2QWTA

Crystal structure of the tetr transcription regulatory protein from mycobacterium vanbaalenii
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
179
structure length
167
Chain Sequence
b'PLRADAARNRARVLEVAYDTFAAEGLGVPMDEIARRAGVGAGTVYRHFPTKQALVVAVAEDRVRRIVDHARTLLAAEGPGEALFVFMRDMVRSAAADYGLVDALVGYGLDLEVAAPGAEAAFLATLGELLAAAQRAGTVRADVDVAVIKALLVSERVVRVIEDGLRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of the TetR transcription regulatory protein from Mycobacterium vanbaalenii.
rcsb
source organism Mycobacterium vanbaalenii pyr-1
molecule tags Transcription
total genus 65
structure length 167
sequence length 179
ec nomenclature
pdb deposition date 2007-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2qwtA00
3KZ9A 4GCLA 2YVHA 3CWRA 3G1MA 2NP3A 5H9TA 3COLA 3LWJA 3BHQA 3HTIA 4M3EA 2UXHA 2QOPA 2OI8A 1T33A 2PZ9A 2HXOA 3VVYA 1RKWA 2GUHA 3T6NA 5F1JA 2IEKA 4D5FA 3IUVA 3IH4A 2ZOZA 3PM1A 3VP5A 1JUPA 2G7GA 3HTJA 2XRLA 3DPJA 3BR5A 2GENA 4NELA 3G1LA 5HBUA 5F04A 3KKDA 4D7NA 4M3GA 2XPVA 4V2FA 4UDSA 3HIMA 5FMPA 3Q0VA 5K58A 3C2BA 1Z0XA 5K7FA 1RKTA 2GFNA 1ORKA 1VI0A 5F0FA 1Z77A 2FJ1A 2Y2ZA 2FX0A 2NX4A 5IPAA 3O8HA 3PASA 2PBXA 5CW8A 4MO7A 5EZHA 3HGYA 5FGLA 5IP6A 2WV1A 2I10A 4W1UA 3BR0A 5F0CA 1JTXA 4V2GA 3VUQA 3VVXA 2Y30A 3BJBA 3SDGA 3ANPA 2JK3A 2WGBA 2RHAA 3AQSA 3C07A 4G12A 5GPCA 3MVPA 2HQ5A 2JJ7A 1SGMA 3ON2A 3ZQHA 2XGDA 3JSJA 4GFLA 2DTZA 4M3BA 1JUMA 5F0HA 2Q24A 4M3DA 2G0EA 4NN1A 3Q3SA 2UXUA 1U9NA 1JT6A 3FRQA 3KKCA 4M3FA 1RPWA 2O7TA 1JT0A 3HE0A 3ZQLA 3NI7A 3ZQFA 3RH2A 4JYKA 3S5RA 4CGRA 4ACIA 5HSZA 3BNIA 2G7SA 3FIWA 3G1OA 4MK6A 3O60A 2FQ4A 2HYTA 3HTHA 4JL3A 3HTAA 2XB5A 3WHBA 3IH3A 3BTCA 2XDNA 3F1BA 2W53A 3QPSA 2F07A 2NS7A 5FKKA 2UXPA 4ABZA 3AQTA 5FKMA 4KWAA 3VW2A 3LHQA 2XPUA 3V78A 4I6ZA 2Y31A 2EH3A 3Q0WA 2GBYA 3NPIA 1QVTA 5EZGA 4ICHA 4JNNA 4YZEA 3P9TA 3ZQIA 4GCTA 2IU5A 3NRGA 3ANGA 2X9DA 2HKUA 3NNRA 3B6CA 3BRUA 2IAIA 5CXGA 3DCFA 2FD5A 5J1RA 3PPBA 1BJZA 3KNWA 3VOXA 2OERA 5AQCA 3VVZA 3VW1A 4XK4A 3O8GA 2G3BA 2HXIA 2ZCXA 2ID6A 3LOCA 2V57A 3QQAA 3V6GA 4DW6A 2WUIA 3BR6A 5FHPA 4JKZA 2ZCNA 2ZB9A 2OF7A 2TRTA 3BR2A 2X6OA 3TP3A 2YVEA 3BTJA 2NP5A 4D7MA 4D5CA 3HGGA 4AC6A 4AUXA 5FKLA 3QKXA 2TCTA 4B3AA 5DAJA 4GCKA 2HYJA 1T56A 3TP0A 3VW0A 2NS8A 1QVUA 3G7RA 3LSRA 1JTYA 3EGQA 4AF5A 5J3LA 5GPAA 4B1RA 4W97A 2RAEA 3LJLA 3G56A 5J1YA 2ZOYA 3B81A 2QKOA 3ON4A 3BTLA 3IH2A 3QBMA 2QTQA 1UI6A 3FK7A 2QCOA 4X1EA 2VKEA 3F0CA 3CDLA 3LSPA 1UI5A 2ZCMA 3BR1A 5IOYA 2XGEA 3GEUA 5CXIA 3Q0UA 3FK6A 2O7OA 5F27A 2G7LA 2VPRA 5FKOA 3DEWA 3VOKA 1ZKGA 3CCYA 4PXIA 2DG7A 3VIBA 4I76A 5HAWA 2VKVA 5D18A 2QIBA 3QPLA 1ZK8A 5F08A 4MXMA 3E7QA 1A6IA 3GZIA 4HKUA 3BQZA 2QWTA 3BT9A 3RD3A 5GP9A 3CJDA 2D6YA 2RASA 2XPWA 3BQYA 1QPIA 5FKNA 5K7HA 5J1UA 3B6AA 5D19A 2REKA 1JUSA 5IOZA 2UXOA 3NXCA 5K7ZA 3ZQGA 3EUPA 2UXIA 2IBDA 4L62A 4AC0A 3WHCA 2FBQA 2DG8A 3LSJA 5EYRA 3BTIA 2XGCA 3MNLA 3SFIA 3BCGA 3BR3A 2ID3A 2OPTA 1U9OA 5D1RA 5EFYA 3VPRA 3CRJA 5C4YA 4GFKA 4ME9A
chains in the Genus database with same CATH superfamily
3KZ9A 4GCLA 2YVHA 3CWRA 3G1MA 2NP3A 5H9TA 3COLA 3LWJA 3BHQA 3HTIA 4M3EA 2UXHA 2QOPA 2R7WA 5CQGA 2OI8A 1T33A 2PZ9A 2HXOA 3VVYA 1RKWA 2GUHA 3T6NA 5F1JA 2IEKA 4D5FA 3IUVA 3IH4A 3FHNA 2ZOZA 3PM1A 3VP5A 1JUPA 2G7GA 3HTJA 2XRLA 3DPJA 3BR5A 2GENA 4NELA 3G1LA 5HBUA 5F04A 3KKDA 4D7NA 2R7VA 4M3GA 2XPVA 4V2FA 4UDSA 3KYLA 3HIMA 5FMPA 3Q0VA 5K58A 3C2BA 1Z0XA 5K7FA 1RKTA 2GFNA 1ORKA 1VI0A 5F0FA 1Z77A 2R7TA 2FJ1A 2Y2ZA 2FX0A 2NX4A 5IPAA 4IRVA 3O8HA 3PASA 2PBXA 3K8PC 5CW8A 4MO7A 5EZHA 3HGYA 5FGLA 5IP6A 2WV1A 2I10A 4W1UA 2A2FX 3BR0A 5F0CA 1JTXA 4V2GA 3VUQA 3VVXA 2Y30A 3BJBA 3SDGA 3ANPA 2JK3A 2WGBA 2RHAA 3AQSA 3C07A 4G12A 5GPCA 3MVPA 2HQ5A 2JJ7A 1SGMA 3ON2A 3ZQHA 2XGDA 3JSJA 4GFLA 4WIBA 2DTZA 4M3BA 1JUMA 5F0HA 2Q24A 4M3DA 2G0EA 4NN1A 3Q3SA 2UXUA 1U9NA 1JT6A 2ZY9A 3FRQA 3KKCA 4M3FA 1RPWA 2O7TA 1JT0A 3HE0A 3ZQLA 3NI7A 3ZQFA 3RH2A 4JYKA 3S5RA 4CGRA 4ACIA 5HSZA 3BNIA 2G7SA 3FIWA 2YVXA 3G1OA 4MK6A 3O60A 2FQ4A 2HYTA 3HTHA 4C2MA 4JL3A 3HTAA 2XB5A 3WHBA 3IH3A 3BTCA 2XDNA 3F1BA 2W53A 3QPSA 2F07A 2NS7A 5FKKA 2R7SA 2UXPA 4ABZA 3AQTA 5FKMA 4KWAA 3VW2A 3LHQA 2XPUA 3V78A 4I6ZA 2B1EA 2Y31A 2EH3A 3Q0WA 2GBYA 2R7XA 3NPIA 1QVTA 3DU6A 5EZGA 4ICHA 4JNNA 4YZEA 3P9TA 3ZQIA 4GCTA 2IU5A 3NRGA 4OD5A 2R7QA 3ANGA 2R7RA 2X9DA 2HKUA 3NNRA 3B6CA 3SWHA 3BRUA 2IAIA 5CXGA 3DCFA 2FD5A 5J1RA 3PPBA 1BJZA 3KNWA 3VOXA 3VTIA 2OERA 4U9NA 5AQCA 3VVZA 3VW1A 4XK4A 3O8GA 2G3BA 2HXIA 2ZCXA 2ID6A 3LOCA 2V57A 3QQAA 3V6GA 4DW6A 2WUIA 3BR6A 5FHPA 4JKZA 2ZCNA 2R7UA 2ZB9A 2OF7A 2TRTA 4DVYP 3BR2A 2X6OA 3TP3A 2YVEA 3BTJA 2NP5A 4D7MA 4D5CA 2FJI1 3HGGA 4AC6A 4AUXA 5FKLA 3QKXA 2TCTA 4B3AA 5DAJA 4GCKA 2HYJA 1T56A 3TP0A 3VW0A 2NS8A 1QVUA 3G7RA 3LSRA 1JTYA 3EGQA 4AF5A 5J3LA 5GPAA 4B1RA 4W97A 2RAEA 3LJLA 3G56A 5J1YA 2ZOYA 3B81A 2QKOA 3ON4A 3BTLA 3IH2A 3QBMA 2QTQA 1UI6A 3FK7A 2QCOA 3DU5A 4X1EA 2VKEA 3F0CA 3CDLA 3LSPA 1UI5A 2ZCMA 3BR1A 5IOYA 2XGEA 3GEUA 5CXIA 3Q0UA 3FK6A 2O7OA 5F27A 2G7LA 2VPRA 5FKOA 3DEWA 3NS4A 3VOKA 1ZKGA 3CCYA 4PXIA 2DG7A 3VIBA 4I76A 5HAWA 2VKVA 5D18A 2QIBA 3QPLA 1ZK8A 5F08A 4MXMA 3E7QA 1A6IA 3GZIA 4HKUA 3BQZA 2QWTA 3BT9A 3RD3A 5GP9A 3CJDA 2D6YA 2RASA 2XPWA 3BQYA 1QPIA 5FKNA 5K7HA 5J1UA 3B6AA 5D19A 2REKA 1JUSA 5IOZA 2UXOA 3NXCA 5K7ZA 3ZQGA 4OD4A 3EUPA 2UXIA 2IBDA 4L62A 2PFVA 4AC0A 3WHCA 2B3WA 2FBQA 2DG8A 3LSJA 5EYRA 2R7OA 3BTIA 2XGCA 3MNLA 3SFIA 3BCGA 3BR3A 2ID3A 2OPTA 1U9OA 5D1RA 5EFYA 3VPRA 3CRJA 4U9LA 5C4YA 4GFKA 4ME9A
chains in the Genus database with same CATH topology
3KZ9A 4GCLA 2YVHA 3CWRA 3G1MA 2NP3A 5H9TA 3COLA 3LWJA 3BHQA 3HTIA 4M3EA 2UXHA 2QOPA 2OI8A 1T33A 2PZ9A 2HXOA 3VVYA 1RKWA 2GUHA 3T6NA 5F1JA 2IEKA 4D5FA 3IUVA 3IH4A 2ZOZA 3PM1A 3VP5A 1JUPA 2G7GA 3HTJA 2XRLA 3DPJA 3BR5A 2GENA 4NELA 3G1LA 5HBUA 5F04A 3KKDA 4D7NA 4M3GA 2XPVA 4V2FA 4UDSA 3HIMA 5FMPA 3Q0VA 5K58A 3C2BA 1Z0XA 5K7FA 1RKTA 2GFNA 1ORKA 1VI0A 5F0FA 1Z77A 2FJ1A 2Y2ZA 2FX0A 2NX4A 5IPAA 3O8HA 3PASA 2PBXA 5CW8A 4MO7A 5EZHA 3HGYA 5FGLA 5IP6A 2WV1A 2I10A 4W1UA 3BR0A 5F0CA 1JTXA 4V2GA 3VUQA 3VVXA 2Y30A 3BJBA 3SDGA 3ANPA 2JK3A 2WGBA 2RHAA 3AQSA 3C07A 4G12A 5GPCA 3MVPA 2HQ5A 2JJ7A 1SGMA 3ON2A 3ZQHA 2XGDA 3JSJA 4GFLA 2DTZA 4M3BA 1JUMA 5F0HA 2Q24A 4M3DA 2G0EA 4NN1A 3Q3SA 2UXUA 1U9NA 1JT6A 3FRQA 3KKCA 4M3FA 1RPWA 2O7TA 1JT0A 3HE0A 3ZQLA 3NI7A 3ZQFA 3RH2A 4JYKA 3S5RA 4CGRA 4ACIA 5HSZA 3BNIA 2G7SA 3FIWA 3G1OA 4MK6A 3O60A 2FQ4A 2HYTA 3HTHA 4JL3A 3HTAA 2XB5A 3WHBA 3IH3A 3BTCA 2XDNA 3F1BA 2W53A 3QPSA 2F07A 2NS7A 5FKKA 2UXPA 4ABZA 3AQTA 5FKMA 4KWAA 3VW2A 3LHQA 2XPUA 3V78A 4I6ZA 2Y31A 2EH3A 3Q0WA 2GBYA 3NPIA 1QVTA 5EZGA 4ICHA 4JNNA 4YZEA 3P9TA 3ZQIA 4GCTA 2IU5A 3NRGA 3ANGA 2X9DA 2HKUA 3NNRA 3B6CA 3BRUA 2IAIA 5CXGA 3DCFA 2FD5A 5J1RA 3PPBA 1BJZA 3KNWA 3VOXA 2OERA 5AQCA 3VVZA 3VW1A 4XK4A 3O8GA 2G3BA 2HXIA 2ZCXA 2ID6A 3LOCA 2V57A 3QQAA 3V6GA 4DW6A 2WUIA 3BR6A 5FHPA 4JKZA 2ZCNA 2ZB9A 2OF7A 2TRTA 3BR2A 2X6OA 3TP3A 2YVEA 3BTJA 2NP5A 4D7MA 4D5CA 3HGGA 4AC6A 4AUXA 5FKLA 3QKXA 2TCTA 4B3AA 5DAJA 4GCKA 2HYJA 1T56A 3TP0A 3VW0A 2NS8A 1QVUA 3G7RA 3LSRA 1JTYA 3EGQA 4AF5A 5J3LA 5GPAA 4B1RA 4W97A 2RAEA 3LJLA 3G56A 5J1YA 2ZOYA 3B81A 2QKOA 3ON4A 3BTLA 3IH2A 3QBMA 2QTQA 1UI6A 3FK7A 2QCOA 4X1EA 2VKEA 3F0CA 3CDLA 3LSPA 1UI5A 2ZCMA 3BR1A 5IOYA 2XGEA 3GEUA 5CXIA 3Q0UA 3FK6A 2O7OA 5F27A 2G7LA 2VPRA 5FKOA 3DEWA 3VOKA 1ZKGA 3CCYA 4PXIA 2DG7A 3VIBA 4I76A 5HAWA 2VKVA 5D18A 2QIBA 3QPLA 1ZK8A 5F08A 4MXMA 3E7QA 1A6IA 3GZIA 4HKUA 3BQZA 2QWTA 3BT9A 3RD3A 5GP9A 3CJDA 2D6YA 2RASA 2XPWA 3BQYA 1QPIA 5FKNA 5K7HA 5J1UA 3B6AA 5D19A 2REKA 1JUSA 5IOZA 2UXOA 3NXCA 5K7ZA 3ZQGA 3EUPA 2UXIA 2IBDA 4L62A 4AC0A 3WHCA 2FBQA 2DG8A 3LSJA 5EYRA 3BTIA 2XGCA 3MNLA 3SFIA 3BCGA 3BR3A 2ID3A 2OPTA 1U9OA 5D1RA 5EFYA 3VPRA 3CRJA 5C4YA 4GFKA 4ME9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZ9 A;  4GCL A;  2YVH A;  3CWR A;  3G1M A;  2NP3 A;  5H9T A;  3COL A;  3LWJ A;  3BHQ A;  3HTI A;  4M3E A;  2UXH A;  2QOP A;  2OI8 A;  1T33 A;  2PZ9 A;  2HXO A;  3VVY A;  1RKW A;  2GUH A;  3T6N A;  5F1J A;  2IEK A;  4D5F A;  3IUV A;  3IH4 A;  2ZOZ A;  3PM1 A;  3VP5 A;  1JUP A;  2G7G A;  3HTJ A;  2XRL A;  3DPJ A;  3BR5 A;  2GEN A;  4NEL A;  3G1L A;  5HBU A;  5F04 A;  3KKD A;  4D7N A;  4M3G A;  2XPV A;  4V2F A;  4UDS A;  3HIM A;  5FMP A;  3Q0V A;  5K58 A;  3C2B A;  1Z0X A;  5K7F A;  1RKT A;  2GFN A;  1ORK A;  1VI0 A;  5F0F A;  1Z77 A;  2FJ1 A;  2Y2Z A;  2FX0 A;  2NX4 A;  5IPA A;  3O8H A;  3PAS A;  2PBX A;  5CW8 A;  4MO7 A;  5EZH A;  3HGY A;  5FGL A;  5IP6 A;  2WV1 A;  2I10 A;  4W1U A;  3BR0 A;  5F0C A;  1JTX A;  4V2G A;  3VUQ A;  3VVX A;  2Y30 A;  3BJB A;  3SDG A;  3ANP A;  2JK3 A;  2WGB A;  2RHA A;  3AQS A;  3C07 A;  4G12 A;  5GPC A;  3MVP A;  2HQ5 A;  2JJ7 A;  1SGM A;  3ON2 A;  3ZQH A;  2XGD A;  3JSJ A;  4GFL A;  2DTZ A;  4M3B A;  1JUM A;  5F0H A;  2Q24 A;  4M3D A;  2G0E A;  4NN1 A;  3Q3S A;  2UXU A;  1U9N A;  1JT6 A;  3FRQ A;  3KKC A;  4M3F A;  1RPW A;  2O7T A;  1JT0 A;  3HE0 A;  3ZQL A;  3NI7 A;  3ZQF A;  3RH2 A;  4JYK A;  3S5R A;  4CGR A;  4ACI A;  5HSZ A;  3BNI A;  2G7S A;  3FIW A;  3G1O A;  4MK6 A;  3O60 A;  2FQ4 A;  2HYT A;  3HTH A;  4JL3 A;  3HTA A;  2XB5 A;  3WHB A;  3IH3 A;  3BTC A;  2XDN A;  3F1B A;  2W53 A;  3QPS A;  2F07 A;  2NS7 A;  5FKK A;  2UXP A;  4ABZ A;  3AQT A;  5FKM A;  4KWA A;  3VW2 A;  3LHQ A;  2XPU A;  3V78 A;  4I6Z A;  2Y31 A;  2EH3 A;  3Q0W A;  2GBY A;  3NPI A;  1QVT A;  5EZG A;  4ICH A;  4JNN A;  4YZE A;  3P9T A;  3ZQI A;  4GCT A;  2IU5 A;  3NRG A;  3ANG A;  2X9D A;  2HKU A;  3NNR A;  3B6C A;  3BRU A;  2IAI A;  5CXG A;  3DCF A;  2FD5 A;  5J1R A;  3PPB A;  1BJZ A;  3KNW A;  3VOX A;  2OER A;  5AQC A;  3VVZ A;  3VW1 A;  4XK4 A;  3O8G A;  2G3B A;  2HXI A;  2ZCX A;  2ID6 A;  3LOC A;  2V57 A;  3QQA A;  3V6G A;  4DW6 A;  2WUI A;  3BR6 A;  5FHP A;  4JKZ A;  2ZCN A;  2ZB9 A;  2OF7 A;  2TRT A;  3BR2 A;  2X6O A;  3TP3 A;  2YVE A;  3BTJ A;  2NP5 A;  4D7M A;  4D5C A;  3HGG A;  4AC6 A;  4AUX A;  5FKL A;  3QKX A;  2TCT A;  4B3A A;  5DAJ A;  4GCK A;  2HYJ A;  1T56 A;  3TP0 A;  3VW0 A;  2NS8 A;  1QVU A;  3G7R A;  3LSR A;  1JTY A;  3EGQ A;  4AF5 A;  5J3L A;  5GPA A;  4B1R A;  4W97 A;  2RAE A;  3LJL A;  3G56 A;  5J1Y A;  2ZOY A;  3B81 A;  2QKO A;  3ON4 A;  3BTL A;  3IH2 A;  3QBM A;  2QTQ A;  1UI6 A;  3FK7 A;  2QCO A;  4X1E A;  2VKE A;  3F0C A;  3CDL A;  3LSP A;  1UI5 A;  2ZCM A;  3BR1 A;  5IOY A;  2XGE A;  3GEU A;  5CXI A;  3Q0U A;  3FK6 A;  2O7O A;  5F27 A;  2G7L A;  2VPR A;  5FKO A;  3DEW A;  3VOK A;  1ZKG A;  3CCY A;  4PXI A;  2DG7 A;  3VIB A;  4I76 A;  5HAW A;  2VKV A;  5D18 A;  2QIB A;  3QPL A;  1ZK8 A;  5F08 A;  4MXM A;  3E7Q A;  1A6I A;  3GZI A;  4HKU A;  3BQZ A;  2QWT A;  3BT9 A;  3RD3 A;  5GP9 A;  3CJD A;  2D6Y A;  2RAS A;  2XPW A;  3BQY A;  1QPI A;  5FKN A;  5K7H A;  5J1U A;  3B6A A;  5D19 A;  2REK A;  1JUS A;  5IOZ A;  2UXO A;  3NXC A;  5K7Z A;  3ZQG A;  3EUP A;  2UXI A;  2IBD A;  4L62 A;  4AC0 A;  3WHC A;  2FBQ A;  2DG8 A;  3LSJ A;  5EYR A;  3BTI A;  2XGC A;  3MNL A;  3SFI A;  3BCG A;  3BR3 A;  2ID3 A;  2OPT A;  1U9O A;  5D1R A;  5EFY A;  3VPR A;  3CRJ A;  5C4Y A;  4GFK A;  4ME9 A; 
#chains in the Genus database with same CATH topology
 3KZ9 A;  4GCL A;  2YVH A;  3CWR A;  3G1M A;  2NP3 A;  5H9T A;  3COL A;  3LWJ A;  3BHQ A;  3HTI A;  4M3E A;  2UXH A;  2QOP A;  2R7W A;  5CQG A;  2OI8 A;  1T33 A;  2PZ9 A;  2HXO A;  3VVY A;  1RKW A;  2GUH A;  3T6N A;  5F1J A;  2IEK A;  4D5F A;  3IUV A;  3IH4 A;  3FHN A;  2ZOZ A;  3PM1 A;  3VP5 A;  1JUP A;  2G7G A;  3HTJ A;  2XRL A;  3DPJ A;  3BR5 A;  2GEN A;  4NEL A;  3G1L A;  5HBU A;  5F04 A;  3KKD A;  4D7N A;  2R7V A;  4M3G A;  2XPV A;  4V2F A;  4UDS A;  3KYL A;  3HIM A;  5FMP A;  3Q0V A;  5K58 A;  3C2B A;  1Z0X A;  5K7F A;  1RKT A;  2GFN A;  1ORK A;  1VI0 A;  5F0F A;  1Z77 A;  2R7T A;  2FJ1 A;  2Y2Z A;  2FX0 A;  2NX4 A;  5IPA A;  4IRV A;  3O8H A;  3PAS A;  2PBX A;  3K8P C;  5CW8 A;  4MO7 A;  5EZH A;  3HGY A;  5FGL A;  5IP6 A;  2WV1 A;  2I10 A;  4W1U A;  2A2F X;  3BR0 A;  5F0C A;  1JTX A;  4V2G A;  3VUQ A;  3VVX A;  2Y30 A;  3BJB A;  3SDG A;  3ANP A;  2JK3 A;  2WGB A;  2RHA A;  3AQS A;  3C07 A;  4G12 A;  5GPC A;  3MVP A;  2HQ5 A;  2JJ7 A;  1SGM A;  3ON2 A;  3ZQH A;  2XGD A;  3JSJ A;  4GFL A;  4WIB A;  2DTZ A;  4M3B A;  1JUM A;  5F0H A;  2Q24 A;  4M3D A;  2G0E A;  4NN1 A;  3Q3S A;  2UXU A;  1U9N A;  1JT6 A;  2ZY9 A;  3FRQ A;  3KKC A;  4M3F A;  1RPW A;  2O7T A;  1JT0 A;  3HE0 A;  3ZQL A;  3NI7 A;  3ZQF A;  3RH2 A;  4JYK A;  3S5R A;  4CGR A;  4ACI A;  5HSZ A;  3BNI A;  2G7S A;  3FIW A;  2YVX A;  3G1O A;  4MK6 A;  3O60 A;  2FQ4 A;  2HYT A;  3HTH A;  4C2M A;  4JL3 A;  3HTA A;  2XB5 A;  3WHB A;  3IH3 A;  3BTC A;  2XDN A;  3F1B A;  2W53 A;  3QPS A;  2F07 A;  2NS7 A;  5FKK A;  2R7S A;  2UXP A;  4ABZ A;  3AQT A;  5FKM A;  4KWA A;  3VW2 A;  3LHQ A;  2XPU A;  3V78 A;  4I6Z A;  2B1E A;  2Y31 A;  2EH3 A;  3Q0W A;  2GBY A;  2R7X A;  3NPI A;  1QVT A;  3DU6 A;  5EZG A;  4ICH A;  4JNN A;  4YZE A;  3P9T A;  3ZQI A;  4GCT A;  2IU5 A;  3NRG A;  4OD5 A;  2R7Q A;  3ANG A;  2R7R A;  2X9D A;  2HKU A;  3NNR A;  3B6C A;  3SWH A;  3BRU A;  2IAI A;  5CXG A;  3DCF A;  2FD5 A;  5J1R A;  3PPB A;  1BJZ A;  3KNW A;  3VOX A;  3VTI A;  2OER A;  4U9N A;  5AQC A;  3VVZ A;  3VW1 A;  4XK4 A;  3O8G A;  2G3B A;  2HXI A;  2ZCX A;  2ID6 A;  3LOC A;  2V57 A;  3QQA A;  3V6G A;  4DW6 A;  2WUI A;  3BR6 A;  5FHP A;  4JKZ A;  2ZCN A;  2R7U A;  2ZB9 A;  2OF7 A;  2TRT A;  4DVY P;  3BR2 A;  2X6O A;  3TP3 A;  2YVE A;  3BTJ A;  2NP5 A;  4D7M A;  4D5C A;  2FJI 1;  3HGG A;  4AC6 A;  4AUX A;  5FKL A;  3QKX A;  2TCT A;  4B3A A;  5DAJ A;  4GCK A;  2HYJ A;  1T56 A;  3TP0 A;  3VW0 A;  2NS8 A;  1QVU A;  3G7R A;  3LSR A;  1JTY A;  3EGQ A;  4AF5 A;  5J3L A;  5GPA A;  4B1R A;  4W97 A;  2RAE A;  3LJL A;  3G56 A;  5J1Y A;  2ZOY A;  3B81 A;  2QKO A;  3ON4 A;  3BTL A;  3IH2 A;  3QBM A;  2QTQ A;  1UI6 A;  3FK7 A;  2QCO A;  3DU5 A;  4X1E A;  2VKE A;  3F0C A;  3CDL A;  3LSP A;  1UI5 A;  2ZCM A;  3BR1 A;  5IOY A;  2XGE A;  3GEU A;  5CXI A;  3Q0U A;  3FK6 A;  2O7O A;  5F27 A;  2G7L A;  2VPR A;  5FKO A;  3DEW A;  3NS4 A;  3VOK A;  1ZKG A;  3CCY A;  4PXI A;  2DG7 A;  3VIB A;  4I76 A;  5HAW A;  2VKV A;  5D18 A;  2QIB A;  3QPL A;  1ZK8 A;  5F08 A;  4MXM A;  3E7Q A;  1A6I A;  3GZI A;  4HKU A;  3BQZ A;  2QWT A;  3BT9 A;  3RD3 A;  5GP9 A;  3CJD A;  2D6Y A;  2RAS A;  2XPW A;  3BQY A;  1QPI A;  5FKN A;  5K7H A;  5J1U A;  3B6A A;  5D19 A;  2REK A;  1JUS A;  5IOZ A;  2UXO A;  3NXC A;  5K7Z A;  3ZQG A;  4OD4 A;  3EUP A;  2UXI A;  2IBD A;  4L62 A;  2PFV A;  4AC0 A;  3WHC A;  2B3W A;  2FBQ A;  2DG8 A;  3LSJ A;  5EYR A;  2R7O A;  3BTI A;  2XGC A;  3MNL A;  3SFI A;  3BCG A;  3BR3 A;  2ID3 A;  2OPT A;  1U9O A;  5D1R A;  5EFY A;  3VPR A;  3CRJ A;  4U9L A;  5C4Y A;  4GFK A;  4ME9 A; 
#chains in the Genus database with same CATH homology
 3KZ9 A;  4GCL A;  2YVH A;  3CWR A;  3G1M A;  2NP3 A;  5H9T A;  3COL A;  3LWJ A;  3BHQ A;  3HTI A;  4M3E A;  2UXH A;  2QOP A;  2OI8 A;  1T33 A;  2PZ9 A;  2HXO A;  3VVY A;  1RKW A;  2GUH A;  3T6N A;  5F1J A;  2IEK A;  4D5F A;  3IUV A;  3IH4 A;  2ZOZ A;  3PM1 A;  3VP5 A;  1JUP A;  2G7G A;  3HTJ A;  2XRL A;  3DPJ A;  3BR5 A;  2GEN A;  4NEL A;  3G1L A;  5HBU A;  5F04 A;  3KKD A;  4D7N A;  4M3G A;  2XPV A;  4V2F A;  4UDS A;  3HIM A;  5FMP A;  3Q0V A;  5K58 A;  3C2B A;  1Z0X A;  5K7F A;  1RKT A;  2GFN A;  1ORK A;  1VI0 A;  5F0F A;  1Z77 A;  2FJ1 A;  2Y2Z A;  2FX0 A;  2NX4 A;  5IPA A;  3O8H A;  3PAS A;  2PBX A;  5CW8 A;  4MO7 A;  5EZH A;  3HGY A;  5FGL A;  5IP6 A;  2WV1 A;  2I10 A;  4W1U A;  3BR0 A;  5F0C A;  1JTX A;  4V2G A;  3VUQ A;  3VVX A;  2Y30 A;  3BJB A;  3SDG A;  3ANP A;  2JK3 A;  2WGB A;  2RHA A;  3AQS A;  3C07 A;  4G12 A;  5GPC A;  3MVP A;  2HQ5 A;  2JJ7 A;  1SGM A;  3ON2 A;  3ZQH A;  2XGD A;  3JSJ A;  4GFL A;  2DTZ A;  4M3B A;  1JUM A;  5F0H A;  2Q24 A;  4M3D A;  2G0E A;  4NN1 A;  3Q3S A;  2UXU A;  1U9N A;  1JT6 A;  3FRQ A;  3KKC A;  4M3F A;  1RPW A;  2O7T A;  1JT0 A;  3HE0 A;  3ZQL A;  3NI7 A;  3ZQF A;  3RH2 A;  4JYK A;  3S5R A;  4CGR A;  4ACI A;  5HSZ A;  3BNI A;  2G7S A;  3FIW A;  3G1O A;  4MK6 A;  3O60 A;  2FQ4 A;  2HYT A;  3HTH A;  4JL3 A;  3HTA A;  2XB5 A;  3WHB A;  3IH3 A;  3BTC A;  2XDN A;  3F1B A;  2W53 A;  3QPS A;  2F07 A;  2NS7 A;  5FKK A;  2UXP A;  4ABZ A;  3AQT A;  5FKM A;  4KWA A;  3VW2 A;  3LHQ A;  2XPU A;  3V78 A;  4I6Z A;  2Y31 A;  2EH3 A;  3Q0W A;  2GBY A;  3NPI A;  1QVT A;  5EZG A;  4ICH A;  4JNN A;  4YZE A;  3P9T A;  3ZQI A;  4GCT A;  2IU5 A;  3NRG A;  3ANG A;  2X9D A;  2HKU A;  3NNR A;  3B6C A;  3BRU A;  2IAI A;  5CXG A;  3DCF A;  2FD5 A;  5J1R A;  3PPB A;  1BJZ A;  3KNW A;  3VOX A;  2OER A;  5AQC A;  3VVZ A;  3VW1 A;  4XK4 A;  3O8G A;  2G3B A;  2HXI A;  2ZCX A;  2ID6 A;  3LOC A;  2V57 A;  3QQA A;  3V6G A;  4DW6 A;  2WUI A;  3BR6 A;  5FHP A;  4JKZ A;  2ZCN A;  2ZB9 A;  2OF7 A;  2TRT A;  3BR2 A;  2X6O A;  3TP3 A;  2YVE A;  3BTJ A;  2NP5 A;  4D7M A;  4D5C A;  3HGG A;  4AC6 A;  4AUX A;  5FKL A;  3QKX A;  2TCT A;  4B3A A;  5DAJ A;  4GCK A;  2HYJ A;  1T56 A;  3TP0 A;  3VW0 A;  2NS8 A;  1QVU A;  3G7R A;  3LSR A;  1JTY A;  3EGQ A;  4AF5 A;  5J3L A;  5GPA A;  4B1R A;  4W97 A;  2RAE A;  3LJL A;  3G56 A;  5J1Y A;  2ZOY A;  3B81 A;  2QKO A;  3ON4 A;  3BTL A;  3IH2 A;  3QBM A;  2QTQ A;  1UI6 A;  3FK7 A;  2QCO A;  4X1E A;  2VKE A;  3F0C A;  3CDL A;  3LSP A;  1UI5 A;  2ZCM A;  3BR1 A;  5IOY A;  2XGE A;  3GEU A;  5CXI A;  3Q0U A;  3FK6 A;  2O7O A;  5F27 A;  2G7L A;  2VPR A;  5FKO A;  3DEW A;  3VOK A;  1ZKG A;  3CCY A;  4PXI A;  2DG7 A;  3VIB A;  4I76 A;  5HAW A;  2VKV A;  5D18 A;  2QIB A;  3QPL A;  1ZK8 A;  5F08 A;  4MXM A;  3E7Q A;  1A6I A;  3GZI A;  4HKU A;  3BQZ A;  2QWT A;  3BT9 A;  3RD3 A;  5GP9 A;  3CJD A;  2D6Y A;  2RAS A;  2XPW A;  3BQY A;  1QPI A;  5FKN A;  5K7H A;  5J1U A;  3B6A A;  5D19 A;  2REK A;  1JUS A;  5IOZ A;  2UXO A;  3NXC A;  5K7Z A;  3ZQG A;  3EUP A;  2UXI A;  2IBD A;  4L62 A;  4AC0 A;  3WHC A;  2FBQ A;  2DG8 A;  3LSJ A;  5EYR A;  3BTI A;  2XGC A;  3MNL A;  3SFI A;  3BCG A;  3BR3 A;  2ID3 A;  2OPT A;  1U9O A;  5D1R A;  5EFY A;  3VPR A;  3CRJ A;  5C4Y A;  4GFK A;  4ME9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...