A;  3CWR A;  5K7F A;  5FKN A;  2OER A;  2XGD A;  5D1R A;  3Q0W A;  2G7S A;  3CJD A;  2HYT A;  2OPT A;  3HGY A;  2QIB A;  2HXI A;  3C2B A;  2G0E A;  5AQC A;  3EUP A;  2PBX A;  4ACI A;  3ANG A;  3SDG A;  3G7R A;  3O8H A;  3GEU A;  2G7G A;  2ZOY A;  2ZCM A;  2X9D A;  1JTX A;  2WV1 A;  5K7H A;  3Q0U A;  3VVY A;  3TP3 A;  4ABZ A;  3BR5 A;  5HSZ A;  2D6Y A;  2QOP A;  3FK6 A;  4AUX A;  3BR2 A;  3QBM A;  4M3B A;  2ZCN A;  3AQS A;  5CXG A;  3BRU A;  3G56 A;  4JL3 A;  3FRQ A;  1JUM A;  2FBQ A;  5FKL A;  2NX4 A;  5CW8 A;  3WHB A;  2YVE A;  1JUS A;  2TRT A;  4B3A A;  3KNW A;  3HTA A;  2ZOZ A;  3ZQF A;  4GFK A;  2DG7 A;  3IH4 A;  5GPA A;  5FKO A;  3AQT A;  1JT6 A;  3TP0 A;  3CDL A;  3WHC A;  3RH2 A;  5DAJ A;  5F0H A;  5J1U A;  2YVH A;  4YZE A;  2VKE A;  1BJZ A;  3BTI A;  4I76 A;  2XGC A;  2ID3 A;  2UXH A;  4W97 A;  4M3G A;  5EYR A;  2O7T A;  5K58 A;  2IU5 A;  5IOY A;  3NRG A;  2XPW A;  4B1R A;  1ZKG A;  5F27 A;  3LSR A;  3V6G A;  3IUV A;  4AC6 A;  2Q24 A;  3IH3 A;  2ZCX A;  3O60 A;  3BR1 A;  3MVP A;  5F08 A;  5IOZ A;  3VIB A;  2GFN A;  4PXI A;  2TCT A;  3B6A A;  4GCT A;  2FJ1 A;  3DPJ A;  3BJB A;  4JYK A;  2NP5 A;  3GZI A;  2DTZ A;  5C4Y A;  3QPS A;  5IPA A;  3DEW A;  3QPL A;  4W1U A;  3BQZ A;  2QTQ A;  2DG8 A;  3BNI A;  4HKU A;  2FX0 A;  5D18 A;  3KZ9 A;  2NS8 A;  4M3E A;  3MNL A;  3QQA A;  3V78 A;  1JTY A;  5CXI A;  4MXM A;  5HAW A;  2JJ7 A;  2XDN A;  1RKW A;  5GPC A;  5FKM A;  3SFI A;  3NXC A;  3BR3 A;  2XPU A;  3LWJ A;  3VW1 A;  5J3L A;  2JK3 A;  4DW6 A;  1JUP A;  3LSJ A;  3LOC A;  2XPV A;  4D5F A;  2W53 A;  2EH3 A;  3HIM A;  3COL A;  3LSP A;  3NI7 A;  3VW0 A;  5EZH A;  3O8G A;  4UDS A;  4V2G A;  2Y2Z A;  2UXI A;  3CRJ A;  3BCG A;  2REK A;  2UXP A;  3HE0 A;  5K7Z A;  2HXO A;  2QCO A;  3BT9 A;  3Q3S A;  3BTC A;  4ME9 A;  3C07 A;  5FKK A;  4GFL A;  1U9N A;  4G12 A;  4JKZ A;  4CGR A;  2O7O A;  2VKV A;  3VVX A;  3EGQ A;  3KKC A;  5J1Y A;  5FHP A;  2X6O A;  3ZQH A;  1U9O A;  4GCK A;  3FK7 A;  2QKO A;  2Y31 A;  4X1E A;  3LHQ A;  4M3D A;  2PZ9 A;  3ANP A;  3BR0 A;  3T6N A;  3VPR A;  5EZG A;  3HTJ A;  5F0C A;  5F04 A;  1UI5 A;  3PM1 A;  3VP5 A;  4AF5 A;  5FMP A;  5D19 A;  3HTH A;  3G1M A;  4MO7 A;  2F07 A;  3G1L A;  3NPI A;  2HKU A;  3BTJ A;  4ICH A;  2V57 A;  3ON4 A;  3ZQL A;  2RAS A; 
#chains in the Genus database with same CATH topology
 3IH2 A;  3ON2 A;  3FIW A;  2R7R A;  4NEL A;  4I6Z A;  3CCY A;  3VW2 A;  3ZQG A;  4IRV A;  3SWH A;  2NP3 A;  5EFY A;  3ZQI A;  4GCL A;  1SGM A;  2B1E A;  2G3B A;  1ZK8 A;  4M3F A;  2ZB9 A;  3VVZ A;  2XGE A;  4D5C A;  4MK6 A;  1QPI A;  2OI8 A;  1Z77 A;  3LJL A;  3PAS A;  2OF7 A;  5J1R A;  2UXU A;  2FD5 A;  2R7O A;  4NN1 A;  3S5R A;  2G7L A;  3VUQ A;  3HGG A;  4D7N A;  3B6C A;  4XK4 A;  3VOK A;  2HYJ A;  4JNN A;  5H9T A;  3DU6 A;  4AC0 A;  3K8P C;  1T56 A;  2R7W A;  4U9L A;  1UI6 A;  3DCF A;  2UXO A;  2R7U A;  3P9T A;  3BQY A;  2WUI A;  3Q0V A;  3QKX A;  2Y30 A;  2IBD A;  3F0C A;  5HBU A;  3BHQ A;  5GP9 A;  1RPW A;  2XRL A;  1RKT A;  1A6I A;  3BTL A;  2XB5 A;  3G1O A;  1ORK A;  4KWA A;  2GEN A;  4L62 A;  2VPR A;  2RAE A;  1Z0X A;  3KKD A;  2ID6 A;  4D7M A;  2I10 A;  3F1B A;  2FQ4 A;  3BR6 A;  3HTI A;  3E7Q A;  3VOX A;  2R7Q A;  1VI0 A;  4V2F A;  1T33 A;  2IEK A;  1QVT A;  4WIB A;  2WGB A;  2GUH A;  5FGL A;  3B81 A;  5F0F A;  3NNR A;  5IP6 A;  1JT0 A;  3NS4 A;  2GBY A;  3PPB A;  3RD3 A;  3FHN A;  3JSJ A;  2HQ5 A;  5F1J A;  2NS7 A;  1QVU A;  2IAI A;  2RHA A;  2QWT A;  3CWR A;  5K7F A;  5FKN A;  2OER A;  2XGD A;  2A2F X;  5D1R A;  3Q0W A;  3VTI A;  2G7S A;  3CJD A;  2HYT A;  2OPT A;  3HGY A;  2QIB A;  2HXI A;  3C2B A;  2G0E A;  5AQC A;  3EUP A;  2PBX A;  4ACI A;  3ANG A;  3SDG A;  3G7R A;  3O8H A;  3GEU A;  2G7G A;  2ZOY A;  2ZCM A;  2X9D A;  1JTX A;  2WV1 A;  3KYL A;  5K7H A;  3Q0U A;  3VVY A;  3TP3 A;  4ABZ A;  3BR5 A;  5HSZ A;  2D6Y A;  2QOP A;  3FK6 A;  4AUX A;  3BR2 A;  3QBM A;  4M3B A;  2ZCN A;  3AQS A;  5CXG A;  3BRU A;  3G56 A;  4JL3 A;  3FRQ A;  1JUM A;  2FBQ A;  5FKL A;  2NX4 A;  5CW8 A;  3WHB A;  2YVE A;  1JUS A;  2TRT A;  4B3A A;  3KNW A;  2R7V A;  3HTA A;  2ZOZ A;  3ZQF A;  4GFK A;  2DG7 A;  3IH4 A;  5GPA A;  5FKO A;  3AQT A;  1JT6 A;  3TP0 A;  3CDL A;  3WHC A;  3RH2 A;  2R7X A;  5DAJ A;  4C2M A;  5F0H A;  5J1U A;  2YVH A;  4YZE A;  2VKE A;  1BJZ A;  3BTI A;  4I76 A;  2XGC A;  2ID3 A;  2UXH A;  4W97 A;  4M3G A;  5EYR A;  2O7T A;  5K58 A;  2IU5 A;  5IOY A;  3NRG A;  2XPW A;  4B1R A;  1ZKG A;  5F27 A;  3LSR A;  2R7T A;  3V6G A;  3IUV A;  4OD5 A;  4AC6 A;  2Q24 A;  3IH3 A;  4OD4 A;  2ZCX A;  3O60 A;  2R7S A;  3BR1 A;  3MVP A;  5F08 A;  5IOZ A;  3VIB A;  3DU5 A;  2GFN A;  4PXI A;  2TCT A;  3B6A A;  4GCT A;  2FJ1 A;  3DPJ A;  4DVY P;  3BJB A;  4JYK A;  2NP5 A;  3GZI A;  2DTZ A;  5C4Y A;  3QPS A;  5IPA A;  3DEW A;  3QPL A;  4W1U A;  3BQZ A;  2QTQ A;  2DG8 A;  3BNI A;  2PFV A;  4HKU A;  2FX0 A;  5D18 A;  3KZ9 A;  2NS8 A;  4M3E A;  3MNL A;  3QQA A;  3V78 A;  5CQG A;  1JTY A;  5CXI A;  4MXM A;  5HAW A;  2JJ7 A;  2XDN A;  1RKW A;  5GPC A;  5FKM A;  3SFI A;  3NXC A;  3BR3 A;  2XPU A;  3LWJ A;  3VW1 A;  5J3L A;  2JK3 A;  4DW6 A;  1JUP A;  3LSJ A;  3LOC A;  2XPV A;  4D5F A;  2W53 A;  2EH3 A;  3HIM A;  3COL A;  3LSP A;  3NI7 A;  3VW0 A;  5EZH A;  3O8G A;  4UDS A;  2B3W A;  4V2G A;  2Y2Z A;  2UXI A;  3CRJ A;  3BCG A;  2REK A;  2UXP A;  3HE0 A;  5K7Z A;  2YVX A;  2HXO A;  2QCO A;  3BT9 A;  3Q3S A;  3BTC A;  4ME9 A;  2ZY9 A;  2FJI 1;  3C07 A;  5FKK A;  4GFL A;  1U9N A;  4G12 A;  4JKZ A;  4CGR A;  2O7O A;  2VKV A;  3VVX A;  3EGQ A;  3KKC A;  5J1Y A;  5FHP A;  2X6O A;  3ZQH A;  1U9O A;  4GCK A;  3FK7 A;  2QKO A;  2Y31 A;  4X1E A;  3LHQ A;  4M3D A;  2PZ9 A;  3ANP A;  3BR0 A;  3T6N A;  3VPR A;  5EZG A;  3HTJ A;  5F0C A;  5F04 A;  1UI5 A;  3PM1 A;  3VP5 A;  4AF5 A;  5FMP A;  5D19 A;  3HTH A;  3G1M A;  4MO7 A;  2F07 A;  3G1L A;  3NPI A;  2HKU A;  3BTJ A;  4ICH A;  2V57 A;  3ON4 A;  4U9N A;  3ZQL A;  2RAS A; 
#chains in the Genus database with same CATH homology
 3IH2 A;  3ON2 A;  3FIW A;  4NEL A;  4I6Z A;  3CCY A;  3VW2 A;  3ZQG A;  2NP3 A;  5EFY A;  3ZQI A;  4GCL A;  1SGM A;  2G3B A;  1ZK8 A;  4M3F A;  2ZB9 A;  3VVZ A;  2XGE A;  4D5C A;  4MK6 A;  1QPI A;  2OI8 A;  1Z77 A;  3LJL A;  3PAS A;  2OF7 A;  5J1R A;  2UXU A;  2FD5 A;  4NN1 A;  3S5R A;  2G7L A;  3VUQ A;  3HGG A;  4D7N A;  3B6C A;  4XK4 A;  3VOK A;  2HYJ A;  4JNN A;  5H9T A;  4AC0 A;  1T56 A;  1UI6 A;  3DCF A;  2UXO A;  3P9T A;  3BQY A;  2WUI A;  3Q0V A;  3QKX A;  2Y30 A;  2IBD A;  3F0C A;  5HBU A;  3BHQ A;  5GP9 A;  1RPW A;  2XRL A;  1RKT A;  1A6I A;  3BTL A;  2XB5 A;  3G1O A;  1ORK A;  4KWA A;  2GEN A;  4L62 A;  2VPR A;  2RAE A;  1Z0X A;  3KKD A;  2ID6 A;  4D7M A;  2I10 A;  3F1B A;  2FQ4 A;  3BR6 A;  3HTI A;  3E7Q A;  3VOX A;  1VI0 A;  4V2F A;  1T33 A;  2IEK A;  1QVT A;  2WGB A;  2GUH A;  5FGL A;  3B81 A;  5F0F A;  3NNR A;  5IP6 A;  1JT0 A;  2GBY A;  3PPB A;  3RD3 A;  3JSJ A;  2HQ5 A;  5F1J A;  2NS7 A;  1QVU A;  2IAI A;  2RHA A;  2QWT A;  3CWR A;  5K7F A;  5FKN A;  2OER A;  2XGD A;  5D1R A;  3Q0W A;  2G7S A;  3CJD A;  2HYT A;  2OPT A;  3HGY A;  2QIB A;  2HXI A;  3C2B A;  2G0E A;  5AQC A;  3EUP A;  2PBX A;  4ACI A;  3ANG A;  3SDG A;  3G7R A;  3O8H A;  3GEU A;  2G7G A;  2ZOY A;  2ZCM A;  2X9D A;  1JTX A;  2WV1 A;  5K7H A;  3Q0U A;  3VVY A;  3TP3 A;  4ABZ A;  3BR5 A;  5HSZ A;  2D6Y A;  2QOP A;  3FK6 A;  4AUX A;  3BR2 A;  3QBM A;  4M3B A;  2ZCN A;  3AQS A;  5CXG A;  3BRU A;  3G56 A;  4JL3 A;  3FRQ A;  1JUM A;  2FBQ A;  5FKL A;  2NX4 A;  5CW8 A;  3WHB A;  2YVE A;  1JUS A;  2TRT A;  4B3A A;  3KNW A;  3HTA A;  2ZOZ A;  3ZQF A;  4GFK A;  2DG7 A;  3IH4 A;  5GPA A;  5FKO A;  3AQT A;  1JT6 A;  3TP0 A;  3CDL A;  3WHC A;  3RH2 A;  5DAJ A;  5F0H A;  5J1U A;  2YVH A;  4YZE A;  2VKE A;  1BJZ A;  3BTI A;  4I76 A;  2XGC A;  2ID3 A;  2UXH A;  4W97 A;  4M3G A;  5EYR A;  2O7T A;  5K58 A;  2IU5 A;  5IOY A;  3NRG A;  2XPW A;  4B1R A;  1ZKG A;  5F27 A;  3LSR A;  3V6G A;  3IUV A;  4AC6 A;  2Q24 A;  3IH3 A;  2ZCX A;  3O60 A;  3BR1 A;  3MVP A;  5F08 A;  5IOZ A;  3VIB A;  2GFN A;  4PXI A;  2TCT A;  3B6A A;  4GCT A;  2FJ1 A;  3DPJ A;  3BJB A;  4JYK A;  2NP5 A;  3GZI A;  2DTZ A;  5C4Y A;  3QPS A;  5IPA A;  3DEW A;  3QPL A;  4W1U A;  3BQZ A;  2QTQ A;  2DG8 A;  3BNI A;  4HKU A;  2FX0 A;  5D18 A;  3KZ9 A;  2NS8 A;  4M3E A;  3MNL A;  3QQA A;  3V78 A;  1JTY A;  5CXI A;  4MXM A;  5HAW A;  2JJ7 A;  2XDN A;  1RKW A;  5GPC A;  5FKM A;  3SFI A;  3NXC A;  3BR3 A;  2XPU A;  3LWJ A;  3VW1 A;  5J3L A;  2JK3 A;  4DW6 A;  1JUP A;  3LSJ A;  3LOC A;  2XPV A;  4D5F A;  2W53 A;  2EH3 A;  3HIM A;  3COL A;  3LSP A;  3NI7 A;  3VW0 A;  5EZH A;  3O8G A;  4UDS A;  4V2G A;  2Y2Z A;  2UXI A;  3CRJ A;  3BCG A;  2REK A;  2UXP A;  3HE0 A;  5K7Z A;  2HXO A;  2QCO A;  3BT9 A;  3Q3S A;  3BTC A;  4ME9 A;  3C07 A;  5FKK A;  4GFL A;  1U9N A;  4G12 A;  4JKZ A;  4CGR A;  2O7O A;  2VKV A;  3VVX A;  3EGQ A;  3KKC A;  5J1Y A;  5FHP A;  2X6O A;  3ZQH A;  1U9O A;  4GCK A;  3FK7 A;  2QKO A;  2Y31 A;  4X1E A;  3LHQ A;  4M3D A;  2PZ9 A;  3ANP A;  3BR0 A;  3T6N A;  3VPR A;  5EZG A;  3HTJ A;  5F0C A;  5F04 A;  1UI5 A;  3PM1 A;  3VP5 A;  4AF5 A;  5FMP A;  5D19 A;  3HTH A;  3G1M A;  4MO7 A;  2F07 A;  3G1L A;  3NPI A;  2HKU A;  3BTJ A;  4ICH A;  2V57 A;  3ON4 A;  3ZQL A;  2RAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...