2QWTA

Crystal structure of the tetr transcription regulatory protein from mycobacterium vanbaalenii
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
179
structure length
167
Chain Sequence
PLRADAARNRARVLEVAYDTFAAEGLGVPMDEIARRAGVGAGTVYRHFPTKQALVVAVAEDRVRRIVDHARTLLAAEGPGEALFVFMRDMVRSAAADYGLVDALVGYGLDLEVAAPGAEAAFLATLGELLAAAQRAGTVRADVDVAVIKALLVSERVVRVIEDGLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of the TetR transcription regulatory protein from Mycobacterium vanbaalenii.
rcsb
source organism Mycobacterium vanbaalenii pyr-1
molecule tags Transcription
total genus 65
structure length 167
sequence length 179
ec nomenclature
pdb deposition date 2007-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2qwtA00
3IH4A 3VW2A 3KNWA 2G0EA 2UXOA 4GFLA 3AQSA 5IP6A 3B81A 3CRJA 3NNRA 2FD5A 3BTLA 5F04A 3HTJA 3ANPA 3BJBA 3BR3A 2RAEA 4ACIA 2NP3A 3NPIA 3Q0UA 3ZQIA 1ORKA 3WHCA 3BR5A 3CDLA 3QBMA 3VVYA 1RKWA 3T6NA 3BR2A 2HKUA 3QQAA 4MK6A 4D7NA 1A6IA 3F0CA 3LSJA 3O8HA 2X6OA 4KWAA 3HIMA 2QOPA 3PM1A 2QIBA 3B6CA 3BQYA 4M3FA 5H9TA 4I6ZA 4ICHA 2UXPA 1VI0A 3KKDA 4M3DA 2UXHA 5F0HA 3O8GA 5F0FA 2HQ5A 2G7LA 4XK4A 3VOKA 3BQZA 3G1OA 2QTQA 4GFKA 4PXIA 2XPWA 2VPRA 5FKNA 2WUIA 4JYKA 2TRTA 2XDNA 5FKOA 4ABZA 1SGMA 3VPRA 2NX4A 3VIBA 3QPSA 1QPIA 3LSPA 1JUSA 2HYJA 3BR6A 2Y30A 3NXCA 3C2BA 4YZEA 5D18A 2GUHA 3G1LA 2PZ9A 3ON2A 4I76A 2V57A 4NN1A 2UXIA 5EZHA 1QVTA 3LJLA 4GCLA 2REKA 2OI8A 3Q3SA 2W53A 3DCFA 3GZIA 2IU5A 3BHQA 4D5FA 3BTIA 3MNLA 2DG8A 2XRLA 2GBYA 3EUPA 2FJ1A 2NP5A 3TP3A 1JT0A 3O60A 2TCTA 4M3EA 3C07A 3HGGA 3HTIA 2X9DA 5EZGA 3NRGA 3JSJA 4UDSA 4JKZA 3IH2A 2G7SA 4AC6A 3P9TA 4M3GA 2Q24A 2FBQA 4NELA 5CXIA 1ZKGA 2IEKA 1RPWA 3G7RA 2F07A 5K58A 3QKXA 2Y31A 5EFYA 2UXUA 3BTJA 4AC0A 5AQCA 3NI7A 3CJDA 2NS7A 3SFIA 4HKUA 2ZOZA 2XGDA 1JUPA 3VW1A 3F1BA 2ID6A 4B3AA 2O7TA 5K7HA 3COLA 2ID3A 3MVPA 1JTXA 3RD3A 2IBDA 1JTYA 5HBUA 3EGQA 4JL3A 2VKVA 4MXMA 2JJ7A 2FX0A 1Z77A 3BR0A 3HE0A 5D1RA 5J1RA 2QWTA 5K7ZA 4V2GA 3ZQHA 3E7QA 3B6AA 2XGCA 5IOZA 4D7MA 5CXGA 1BJZA 5F1JA 2G3BA 2WGBA 3ANGA 1T56A 3HGYA 2ZOYA 4G12A 2OERA 4V2FA 3BCGA 2ZCNA 3BTCA 3CCYA 5FHPA 3QPLA 5FKKA 5FMPA 2HXIA 2JK3A 3Q0VA 5FKMA 4M3BA 3ON4A 3BNIA 3Q0WA 3IUVA 4MO7A 2QCOA 5HAWA 2GFNA 4DW6A 2VKEA 4L62A 2IAIA 5HSZA 4W97A 5F0CA 3KKCA 5CW8A 5FGLA 2OPTA 3HTHA 3S5RA 3VVZA 5IPAA 5IOYA 4CGRA 3HTAA 1Z0XA 1RKTA 4W1UA 5F27A 3ZQFA 2YVHA 3FRQA 3VVXA 5FKLA 3VOXA 2OF7A 5J3LA 2QKOA 4JNNA 4GCKA 3GEUA 5DAJA 3BT9A 2ZB9A 1UI5A 4B1RA 2NS8A 3VP5A 1JT6A 5GP9A 2ZCMA 3FIWA 3LWJA 4D5CA 2RASA 1UI6A 1U9NA 3ZQLA 1JUMA 3DPJA 1T33A 5K7FA 4GCTA 3FK7A 3PPBA 5F08A 3KZ9A 4AUXA 1QVUA 3VW0A 3LHQA 5C4YA 3G1MA 2FQ4A 3BRUA 3ZQGA 3G56A 1U9OA 3BR1A 3IH3A 4X1EA 2O7OA 3CWRA 1ZK8A 5J1UA 3LOCA 2PBXA 2XPVA 3V78A 2DG7A 2XGEA 3AQTA 2HYTA 2Y2ZA 2WV1A 3LSRA 3PASA 2RHAA 2DTZA 3WHBA 2XPUA 2XB5A 5J1YA 3VUQA 2G7GA 5GPCA 2GENA 2EH3A 4ME9A 3SDGA 3V6GA 3FK6A 5D19A 3RH2A 3DEWA 3TP0A 2ZCXA 2HXOA 5EYRA 2I10A 5GPAA 2YVEA 4AF5A 2D6YA
chains in the Genus database with same CATH superfamily
3IH4A 3VW2A 3KNWA 2R7OA 2G0EA 2UXOA 4GFLA 3AQSA 5IP6A 3B81A 4WIBA 3CRJA 3NNRA 2FD5A 3BTLA 5F04A 3HTJA 3ANPA 3BJBA 3BR3A 2R7VA 2RAEA 4ACIA 2NP3A 3NPIA 3Q0UA 3ZQIA 1ORKA 3WHCA 3BR5A 3CDLA 3QBMA 3VVYA 1RKWA 3T6NA 3BR2A 2HKUA 3QQAA 4MK6A 4D7NA 1A6IA 3F0CA 3LSJA 3O8HA 2X6OA 4KWAA 3HIMA 2QOPA 3PM1A 2QIBA 3B6CA 3BQYA 4M3FA 5H9TA 4I6ZA 4ICHA 2UXPA 1VI0A 3KKDA 4M3DA 2UXHA 2B3WA 5F0HA 3O8GA 5F0FA 2HQ5A 2FJI1 2G7LA 4XK4A 3VOKA 3BQZA 3G1OA 2B1EA 2QTQA 4GFKA 4PXIA 2XPWA 2VPRA 5FKNA 2WUIA 4JYKA 2TRTA 2XDNA 5FKOA 4ABZA 1SGMA 3VPRA 2NX4A 3VIBA 3QPSA 1QPIA 2R7XA 3LSPA 1JUSA 2HYJA 3BR6A 2Y30A 3NXCA 4U9LA 3C2BA 4YZEA 5D18A 2GUHA 3G1LA 2PZ9A 3ON2A 4I76A 2V57A 4NN1A 2UXIA 5EZHA 2R7TA 1QVTA 3LJLA 4GCLA 2R7SA 2REKA 2OI8A 3Q3SA 2W53A 3DCFA 3GZIA 2IU5A 3BHQA 4D5FA 3BTIA 3MNLA 2DG8A 2XRLA 2GBYA 3DU5A 3EUPA 2FJ1A 2NP5A 4IRVA 3TP3A 1JT0A 3O60A 2TCTA 4M3EA 3C07A 3HGGA 3HTIA 2X9DA 5EZGA 3NRGA 3JSJA 4UDSA 4JKZA 3IH2A 2G7SA 4AC6A 3P9TA 4M3GA 2Q24A 4C2MA 2FBQA 4NELA 5CXIA 1ZKGA 2A2FX 2IEKA 1RPWA 3G7RA 2F07A 2R7UA 5K58A 3QKXA 2Y31A 5EFYA 2UXUA 3BTJA 4AC0A 5AQCA 3NI7A 3CJDA 2NS7A 3SFIA 4HKUA 2ZOZA 2XGDA 1JUPA 3VW1A 3F1BA 2ID6A 4B3AA 2O7TA 5K7HA 3COLA 2ID3A 3MVPA 1JTXA 3RD3A 2IBDA 1JTYA 5HBUA 3EGQA 4JL3A 2VKVA 4MXMA 2JJ7A 2FX0A 1Z77A 3BR0A 3HE0A 5D1RA 5J1RA 2QWTA 5K7ZA 2R7WA 3DU6A 4V2GA 3ZQHA 3E7QA 3B6AA 2XGCA 5IOZA 5CQGA 4D7MA 5CXGA 1BJZA 5F1JA 2G3BA 2WGBA 3K8PC 4U9NA 3ANGA 3KYLA 1T56A 3HGYA 4OD5A 2ZOYA 4G12A 2OERA 4V2FA 3BCGA 2ZCNA 3BTCA 3CCYA 5FHPA 3QPLA 5FKKA 5FMPA 2HXIA 2JK3A 3Q0VA 5FKMA 4M3BA 3ON4A 3BNIA 3Q0WA 3IUVA 4MO7A 2QCOA 5HAWA 2GFNA 4DW6A 2VKEA 4L62A 2ZY9A 2IAIA 5HSZA 4W97A 5F0CA 3KKCA 5CW8A 5FGLA 2OPTA 4DVYP 3HTHA 3S5RA 3VVZA 5IPAA 5IOYA 4CGRA 2PFVA 3HTAA 1Z0XA 4OD4A 1RKTA 4W1UA 5F27A 3ZQFA 2YVXA 2YVHA 3FRQA 3VVXA 5FKLA 3VOXA 3FHNA 2OF7A 5J3LA 2QKOA 3NS4A 4JNNA 4GCKA 3GEUA 5DAJA 3BT9A 2ZB9A 1UI5A 4B1RA 2NS8A 3VP5A 1JT6A 5GP9A 2ZCMA 3FIWA 3LWJA 4D5CA 2RASA 1UI6A 1U9NA 3ZQLA 1JUMA 3DPJA 1T33A 5K7FA 4GCTA 3FK7A 3PPBA 2R7QA 5F08A 3KZ9A 4AUXA 1QVUA 3VW0A 3LHQA 5C4YA 2R7RA 3G1MA 2FQ4A 3BRUA 3ZQGA 3G56A 1U9OA 3BR1A 3IH3A 4X1EA 2O7OA 3CWRA 1ZK8A 5J1UA 3LOCA 2PBXA 2XPVA 3V78A 2DG7A 2XGEA 3AQTA 2HYTA 2Y2ZA 2WV1A 3LSRA 3PASA 2RHAA 3SWHA 2DTZA 3VTIA 3WHBA 2XPUA 2XB5A 5J1YA 3VUQA 2G7GA 5GPCA 2GENA 2EH3A 4ME9A 3SDGA 3V6GA 3FK6A 5D19A 3RH2A 3DEWA 3TP0A 2ZCXA 2HXOA 5EYRA 2I10A 5GPAA 2YVEA 4AF5A 2D6YA
chains in the Genus database with same CATH topology
3IH4A 3VW2A 3KNWA 2G0EA 2UXOA 4GFLA 3AQSA 5IP6A 3B81A 3CRJA 3NNRA 2FD5A 3BTLA 5F04A 3HTJA 3ANPA 3BJBA 3BR3A 2RAEA 4ACIA 2NP3A 3NPIA 3Q0UA 3ZQIA 1ORKA 3WHCA 3BR5A 3CDLA 3QBMA 3VVYA 1RKWA 3T6NA 3BR2A 2HKUA 3QQAA 4MK6A 4D7NA 1A6IA 3F0CA 3LSJA 3O8HA 2X6OA 4KWAA 3HIMA 2QOPA 3PM1A 2QIBA 3B6CA 3BQYA 4M3FA 5H9TA 4I6ZA 4ICHA 2UXPA 1VI0A 3KKDA 4M3DA 2UXHA 5F0HA 3O8GA 5F0FA 2HQ5A 2G7LA 4XK4A 3VOKA 3BQZA 3G1OA 2QTQA 4GFKA 4PXIA 2XPWA 2VPRA 5FKNA 2WUIA 4JYKA 2TRTA 2XDNA 5FKOA 4ABZA 1SGMA 3VPRA 2NX4A 3VIBA 3QPSA 1QPIA 3LSPA 1JUSA 2HYJA 3BR6A 2Y30A 3NXCA 3C2BA 4YZEA 5D18A 2GUHA 3G1LA 2PZ9A 3ON2A 4I76A 2V57A 4NN1A 2UXIA 5EZHA 1QVTA 3LJLA 4GCLA 2REKA 2OI8A 3Q3SA 2W53A 3DCFA 3GZIA 2IU5A 3BHQA 4D5FA 3BTIA 3MNLA 2DG8A 2XRLA 2GBYA 3EUPA 2FJ1A 2NP5A 3TP3A 1JT0A 3O60A 2TCTA 4M3EA 3C07A 3HGGA 3HTIA 2X9DA 5EZGA 3NRGA 3JSJA 4UDSA 4JKZA 3IH2A 2G7SA 4AC6A 3P9TA 4M3GA 2Q24A 2FBQA 4NELA 5CXIA 1ZKGA 2IEKA 1RPWA 3G7RA 2F07A 5K58A 3QKXA 2Y31A 5EFYA 2UXUA 3BTJA 4AC0A 5AQCA 3NI7A 3CJDA 2NS7A 3SFIA 4HKUA 2ZOZA 2XGDA 1JUPA 3VW1A 3F1BA 2ID6A 4B3AA 2O7TA 5K7HA 3COLA 2ID3A 3MVPA 1JTXA 3RD3A 2IBDA 1JTYA 5HBUA 3EGQA 4JL3A 2VKVA 4MXMA 2JJ7A 2FX0A 1Z77A 3BR0A 3HE0A 5D1RA 5J1RA 2QWTA 5K7ZA 4V2GA 3ZQHA 3E7QA 3B6AA 2XGCA 5IOZA 4D7MA 5CXGA 1BJZA 5F1JA 2G3BA 2WGBA 3ANGA 1T56A 3HGYA 2ZOYA 4G12A 2OERA 4V2FA 3BCGA 2ZCNA 3BTCA 3CCYA 5FHPA 3QPLA 5FKKA 5FMPA 2HXIA 2JK3A 3Q0VA 5FKMA 4M3BA 3ON4A 3BNIA 3Q0WA 3IUVA 4MO7A 2QCOA 5HAWA 2GFNA 4DW6A 2VKEA 4L62A 2IAIA 5HSZA 4W97A 5F0CA 3KKCA 5CW8A 5FGLA 2OPTA 3HTHA 3S5RA 3VVZA 5IPAA 5IOYA 4CGRA 3HTAA 1Z0XA 1RKTA 4W1UA 5F27A 3ZQFA 2YVHA 3FRQA 3VVXA 5FKLA 3VOXA 2OF7A 5J3LA 2QKOA 4JNNA 4GCKA 3GEUA 5DAJA 3BT9A 2ZB9A 1UI5A 4B1RA 2NS8A 3VP5A 1JT6A 5GP9A 2ZCMA 3FIWA 3LWJA 4D5CA 2RASA 1UI6A 1U9NA 3ZQLA 1JUMA 3DPJA 1T33A 5K7FA 4GCTA 3FK7A 3PPBA 5F08A 3KZ9A 4AUXA 1QVUA 3VW0A 3LHQA 5C4YA 3G1MA 2FQ4A 3BRUA 3ZQGA 3G56A 1U9OA 3BR1A 3IH3A 4X1EA 2O7OA 3CWRA 1ZK8A 5J1UA 3LOCA 2PBXA 2XPVA 3V78A 2DG7A 2XGEA 3AQTA 2HYTA 2Y2ZA 2WV1A 3LSRA 3PASA 2RHAA 2DTZA 3WHBA 2XPUA 2XB5A 5J1YA 3VUQA 2G7GA 5GPCA 2GENA 2EH3A 4ME9A 3SDGA 3V6GA 3FK6A 5D19A 3RH2A 3DEWA 3TP0A 2ZCXA 2HXOA 5EYRA 2I10A 5GPAA 2YVEA 4AF5A 2D6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH4 A;  3VW2 A;  3KNW A;  2G0E A;  2UXO A;  4GFL A;  3AQS A;  5IP6 A;  3B81 A;  3CRJ A;  3NNR A;  2FD5 A;  3BTL A;  5F04 A;  3HTJ A;  3ANP A;  3BJB A;  3BR3 A;  2RAE A;  4ACI A;  2NP3 A;  3NPI A;  3Q0U A;  3ZQI A;  1ORK A;  3WHC A;  3BR5 A;  3CDL A;  3QBM A;  3VVY A;  1RKW A;  3T6N A;  3BR2 A;  2HKU A;  3QQA A;  4MK6 A;  4D7N A;  1A6I A;  3F0C A;  3LSJ A;  3O8H A;  2X6O A;  4KWA A;  3HIM A;  2QOP A;  3PM1 A;  2QIB A;  3B6C A;  3BQY A;  4M3F A;  5H9T A;  4I6Z A;  4ICH A;  2UXP A;  1VI0 A;  3KKD A;  4M3D A;  2UXH A;  5F0H A;  3O8G A;  5F0F A;  2HQ5 A;  2G7L A;  4XK4 A;  3VOK A;  3BQZ A;  3G1O A;  2QTQ A;  4GFK A;  4PXI A;  2XPW A;  2VPR A;  5FKN A;  2WUI A;  4JYK A;  2TRT A;  2XDN A;  5FKO A;  4ABZ A;  1SGM A;  3VPR A;  2NX4 A;  3VIB A;  3QPS A;  1QPI A;  3LSP A;  1JUS A;  2HYJ A;  3BR6 A;  2Y30 A;  3NXC A;  3C2B A;  4YZE A;  5D18 A;  2GUH A;  3G1L A;  2PZ9 A;  3ON2 A;  4I76 A;  2V57 A;  4NN1 A;  2UXI A;  5EZH A;  1QVT A;  3LJL A;  4GCL A;  2REK A;  2OI8 A;  3Q3S A;  2W53 A;  3DCF A;  3GZI A;  2IU5 A;  3BHQ A;  4D5F A;  3BTI A;  3MNL A;  2DG8 A;  2XRL A;  2GBY A;  3EUP A;  2FJ1 A;  2NP5 A;  3TP3 A;  1JT0 A;  3O60 A;  2TCT A;  4M3E A;  3C07 A;  3HGG A;  3HTI A;  2X9D A;  5EZG A;  3NRG A;  3JSJ A;  4UDS A;  4JKZ A;  3IH2 A;  2G7S A;  4AC6 A;  3P9T A;  4M3G A;  2Q24 A;  2FBQ A;  4NEL A;  5CXI A;  1ZKG A;  2IEK A;  1RPW A;  3G7R A;  2F07 A;  5K58 A;  3QKX A;  2Y31 A;  5EFY A;  2UXU A;  3BTJ A;  4AC0 A;  5AQC A;  3NI7 A;  3CJD A;  2NS7 A;  3SFI A;  4HKU A;  2ZOZ A;  2XGD A;  1JUP A;  3VW1 A;  3F1B A;  2ID6 A;  4B3A A;  2O7T A;  5K7H A;  3COL A;  2ID3 A;  3MVP A;  1JTX A;  3RD3 A;  2IBD A;  1JTY A;  5HBU A;  3EGQ A;  4JL3 A;  2VKV A;  4MXM A;  2JJ7 A;  2FX0 A;  1Z77 A;  3BR0 A;  3HE0 A;  5D1R A;  5J1R A;  2QWT A;  5K7Z A;  4V2G A;  3ZQH A;  3E7Q A;  3B6A A;  2XGC A;  5IOZ A;  4D7M A;  5CXG A;  1BJZ A;  5F1J A;  2G3B A;  2WGB A;  3ANG A;  1T56 A;  3HGY A;  2ZOY A;  4G12 A;  2OER A;  4V2F A;  3BCG A;  2ZCN A;  3BTC A;  3CCY A;  5FHP A;  3QPL A;  5FKK A;  5FMP A;  2HXI A;  2JK3 A;  3Q0V A;  5FKM A;  4M3B A;  3ON4 A;  3BNI A;  3Q0W A;  3IUV A;  4MO7 A;  2QCO A;  5HAW A;  2GFN A;  4DW6 A;  2VKE A;  4L62 A;  2IAI A;  5HSZ A;  4W97 A;  5F0C A;  3KKC A;  5CW8 A;  5FGL A;  2OPT A;  3HTH A;  3S5R A;  3VVZ A;  5IPA A;  5IOY A;  4CGR A;  3HTA A;  1Z0X A;  1RKT A;  4W1U A;  5F27 A;  3ZQF A;  2YVH A;  3FRQ A;  3VVX A;  5FKL A;  3VOX A;  2OF7 A;  5J3L A;  2QKO A;  4JNN A;  4GCK A;  3GEU A;  5DAJ A;  3BT9 A;  2ZB9 A;  1UI5 A;  4B1R A;  2NS8 A;  3VP5 A;  1JT6 A;  5GP9 A;  2ZCM A;  3FIW A;  3LWJ A;  4D5C A;  2RAS A;  1UI6 A;  1U9N A;  3ZQL A;  1JUM A;  3DPJ A;  1T33 A;  5K7F A;  4GCT A;  3FK7 A;  3PPB A;  5F08 A;  3KZ9 A;  4AUX A;  1QVU A;  3VW0 A;  3LHQ A;  5C4Y A;  3G1M A;  2FQ4 A;  3BRU A;  3ZQG A;  3G56 A;  1U9O A;  3BR1 A;  3IH3 A;  4X1E A;  2O7O A;  3CWR A;  1ZK8 A;  5J1U A;  3LOC A;  2PBX A;  2XPV A;  3V78 A;  2DG7 A;  2XGE A;  3AQT A;  2HYT A;  2Y2Z A;  2WV1 A;  3LSR A;  3PAS A;  2RHA A;  2DTZ A;  3WHB A;  2XPU A;  2XB5 A;  5J1Y A;  3VUQ A;  2G7G A;  5GPC A;  2GEN A;  2EH3 A;  4ME9 A;  3SDG A;  3V6G A;  3FK6 A;  5D19 A;  3RH2 A;  3DEW A;  3TP0 A;  2ZCX A;  2HXO A;  5EYR A;  2I10 A;  5GPA A;  2YVE A;  4AF5 A;  2D6Y A; 
#chains in the Genus database with same CATH topology
 3IH4 A;  3VW2 A;  3KNW A;  2R7O A;  2G0E A;  2UXO A;  4GFL A;  3AQS A;  5IP6 A;  3B81 A;  4WIB A;  3CRJ A;  3NNR A;  2FD5 A;  3BTL A;  5F04 A;  3HTJ A;  3ANP A;  3BJB A;  3BR3 A;  2R7V A;  2RAE A;  4ACI A;  2NP3 A;  3NPI A;  3Q0U A;  3ZQI A;  1ORK A;  3WHC A;  3BR5 A;  3CDL A;  3QBM A;  3VVY A;  1RKW A;  3T6N A;  3BR2 A;  2HKU A;  3QQA A;  4MK6 A;  4D7N A;  1A6I A;  3F0C A;  3LSJ A;  3O8H A;  2X6O A;  4KWA A;  3HIM A;  2QOP A;  3PM1 A;  2QIB A;  3B6C A;  3BQY A;  4M3F A;  5H9T A;  4I6Z A;  4ICH A;  2UXP A;  1VI0 A;  3KKD A;  4M3D A;  2UXH A;  2B3W A;  5F0H A;  3O8G A;  5F0F A;  2HQ5 A;  2FJI 1;  2G7L A;  4XK4 A;  3VOK A;  3BQZ A;  3G1O A;  2B1E A;  2QTQ A;  4GFK A;  4PXI A;  2XPW A;  2VPR A;  5FKN A;  2WUI A;  4JYK A;  2TRT A;  2XDN A;  5FKO A;  4ABZ A;  1SGM A;  3VPR A;  2NX4 A;  3VIB A;  3QPS A;  1QPI A;  2R7X A;  3LSP A;  1JUS A;  2HYJ A;  3BR6 A;  2Y30 A;  3NXC A;  4U9L A;  3C2B A;  4YZE A;  5D18 A;  2GUH A;  3G1L A;  2PZ9 A;  3ON2 A;  4I76 A;  2V57 A;  4NN1 A;  2UXI A;  5EZH A;  2R7T A;  1QVT A;  3LJL A;  4GCL A;  2R7S A;  2REK A;  2OI8 A;  3Q3S A;  2W53 A;  3DCF A;  3GZI A;  2IU5 A;  3BHQ A;  4D5F A;  3BTI A;  3MNL A;  2DG8 A;  2XRL A;  2GBY A;  3DU5 A;  3EUP A;  2FJ1 A;  2NP5 A;  4IRV A;  3TP3 A;  1JT0 A;  3O60 A;  2TCT A;  4M3E A;  3C07 A;  3HGG A;  3HTI A;  2X9D A;  5EZG A;  3NRG A;  3JSJ A;  4UDS A;  4JKZ A;  3IH2 A;  2G7S A;  4AC6 A;  3P9T A;  4M3G A;  2Q24 A;  4C2M A;  2FBQ A;  4NEL A;  5CXI A;  1ZKG A;  2A2F X;  2IEK A;  1RPW A;  3G7R A;  2F07 A;  2R7U A;  5K58 A;  3QKX A;  2Y31 A;  5EFY A;  2UXU A;  3BTJ A;  4AC0 A;  5AQC A;  3NI7 A;  3CJD A;  2NS7 A;  3SFI A;  4HKU A;  2ZOZ A;  2XGD A;  1JUP A;  3VW1 A;  3F1B A;  2ID6 A;  4B3A A;  2O7T A;  5K7H A;  3COL A;  2ID3 A;  3MVP A;  1JTX A;  3RD3 A;  2IBD A;  1JTY A;  5HBU A;  3EGQ A;  4JL3 A;  2VKV A;  4MXM A;  2JJ7 A;  2FX0 A;  1Z77 A;  3BR0 A;  3HE0 A;  5D1R A;  5J1R A;  2QWT A;  5K7Z A;  2R7W A;  3DU6 A;  4V2G A;  3ZQH A;  3E7Q A;  3B6A A;  2XGC A;  5IOZ A;  5CQG A;  4D7M A;  5CXG A;  1BJZ A;  5F1J A;  2G3B A;  2WGB A;  3K8P C;  4U9N A;  3ANG A;  3KYL A;  1T56 A;  3HGY A;  4OD5 A;  2ZOY A;  4G12 A;  2OER A;  4V2F A;  3BCG A;  2ZCN A;  3BTC A;  3CCY A;  5FHP A;  3QPL A;  5FKK A;  5FMP A;  2HXI A;  2JK3 A;  3Q0V A;  5FKM A;  4M3B A;  3ON4 A;  3BNI A;  3Q0W A;  3IUV A;  4MO7 A;  2QCO A;  5HAW A;  2GFN A;  4DW6 A;  2VKE A;  4L62 A;  2ZY9 A;  2IAI A;  5HSZ A;  4W97 A;  5F0C A;  3KKC A;  5CW8 A;  5FGL A;  2OPT A;  4DVY P;  3HTH A;  3S5R A;  3VVZ A;  5IPA A;  5IOY A;  4CGR A;  2PFV A;  3HTA A;  1Z0X A;  4OD4 A;  1RKT A;  4W1U A;  5F27 A;  3ZQF A;  2YVX A;  2YVH A;  3FRQ A;  3VVX A;  5FKL A;  3VOX A;  3FHN A;  2OF7 A;  5J3L A;  2QKO A;  3NS4 A;  4JNN A;  4GCK A;  3GEU A;  5DAJ A;  3BT9 A;  2ZB9 A;  1UI5 A;  4B1R A;  2NS8 A;  3VP5 A;  1JT6 A;  5GP9 A;  2ZCM A;  3FIW A;  3LWJ A;  4D5C A;  2RAS A;  1UI6 A;  1U9N A;  3ZQL A;  1JUM A;  3DPJ A;  1T33 A;  5K7F A;  4GCT A;  3FK7 A;  3PPB A;  2R7Q A;  5F08 A;  3KZ9 A;  4AUX A;  1QVU A;  3VW0 A;  3LHQ A;  5C4Y A;  2R7R A;  3G1M A;  2FQ4 A;  3BRU A;  3ZQG A;  3G56 A;  1U9O A;  3BR1 A;  3IH3 A;  4X1E A;  2O7O A;  3CWR A;  1ZK8 A;  5J1U A;  3LOC A;  2PBX A;  2XPV A;  3V78 A;  2DG7 A;  2XGE A;  3AQT A;  2HYT A;  2Y2Z A;  2WV1 A;  3LSR A;  3PAS A;  2RHA A;  3SWH A;  2DTZ A;  3VTI A;  3WHB A;  2XPU A;  2XB5 A;  5J1Y A;  3VUQ A;  2G7G A;  5GPC A;  2GEN A;  2EH3 A;  4ME9 A;  3SDG A;  3V6G A;  3FK6 A;  5D19 A;  3RH2 A;  3DEW A;  3TP0 A;  2ZCX A;  2HXO A;  5EYR A;  2I10 A;  5GPA A;  2YVE A;  4AF5 A;  2D6Y A; 
#chains in the Genus database with same CATH homology
 3IH4 A;  3VW2 A;  3KNW A;  2G0E A;  2UXO A;  4GFL A;  3AQS A;  5IP6 A;  3B81 A;  3CRJ A;  3NNR A;  2FD5 A;  3BTL A;  5F04 A;  3HTJ A;  3ANP A;  3BJB A;  3BR3 A;  2RAE A;  4ACI A;  2NP3 A;  3NPI A;  3Q0U A;  3ZQI A;  1ORK A;  3WHC A;  3BR5 A;  3CDL A;  3QBM A;  3VVY A;  1RKW A;  3T6N A;  3BR2 A;  2HKU A;  3QQA A;  4MK6 A;  4D7N A;  1A6I A;  3F0C A;  3LSJ A;  3O8H A;  2X6O A;  4KWA A;  3HIM A;  2QOP A;  3PM1 A;  2QIB A;  3B6C A;  3BQY A;  4M3F A;  5H9T A;  4I6Z A;  4ICH A;  2UXP A;  1VI0 A;  3KKD A;  4M3D A;  2UXH A;  5F0H A;  3O8G A;  5F0F A;  2HQ5 A;  2G7L A;  4XK4 A;  3VOK A;  3BQZ A;  3G1O A;  2QTQ A;  4GFK A;  4PXI A;  2XPW A;  2VPR A;  5FKN A;  2WUI A;  4JYK A;  2TRT A;  2XDN A;  5FKO A;  4ABZ A;  1SGM A;  3VPR A;  2NX4 A;  3VIB A;  3QPS A;  1QPI A;  3LSP A;  1JUS A;  2HYJ A;  3BR6 A;  2Y30 A;  3NXC A;  3C2B A;  4YZE A;  5D18 A;  2GUH A;  3G1L A;  2PZ9 A;  3ON2 A;  4I76 A;  2V57 A;  4NN1 A;  2UXI A;  5EZH A;  1QVT A;  3LJL A;  4GCL A;  2REK A;  2OI8 A;  3Q3S A;  2W53 A;  3DCF A;  3GZI A;  2IU5 A;  3BHQ A;  4D5F A;  3BTI A;  3MNL A;  2DG8 A;  2XRL A;  2GBY A;  3EUP A;  2FJ1 A;  2NP5 A;  3TP3 A;  1JT0 A;  3O60 A;  2TCT A;  4M3E A;  3C07 A;  3HGG A;  3HTI A;  2X9D A;  5EZG A;  3NRG A;  3JSJ A;  4UDS A;  4JKZ A;  3IH2 A;  2G7S A;  4AC6 A;  3P9T A;  4M3G A;  2Q24 A;  2FBQ A;  4NEL A;  5CXI A;  1ZKG A;  2IEK A;  1RPW A;  3G7R A;  2F07 A;  5K58 A;  3QKX A;  2Y31 A;  5EFY A;  2UXU A;  3BTJ A;  4AC0 A;  5AQC A;  3NI7 A;  3CJD A;  2NS7 A;  3SFI A;  4HKU A;  2ZOZ A;  2XGD A;  1JUP A;  3VW1 A;  3F1B A;  2ID6 A;  4B3A A;  2O7T A;  5K7H A;  3COL A;  2ID3 A;  3MVP A;  1JTX A;  3RD3 A;  2IBD A;  1JTY A;  5HBU A;  3EGQ A;  4JL3 A;  2VKV A;  4MXM A;  2JJ7 A;  2FX0 A;  1Z77 A;  3BR0 A;  3HE0 A;  5D1R A;  5J1R A;  2QWT A;  5K7Z A;  4V2G A;  3ZQH A;  3E7Q A;  3B6A A;  2XGC A;  5IOZ A;  4D7M A;  5CXG A;  1BJZ A;  5F1J A;  2G3B A;  2WGB A;  3ANG A;  1T56 A;  3HGY A;  2ZOY A;  4G12 A;  2OER A;  4V2F A;  3BCG A;  2ZCN A;  3BTC A;  3CCY A;  5FHP A;  3QPL A;  5FKK A;  5FMP A;  2HXI A;  2JK3 A;  3Q0V A;  5FKM A;  4M3B A;  3ON4 A;  3BNI A;  3Q0W A;  3IUV A;  4MO7 A;  2QCO A;  5HAW A;  2GFN A;  4DW6 A;  2VKE A;  4L62 A;  2IAI A;  5HSZ A;  4W97 A;  5F0C A;  3KKC A;  5CW8 A;  5FGL A;  2OPT A;  3HTH A;  3S5R A;  3VVZ A;  5IPA A;  5IOY A;  4CGR A;  3HTA A;  1Z0X A;  1RKT A;  4W1U A;  5F27 A;  3ZQF A;  2YVH A;  3FRQ A;  3VVX A;  5FKL A;  3VOX A;  2OF7 A;  5J3L A;  2QKO A;  4JNN A;  4GCK A;  3GEU A;  5DAJ A;  3BT9 A;  2ZB9 A;  1UI5 A;  4B1R A;  2NS8 A;  3VP5 A;  1JT6 A;  5GP9 A;  2ZCM A;  3FIW A;  3LWJ A;  4D5C A;  2RAS A;  1UI6 A;  1U9N A;  3ZQL A;  1JUM A;  3DPJ A;  1T33 A;  5K7F A;  4GCT A;  3FK7 A;  3PPB A;  5F08 A;  3KZ9 A;  4AUX A;  1QVU A;  3VW0 A;  3LHQ A;  5C4Y A;  3G1M A;  2FQ4 A;  3BRU A;  3ZQG A;  3G56 A;  1U9O A;  3BR1 A;  3IH3 A;  4X1E A;  2O7O A;  3CWR A;  1ZK8 A;  5J1U A;  3LOC A;  2PBX A;  2XPV A;  3V78 A;  2DG7 A;  2XGE A;  3AQT A;  2HYT A;  2Y2Z A;  2WV1 A;  3LSR A;  3PAS A;  2RHA A;  2DTZ A;  3WHB A;  2XPU A;  2XB5 A;  5J1Y A;  3VUQ A;  2G7G A;  5GPC A;  2GEN A;  2EH3 A;  4ME9 A;  3SDG A;  3V6G A;  3FK6 A;  5D19 A;  3RH2 A;  3DEW A;  3TP0 A;  2ZCX A;  2HXO A;  5EYR A;  2I10 A;  5GPA A;  2YVE A;  4AF5 A;  2D6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...