2QWWA

Crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
148
structure length
146
Chain Sequence
NTDTENISELLKTYWSIQRISAGYADQNAASLGLTIQQLAMINVIYSTPGISVADLTKRLIITGSSAAANVDGLISLGLVVKLNKPNDSMDLTLKLSKKGEDLSKRSTANAFMYKAMMKVFENLTENEIEELIRLNKKVETLLKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of multiple antibiotic-resistance repressor (MarR) (YP_013417.1) from Listeria monocytogenes 4b F2365 at 2.07 A resolution
rcsb
source organism Listeria monocytogenes str. 4b
molecule tags Transcription
molecule keywords Transcriptional regulator, MarR family
total genus 54
structure length 146
sequence length 148
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qwwA00
2XAFA 4MGRA 5JFRA 4MHGA 2EFWA 1XSDA 5HOOA 1DPRA 2RKHA 2O6GE 3VB2A 1BIBA 1AOYA 1S8NA 5ILSA 5JHUA 4G7ZF 1SD6A 3GYHX 1IN4A 5HS8A 3ZPLA 2D1HA 2XAGA 4LGWA 5L3DA 1TW2A 3ZN0A 1U5TB 3FM5A 4IHTA 1V3FA 4Q47A 1G3YA 1YYVA 3GFJA 4GCVA 5J8CA 1XB4A 4IPAA 5L3EA 2ZBKA 1U6GA 1IF1A 5HDGA 3V8KA 2YU3A 4NB5A 1PDNC 1KU9A 4WK8F 3HSEA 5DEQA 4HDVA 2XROA 4IXAA 5D5UB 2CYYA 4QLCU 4HW0A 3EDPA 2FXAA 5D6FA 3TO7A 2P5VA 5F1RA 1R00A 3NRVA 4EM2A 4ESJA 1T0FA 2CGPA 2RN7A 1IXCA 2BE5F 3MZYA 4CDGA 2KJCA 2OD5A 2PLYA 1B59A 2F5FA 2E7XA 5L3BA 3WTZA 2EB7A 2MD5A 2STWA 1KYZA 3RI4A 4GYIA 3QRFF 2IA0A 5K1YA 1U78A 4E70A 3F8CA 3RKYA 1MJBA 3N97A 1D5VA 1WWXA 2HZTA 3WTSC 1F4KA 1Z6TA 3O2PE 3SQNA 1TNSA 5BPDA 4A5MA 2VBXA 5E18F 1FZPB 1QZZA 2K4JA 2V9VA 4WCGA 1T6SA 1ZARA 4RAZA 5IT9Z 2QZ8A 1L0OC 4G6QA 2Z33A 1SMYF 2HR3A 3L00A 4CO8A 3IC7A 3U2RA 4UHTA 5HS9A 2DT5A 1XCBA 3GO5A 2GWRA 3E6DA 4XBFA 2JPBA 2XRNA 1HKQA 1U5TA 1WKMA 5LGUA 2L54A 2L4AA 3WG9A 1D8KA 2ZKZA 1PUEE 5DD8A 5BOXA 5HS7A 2XKPA 5ILVA 3I59B 2GIVA 1ONVA 3B73A 2XAQA 3ELKA 3DEUA 3WGGA 1USSA 2Z5UA 3VFZA 1WI9A 4RGSA 1YIOA 2W85A 2MH2A 4LJZF 4U0WA 1MDMA 5CVUA 4EJOA 4LG0A 2A6HF 3GEZA 3F21A 1MJ9A 1ZRCA 1RZ4A 1K79A 2AS5F 3WGIA 1S29A 3MFKA 2FRHA 1TNTA 4ON0A 1LDJA 4BAYA 3I71A 4B09A 3EETA 4KNYA 2JTVA 1ULYA 1FY7A 4R1HA 2VT3A 1ZLKA 3IRQA 3DF8A 1MZBA 2EFNA 2F5DA 3EYYA 5HDNA 1Q1HA 3FXRA 2GXGA 3SZTA 3FXQA 1BBYA 1MJAA 1FYKA 4I7HA 4IVNA 4BNCA 3M7GA 2QYOA 2XV4S 3I64A 3H3ZA 2ETHA 3RIRA 4L9VA 1J75A 4Y15A 5TJJA 3I0TA 1X3UA 2BGCA 1LDDA 1FSEA 1GHCA 2PG4A 3ROUA 2A3SA 3E5UA 4KIGA 3P7NA 1H9TA 4Q48A 2NNYA 5FFZA 1YW7A 3KLNA 5E1ZB 1FX7A 2Y48A 5D4RA 3KZZA 3KZYA 1FP1D 4HX8A 1KU3A 3H3UA 2Y0MA 1YFHA 2ADUA 3V7RA 4EV0A 1KQ0A 3KEOA 4D0PA 3CJNA 3F23A 4P5OA 2HKOA 3CLOA 2GXBA 5ICCA 2F5EA 3WTXC 1UB9A 5K5QA 5LGTA 3GFMA 2LNBA 1J59A 3O6BB 1XDSA 1FYMA 4IRHA 3BOQA 3BZ6A 3I54A 2FEZA 2CSOA 2O61A 5ILUA 4UVAA 2NS0A 3KLOA 4M74A 3JAMZ 2L4MA 4FHTA 3REOA 4I0BA 4Q4ZF 1EH8A 3GVAA 3C1DA 4LK0F 3ZMZA 3HIFA 5JVTA 2BV6A 2IJLA 1XN7A 4AWXB 2G9WA 3LQRA 1K7AA 4KA4A 5ED4A 5AONA 1FBUA 4ETSA 2DU9A 4R79A 1USTA 4HOBA 2GAUA 2IPQX 2MBFA 2L01A 4ENJA 3T8RA 1IXSB 4IJAA 4ESBA 1ZG3A 1QBJA 5F64A 1JE8A 3J81K 3HRSA 5K5RA 2BYVE 2R7DA 2KKOA 5ICGA 1IZ1A 5KVRA 1V4RA 1QPMA 1JHHA 2O3FA 1S7AA 4KFCA 3WODF 1HQCA 1U3EM 1Z1DA 4L0ZB 4IHSA 1O3QA 1O57A 3M1EA 3DQVC 3VOEA 6PAXA 3PQKA 4RGUA 1YS6A 3BJ6A 1S3JA 1ZG1A 2Z3YA 3TOBA 4HBLA 4R8HA 4HYEA 3D5LA 2VC0A 2OZUA 2GA2A 1Y0UA 2ISZA 5A2QK 4I2OA 4EMSA 2FSWA 2FBIA 2O03A 5HLGA 1DUXC 1J0RA 1W7PA 3E5XA 2XAJA 3QAHA 4MTEA 1YS7A 2BEOA 1KGSA 3J7AO 2C6YA 1I6XA 3F8FA 5H20A 1XGOA 3V7CA 3TDUC 4LLNA 1R7JA 1ODDA 2YR2A 2AXLA 3HHHA 2ZXJA 3B02A 1ZLJA 4KN7X 5LRSA 2WTEA 1SFEA 1TW3A 1JGSA 1TQMA 2EWNA 3GW2A 3WU0A 2LF7A 1FNNA 2DLLA 2EK5A 3LQQA 5DV5A 3QPHA 4IRIA 3GLXA 2CW0F 2FMYA 4OIPF 4EVIA 1XCVA 4XRFA 4FT8A 3R61A 1F9NA 4AVPA 4HX7A 4MTDA 4HF0A 2HFHA 2PEXA 3LA7A 3N4MA 2YPRA 2P6SA 5LHIA 5E1XA 4UV9A 2VODA 3T0YA 2G7HA 4Q5SF 3GWZA 1PP8F 1H0MA 1XD7A 2ZNYA 1HW5A 1ZREA 2HKXA 3KFWX 2L02A 4MEYF 5E8GA 2IVMA 3GF2A 1XMAA 3Q9VA 4B8XA 3COAC 4HQMA 3C18A 2PN6A 3W6KB 3I53A 3WE3A 1Z6RA 1W5TA 1H9GA 3HHGA 1IN7A 3NEUA 3TGNA 1TTYA 4M9SA 2Z9OA 4DQ2A 5LLQA 2ZFWA 5BMZA 1EH7A 2VOOA 1XDUA 1BOAA 1STZA 4XSZF 3CO6C 2FMLA 4EJWA 1EH6A 2DI3A 2XUBA 3RPUA 4WF2A 4XLNF 4I09A 3E6CC 2L3DA 4HDUA 1VTNC 4GYGA 4RGXA 1U2WA 1UFMA 5FFXA 2YSRA 1IRGA 3LAPA 1MKMA 1OKRA 2BBYA 2HGCA 5CVIA 1Z9CA 2EA2A 4RB2C 4WX9A 4WXHA 5D6EA 2K02A 4U0YA 3LA3A 3NQOA 1Z05A 1FSHA 1K78B 2A69F 3ISPA 2Q8KA 1T39A 3K2ZA 1B9NA 1BJAA 4YFXF 2RDPA 5E1WA 3J80K 2PMUA 4EJUA 3F8NA 3LFKA 3JSOA 3CUOA 4OINF 3I59A 3SXYA 2FE3A 2VXZA 1R1UA 2FF4A 3QOPA 3ECHA 3QU6A 1W5SA 1B1BA 2RVCA 1HSTA 5K5OA 5JR3A 2MLKA 3GZ5A 2XAHA 3I4PA 3KETA 1O7FA 2J5PA 3HTUA 4F7ZA 2H6CA 3R60A 2Y75A 3KP6A 5EEHA 1WRJA 3GFIA 2IW5A 3KP3A 1K6OA 4G9YA 1FBQA 4PDKA 4A0YA 4ZYGA 2FNPA 3L7WA 3F3XA 2K27A 3WTYC 4G7HF 3KP7A 2P7VB 3G73A 3K9TA 4HF2A 3Q9SA 5F6FA 4CYDA 1D3YA 4JBAA 2UWMA 1G6NA 1DP7P 2PJPA 1XGMA 1ZGAA 1XMKA 2R7FA 2OZ6A 1R23A 4UVBA 3KP5A 5L3GA 1OYIA 3JW4A 1MGTA 2OQGA 4HLXA 3BJOA 3TOAA 4OIRF 2M45A 2H09A 4A12A 2IP2A 3GXOA 2ZMEA 2ACJA 1QO0D 4CZZA 3ERED 4S05A 2M5WA 4WXDA 2JRTA 5JI6A 4RS8A 1R58A 1RIOH 1D8JA 4L9JA 5FLXK 4EGZA 4HF1A 3V4GA 3TO6A 4A0ZA 1T2KA 5DDGA 5DUIA 2HTJA 2HQRA 5HLHA 1XGNA 1SD7A 4WXCA 1I1SA 2XVCA 2FBKA 2VONA 5CLSA 2UZKA 1IXRC 1S6LA 3CUQB 1J7KA 2ZNZA 3HUGA 5D4SA 1I27A 5KK1A 2WWYA 1HSJA 3RDIA 5H6RA 5DUKA 1S7OA 4HAMA 3HRTA 5CYVA 1ZYRF 3FMRA 2D2WA 3SZPA 2DBBA 5FB2A 3U1DA 1G3TA 4Z2YA 2KIUA 3R6SA 3JAMK 4OOIA 2W57A 2Q2EA 1BM9A 2E1NA 4PZJA 2P5KA 3SFZA 4N9HA 2COMA 2UXXA 5D5XB 3MCZA 2DPUA 2P5LC 3V7SA 1PP7U 1O3TA 1QGPA 3R0JA 2Z99A 3FMSA 2EV5A 4L0YB 3ZMDA 1BI3A 4ZYDA 5AIQA 1XSXA 3AAFA 1TQPA 2GZWA 5CVVA 4ENKA 2H27A 4LG0B 3QPTA 4EJTA 2IA1A 3FM3A 3T1BA 3CO7C 2VOPA 1DPUA 3VODA 2ZMEB 3ZMSA 4HV5A 4A5NA 1HXDA 2RGVA 3EQLF 1KQ9A 1SFUA 3IL2A 1OPCA 4UNOA 3P9CA 4NQWA 3RPQA 2M8EA 3CUQC 2FU4A 4GO1A 4YG2F 1BC7C 1YG2A 2QQ9A 3H92A 2FA5A 1DDNA 2PQ8A 2A5YB 5LHGA 2YX4A 3ZMTA 4OU0A 2H94A 3OOPA 3RYRA 4BQAA 2EV6A 2HTSA 2MLGA 4U7BA 5HVQC 1HW1A 2IT0A 4KIBA 4U0VA 5E8IA 4PGGA 2HYGD 1EV7A 2FBHA 3IHUA 1RNLA 2OBPA 4HLYA 2HQNA 1E2XA 4BH9A 1F5TA 3RKWA 3TKYA 1RUOA 2W84A 2CQKA 3KEQA 4LB5A 1IUYA 2QBYB 4BHCA 2V1XA 5CJ9A 1O3RA 3MWMA 1QQIA 1G4DA 3LA2A 1FWZA 5EEGA 3HYIA 4GGGA 1SAXA 4S04A 1P4XA 2OAZA 1R5HA 1SD5A 3BROA 1J2XA 2B0LA 2WC2A 2KJBA 1ZAOA 1HKTA 3VEPA 4Y17A 4MEXF 2VN2A 2ESNA 4HQEA 4P9FA 4G7OF 4K2EA 2DQLA 1JHFA 5BQTA 4U7DA 2QM3A 1KYWA 2V79A 4RB1A 3DP7A 4KMUX 3E6MA 1LEAA 3LSTA 4L18B 2CFXA 4Y13A 1P4WA 1TBXA 4HX4A 4I02A 2JSCA 1GXQA 5FO5A 4OIQF 1TLHB 3QP6A 3FXUA 3TQNA 1CF7A 2V6CA 2XKOA 2EV0A 3R4KA 4AIKA 3WTTC 1U8RA 4DNCA 4LFUA 4A6EA 2ZCWA 4G8XA 2CWEA 3GFLA 3PFIA 4M72A 4OMYA 3IKTA 4BHBA 5HLIA 2IA2A 1FOKA 2QVOA 2XHKA 2DO7A 3WTWC 2HOEA 3F72A 4HZFA 2K7LA 1Z91A 2FQ3A 1F1ZA 2QENA 4IRGA 1IW7F 3HTSB 4AD9A 2QLZA 3WGHA 1MD0A 3DFGA 2LKPA 4LD5A 3FZVA 1BI0A 2P4WA 4CICA 4L9NA 1UCRA 3HRMA 3TO9A 2JZYA 2P7CB 3BPXA 3L09A 3ZP5A 5DCFA 1I5ZA 4L5JA 4I0AA 2VE8A 3KE2A 3M9AA 2JT1A 4AIJA 4ASNA 4PGHA 4BHPA 3HSFA 1R5GA 2DPDA 2DK8A 4O5VA 4ESFA 1ZRDA 1W7PB 2XIGA 2PMHA 2TDXA 2VBWA 2PI0A 3P9IA 2P8TA 5LEJA 2VE9A 1U5TC 5D8KB 1SMTA 3G3ZA 3IWFA 5CVJA 3S2WA 1YTYA 3K0LA 5LBQA 3GUDA 4BXUA 3WTVC 5DYMA 1XSVA 1ON1A 2JPCA 2CO5A 2O0YA 3DPLC 5J6XA 3MAJA 4L5IA 3KCCA 4U88A 1UHWA 2NYXA 3C7JA 3C3WA 4EGYA 3K1NA 4LMYA 2HEOA 3J81Z 3I5UA 5D5VB 3D0SA 3M8FA 1LQ1A 5J8FA 3WU1B 3ZQ7A 3KP2A 3OV8A 4CHUA 3DPTA 1ON2A 5LEKA 2IRFG 3T8TA 2A6EF 2CG4A 3ABTA 2HYFA 4EM0B 2EFQA 4A0XA 3I58A 3RJPA 3CDHA 4LLLA 3ECOA 2X0LA 1G3WA 1P4AA 2R3SA 4GXOA 1QNTA 1YW9A 4KICA 2HS5A 2DQRA 3RKXA 4BYYA 5FLXZ 4FX4A 1Z7UA 2W25A 3ULQB 1IN8A 3SHFA 4IF4A 2WV0A 4EJVA 3FX3A 5E17F 1LEBA 3JSPA 1HKSA 4M9XA 1GVJA 4M71A 1R1VA 1L3LA 3R0AA 3U9GA 5DCMB 3KP4A 4RB3C 1P6RA 2D45A 3DXJF 3BPVA 3F6OA 2NNNA 4MNUA 4HA8A 1YW8A 1LNWA 4ZYEA 2KIMA 3MZHA 1ZHFA 2FOKA 1YO5C 4ZYHA 4ZH4F 2MC3A 4ZZDA 2FNAA 4KT5C 4PCQA 3BJAA 2VC1A 4A2UA 2RNJA 3PQJA 3L2CA 4KIFA 1ZN2A 1B4AA 5H6QA 5IT9K 3RTRA 2M30A 2J5OA 5LHHA 1NHAA 5BPIA 4M6YA 1HW2A 2UXNA 3V8JA 3LAJA 1BC8C 2OA4A 1R36A 4EQQA 1K78A 2DAOA 3K69A 3HOSA 2HDCA 1SFXA 2RV8A 4KMFA 2MA3A 1T38A 4JK1X 2EFPA 2X4HA 1HBXG 5A2QZ 1O7LA 1RI7A 1W7PD 3MQ0A 1OMIA 1TQIA 4YIFA 3IRRA 4KN4X 2XASA 2YX7A 1BN5A 3E5QA 4RGRA 4M73A 4ENNA 3F8BA 1CGPA 1YQAA 2ISYA 3P9KA 2PFBA 3W6JB 2OU2A 1FLIA 1RUNA 2QQAA 3BP8A 2NAZA 2F5CA 2PBIA 4I01A 5TRDA 4I98B 4O6JA 5LGNA 3FMQA 3HSRA 4P9UA 4N0BA 3LWFA 1FBSA 1B6AA 1QZYA 3HRUA 4QWQA 1FC3A 1YLFA 4KDPA 1ZGJA 4YFNF 3F8MA 1KA8A 1OYWA 2OQRA 5FGMA 5L3FA 2EJRA 2M87A 4G94A 2V1DA 5LRRA 2MH9A 3IWZA 4YIIA 4M9ZA 5DCMA 2VT2A 4O3MA 5D5WB 4L9TA 1B9MA 1OYYA 4MQVA 5BS6A 2F2EA 3QU3A 4UV8A 5DD4A 1I1GA 1ZH5A 3WE2A 1KU7A 3ZMUA 3QP5A 3RYPA 5CVRA 4WWCA 2QWWA 1GXPA 3EYIA 3F6VA 2P6TA 1IN5A 5FD6A 4ENMA 2A61A 3K1MA 3JTGA 1WSUA 3K1PA 3BDDA 1E17A 3CTAA 2GA1A 1LDKB 3DV8A 2DFIA 1A04A 3BWGA 1UHMA 1IRFA 1R22A 2KRFA 4XSXF 2A07F 4MQ9F 3JTHA 2V1UA 2RC4A 2A68F 3ZMVA 4LK1F 1BI1A 3CUQA 2QBYA 3FHZA 4P55A 4RB0A 3E97A 5FD5A 4RAYA 5ICFA 3HOTA 5ERIA 1LVAA 1J5YA 1ZRFA 3O3KA 4KYWA 1XGSA 2QUFA 1FT9A 4A6DA 3V8LA 3FWEA 2VBYA 1IAWA 2XGXA 2STTA 1WQ2A 2KIFA 1OR7A 3Q5FA 4OMZA 1KU2A 4TV7A 3GX4X 2ELHA 2LDUA 5HDKA 1BIAA 3GZ6A 1MDMB 2DW4A 4FX0A 1REPC 4CXFA 2LSOA 3F22A 2RQPA 2DK5A 1P92A 5AIPA 2H6BA 2K4BA 3IKVA 2NRAC 4LB6B 1LJ9A 3J80Z 4NHJA 2ZO4A 3BY6A 3FF5A 3M8EA 1C0WA 1P2FA 3DKWA 2QQBA 3ABUA 1T98A 5L3CA 1J9IA 5E20A 1FYLA 1FPQA 4UXNA 3ZN1A 4YFKF 4KUMA 4M6XA 3T5XA 1SD4A 2E7WA 1ZG5A 1R1TA 2K86A 2Q0OA 2D1VA 3L9FA 4ZZLA 1CF7B 4OIOF 4UUVA 1JXSA 4N9IA 4P96A 2E1CA 4LLGF 2DTRA 4CGZA 5IT3A 2EA4A 5ICEA 2W24A 4XLPF 4G6DA 3TDZC 2GQQA 3MEXA 3WTUC 1BI2A 1G3SA 1O3SA 4UVCA 2ZJ2A 2M1BA 1AWCA 1W4MA 4H0EA 1LB2A 5D8LB 2HWVA 4HV6A 3ML6A 3E6BA 1FP2A 2LF8A 4EM1A 3EUHA 2ESHA 1KQ8A 2G7UA 2O8XA 2EFOA 3E3VA 1IN6A 4JQFA 4AIHA 2VBZA
chains in the Genus database with same CATH superfamily
2XAFA 1LFBA 1Z3YA 4MGRA 4HNTA 5JFRA 3BZCA 4D7NA 4MHGA 3PUFA 2EFWA 2IS2A 4B48A 1XSDA 3OMYA 1UG0A 4HSTA 5HOOA 1NTCA 4XOPA 4M6VA 1DPRA 2RKHA 2LRDA 4UUTA 5IOYA 2O6GE 3VB2A 4XLEA 1BIBA 1AOYA 1S8NA 5ILSA 2V26A 5JHUA 5M5WJ 1DGWY 1SD6A 4G7ZF 3GYHX 1IN4A 1EF4A 2DMUA 1SEUA 5HS8A 4E7LA 1VNDA 5TISC 3ZPLA 2VL8A 3OYHA 2KZVA 1ZELA 2D1HA 2XAGA 4LGWA 3S17J 5L3DA 2IGKA 1HDDC 3M3YJ 1TW2A 1VQ8I 3ZN0A 1U5TB 3FM5A 4IHTA 2K9QA 2I8DA 2OCEA 3KIOA 2BW3B 1V3FA 4Q47A 3LSKA 1G3YA 1TWFJ 1YYVA 3GFJA 3P5JA 4GCVA 5H2FC 4MFEA 5J8CA 2ZJQF 5B1AH 2LKSA 1XB4A 3HC7A 4IPAA 5L3EA 4OAYA 4PK4A 4ZDOA 1JT6A 4E7JA 2ZBKA 5J3LA 2IGNA 1U6GA 1IF1A 2R5YB 2Y2ZA 1MMNA 5HDGA 1FMWA 4D5CA 2ZMEC 3V8KA 3OIPA 2YU3A 4NB5A 1ENHA 1PDNC 1HC8A 5C44J 1KU9A 1EA3A 4WK8F 2JJ7A 3HSEA 5DEQA 4HDVA 4YRVA 3BG7A 2XROA 3K4BA 4IXAA 2L7FP 2DMPA 2MG4A 5J47A 4A3JJ 2E36A 3CJTB 4A93J 3A4CA 4BBRJ 5D5UB 2CYYA 2KFDA 5FKNA 3BR1A 4BGDA 4C3IJ 4QLCU 4HW0A 1BR4A 2HDWA 2XPWA 3EDPA 4ANJA 2FXAA 4NBQA 5HLTA 5D6FA 1RR7A 3TO7A 2MFZA 2P5VA 5F1RA 1R00A 3NRVA 3KYLA 4EM2A 1DQUA 1Y56A 1K4SA 2PMZN 4ESJA 3IH4A 1T0FA 2BHYA 2CGPA 4KT6A 2RN7A 4J01A 4YIRX 3PO2J 2Z16A 4NC7A 3ZXSA 2HVSA 1IXCA 1UELB 2FX0A 2BE5F 3MZYA 4ZDPA 3VDXA 2I10A 3CF2A 3FXMA 4CDGA 2KJCA 2OD5A 2KP6A 1A36A 1U8BA 2PLYA 1XG1A 1B59A 1I50J 2F5FA 5JLXA 5J4VA 2OTJI 2WBMA 2E7XA 3CJQB 5M5XJ 3S16J 5L3BA 5J1UA 5IP6A 3WTZA 1XPXA 2EB7A 1QU3A 1V55H 2MD5A 2STWA 1KYZA 3RI4A 4GYIA 3S1QJ 4G6TB 4A3LJ 3QRFF 3M4OJ 2IA0A 5K1YA 1IV6A 3VWBA 2WY8Q 1U78A 1QVTA 4GFBA 4HNVA 2IS1A 4E70A 3F8CA 2JA7J 3RKYA 2GOXB 4II2A 1UAAA 2R7RA 4PFPA 1MJBA 3CCVI 4A69C 3N97A 1D5VA 1WWXA 5EYRA 2HZTA 4B3XA 5IOZA 1OJLA 3WTSC 1F4KA 1Z6TA 5FKOA 3O2PE 3SQNA 1XMXA 5DTDA 4C2UA 1TNSA 1ZR4A 5BPDA 2ECBA 4A5MA 2VBXA 5E18F 1JKPC 2CV2A 1FZPB 1QZZA 2K4JA 3CP2A 2CFOA 5EEAA 2V9VA 4WCGA 1T6SA 1ZARA 2L0KA 4RAZA 5IT9Z 3FKIJ 2FQ4A 1XC5A 2VPLA 2QZ8A 4DBRA 1L0OC 3C2GA 4G6QA 2Z33A 4A3EJ 1SMYF 2HR3A 3L00A 3A0HC 3DKXA 4CO8A 3IC7A 3LNQA 1E3HA 1OCRH 3OIQA 3U2RA 4ABZA 2FUG2 4UHTA 3LSJA 1ERDA 2EH3A 3BCBA 5HS9A 4JYKA 4XN3A 1VQLI 2DT5A 1K61A 1XCBA 3H9QA 1HLVA 2WB1A 3GO5A 2GWRA 3CCEI 3E6DA 4XBFA 1TWCJ 2JPBA 2XRNA 2M7AA 1HKQA 1OISA 3JRAA 1U5TA 1BOBA 4LIUA 2AO9A 4XK4A 5FKMA 2V7FA 1WKMA 5LGUA 3HOWJ 2HXOA 2L54A 2L4AA 3WG9A 1D8KA 2Q1ZB 2ID6A 2VASA 2ZKZA 4DGWB 1PUEE 2I5UA 2H1LA 4LITA 5DD8A 5BOXA 4YELA 5HS7A 4A3CJ 4PJLA 2XKPA 5IYDJ 3ONQA 5ILVA 3I59B 2GIVA 4X0GA 1ONVA 3B73A 3IAS2 1W0UA 2XAQA 3ELKA 3DEUA 3K4MA 2OC6A 4ZJZA 1X2MA 3WGGA 4CA0A 5IP7J 1TZLA 3OYLA 1FJLA 4XICA 3DCFA 1SFKA 1USSA 2Z5UA 3VFZA 4I76A 1WI9A 1D5YA 3L2QA 1N77A 4RGSA 1YIOA 2W85A 1GV2A 2DT6A 4Z6YA 3GLLA 4F91B 2MH2A 4LJZF 4U0WA 2NVTJ 1MDMA 2VQCA 3DBHB 5CVUA 1MBGA 5EG0B 1HA8A 3FXJA 4EJOA 3I4MJ 3DBLB 4LG0A 1PJRA 1VQOI 1OR7C 2IBDA 4D1QA 2A6HF 5F08A 1QVUA 3GEZA 1AU7A 1B8IB 3AG4H 3HKZN 3F21A 1MJ9A 3DPUA 1OCCH 2ID3A 4BEHA 2XF6A 5C4JJ 1RZ4A 1K79A 1ZRCA 2AS5F 3WGIA 1S29A 3MFKA 2FRHA 1MSFC 1TNTA 2JUCA 4ON0A 1D0YA 1LDJA 4BAYA 2XDVA 3I71A 4B09A 3O8GA 3DKYA 3EETA 3C2HA 4KNYA 2R7SA 2TRTA 3OYEA 1G59A 2JA6J 2PX9A 3PSFA 4IHVA 2JTVA 1ULYA 3SEQA 1FY7A 1LUJB 2JA8J 1WJDA 4R1HA 2VT3A 1Z7LA 3BG9A 3OSGA 2L5QA 5GTHC 2ELJA 3IAM2 1ZLKA 3S3OA 2IGMA 3IRQA 2BHZA 3DF8A 3PUBA 4NDLA 1MZBA 2EFNA 4BQOA 4ZTJA 2F5DA 3EYYA 1MBKA 4PJNA 4BUPA 3IV5A 3W6VA 5HDNA 3CZ6A 3OYCA 1Q1HA 3FXRA 1WI3A 2CUEA 3OYKA 5F04A 3GTJJ 2GXGA 2KRHA 1DU6A 4UB6C 2AQEA 3SZTA 3FXQA 4B1RA 1BBYA 3QPLA 1MJAA 2MSYA 4XORA 2LBFA 1FYKA 4I7HA 3PNVA 4IVNA 4BNCA 5E3NA 3M7GA 5F27A 2QYOA 2XV4S 3I64A 2LD5A 3H3ZA 2QSFX 2JVGA 2ETHA 2NS7A 2WAFA 3RIRA 4L9VA 1J75A 4JX4A 4BDZA 5IPAA 5F1JA 4Y15A 1R6RA 5TJJA 3I0TA 1JKQC 2DMTA 4I99C 1X3UA 2BGCA 1LDDA 1FSEA 1GHCA 2PG4A 3ROUA 4C3JJ 4N4OB 2A3SA 4XIDA 2LREA 3E5UA 4KIGA 3VYTB 2W7NA 3Q0UA 3P7NA 1H9TA 3TEDA 4Q48A 2N8GA 1IO2A 3L1PA 2NNYA 3PJRA 5FFZA 2CMPA 1YW7A 4M3FA 4RAFA 4XLFA 1OCPA 1WPKA 3KLNA 5E1ZB 1FX7A 2LFBA 2QF7A 2Y48A 5D4RA 3DLAA 3KZZA 1ZTRA 3Q0VA 5HNHA 1MBHA 3KZYA 2NOJB 1IDYA 1S72I 3PL8A 1FP1D 3W3CA 4BS9A 3CMAI 1RESA 1ITYA 3A02A 1GT0C 3ABMH 4HX8A 2WB1N 3CCYA 2DN0A 1KU3A 3H3UA 4PJJA 3ESWB 2Y0MA 1YFHA 2ADUA 4FISA 2V1NA 3H5RA 3V7RA 4EV0A 5FJ8J 2CQXA 3JRGA 1KQ0A 3L2VA 4BQQA 3KEOA 2H8WA 4BQNA 5FROA 5JVGF 4X6AJ 4D0PA 1Y0NA 1N78A 3CJNA 3KYCB 3PIOF 3F23A 3L2RA 2R7TA 4P5OA 2HKOA 3CLOA 2GXBA 1OLTA 5ICCA 2F5EA 3WTXC 1UB9A 5K5QA 5LGTA 4CCMA 4BL0B 3J7YJ 3GFMA 1B8IA 2LNBA 1J59A 3O6BB 1XDSA 4OWRB 1FYMA 2JSPA 4IRHA 2CW8A 1IRZA 2JMWA 3BOQA 3OR2C 1D1AA 3BZ6A 3I54A 5EZGA 2FEZA 5CKTA 1SVMA 2CSOA 2O61A 5ILUA 4A3BJ 4UVAA 1W36D 2NS0A 3HJEA 3KLOA 4C2MJ 1VZ0A 1ZQ3P 2R0QC 4M74A 3CESA 3E1SA 3JAMZ 1XTAA 2L4MA 4FHTA 4BJTA 4F55A 1IGNA 3CCSI 1PVEA 3REOA 4I0BA 3S3NA 1ETXA 2L7ZA 4Q4ZF 1EH8A 3K4KA 3GVAA 2DDBA 3C1DA 4LK0F 3CC7I 2M4KA 4BJ5C 1WGXA 3ERMA 4DJAA 2CQQA 1IRXA 3ZMZA 4BXFA 5K7FA 3H9JA 5HODA 3HIFA 5JVTA 4S0HB 2BV6A 2CU7A 2IJLA 1XN7A 3FKJA 4AWXB 5GAHJ 2G9WA 3LQRA 2ZJPF 4KA4A 1K7AA 5ED4A 5AONA 2CV1A 1FBUA 4KJZA 4QPQA 4ETSA 2DU9A 4G12A 2IS4A 4R79A 4W1UA 2IAIA 3LFUA 5EF6A 1USTA 4HOBA 2GAUA 3C2BA 3GCMA 4XQFA 2IPQX 2MBFA 3S2HJ 3SEZA 2L01A 3CCQI 4ENJA 9ANTA 3T8RA 2D5VA 1IXSB 1RRJA 4IJAA 4ESBA 2HVRA 1QPIA 1R49A 1ZG3A 5IYCJ 1QBJA 2LH9A 5F64A 1JE8A 3J81K 3RQIA 3HRSA 5K5RA 3F0CA 2BYVE 2R7DA 4CSWA 2KKOA 4XLCA 4XMYA 5ICGA 3S2DJ 3PM1A 1IZ1A 5KVRA 4F93B 1SFOJ 2VXDA 4E7ZA 1V4RA 4IL6C 4XKVA 1QPMA 1JHHA 2O3FA 1S7AA 3H36A 4KFCA 3WODF 4IO9F 1HQCA 1U3EM 1IV8A 1G2HA 3QOEA 1Z1DA 4L0ZB 4IHSA 1O3QA 1O57A 2LTPA 3M1EA 5FLMJ 5J1RA 3DQVC 3VOEA 1VQ7I 3D5SC 6PAXA 3PQKA 4RGUA 2WAQA 1YS6A 3BJ6A 1VQ5I 2CV0A 1S3JA 1ZG1A 1QA6A 2BY0A 2Z3YA 4GRIA 3TOBA 4HBLA 4A3MJ 2Y9ZA 2XGEA 3FISA 4XL9A 1O4XA 4R8HA 3WHCA 3VSLA 1D1CA 4HYEA 5JHFA 3DTIA 2VC0A 3D5LA 2OZUA 1Y0UA 2GA2A 5KCMA 2ISZA 4XR6A 4CYCB 5A2QK 2GIZA 4QTRA 4I2OA 1WZ2A 3CF5F 4RA2A 1YRNB 4EMSA 1T56A 2FSWA 3LSPA 2FBIA 2O03A 5HLGA 3HL2A 1J0RA 4RBOA 1DUXC 1W7PA 3E5XA 2XAJA 3QAHA 4MTEA 1YS7A 2BEOA 1KGSA 4XKCA 2OV7A 2IEKA 3J7AO 1AKHB 5DS9A 1JUPA 2C6YA 1I6XA 3F8FA 5BNGA 5H20A 1XGOA 3OYBA 1MMAA 3V7CA 3TDUC 2DMQA 5EZHA 4LLNA 1R7JA 1ODDA 4Y7NJ 2YR2A 3S8PA 2AXLA 3HHHA 2ZXJA 3B02A 4XRSA 1ZLJA 4KN7X 5LRSA 2WTEA 3OYDA 1SFEA 1TW3A 1JGSA 1TQMA 2EWNA 1X1DA 3GW2A 3WU0A 2LF7A 2LY1A 2WY7Q 3JREA 1ZK8A 4HNUA 2LG4A 1FNNA 2DLLA 2EK5A 3LQQA 5DV5A 5K7ZA 3QPHA 4IRIA 3F9KA 3GLXA 2CW0F 2FMYA 4OIPF 1X1BA 2E5ZA 4EVIA 3IH3A 3ZQFA 2M7BA 4UB8C 1XCVA 5J40A 1MMDA 4M3BA 4XRFA 1MBEA 4FT8A 3JRFA 3R61A 2MD0A 1F9NA 5EG0A 2R4GA 1A31A 1R5ID 1IUFA 4C2TA 4AVPA 2DA1A 4HX7A 4MTDA 1FIAA 4HF0A 1BA5A 2HFHA 2PEXA 3K2AA 2ME0A 3LA7A 2YPRA 3N4MA 2P6SA 1YE9A 2CUJA 2F6CA 5CQEA 4A3FJ 5LHIA 5E1XA 1K6YA 2M8GX 4UV9A 3CMYA 4LIVA 3PNYA 2F4IA 2VODA 2HZDA 1Y8QB 3OIOA 1T33A 3T0YA 2G7HA 4Y4RA 3GWZA 4Q5SF 1T95A 1PP8F 2Y0SA 1H0MA 4IKFA 1XD7A 3BG3A 3HGYA 1YX3A 2ZNYA 1JT0A 1HW5A 2VJIA 1MBFA 3KEYA 1ZREA 3OS0A 2HKXA 3KFWX 2L02A 1YJWI 3K70D 2X9DA 1A5JA 2M3AA 4JP0A 4MEYF 2L9VA 1W36C 5E8GA 3GBGA 2IVMA 3QODA 3GF2A 1XMAA 3Q9VA 2X48A 2YS9A 3LSRA 2DT7B 2ELKA 1PYVA 1WHUA 3I55I 1WH7A 4Y3OA 4B8XA 3Q3SA 4HQMA 4C3HJ 3COAC 2HOTA 2R92J 3AL0B 3BG5A 2W4SA 2X85A 3C18A 2PN6A 3W6KB 3I53A 3WE3A 1Z6RA 5EGOA 4XOTA 1W5TA 1T0FC 2R7ZJ 1H9GA 3HHGA 3OSFA 1IN7A 2QSGX 3GTLJ 1K4TA 3NEUA 1B72B 5KAIC 3TGNA 1U9OA 1TTYA 4M9SA 2LBFB 2Z9OA 4DQ2A 5TGTA 5LLQA 2ZFWA 5BMZA 5M5YJ 4BY7J 2F4MB 3ZRGA 1EH7A 2VOOA 2X6OA 2VKHA 1XDUA 1BOAA 1STZA 4HPQA 4XSZF 3CO6C 1RPWA 5F0CA 2FMLA 3S32A 5E3OA 4EJWA 4W97A 4ZDLA 1EH6A 2QKMB 3BR0A 1IJWC 1YRNA 2DI3A 2CH0A 2XUBA 3LSMA 3RPUA 4WF2A 1QZEA 3ZOBA 4XLNF 4I09A 2A05A 3SJMA 1YI2I 3E6CC 2VUMJ 2KISA 2L3DA 2E35A 2L9NA 3SDBA 3CCRI 4HDUA 2CJJA 1VTNC 3ASOH 2X6WA 4GYGA 2ZXWH 4RGXA 3RQ4A 1BW5A 1JUSA 1U2WA 1VQNI 1UFMA 5FFXA 2YSRA 2X51A 2R7UA 1IRGA 2Z2SB 2JA5J 5E79C 3LAPA 1MKMA 1OKRA 5KHDA 2BBYA 2HGCA 5CVIA 1Z9CA 2LR8A 4QPOA 2EA2A 4RB2C 4WX9A 3OYMA 4WXHA 5D6EA 1SVOA 2K02A 3HG9A 4U0YA 2TCTA 3LA3A 3NQOA 1Z05A 3D5RC 3EUKL 1FSHA 1K78B 2A69F 2L7KA 3ISPA 1BR1A 3KYDB 2Q8KA 1T39A 1E3PA 2K5CA 1WFXA 3L2UA 3K2ZA 3ZGKA 1B9NA 1BJAA 2KDOA 2RDPA 5E1WA 4YFXF 2PMUA 3J80K 3H0GJ 4EJUA 3F8NA 3LFKA 3JSOA 3CUOA 4OINF 1MNDA 3I59A 3SXYA 2G0EA 2FE3A 2VXZA 1VQ6I 2E34A 1R1UA 2FF4A 3UNGC 1I3QJ 4PFOA 1LFPA 3QOPA 1OQYA 3ECHA 3QU6A 1SVLA 1W5SA 1B1BA 2RVCA 1HSTA 4C9YA 5K5OA 3CCUI 4U87A 5JR3A 2O9LA 1S9HA 2MLKA 2KMUA 1VQMI 3GZ5A 2XAHA 3I4PA 3ABLH 3KETA 3FBNB 1O7FA 2J5PA 3HTUA 4F7ZA 2H6CA 3R60A 2OPTA 2Y75A 2DFEA 3KP6A 5EEHA 1ETYA 1Z77A 1W0TA 1WRJA 3L2WA 3GFIA 3X2QH 4BEHB 2IW5A 3KP3A 1K6OA 4RLFA 2FD5A 4G9YA 2AQFA 2DTZA 3MKZA 1FBQA 3HOUJ 4PDKA 2GOMA 4A0YA 4ZYGA 3H3VK 2FNPA 4A3KJ 2OUMA 3L7WA 4IOAF 3F3XA 2K27A 3DTKA 3OL3A 4IEJA 3WTYC 4G7HF 2JQ7A 4QSHA 3KP7A 4PJMA 4CZCA 2P7VB 3G73A 3K9TA 4HF2A 2K40A 3Q9SA 2JK3A 4B4CA 1SAUA 5F6FA 4CYDA 1D3YA 1V54H 4JBAA 2UWMA 1G6NA 1DP7P 2PJPA 5EGOB 1XGMA 4ZYAA 3A2KA 2XRLA 1GDTA 1ZGAA 1XMKA 4E4HA 3G1MA 2R7FA 4X1EA 2OZ6A 1R23A 4UVBA 3KP5A 5L3GA 2A5WA 1OYIA 3JW4A 2ZSIB 1G8XA 1MGTA 2OCCH 2OQGA 2Y31A 1RC9A 4BXXJ 4BKXA 2ZSHB 4HLXA 1VFCA 5B66C 1T8IA 3BJOA 4IHYA 3TOAA 4OIRF 4IHXA 2ZC2A 4HG2A 2M45A 2HXIA 2H09A 3H9GA 3J7ZI 3K4NA 4DIQA 2KDZA 4A12A 2IP2A 3GXOA 2VJ4A 2VPRA 2ZMEA 1P7JA 2BY3A 3KPHA 2ACJA 1ORKA 1QO0D 4OAZA 4BE2A 4CZZA 3ERED 2DFFA 4XONA 3RZDJ 4S05A 2M5WA 2LOOA 4WXDA 2JRTA 3OR1C 4D7MA 2FJ1A 3BR6A 5JI6A 4RS8A 1R58A 2ICWG 1WJAA 1RIOH 2R7WA 5K7HA 3N05A 3MMYB 1D8JA 4L9JA 1MSEC 5FLXK 4EGZA 5GP9A 2CS3A 4HF1A 1MIJA 2DDAA 3V4GA 3TO6A 2CRGA 1NK2P 2OTLI 4A0ZA 3E7LA 1T2KA 5DDGA 2DOEA 1WJCA 2LMDA 3CJRB 3VSKA 1P9QC 3FXKA 2HTJA 5DUIA 2HQRA 3BTCA 3GTKJ 2CUFA 5HLHA 2M2EA 1XGNA 2PMZA 3CP8A 1SD7A 4AUXA 4WXCA 1I1SA 2XVCA 2FBKA 3JRDA 2RAEA 2VONA 5CLSA 2UZKA 1IXRC 1S6LA 4E7SA 3CUQB 2WA0A 4NC8A 1J7KA 1LPQA 2ZNZA 1NK3P 3HUGA 5D4SA 1I27A 2P0WA 2HQ5A 5KK1A 2VKVA 2WWYA 1LE8A 1HSJA 3RDIA 2K3PA 4B3AA 5B5EC 5H6RA 5DUKA 1AKHA 1S7OA 2B7EA 2LP0A 3JRHA 4HAMA 4UUSA 3HRTA 4LG3A 2W48A 1WJFA 1WJ5A 2NVYJ 5CYVA 3OS1A 3BR3A 1ZYRF 4J00A 4MIMA 4BU2A 3FMRA 2D2WA 2V9KA 3SZPA 3OYJA 2DBBA 3KZIC 2DA6A 3AL0C 5FB2A 3I9V2 4P1WA 3U1DA 1G3TA 4Z2YA 2KIUA 3R6SA 1IDZA 4ZC3A 3ZQHA 3BG6A 3NAUA 4OOIA 3JAMK 1UZCA 2E1MB 2W57A 2Q2EA 2DYSH 1BM9A 2M4GA 2E1NA 3GTPJ 4PZJA 2P5KA 2QQ8A 3SFZA 3AKZA 4BE1A 5FKKA 4DBQA 3AFHA 4N9HA 5F0HA 2COMA 3PIPF 3HPGA 1X1AA 1X2NA 4HSRA 2UXXA 4E7HA 1H89C 5D5XB 3MCZA 2VQHA 2DPUA 2P5LC 3V7SA 1PP7U 2LKXA 1O3TA 1QGPA 2EILH 4JOMA 3CCMI 4F92B 3R0JA 2Z99A 1JI8A 4DYCA 2R7XA 3FMSA 3MKLA 2DXIA 1ETQA 2EV5A 4L0YB 2Y69H 3ZMDA 1BI3A 4ZYDA 2UUZA 5AIQA 1WJEA 2R7QA 1XSXA 2LK2A 2A6TA 2EQRA 1TQPA 3AAFA 1N25A 3W2AA 3DBRB 2GZWA 4GDFA 3H5AA 5CVVA 4ENKA 2H27A 3QYFA 3TBIA 3JRCA 4LG0B 2KZGA 3VPRA 2L9SA 1YHQI 4A3GJ 3QPTA 4EJTA 3HOVJ 3TP0A 2IA1A 2XC7A 3HOYJ 3FM3A 3U21A 3T1BA 4V2FA 3CO7C 2VJ5A 3TMOA 5HNFA 2H1KA 2VOPA 4F3QA 1DPUA 3VODA 2ZMEB 1DU0A 1HOMA 2VKEA 3S3MA 3ZMSA 4HV5A 1JJ8C 4A5NA 1HXDA 2RQQA 3BR2A 2NXNB 2RGVA 3HZJA 3OY9A 2Y9YA 2MC4A 4AYBA 5EJCA 3EQLF 2EIJH 1VQPI 1KQ9A 4XRMA 1SFUA 3IL2A 1OPCA 3QPSA 4PJ0C 3P9CA 4UNOA 4NQWA 3RPQA 3OYFA 2M8EA 1X58A 2BY2A 3CUQC 5GPCA 2FU4A 1ACIA 1B72A 1K83J 4BJ6C 3TW7A 2CW7A 4GO1A 4YG2F 1BC7C 1EJ9A 1R4MB 1IC8A 1YG2A 2XGCA 3S1MJ 2R7OA 2QQ9A 3H92A 2VJJA 1Z3XA 2FA5A 1YX5A 1DDNA 2PQ8A 2A5YB 5LHGA 2YX4A 3ZMTA 3A01B 2VLAA 4J19A 4OU0A 2H94A 3ZR8X 3OOPA 3ABKH 1BW6A 3RYRA 3DU6A 1UG2A 4BY1J 2XSJC 4BQAA 2EV6A 2HTSA 2MLGA 3K7AJ 4B47A 4U7BA 4DYRA 1LE8B 5HVQC 2HU9A 2E19A 1HW1A 1NH3A 2IT0A 4KIBA 4CYCA 4U0VA 4I6ZA 5E8IA 4PGGA 3FXOA 2QKLB 3QQAA 2HYGD 1EV7A 2FBHA 4BDYA 3IHUA 4HRIA 1RNLA 2OBPA 4HLYA 2HQNA 1E2XA 1WH5A 4E7KA 4KITB 4BH9A 1F5TA 3RKWA 2EZIA 2GM4A 3TKYA 2L9RA 1RUOA 3CQZJ 2W84A 1VQ9I 1FOXA 2NOGA 3BQYA 2CQKA 2LVSA 5C4XJ 3KEQA 4LB5A 1U9NA 2H8RA 1IUYA 2QBYB 4BHCA 3HGGA 2V1XA 5CJ9A 4CCNA 1O3RA 3MWMA 1QQIA 4PSXA 4F52A 1SC7A 3M8JA 1G4DA 1UMQA 3LA2A 2FOWA 3LSIA 2R5YA 3BCAA 2HOAA 2JWTA 2EZHA 1FWZA 4Y52J 5EEGA 3MN2A 2ZXIA 3HYIA 3OYGA 2XPVA 1FOWA 2HPMA 4GGGA 1SAXA 3BTJA 4S04A 3VYSB 1P4XA 2OAZA 1R5HA 1PUFB 4XN0A 1P7IA 1SD5A 4B43A 3BROA 4CCLA 3FXLA 1J2XA 2B0LA 2WC2A 3MVPA 1VI0A 2LY2A 2KJBA 1W5CC 3G6EI 1ZAOA 4DW6A 1HKTA 5IY5H 3VEPA 1WVRA 2HPIA 4Y17A 3SZGA 4MEXF 4FCYA 2EIKH 2F48A 2VN2A 5GADJ 2ECCA 3FHNA 3HOXJ 2ESNA 4HQEA 3FDYA 1ETOA 4P9FA 3VYUB 4G7OF 4K2EA 2DQLA 1JHFA 5BQTA 2OJED 4U7DA 2QM3A 5J1YA 1KYWA 2B63J 2F4OB 2VKDA 2V79A 4RB1A 3DP7A 4IOCF 4B44A 2Y30A 4KMUX 1XS9A 3J7AY 2BVLA 3E6MA 5FKLA 3K10A 1LEAA 2PJRB 1E3OC 3LSTA 2NVUB 1GV5A 4L18B 2CFXA 4Y13A 1P4WA 1TBXA 1A6QA 3CMMA 3HKZA 2K85A 4NQWB 2QA4I 4HX4A 4I02A 2JSCA 1GXQA 5FO5A 4AC0A 3RZOJ 4OIQF 3H0DA 1X4PA 1TLHB 3BT9A 3QP6A 3FXUA 3TQNA 2ME6A 1CF7A 2R93J 2V6CA 2IGOA 2XKOA 2EV0A 3R4KA 2DJIA 4AIKA 3WTTC 3I56I 1U8RA 5J4YA 4DNCA 2ZJRF 4LFUA 2O5RA 4A6EA 2ZCWA 1J09A 2NVXJ 2EPFA 1ZKGA 4G8XA 2CWEA 1TWAJ 2MYSA 3GFLA 3PFIA 4EEFG 5IP9J 1MH4A 4M72A 3ZQLA 4LOCA 4OMYA 1UHSA 3IKTA 1Y6IA 4AVZA 2K9LA 5HLIA 4BHBA 2IA2A 1FOKA 2YU9J 2QVOA 2HQAA 2XHKA 2DO7A 3WTWC 2HOEA 3F72A 4CUGA 2DJNA 4HZFA 2K7LA 1Z91A 5C3EJ 2FQ3A 1A35A 4V2GA 2OF7A 1F1ZA 2QENA 4IRGA 1IW7F 3HTSB 3DU5A 4AD9A 2DA2A 3I3LA 2QLZA 3WGHA 1MD0A 3DFGA 1S5LC 2LKPA 4LD5A 1FOYA 2W1OA 2XB5A 3FZVA 1BI0A 2VB6A 4MO7A 2QEXI 2P4WA 4CICA 3LMMA 1YOVB 4L9NA 3HDDA 3LSHA 1UCRA 3HRMA 2WAQN 4RM2A 2YUSA 3TO9A 2JZYA 2P7CB 3S1NJ 4BBSJ 3BPXA 3L09A 2KRCA 3ZP5A 5DCFA 1I5ZA 4XLAA 4L5JA 4I0AA 3NWTA 4M3EA 2VE8A 3NWSA 3DTEA 3KE2A 3M9AA 3TL4X 2JT1A 1X3ZB 3SDGA 4AIJA 5FRMA 4ASNA 1XX5A 1Q1VA 4PGHA 1ETVA 3GZNB 4BHPA 3HSFA 2BXYA 3CMEI 1NG7A 1R5GA 3ZCOA 2DPDA 3QYEA 5FRNA 2DK8A 2HYJA 4O5VA 2E2IJ 2HI3A 4ESFA 1TP4A 1ZRDA 3K6GA 4QIWN 3MKYB 1M1EB 1W7PB 2PMHA 2XIGA 2TDXA 4NNJA 2VBWA 3A0BC 2PI0A 3P9IA 1FTZA 2P8TA 5LEJA 2VE9A 1U5TC 5D8KB 1SMTA 3BC8A 2M0CA 4ITVA 1IG7A 4RM3A 1F43A 3G3ZA 3IWFA 1D1BA 2GBYA 2Q2EB 5CVJA 3S2WA 3K0LA 1YTYA 5LBQA 3GUDA 4BXUA 3WTVC 1YIJI 4H4KC 5DYMA 4JX5A 1LVKA 1LKXA 3OOUA 4DOZA 1XSVA 1ON1A 3SFIA 1FIPA 2JPCA 2K3FA 3W2VA 2CO5A 1OFCX 2O0YA 3DPLC 4II3A 2V6EA 2EZKA 3IP4B 5J6XA 3WU2C 1HF0A 2X1CA 1FEXA 5F0FA 3MAJA 1BJZA 2DA7A 4L5IA 3KCCA 4A3IJ 3DEEA 2M9HA 4AU7A 4U88A 1UHWA 2NYXA 3C7JA 3H1CA 3C3WA 2KIQA 2HNHA 4EGYA 3GTQJ 3K1NA 1Y1WJ 1KONA 4LMYA 2HEOA 3FBIB 3J81Z 3RKQA 3QWLA 1QHGA 3I5UA 1CQTA 5D5VB 3D0SA 3HPHA 3K4JA 3M8FA 5J8FA 1LQ1A 3WU1B 3ZQ7A 3KP2A 3OV8A 4CHUA 2LYCA 1Y1VJ 1VF9A 2DCEA 3DPTA 1Y39A 2XGDA 2DFHA 3HXLA 3RPUD 4MFDA 1ON2A 5LEKA 1E0EA 3M1CA 2WAEA 2IRFG 3T8TA 2A6EF 2CG4A 3ABTA 2HYFA 1HDPA 4EM0B 4XLHA 2K9MA 2EFQA 2NS8A 3QYBA 3H5NA 4NUBA 4RAGA 4RDUA 1X1PA 4A0XA 2DYRH 3I58A 1X4OA 1N75A 3AG3H 2UV1A 1JJ6C 1JKOC 4HEA2 2IS6A 3RJPA 3O8HA 3CDHA 4CCKA 2E2JJ 4LLLA 4UY8I 2BVMA 3ECOA 2X0LA 5GPAA 3PNTA 1MMGA 1G3WA 4D5FA 1P4AA 3ZQQA 2R3SA 1QRYA 4GXOA 3RCOA 1QNTA 1YW9A 2BXZA 4FETA 4KICA 2HS5A 2QSHX 2DQRA 3B6AA 3RKXA 4BYYA 5FLXZ 4FX4A 1BL0A 1MH3A 1H88C 3TP3A 4XKWA 1Z7UA 4AM3A 2W25A 3ULQB 1IN8A 3SHFA 3ASNH 4IF4A 2EIMH 2WV0A 4EJVA 3FX3A 5E17F 1LEBA 2KQRA 2XPUA 3OWTA 3JSPA 1HKSA 3BR5A 4IQ4A 1YJ9I 2CUZA 4M9XA 2RREA 1GVJA 3ZQIA 3UKGA 1VQ4I 2M0MA 3GMEA 4M71A 4AIDA 1R1VA 1L3LA 2B9SA 3WHBA 1V5FA 3R0AA 2JN6A 2M34A 3U9GA 1AHDP 4RLQA 1WJBA 5DCMB 3KP4A 4RB3C 1P6RA 2AHQA 1FMVA 5FLVA 2D45A 3DXJF 4FASD 2W82A 3BPVA 3F6OA 2NNNA 4MNUA 4XKBA 4HA8A 2CQ7A 3HM5A 1F36A 1WCMJ 3K4CA 3CCLI 2DOAA 1YW8A 1LNWA 4FTHA 4ZYEA 2KIMA 3MZHA 1D0XA 1ZHFA 1ETKA 2FOKA 1YO5C 2V4JC 5CPRB 4ZYHA 4ZH4F 5DM7F 2MC3A 4ZZDA 2FNAA 4KT5C 1V5GA 4PCQA 3BJAA 2VC1A 4A2UA 2RNJA 3PQJA 3HOZJ 1U0JA 3L2CA 1RR8C 4CCJA 4KIFA 3OYAA 1ZR2A 1ZN2A 1B4AA 4BE0A 1RKWA 2XF5A 5B3SH 5H6QA 4IX7A 5IT9K 3RTRA 1I6HJ 2M30A 4E7IA 4C30A 4UUSB 1X3WB 2J5OA 5LHHA 1NHAA 5BPIA 4M6YA 2HDDA 1OCOH 1HW2A 3BQZA 2UXNA 3V8JA 3LAJA 1BC8C 2OA4A 2DODA 1R71A 1R36A 4EQQA 4A3DJ 1K78A 1DGRM 3Q0WA 2DAOA 2AXTC 2BW3A 1JTYA 3FK7A 3K69A 3HOSA 2HDCA 2DA3A 1SFXA 1GUUA 2RV8A 3BTIA 4IHWA 4KMFA 2MA3A 1T38A 4JK1X 3K70C 2ZB9A 2KLOA 2EFPA 2X4HA 2QGUA 1HBXG 5A2QZ 4BACA 1O7LA 1MNMC 1RI7A 2EZLA 3GTOJ 1W7PD 3SYTA 3HBLA 3MQ0A 4PSWA 1TC3C 2VI6A 1OMIA 1TQIA 4YIFA 3IRRA 1A6IA 4KN4X 4FE4A 2XASA 4XRSG 3KX2A 3OYIA 2YX7A 3EUAA 4JX6A 3MKWB 1BN5A 1APLC 1VQKI 1I39A 3E5QA 4M73A 4RGRA 2HOSA 4ENNA 3OYNA 2EBIA 3CCJI 3F8BA 1CGPA 1YQAA 2ISYA 3P9KA 2PFBA 3W6JB 2OU2A 1FLIA 1RUNA 2QQAA 2WV1A 3BP8A 3S1RJ 2NAZA 2KT0A 2F5CA 2PBIA 1UJ8A 4I01A 5TRDA 1AA7A 3OL4A 4I98B 4DZPA 2L7MP 2X1EA 2DA5A 4O6JA 5LGNA 3EPZA 3FMQA 5E3MA 3JRIA 3HSRA 2IXSA 4P9UA 5KAFC 4N0BA 2VQLA 3LWFA 1Z0XA 2LY9A 3ZQCA 3CD6I 1FBSA 1B6AA 1QZYA 3HRUA 2X6YA 3BLYA 4QWQA 1FC3A 1JUMA 2EINH 1YLFA 4KDPA 1ZGJA 1SANA 4YFNF 3F8MA 1KA8A 1OYWA 2OQRA 2Y0SN 5FGMA 1GVDA 5L3FA 1OCZH 2EJRA 2M87A 3AG2H 4G94A 2V1DA 3S14J 2LLKA 5LRRA 3AG1H 2MH9A 1GLNA 3S15J 3IWZA 4YIIA 2O8KA 4M9ZA 5DCMA 2K9NA 2VT2A 3LL7A 4O3MA 1R9TJ 5D5WB 4L9TA 1B9MA 1OYYA 4MQVA 3S93A 3QU3A 2F2EA 4UV8A 5BS6A 5DD4A 1I1GA 3JR9A 1ZH5A 1I3AA 1Y8RB 3WE2A 2JA2A 5GAEJ 1KU7A 1MMSA 3ZMUA 3V42A 1Z21A 3QP5A 3RYPA 5CVRA 4WWCA 2L2OA 2QWWA 1GXPA 3EYIA 2NVQJ 3F6VA 2KL4A 2P6TA 1IN5A 2O7OA 3A03A 5FD6A 1EKEA 1H8AC 1JTXA 4ENMA 3CLQA 5LD2C 3BTLA 1ETWA 2R5ZA 2A61A 3K1MA 1RKTA 5IYBJ 3JTGA 4PUSA 4IQJA 1WSUA 3K1PA 3BDDA 1E17A 2E1OA 3CTAA 4M3DA 2GA1A 1X19A 1LDKB 4YEJA 3DV8A 2HVQA 2DFIA 1A04A 3U1KA 2W00A 2JVHA 5CQGA 3BWGA 1UHMA 1IRFA 1R22A 2KRFA 4XSXF 5GAGJ 4RMNA 5M3MJ 2A07F 4MQ9F 3JTHA 2V1UA 1ZGWA 3OS2A 2RC4A 5LFAA 3PO3J 2A68F 3ZMVA 4LK1F 1BI1A 2DA4A 5JLWA 2BY1A 3CUQA 2QBYA 3CDIA 3LSGA 3FHZA 4P55A 3HB9A 3E97A 4RB0A 2KHMA 3HUGB 5FD5A 2GLOA 4RAYA 5ICFA 3HOTA 5ERIA 4XM3A 1LVAA 1J5YA 4NC6A 1ZRFA 3O3KA 4KYWA 4Y33A 4KISA 1XGSA 3G2BA 3NARA 2QUFA 1FT9A 4A6DA 3V8LA 3G1LA 3DLLF 3FWEA 2VBYA 2ZFUA 3W2WA 1FTTA 4D9JA 1IAWA 2DMNA 2XGXA 2STTA 1WQ2A 2KIFA 2F5VA 1OR7A 4MLOA 3GTMJ 5M3FJ 3Q5FA 3DWLE 3WG7H 1PUFA 4OMZA 1KU2A 3HEFA 4TV7A 3GX4X 1W1WE 3LOCA 2ELHA 4V19K 2LDUA 2RNGA 3IUOA 1TWGJ 1BIAA 5HDKA 3GZ6A 2VQGA 1MBJA 2MW8A 1MDMB 5GTIC 2DW4A 4FX0A 1V5EA 3G71I 1REPC 5EDNA 3UR3C 4CXFA 2BZTA 2P81A 3H35A 2LSOA 3F22A 2RQPA 3VYRB 2QCOA 1DP3A 3E0JB 1YITI 2DK5A 1P92A 5AIPA 2H6BA 2K4BA 4CCOA 3IKVA 2NRAC 4LB6B 1LJ9A 4EATA 3J80Z 4NHJA 1BR2A 2Z1DA 2ZO4A 4M3GA 3BY6A 2XSDC 3FF5A 2MGQA 2CQNA 3M8EA 3TW6A 1C0WA 3I4NJ 2E60A 1P2FA 1TT0A 3DKWA 2COBA 3JCUC 3PFYA 2QQBA 2PJRA 3ABUA 1T98A 3EUHC 5L3CA 1POGA 1J9IA 5E20A 5KNLA 1TL8A 1FPQA 1FYLA 4UXNA 3ZN1A 2XAUA 1S7EA 3D1NI 2BOLA 1TWHJ 2ZXHA 4YFKF 4KUMA 4M6XA 3T5XA 1SD4A 2E7WA 1ZG5A 1R1TA 3B6CA 2X6XA 4E6KG 2K86A 4ZTFA 2Q0OA 3M07A 2LC2A 1MW7A 2D1VA 3L9FA 4ZZLA 3G1OA 1CF7B 1KZHA 4OIOF 4UUVA 3DEWA 1JXSA 4N9IA 3IH2A 4P96A 2XB0X 1LFUP 2E1CA 4LLGF 2E71A 2DTRA 1T08B 5DM6F 2R7VA 2E1MC 4AYBN 1JGGA 4CGZA 1R4NB 2GXAA 2KPMA 1D0ZA 2DOFA 1YJNI 5IT3A 1NG6A 4N4NB 3A1YA 2EA4A 4CH7A 2W24A 4DYQA 5ICEA 4XLPF 4G6DA 3TDZC 2VIXA 1X1CA 2E2HJ 2GQQA 1MNEA 1JKRC 2MABA 3MEXA 3WTUC 3JRBA 1BI2A 1G3SA 1O3SA 4UVCA 2ZJ2A 1RETA 2M1BA 3ZQGA 1AWCA 3RSNA 2V9PA 1W4MA 3MD2A 4H0EA 1HCRA 2R5ZB 1LB2A 2X1DA 5D8LB 2HWVA 4FE7A 5B1BH 3FIWA 2K9SA 3MZ8A 4L5EA 4HV6A 3PSIA 1OCTC 3ML6A 3E6BA 4DZJA 1QHHD 2JUGA 1FP2A 2LF8A 4EM1A 2WADA 3CC2I 1TT5B 3EUHA 3BZKA 3K4LA 4FQGA 3G4SI 2ESHA 1Z67A 1KQ8A 2G7UA 2JRMA 5E3LA 4IZZA 2XF7A 2O8XA 3FK6A 2EFOA 3CC4I 3E3VA 3CDLA 2E5NA 4XNFA 1IN6A 3A01A 4JQFA 4AIHA 3GTGJ 2VBZA
chains in the Genus database with same CATH topology
2XAFA 4MGRA 5JFRA 4MHGA 2EFWA 1XSDA 5HOOA 1DPRA 2RKHA 2O6GE 3VB2A 1BIBA 1AOYA 1S8NA 5ILSA 5JHUA 4G7ZF 1SD6A 3GYHX 1IN4A 5HS8A 3ZPLA 2D1HA 2XAGA 4LGWA 5L3DA 1TW2A 3ZN0A 1U5TB 3FM5A 4IHTA 1V3FA 4Q47A 1G3YA 1YYVA 3GFJA 4GCVA 5J8CA 1XB4A 4IPAA 5L3EA 2ZBKA 1U6GA 1IF1A 5HDGA 3V8KA 2YU3A 4NB5A 1PDNC 1KU9A 4WK8F 3HSEA 5DEQA 4HDVA 2XROA 4IXAA 5D5UB 2CYYA 4QLCU 4HW0A 3EDPA 2FXAA 5D6FA 3TO7A 2P5VA 5F1RA 1R00A 3NRVA 4EM2A 4ESJA 1T0FA 2CGPA 2RN7A 1IXCA 2BE5F 3MZYA 4CDGA 2KJCA 2OD5A 2PLYA 1B59A 2F5FA 2E7XA 5L3BA 3WTZA 2EB7A 2MD5A 2STWA 1KYZA 3RI4A 4GYIA 3QRFF 2IA0A 5K1YA 1U78A 4E70A 3F8CA 3RKYA 1MJBA 3N97A 1D5VA 1WWXA 2HZTA 3WTSC 1F4KA 1Z6TA 3O2PE 3SQNA 1TNSA 5BPDA 4A5MA 2VBXA 5E18F 1FZPB 1QZZA 2K4JA 2V9VA 4WCGA 1T6SA 1ZARA 4RAZA 5IT9Z 2QZ8A 1L0OC 4G6QA 2Z33A 1SMYF 2HR3A 3L00A 4CO8A 3IC7A 3U2RA 4UHTA 5HS9A 2DT5A 1XCBA 3GO5A 2GWRA 3E6DA 4XBFA 2JPBA 2XRNA 1HKQA 1U5TA 1WKMA 5LGUA 2L54A 2L4AA 3WG9A 1D8KA 2ZKZA 1PUEE 5DD8A 5BOXA 5HS7A 2XKPA 5ILVA 3I59B 2GIVA 1ONVA 3B73A 2XAQA 3ELKA 3DEUA 3WGGA 1USSA 2Z5UA 3VFZA 1WI9A 4RGSA 1YIOA 2W85A 2MH2A 4LJZF 4U0WA 1MDMA 5CVUA 4EJOA 4LG0A 2A6HF 3GEZA 3F21A 1MJ9A 1ZRCA 1RZ4A 1K79A 2AS5F 3WGIA 1S29A 3MFKA 2FRHA 1TNTA 4ON0A 1LDJA 4BAYA 3I71A 4B09A 3EETA 4KNYA 2JTVA 1ULYA 1FY7A 4R1HA 2VT3A 1ZLKA 3IRQA 3DF8A 1MZBA 2EFNA 2F5DA 3EYYA 5HDNA 1Q1HA 3FXRA 2GXGA 3SZTA 3FXQA 1BBYA 1MJAA 1FYKA 4I7HA 4IVNA 4BNCA 3M7GA 2QYOA 2XV4S 3I64A 3H3ZA 2ETHA 3RIRA 4L9VA 1J75A 4Y15A 5TJJA 3I0TA 1X3UA 2BGCA 1LDDA 1FSEA 1GHCA 2PG4A 3ROUA 2A3SA 3E5UA 4KIGA 3P7NA 1H9TA 4Q48A 2NNYA 5FFZA 1YW7A 3KLNA 5E1ZB 1FX7A 2Y48A 5D4RA 3KZZA 3KZYA 1FP1D 4HX8A 1KU3A 3H3UA 2Y0MA 1YFHA 2ADUA 3V7RA 4EV0A 1KQ0A 3KEOA 4D0PA 3CJNA 3F23A 4P5OA 2HKOA 3CLOA 2GXBA 5ICCA 2F5EA 3WTXC 1UB9A 5K5QA 5LGTA 3GFMA 2LNBA 1J59A 3O6BB 1XDSA 1FYMA 4IRHA 3BOQA 3BZ6A 3I54A 2FEZA 2CSOA 2O61A 5ILUA 4UVAA 2NS0A 3KLOA 4M74A 3JAMZ 2L4MA 4FHTA 3REOA 4I0BA 4Q4ZF 1EH8A 3GVAA 3C1DA 4LK0F 3ZMZA 3HIFA 5JVTA 2BV6A 2IJLA 1XN7A 4AWXB 2G9WA 3LQRA 1K7AA 4KA4A 5ED4A 5AONA 1FBUA 4ETSA 2DU9A 4R79A 1USTA 4HOBA 2GAUA 2IPQX 2MBFA 2L01A 4ENJA 3T8RA 1IXSB 4IJAA 4ESBA 1ZG3A 1QBJA 5F64A 1JE8A 3J81K 3HRSA 5K5RA 2BYVE 2R7DA 2KKOA 5ICGA 1IZ1A 5KVRA 1V4RA 1QPMA 1JHHA 2O3FA 1S7AA 4KFCA 3WODF 1HQCA 1U3EM 1Z1DA 4L0ZB 4IHSA 1O3QA 1O57A 3M1EA 3DQVC 3VOEA 6PAXA 3PQKA 4RGUA 1YS6A 3BJ6A 1S3JA 1ZG1A 2Z3YA 3TOBA 4HBLA 4R8HA 4HYEA 3D5LA 2VC0A 2OZUA 2GA2A 1Y0UA 2ISZA 5A2QK 4I2OA 4EMSA 2FSWA 2FBIA 2O03A 5HLGA 1DUXC 1J0RA 1W7PA 3E5XA 2XAJA 3QAHA 4MTEA 1YS7A 2BEOA 1KGSA 3J7AO 2C6YA 1I6XA 3F8FA 5H20A 1XGOA 3V7CA 3TDUC 4LLNA 1R7JA 1ODDA 2YR2A 2AXLA 3HHHA 2ZXJA 3B02A 1ZLJA 4KN7X 5LRSA 2WTEA 1SFEA 1TW3A 1JGSA 1TQMA 2EWNA 3GW2A 3WU0A 2LF7A 1FNNA 2DLLA 2EK5A 3LQQA 5DV5A 3QPHA 4IRIA 3GLXA 2CW0F 2FMYA 4OIPF 4EVIA 1XCVA 4XRFA 4FT8A 3R61A 1F9NA 4AVPA 4HX7A 4MTDA 4HF0A 2HFHA 2PEXA 3LA7A 3N4MA 2YPRA 2P6SA 5LHIA 5E1XA 4UV9A 2VODA 3T0YA 2G7HA 4Q5SF 3GWZA 1PP8F 1H0MA 1XD7A 2ZNYA 1HW5A 1ZREA 2HKXA 3KFWX 2L02A 4MEYF 5E8GA 2IVMA 3GF2A 1XMAA 3Q9VA 4B8XA 3COAC 4HQMA 3C18A 2PN6A 3W6KB 3I53A 3WE3A 1Z6RA 1W5TA 1H9GA 3HHGA 1IN7A 3NEUA 3TGNA 1TTYA 4M9SA 2Z9OA 4DQ2A 5LLQA 2ZFWA 5BMZA 1EH7A 2VOOA 1XDUA 1BOAA 1STZA 4XSZF 3CO6C 2FMLA 4EJWA 1EH6A 2DI3A 2XUBA 3RPUA 4WF2A 4XLNF 4I09A 3E6CC 2L3DA 4HDUA 1VTNC 4GYGA 4RGXA 1U2WA 1UFMA 5FFXA 2YSRA 1IRGA 3LAPA 1MKMA 1OKRA 2BBYA 2HGCA 5CVIA 1Z9CA 2EA2A 4RB2C 4WX9A 4WXHA 5D6EA 2K02A 4U0YA 3LA3A 3NQOA 1Z05A 1FSHA 1K78B 2A69F 3ISPA 2Q8KA 1T39A 3K2ZA 1B9NA 1BJAA 4YFXF 2RDPA 5E1WA 3J80K 2PMUA 4EJUA 3F8NA 3LFKA 3JSOA 3CUOA 4OINF 3I59A 3SXYA 2FE3A 2VXZA 1R1UA 2FF4A 3QOPA 3ECHA 3QU6A 1W5SA 1B1BA 2RVCA 1HSTA 5K5OA 5JR3A 2MLKA 3GZ5A 2XAHA 3I4PA 3KETA 1O7FA 2J5PA 3HTUA 4F7ZA 2H6CA 3R60A 2Y75A 3KP6A 5EEHA 1WRJA 3GFIA 2IW5A 3KP3A 1K6OA 4G9YA 1FBQA 4PDKA 4A0YA 4ZYGA 2FNPA 3L7WA 3F3XA 2K27A 3WTYC 4G7HF 3KP7A 2P7VB 3G73A 3K9TA 4HF2A 3Q9SA 5F6FA 4CYDA 1D3YA 4JBAA 2UWMA 1G6NA 1DP7P 2PJPA 1XGMA 1ZGAA 1XMKA 2R7FA 2OZ6A 1R23A 4UVBA 3KP5A 5L3GA 1OYIA 3JW4A 1MGTA 2OQGA 4HLXA 3BJOA 3TOAA 4OIRF 2M45A 2H09A 4A12A 2IP2A 3GXOA 2ZMEA 2ACJA 1QO0D 4CZZA 3ERED 4S05A 2M5WA 4WXDA 2JRTA 5JI6A 4RS8A 1R58A 1RIOH 1D8JA 4L9JA 5FLXK 4EGZA 4HF1A 3V4GA 3TO6A 4A0ZA 1T2KA 5DDGA 5DUIA 2HTJA 2HQRA 5HLHA 1XGNA 1SD7A 4WXCA 1I1SA 2XVCA 2FBKA 2VONA 5CLSA 2UZKA 1IXRC 1S6LA 3CUQB 1J7KA 2ZNZA 3HUGA 5D4SA 1I27A 5KK1A 2WWYA 1HSJA 3RDIA 5H6RA 5DUKA 1S7OA 4HAMA 3HRTA 5CYVA 1ZYRF 3FMRA 2D2WA 3SZPA 2DBBA 5FB2A 3U1DA 1G3TA 4Z2YA 2KIUA 3R6SA 3JAMK 4OOIA 2W57A 2Q2EA 1BM9A 2E1NA 4PZJA 2P5KA 3SFZA 4N9HA 2COMA 2UXXA 5D5XB 3MCZA 2DPUA 2P5LC 3V7SA 1PP7U 1O3TA 1QGPA 3R0JA 2Z99A 3FMSA 2EV5A 4L0YB 3ZMDA 1BI3A 4ZYDA 5AIQA 1XSXA 3AAFA 1TQPA 2GZWA 5CVVA 4ENKA 2H27A 4LG0B 3QPTA 4EJTA 2IA1A 3FM3A 3T1BA 3CO7C 2VOPA 1DPUA 3VODA 2ZMEB 3ZMSA 4HV5A 4A5NA 1HXDA 2RGVA 3EQLF 1KQ9A 1SFUA 3IL2A 1OPCA 4UNOA 3P9CA 4NQWA 3RPQA 2M8EA 3CUQC 2FU4A 4GO1A 4YG2F 1BC7C 1YG2A 2QQ9A 3H92A 2FA5A 1DDNA 2PQ8A 2A5YB 5LHGA 2YX4A 3ZMTA 4OU0A 2H94A 3OOPA 3RYRA 4BQAA 2EV6A 2HTSA 2MLGA 4U7BA 5HVQC 1HW1A 2IT0A 4KIBA 4U0VA 5E8IA 4PGGA 2HYGD 1EV7A 2FBHA 3IHUA 1RNLA 2OBPA 4HLYA 2HQNA 1E2XA 4BH9A 1F5TA 3RKWA 3TKYA 1RUOA 2W84A 2CQKA 3KEQA 4LB5A 1IUYA 2QBYB 4BHCA 2V1XA 5CJ9A 1O3RA 3MWMA 1QQIA 1G4DA 3LA2A 1FWZA 5EEGA 3HYIA 4GGGA 1SAXA 4S04A 1P4XA 2OAZA 1R5HA 1SD5A 3BROA 1J2XA 2B0LA 2WC2A 2KJBA 1ZAOA 1HKTA 3VEPA 4Y17A 4MEXF 2VN2A 2ESNA 4HQEA 4P9FA 4G7OF 4K2EA 2DQLA 1JHFA 5BQTA 4U7DA 2QM3A 1KYWA 2V79A 4RB1A 3DP7A 4KMUX 3E6MA 1LEAA 3LSTA 4L18B 2CFXA 4Y13A 1P4WA 1TBXA 4HX4A 4I02A 2JSCA 1GXQA 5FO5A 4OIQF 1TLHB 3QP6A 3FXUA 3TQNA 1CF7A 2V6CA 2XKOA 2EV0A 3R4KA 4AIKA 3WTTC 1U8RA 4DNCA 4LFUA 4A6EA 2ZCWA 4G8XA 2CWEA 3GFLA 3PFIA 4M72A 4OMYA 3IKTA 4BHBA 5HLIA 2IA2A 1FOKA 2QVOA 2XHKA 2DO7A 3WTWC 2HOEA 3F72A 4HZFA 2K7LA 1Z91A 2FQ3A 1F1ZA 2QENA 4IRGA 1IW7F 3HTSB 4AD9A 2QLZA 3WGHA 1MD0A 3DFGA 2LKPA 4LD5A 3FZVA 1BI0A 2P4WA 4CICA 4L9NA 1UCRA 3HRMA 3TO9A 2JZYA 2P7CB 3BPXA 3L09A 3ZP5A 5DCFA 1I5ZA 4L5JA 4I0AA 2VE8A 3KE2A 3M9AA 2JT1A 4AIJA 4ASNA 4PGHA 4BHPA 3HSFA 1R5GA 2DPDA 2DK8A 4O5VA 4ESFA 1ZRDA 1W7PB 2XIGA 2PMHA 2TDXA 2VBWA 2PI0A 3P9IA 2P8TA 5LEJA 2VE9A 1U5TC 5D8KB 1SMTA 3G3ZA 3IWFA 5CVJA 3S2WA 1YTYA 3K0LA 5LBQA 3GUDA 4BXUA 3WTVC 5DYMA 1XSVA 1ON1A 2JPCA 2CO5A 2O0YA 3DPLC 5J6XA 3MAJA 4L5IA 3KCCA 4U88A 1UHWA 2NYXA 3C7JA 3C3WA 4EGYA 3K1NA 4LMYA 2HEOA 3J81Z 3I5UA 5D5VB 3D0SA 3M8FA 1LQ1A 5J8FA 3WU1B 3ZQ7A 3KP2A 3OV8A 4CHUA 3DPTA 1ON2A 5LEKA 2IRFG 3T8TA 2A6EF 2CG4A 3ABTA 2HYFA 4EM0B 2EFQA 4A0XA 3I58A 3RJPA 3CDHA 4LLLA 3ECOA 2X0LA 1G3WA 1P4AA 2R3SA 4GXOA 1QNTA 1YW9A 4KICA 2HS5A 2DQRA 3RKXA 4BYYA 5FLXZ 4FX4A 1Z7UA 2W25A 3ULQB 1IN8A 3SHFA 4IF4A 2WV0A 4EJVA 3FX3A 5E17F 1LEBA 3JSPA 1HKSA 4M9XA 1GVJA 4M71A 1R1VA 1L3LA 3R0AA 3U9GA 5DCMB 3KP4A 4RB3C 1P6RA 2D45A 3DXJF 3BPVA 3F6OA 2NNNA 4MNUA 4HA8A 1YW8A 1LNWA 4ZYEA 2KIMA 3MZHA 1ZHFA 2FOKA 1YO5C 4ZYHA 4ZH4F 2MC3A 4ZZDA 2FNAA 4KT5C 4PCQA 3BJAA 2VC1A 4A2UA 2RNJA 3PQJA 3L2CA 4KIFA 1ZN2A 1B4AA 5H6QA 5IT9K 3RTRA 2M30A 2J5OA 5LHHA 1NHAA 5BPIA 4M6YA 1HW2A 2UXNA 3V8JA 3LAJA 1BC8C 2OA4A 1R36A 4EQQA 1K78A 2DAOA 3K69A 3HOSA 2HDCA 1SFXA 2RV8A 4KMFA 2MA3A 1T38A 4JK1X 2EFPA 2X4HA 1HBXG 5A2QZ 1O7LA 1RI7A 1W7PD 3MQ0A 1OMIA 1TQIA 4YIFA 3IRRA 4KN4X 2XASA 2YX7A 1BN5A 3E5QA 4RGRA 4M73A 4ENNA 3F8BA 1CGPA 1YQAA 2ISYA 3P9KA 2PFBA 3W6JB 2OU2A 1FLIA 1RUNA 2QQAA 3BP8A 2NAZA 2F5CA 2PBIA 4I01A 5TRDA 4I98B 4O6JA 5LGNA 3FMQA 3HSRA 4P9UA 4N0BA 3LWFA 1FBSA 1B6AA 1QZYA 3HRUA 4QWQA 1FC3A 1YLFA 4KDPA 1ZGJA 4YFNF 3F8MA 1KA8A 1OYWA 2OQRA 5FGMA 5L3FA 2EJRA 2M87A 4G94A 2V1DA 5LRRA 2MH9A 3IWZA 4YIIA 4M9ZA 5DCMA 2VT2A 4O3MA 5D5WB 4L9TA 1B9MA 1OYYA 4MQVA 5BS6A 2F2EA 3QU3A 4UV8A 5DD4A 1I1GA 1ZH5A 3WE2A 1KU7A 3ZMUA 3QP5A 3RYPA 5CVRA 4WWCA 2QWWA 1GXPA 3EYIA 3F6VA 2P6TA 1IN5A 5FD6A 4ENMA 2A61A 3K1MA 3JTGA 1WSUA 3K1PA 3BDDA 1E17A 3CTAA 2GA1A 1LDKB 3DV8A 2DFIA 1A04A 3BWGA 1UHMA 1IRFA 1R22A 2KRFA 4XSXF 2A07F 4MQ9F 3JTHA 2V1UA 2RC4A 2A68F 3ZMVA 4LK1F 1BI1A 3CUQA 2QBYA 3FHZA 4P55A 4RB0A 3E97A 5FD5A 4RAYA 5ICFA 3HOTA 5ERIA 1LVAA 1J5YA 1ZRFA 3O3KA 4KYWA 1XGSA 2QUFA 1FT9A 4A6DA 3V8LA 3FWEA 2VBYA 1IAWA 2XGXA 2STTA 1WQ2A 2KIFA 1OR7A 3Q5FA 4OMZA 1KU2A 4TV7A 3GX4X 2ELHA 2LDUA 5HDKA 1BIAA 3GZ6A 1MDMB 2DW4A 4FX0A 1REPC 4CXFA 2LSOA 3F22A 2RQPA 2DK5A 1P92A 5AIPA 2H6BA 2K4BA 3IKVA 2NRAC 4LB6B 1LJ9A 3J80Z 4NHJA 2ZO4A 3BY6A 3FF5A 3M8EA 1C0WA 1P2FA 3DKWA 2QQBA 3ABUA 1T98A 5L3CA 1J9IA 5E20A 1FYLA 1FPQA 4UXNA 3ZN1A 4YFKF 4KUMA 4M6XA 3T5XA 1SD4A 2E7WA 1ZG5A 1R1TA 2K86A 2Q0OA 2D1VA 3L9FA 4ZZLA 1CF7B 4OIOF 4UUVA 1JXSA 4N9IA 4P96A 2E1CA 4LLGF 2DTRA 4CGZA 5IT3A 2EA4A 5ICEA 2W24A 4XLPF 4G6DA 3TDZC 2GQQA 3MEXA 3WTUC 1BI2A 1G3SA 1O3SA 4UVCA 2ZJ2A 2M1BA 1AWCA 1W4MA 4H0EA 1LB2A 5D8LB 2HWVA 4HV6A 3ML6A 3E6BA 1FP2A 2LF8A 4EM1A 3EUHA 2ESHA 1KQ8A 2G7UA 2O8XA 2EFOA 3E3VA 1IN6A 4JQFA 4AIHA 2VBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XAF A;  4MGR A;  5JFR A;  4MHG A;  2EFW A;  1XSD A;  5HOO A;  1DPR A;  2RKH A;  2O6G E;  3VB2 A;  1BIB A;  1AOY A;  1S8N A;  5ILS A;  5JHU A;  4G7Z F;  1SD6 A;  3GYH X;  1IN4 A;  5HS8 A;  3ZPL A;  2D1H A;  2XAG A;  4LGW A;  5L3D A;  1TW2 A;  3ZN0 A;  1U5T B;  3FM5 A;  4IHT A;  1V3F A;  4Q47 A;  1G3Y A;  1YYV A;  3GFJ A;  4GCV A;  5J8C A;  1XB4 A;  4IPA A;  5L3E A;  2ZBK A;  1U6G A;  1IF1 A;  5HDG A;  3V8K A;  2YU3 A;  4NB5 A;  1PDN C;  1KU9 A;  4WK8 F;  3HSE A;  5DEQ A;  4HDV A;  2XRO A;  4IXA A;  5D5U B;  2CYY A;  4QLC U;  4HW0 A;  3EDP A;  2FXA A;  5D6F A;  3TO7 A;  2P5V A;  5F1R A;  1R00 A;  3NRV A;  4EM2 A;  4ESJ A;  1T0F A;  2CGP A;  2RN7 A;  1IXC A;  2BE5 F;  3MZY A;  4CDG A;  2KJC A;  2OD5 A;  2PLY A;  1B59 A;  2F5F A;  2E7X A;  5L3B A;  3WTZ A;  2EB7 A;  2MD5 A;  2STW A;  1KYZ A;  3RI4 A;  4GYI A;  3QRF F;  2IA0 A;  5K1Y A;  1U78 A;  4E70 A;  3F8C A;  3RKY A;  1MJB A;  3N97 A;  1D5V A;  1WWX A;  2HZT A;  3WTS C;  1F4K A;  1Z6T A;  3O2P E;  3SQN A;  1TNS A;  5BPD A;  4A5M A;  2VBX A;  5E18 F;  1FZP B;  1QZZ A;  2K4J A;  2V9V A;  4WCG A;  1T6S A;  1ZAR A;  4RAZ A;  5IT9 Z;  2QZ8 A;  1L0O C;  4G6Q A;  2Z33 A;  1SMY F;  2HR3 A;  3L00 A;  4CO8 A;  3IC7 A;  3U2R A;  4UHT A;  5HS9 A;  2DT5 A;  1XCB A;  3GO5 A;  2GWR A;  3E6D A;  4XBF A;  2JPB A;  2XRN A;  1HKQ A;  1U5T A;  1WKM A;  5LGU A;  2L54 A;  2L4A A;  3WG9 A;  1D8K A;  2ZKZ A;  1PUE E;  5DD8 A;  5BOX A;  5HS7 A;  2XKP A;  5ILV A;  3I59 B;  2GIV A;  1ONV A;  3B73 A;  2XAQ A;  3ELK A;  3DEU A;  3WGG A;  1USS A;  2Z5U A;  3VFZ A;  1WI9 A;  4RGS A;  1YIO A;  2W85 A;  2MH2 A;  4LJZ F;  4U0W A;  1MDM A;  5CVU A;  4EJO A;  4LG0 A;  2A6H F;  3GEZ A;  3F21 A;  1MJ9 A;  1ZRC A;  1RZ4 A;  1K79 A;  2AS5 F;  3WGI A;  1S29 A;  3MFK A;  2FRH A;  1TNT A;  4ON0 A;  1LDJ A;  4BAY A;  3I71 A;  4B09 A;  3EET A;  4KNY A;  2JTV A;  1ULY A;  1FY7 A;  4R1H A;  2VT3 A;  1ZLK A;  3IRQ A;  3DF8 A;  1MZB A;  2EFN A;  2F5D A;  3EYY A;  5HDN A;  1Q1H A;  3FXR A;  2GXG A;  3SZT A;  3FXQ A;  1BBY A;  1MJA A;  1FYK A;  4I7H A;  4IVN A;  4BNC A;  3M7G A;  2QYO A;  2XV4 S;  3I64 A;  3H3Z A;  2ETH A;  3RIR A;  4L9V A;  1J75 A;  4Y15 A;  5TJJ A;  3I0T A;  1X3U A;  2BGC A;  1LDD A;  1FSE A;  1GHC A;  2PG4 A;  3ROU A;  2A3S A;  3E5U A;  4KIG A;  3P7N A;  1H9T A;  4Q48 A;  2NNY A;  5FFZ A;  1YW7 A;  3KLN A;  5E1Z B;  1FX7 A;  2Y48 A;  5D4R A;  3KZZ A;  3KZY A;  1FP1 D;  4HX8 A;  1KU3 A;  3H3U A;  2Y0M A;  1YFH A;  2ADU A;  3V7R A;  4EV0 A;  1KQ0 A;  3KEO A;  4D0P A;  3CJN A;  3F23 A;  4P5O A;  2HKO A;  3CLO A;  2GXB A;  5ICC A;  2F5E A;  3WTX C;  1UB9 A;  5K5Q A;  5LGT A;  3GFM A;  2LNB A;  1J59 A;  3O6B B;  1XDS A;  1FYM A;  4IRH A;  3BOQ A;  3BZ6 A;  3I54 A;  2FEZ A;  2CSO A;  2O61 A;  5ILU A;  4UVA A;  2NS0 A;  3KLO A;  4M74 A;  3JAM Z;  2L4M A;  4FHT A;  3REO A;  4I0B A;  4Q4Z F;  1EH8 A;  3GVA A;  3C1D A;  4LK0 F;  3ZMZ A;  3HIF A;  5JVT A;  2BV6 A;  2IJL A;  1XN7 A;  4AWX B;  2G9W A;  3LQR A;  1K7A A;  4KA4 A;  5ED4 A;  5AON A;  1FBU A;  4ETS A;  2DU9 A;  4R79 A;  1UST A;  4HOB A;  2GAU A;  2IPQ X;  2MBF A;  2L01 A;  4ENJ A;  3T8R A;  1IXS B;  4IJA A;  4ESB A;  1ZG3 A;  1QBJ A;  5F64 A;  1JE8 A;  3J81 K;  3HRS A;  5K5R A;  2BYV E;  2R7D A;  2KKO A;  5ICG A;  1IZ1 A;  5KVR A;  1V4R A;  1QPM A;  1JHH A;  2O3F A;  1S7A A;  4KFC A;  3WOD F;  1HQC A;  1U3E M;  1Z1D A;  4L0Z B;  4IHS A;  1O3Q A;  1O57 A;  3M1E A;  3DQV C;  3VOE A;  6PAX A;  3PQK A;  4RGU A;  1YS6 A;  3BJ6 A;  1S3J A;  1ZG1 A;  2Z3Y A;  3TOB A;  4HBL A;  4R8H A;  4HYE A;  3D5L A;  2VC0 A;  2OZU A;  2GA2 A;  1Y0U A;  2ISZ A;  5A2Q K;  4I2O A;  4EMS A;  2FSW A;  2FBI A;  2O03 A;  5HLG A;  1DUX C;  1J0R A;  1W7P A;  3E5X A;  2XAJ A;  3QAH A;  4MTE A;  1YS7 A;  2BEO A;  1KGS A;  3J7A O;  2C6Y A;  1I6X A;  3F8F A;  5H20 A;  1XGO A;  3V7C A;  3TDU C;  4LLN A;  1R7J A;  1ODD A;  2YR2 A;  2AXL A;  3HHH A;  2ZXJ A;  3B02 A;  1ZLJ A;  4KN7 X;  5LRS A;  2WTE A;  1SFE A;  1TW3 A;  1JGS A;  1TQM A;  2EWN A;  3GW2 A;  3WU0 A;  2LF7 A;  1FNN A;  2DLL A;  2EK5 A;  3LQQ A;  5DV5 A;  3QPH A;  4IRI A;  3GLX A;  2CW0 F;  2FMY A;  4OIP F;  4EVI A;  1XCV A;  4XRF A;  4FT8 A;  3R61 A;  1F9N A;  4AVP A;  4HX7 A;  4MTD A;  4HF0 A;  2HFH A;  2PEX A;  3LA7 A;  3N4M A;  2YPR A;  2P6S A;  5LHI A;  5E1X A;  4UV9 A;  2VOD A;  3T0Y A;  2G7H A;  4Q5S F;  3GWZ A;  1PP8 F;  1H0M A;  1XD7 A;  2ZNY A;  1HW5 A;  1ZRE A;  2HKX A;  3KFW X;  2L02 A;  4MEY F;  5E8G A;  2IVM A;  3GF2 A;  1XMA A;  3Q9V A;  4B8X A;  3COA C;  4HQM A;  3C18 A;  2PN6 A;  3W6K B;  3I53 A;  3WE3 A;  1Z6R A;  1W5T A;  1H9G A;  3HHG A;  1IN7 A;  3NEU A;  3TGN A;  1TTY A;  4M9S A;  2Z9O A;  4DQ2 A;  5LLQ A;  2ZFW A;  5BMZ A;  1EH7 A;  2VOO A;  1XDU A;  1BOA A;  1STZ A;  4XSZ F;  3CO6 C;  2FML A;  4EJW A;  1EH6 A;  2DI3 A;  2XUB A;  3RPU A;  4WF2 A;  4XLN F;  4I09 A;  3E6C C;  2L3D A;  4HDU A;  1VTN C;  4GYG A;  4RGX A;  1U2W A;  1UFM A;  5FFX A;  2YSR A;  1IRG A;  3LAP A;  1MKM A;  1OKR A;  2BBY A;  2HGC A;  5CVI A;  1Z9C A;  2EA2 A;  4RB2 C;  4WX9 A;  4WXH A;  5D6E A;  2K02 A;  4U0Y A;  3LA3 A;  3NQO A;  1Z05 A;  1FSH A;  1K78 B;  2A69 F;  3ISP A;  2Q8K A;  1T39 A;  3K2Z A;  1B9N A;  1BJA A;  4YFX F;  2RDP A;  5E1W A;  3J80 K;  2PMU A;  4EJU A;  3F8N A;  3LFK A;  3JSO A;  3CUO A;  4OIN F;  3I59 A;  3SXY A;  2FE3 A;  2VXZ A;  1R1U A;  2FF4 A;  3QOP A;  3ECH A;  3QU6 A;  1W5S A;  1B1B A;  2RVC A;  1HST A;  5K5O A;  5JR3 A;  2MLK A;  3GZ5 A;  2XAH A;  3I4P A;  3KET A;  1O7F A;  2J5P A;  3HTU A;  4F7Z A;  2H6C A;  3R60 A;  2Y75 A;  3KP6 A;  5EEH A;  1WRJ A;  3GFI A;  2IW5 A;  3KP3 A;  1K6O A;  4G9Y A;  1FBQ A;  4PDK A;  4A0Y A;  4ZYG A;  2FNP A;  3L7W A;  3F3X A;  2K27 A;  3WTY C;  4G7H F;  3KP7 A;  2P7V B;  3G73 A;  3K9T A;  4HF2 A;  3Q9S A;  5F6F A;  4CYD A;  1D3Y A;  4JBA A;  2UWM A;  1G6N A;  1DP7 P;  2PJP A;  1XGM A;  1ZGA A;  1XMK A;  2R7F A;  2OZ6 A;  1R23 A;  4UVB A;  3KP5 A;  5L3G A;  1OYI A;  3JW4 A;  1MGT A;  2OQG A;  4HLX A;  3BJO A;  3TOA A;  4OIR F;  2M45 A;  2H09 A;  4A12 A;  2IP2 A;  3GXO A;  2ZME A;  2ACJ A;  1QO0 D;  4CZZ A;  3ERE D;  4S05 A;  2M5W A;  4WXD A;  2JRT A;  5JI6 A;  4RS8 A;  1R58 A;  1RIO H;  1D8J A;  4L9J A;  5FLX K;  4EGZ A;  4HF1 A;  3V4G A;  3TO6 A;  4A0Z A;  1T2K A;  5DDG A;  5DUI A;  2HTJ A;  2HQR A;  5HLH A;  1XGN A;  1SD7 A;  4WXC A;  1I1S A;  2XVC A;  2FBK A;  2VON A;  5CLS A;  2UZK A;  1IXR C;  1S6L A;  3CUQ B;  1J7K A;  2ZNZ A;  3HUG A;  5D4S A;  1I27 A;  5KK1 A;  2WWY A;  1HSJ A;  3RDI A;  5H6R A;  5DUK A;  1S7O A;  4HAM A;  3HRT A;  5CYV A;  1ZYR F;  3FMR A;  2D2W A;  3SZP A;  2DBB A;  5FB2 A;  3U1D A;  1G3T A;  4Z2Y A;  2KIU A;  3R6S A;  3JAM K;  4OOI A;  2W57 A;  2Q2E A;  1BM9 A;  2E1N A;  4PZJ A;  2P5K A;  3SFZ A;  4N9H A;  2COM A;  2UXX A;  5D5X B;  3MCZ A;  2DPU A;  2P5L C;  3V7S A;  1PP7 U;  1O3T A;  1QGP A;  3R0J A;  2Z99 A;  3FMS A;  2EV5 A;  4L0Y B;  3ZMD A;  1BI3 A;  4ZYD A;  5AIQ A;  1XSX A;  3AAF A;  1TQP A;  2GZW A;  5CVV A;  4ENK A;  2H27 A;  4LG0 B;  3QPT A;  4EJT A;  2IA1 A;  3FM3 A;  3T1B A;  3CO7 C;  2VOP A;  1DPU A;  3VOD A;  2ZME B;  3ZMS A;  4HV5 A;  4A5N A;  1HXD A;  2RGV A;  3EQL F;  1KQ9 A;  1SFU A;  3IL2 A;  1OPC A;  4UNO A;  3P9C A;  4NQW A;  3RPQ A;  2M8E A;  3CUQ C;  2FU4 A;  4GO1 A;  4YG2 F;  1BC7 C;  1YG2 A;  2QQ9 A;  3H92 A;  2FA5 A;  1DDN A;  2PQ8 A;  2A5Y B;  5LHG A;  2YX4 A;  3ZMT A;  4OU0 A;  2H94 A;  3OOP A;  3RYR A;  4BQA A;  2EV6 A;  2HTS A;  2MLG A;  4U7B A;  5HVQ C;  1HW1 A;  2IT0 A;  4KIB A;  4U0V A;  5E8I A;  4PGG A;  2HYG D;  1EV7 A;  2FBH A;  3IHU A;  1RNL A;  2OBP A;  4HLY A;  2HQN A;  1E2X A;  4BH9 A;  1F5T A;  3RKW A;  3TKY A;  1RUO A;  2W84 A;  2CQK A;  3KEQ A;  4LB5 A;  1IUY A;  2QBY B;  4BHC A;  2V1X A;  5CJ9 A;  1O3R A;  3MWM A;  1QQI A;  1G4D A;  3LA2 A;  1FWZ A;  5EEG A;  3HYI A;  4GGG A;  1SAX A;  4S04 A;  1P4X A;  2OAZ A;  1R5H A;  1SD5 A;  3BRO A;  1J2X A;  2B0L A;  2WC2 A;  2KJB A;  1ZAO A;  1HKT A;  3VEP A;  4Y17 A;  4MEX F;  2VN2 A;  2ESN A;  4HQE A;  4P9F A;  4G7O F;  4K2E A;  2DQL A;  1JHF A;  5BQT A;  4U7D A;  2QM3 A;  1KYW A;  2V79 A;  4RB1 A;  3DP7 A;  4KMU X;  3E6M A;  1LEA A;  3LST A;  4L18 B;  2CFX A;  4Y13 A;  1P4W A;  1TBX A;  4HX4 A;  4I02 A;  2JSC A;  1GXQ A;  5FO5 A;  4OIQ F;  1TLH B;  3QP6 A;  3FXU A;  3TQN A;  1CF7 A;  2V6C A;  2XKO A;  2EV0 A;  3R4K A;  4AIK A;  3WTT C;  1U8R A;  4DNC A;  4LFU A;  4A6E A;  2ZCW A;  4G8X A;  2CWE A;  3GFL A;  3PFI A;  4M72 A;  4OMY A;  3IKT A;  4BHB A;  5HLI A;  2IA2 A;  1FOK A;  2QVO A;  2XHK A;  2DO7 A;  3WTW C;  2HOE A;  3F72 A;  4HZF A;  2K7L A;  1Z91 A;  2FQ3 A;  1F1Z A;  2QEN A;  4IRG A;  1IW7 F;  3HTS B;  4AD9 A;  2QLZ A;  3WGH A;  1MD0 A;  3DFG A;  2LKP A;  4LD5 A;  3FZV A;  1BI0 A;  2P4W A;  4CIC A;  4L9N A;  1UCR A;  3HRM A;  3TO9 A;  2JZY A;  2P7C B;  3BPX A;  3L09 A;  3ZP5 A;  5DCF A;  1I5Z A;  4L5J A;  4I0A A;  2VE8 A;  3KE2 A;  3M9A A;  2JT1 A;  4AIJ A;  4ASN A;  4PGH A;  4BHP A;  3HSF A;  1R5G A;  2DPD A;  2DK8 A;  4O5V A;  4ESF A;  1ZRD A;  1W7P B;  2XIG A;  2PMH A;  2TDX A;  2VBW A;  2PI0 A;  3P9I A;  2P8T A;  5LEJ A;  2VE9 A;  1U5T C;  5D8K B;  1SMT A;  3G3Z A;  3IWF A;  5CVJ A;  3S2W A;  1YTY A;  3K0L A;  5LBQ A;  3GUD A;  4BXU A;  3WTV C;  5DYM A;  1XSV A;  1ON1 A;  2JPC A;  2CO5 A;  2O0Y A;  3DPL C;  5J6X A;  3MAJ A;  4L5I A;  3KCC A;  4U88 A;  1UHW A;  2NYX A;  3C7J A;  3C3W A;  4EGY A;  3K1N A;  4LMY A;  2HEO A;  3J81 Z;  3I5U A;  5D5V B;  3D0S A;  3M8F A;  1LQ1 A;  5J8F A;  3WU1 B;  3ZQ7 A;  3KP2 A;  3OV8 A;  4CHU A;  3DPT A;  1ON2 A;  5LEK A;  2IRF G;  3T8T A;  2A6E F;  2CG4 A;  3ABT A;  2HYF A;  4EM0 B;  2EFQ A;  4A0X A;  3I58 A;  3RJP A;  3CDH A;  4LLL A;  3ECO A;  2X0L A;  1G3W A;  1P4A A;  2R3S A;  4GXO A;  1QNT A;  1YW9 A;  4KIC A;  2HS5 A;  2DQR A;  3RKX A;  4BYY A;  5FLX Z;  4FX4 A;  1Z7U A;  2W25 A;  3ULQ B;  1IN8 A;  3SHF A;  4IF4 A;  2WV0 A;  4EJV A;  3FX3 A;  5E17 F;  1LEB A;  3JSP A;  1HKS A;  4M9X A;  1GVJ A;  4M71 A;  1R1V A;  1L3L A;  3R0A A;  3U9G A;  5DCM B;  3KP4 A;  4RB3 C;  1P6R A;  2D45 A;  3DXJ F;  3BPV A;  3F6O A;  2NNN A;  4MNU A;  4HA8 A;  1YW8 A;  1LNW A;  4ZYE A;  2KIM A;  3MZH A;  1ZHF A;  2FOK A;  1YO5 C;  4ZYH A;  4ZH4 F;  2MC3 A;  4ZZD A;  2FNA A;  4KT5 C;  4PCQ A;  3BJA A;  2VC1 A;  4A2U A;  2RNJ A;  3PQJ A;  3L2C A;  4KIF A;  1ZN2 A;  1B4A A;  5H6Q A;  5IT9 K;  3RTR A;  2M30 A;  2J5O A;  5LHH A;  1NHA A;  5BPI A;  4M6Y A;  1HW2 A;  2UXN A;  3V8J A;  3LAJ A;  1BC8 C;  2OA4 A;  1R36 A;  4EQQ A;  1K78 A;  2DAO A;  3K69 A;  3HOS A;  2HDC A;  1SFX A;  2RV8 A;  4KMF A;  2MA3 A;  1T38 A;  4JK1 X;  2EFP A;  2X4H A;  1HBX G;  5A2Q Z;  1O7L A;  1RI7 A;  1W7P D;  3MQ0 A;  1OMI A;  1TQI A;  4YIF A;  3IRR A;  4KN4 X;  2XAS A;  2YX7 A;  1BN5 A;  3E5Q A;  4RGR A;  4M73 A;  4ENN A;  3F8B A;  1CGP A;  1YQA A;  2ISY A;  3P9K A;  2PFB A;  3W6J B;  2OU2 A;  1FLI A;  1RUN A;  2QQA A;  3BP8 A;  2NAZ A;  2F5C A;  2PBI A;  4I01 A;  5TRD A;  4I98 B;  4O6J A;  5LGN A;  3FMQ A;  3HSR A;  4P9U A;  4N0B A;  3LWF A;  1FBS A;  1B6A A;  1QZY A;  3HRU A;  4QWQ A;  1FC3 A;  1YLF A;  4KDP A;  1ZGJ A;  4YFN F;  3F8M A;  1KA8 A;  1OYW A;  2OQR A;  5FGM A;  5L3F A;  2EJR A;  2M87 A;  4G94 A;  2V1D A;  5LRR A;  2MH9 A;  3IWZ A;  4YII A;  4M9Z A;  5DCM A;  2VT2 A;  4O3M A;  5D5W B;  4L9T A;  1B9M A;  1OYY A;  4MQV A;  5BS6 A;  2F2E A;  3QU3 A;  4UV8 A;  5DD4 A;  1I1G A;  1ZH5 A;  3WE2 A;  1KU7 A;  3ZMU A;  3QP5 A;  3RYP A;  5CVR A;  4WWC A;  2QWW A;  1GXP A;  3EYI A;  3F6V A;  2P6T A;  1IN5 A;  5FD6 A;  4ENM A;  2A61 A;  3K1M A;  3JTG A;  1WSU A;  3K1P A;  3BDD A;  1E17 A;  3CTA A;  2GA1 A;  1LDK B;  3DV8 A;  2DFI A;  1A04 A;  3BWG A;  1UHM A;  1IRF A;  1R22 A;  2KRF A;  4XSX F;  2A07 F;  4MQ9 F;  3JTH A;  2V1U A;  2RC4 A;  2A68 F;  3ZMV A;  4LK1 F;  1BI1 A;  3CUQ A;  2QBY A;  3FHZ A;  4P55 A;  4RB0 A;  3E97 A;  5FD5 A;  4RAY A;  5ICF A;  3HOT A;  5ERI A;  1LVA A;  1J5Y A;  1ZRF A;  3O3K A;  4KYW A;  1XGS A;  2QUF A;  1FT9 A;  4A6D A;  3V8L A;  3FWE A;  2VBY A;  1IAW A;  2XGX A;  2STT A;  1WQ2 A;  2KIF A;  1OR7 A;  3Q5F A;  4OMZ A;  1KU2 A;  4TV7 A;  3GX4 X;  2ELH A;  2LDU A;  5HDK A;  1BIA A;  3GZ6 A;  1MDM B;  2DW4 A;  4FX0 A;  1REP C;  4CXF A;  2LSO A;  3F22 A;  2RQP A;  2DK5 A;  1P92 A;  5AIP A;  2H6B A;  2K4B A;  3IKV A;  2NRA C;  4LB6 B;  1LJ9 A;  3J80 Z;  4NHJ A;  2ZO4 A;  3BY6 A;  3FF5 A;  3M8E A;  1C0W A;  1P2F A;  3DKW A;  2QQB A;  3ABU A;  1T98 A;  5L3C A;  1J9I A;  5E20 A;  1FYL A;  1FPQ A;  4UXN A;  3ZN1 A;  4YFK F;  4KUM A;  4M6X A;  3T5X A;  1SD4 A;  2E7W A;  1ZG5 A;  1R1T A;  2K86 A;  2Q0O A;  2D1V A;  3L9F A;  4ZZL A;  1CF7 B;  4OIO F;  4UUV A;  1JXS A;  4N9I A;  4P96 A;  2E1C A;  4LLG F;  2DTR A;  4CGZ A;  5IT3 A;  2EA4 A;  5ICE A;  2W24 A;  4XLP F;  4G6D A;  3TDZ C;  2GQQ A;  3MEX A;  3WTU C;  1BI2 A;  1G3S A;  1O3S A;  4UVC A;  2ZJ2 A;  2M1B A;  1AWC A;  1W4M A;  4H0E A;  1LB2 A;  5D8L B;  2HWV A;  4HV6 A;  3ML6 A;  3E6B A;  1FP2 A;  2LF8 A;  4EM1 A;  3EUH A;  2ESH A;  1KQ8 A;  2G7U A;  2O8X A;  2EFO A;  3E3V A;  1IN6 A;  4JQF A;  4AIH A;  2VBZ A; 
#chains in the Genus database with same CATH topology
 2XAF A;  1LFB A;  1Z3Y A;  4MGR A;  4HNT A;  5JFR A;  3BZC A;  4D7N A;  4MHG A;  3PUF A;  2EFW A;  2IS2 A;  4B48 A;  1XSD A;  3OMY A;  1UG0 A;  4HST A;  5HOO A;  1NTC A;  4XOP A;  4M6V A;  1DPR A;  2RKH A;  2LRD A;  4UUT A;  5IOY A;  2O6G E;  3VB2 A;  4XLE A;  1BIB A;  1AOY A;  1S8N A;  5ILS A;  2V26 A;  5JHU A;  5M5W J;  1DGW Y;  1SD6 A;  4G7Z F;  3GYH X;  1IN4 A;  1EF4 A;  2DMU A;  1SEU A;  5HS8 A;  4E7L A;  1VND A;  5TIS C;  3ZPL A;  2VL8 A;  3OYH A;  2KZV A;  1ZEL A;  2D1H A;  2XAG A;  4LGW A;  3S17 J;  5L3D A;  2IGK A;  1HDD C;  3M3Y J;  1TW2 A;  1VQ8 I;  3ZN0 A;  1U5T B;  3FM5 A;  4IHT A;  2K9Q A;  2I8D A;  2OCE A;  3KIO A;  2BW3 B;  1V3F A;  4Q47 A;  3LSK A;  1G3Y A;  1TWF J;  1YYV A;  3GFJ A;  3P5J A;  4GCV A;  5H2F C;  4MFE A;  5J8C A;  2ZJQ F;  5B1A H;  2LKS A;  1XB4 A;  3HC7 A;  4IPA A;  5L3E A;  4OAY A;  4PK4 A;  4ZDO A;  1JT6 A;  4E7J A;  2ZBK A;  5J3L A;  2IGN A;  1U6G A;  1IF1 A;  2R5Y B;  2Y2Z A;  1MMN A;  5HDG A;  1FMW A;  4D5C A;  2ZME C;  3V8K A;  3OIP A;  2YU3 A;  4NB5 A;  1ENH A;  1PDN C;  1HC8 A;  5C44 J;  1KU9 A;  1EA3 A;  4WK8 F;  2JJ7 A;  3HSE A;  5DEQ A;  4HDV A;  4YRV A;  3BG7 A;  2XRO A;  3K4B A;  4IXA A;  2L7F P;  2DMP A;  2MG4 A;  5J47 A;  4A3J J;  2E36 A;  3CJT B;  4A93 J;  3A4C A;  4BBR J;  5D5U B;  2CYY A;  2KFD A;  5FKN A;  3BR1 A;  4BGD A;  4C3I J;  4QLC U;  4HW0 A;  1BR4 A;  2HDW A;  2XPW A;  3EDP A;  4ANJ A;  2FXA A;  4NBQ A;  5HLT A;  5D6F A;  1RR7 A;  3TO7 A;  2MFZ A;  2P5V A;  5F1R A;  1R00 A;  3NRV A;  3KYL A;  4EM2 A;  1DQU A;  1Y56 A;  1K4S A;  2PMZ N;  4ESJ A;  3IH4 A;  1T0F A;  2BHY A;  2CGP A;  4KT6 A;  2RN7 A;  4J01 A;  4YIR X;  3PO2 J;  2Z16 A;  4NC7 A;  3ZXS A;  2HVS A;  1IXC A;  1UEL B;  2FX0 A;  2BE5 F;  3MZY A;  4ZDP A;  3VDX A;  2I10 A;  3CF2 A;  3FXM A;  4CDG A;  2KJC A;  2OD5 A;  2KP6 A;  1A36 A;  1U8B A;  2PLY A;  1XG1 A;  1B59 A;  1I50 J;  2F5F A;  5JLX A;  5J4V A;  2OTJ I;  2WBM A;  2E7X A;  3CJQ B;  5M5X J;  3S16 J;  5L3B A;  5J1U A;  5IP6 A;  3WTZ A;  1XPX A;  2EB7 A;  1QU3 A;  1V55 H;  2MD5 A;  2STW A;  1KYZ A;  3RI4 A;  4GYI A;  3S1Q J;  4G6T B;  4A3L J;  3QRF F;  3M4O J;  2IA0 A;  5K1Y A;  1IV6 A;  3VWB A;  2WY8 Q;  1U78 A;  1QVT A;  4GFB A;  4HNV A;  2IS1 A;  4E70 A;  3F8C A;  2JA7 J;  3RKY A;  2GOX B;  4II2 A;  1UAA A;  2R7R A;  4PFP A;  1MJB A;  3CCV I;  4A69 C;  3N97 A;  1D5V A;  1WWX A;  5EYR A;  2HZT A;  4B3X A;  5IOZ A;  1OJL A;  3WTS C;  1F4K A;  1Z6T A;  5FKO A;  3O2P E;  3SQN A;  1XMX A;  5DTD A;  4C2U A;  1TNS A;  1ZR4 A;  5BPD A;  2ECB A;  4A5M A;  2VBX A;  5E18 F;  1JKP C;  2CV2 A;  1FZP B;  1QZZ A;  2K4J A;  3CP2 A;  2CFO A;  5EEA A;  2V9V A;  4WCG A;  1T6S A;  1ZAR A;  2L0K A;  4RAZ A;  5IT9 Z;  3FKI J;  2FQ4 A;  1XC5 A;  2VPL A;  2QZ8 A;  4DBR A;  1L0O C;  3C2G A;  4G6Q A;  2Z33 A;  4A3E J;  1SMY F;  2HR3 A;  3L00 A;  3A0H C;  3DKX A;  4CO8 A;  3IC7 A;  3LNQ A;  1E3H A;  1OCR H;  3OIQ A;  3U2R A;  4ABZ A;  2FUG 2;  4UHT A;  3LSJ A;  1ERD A;  2EH3 A;  3BCB A;  5HS9 A;  4JYK A;  4XN3 A;  1VQL I;  2DT5 A;  1K61 A;  1XCB A;  3H9Q A;  1HLV A;  2WB1 A;  3GO5 A;  2GWR A;  3CCE I;  3E6D A;  4XBF A;  1TWC J;  2JPB A;  2XRN A;  2M7A A;  1HKQ A;  1OIS A;  3JRA A;  1U5T A;  1BOB A;  4LIU A;  2AO9 A;  4XK4 A;  5FKM A;  2V7F A;  1WKM A;  5LGU A;  3HOW J;  2HXO A;  2L54 A;  2L4A A;  3WG9 A;  1D8K A;  2Q1Z B;  2ID6 A;  2VAS A;  2ZKZ A;  4DGW B;  1PUE E;  2I5U A;  2H1L A;  4LIT A;  5DD8 A;  5BOX A;  4YEL A;  5HS7 A;  4A3C J;  4PJL A;  2XKP A;  5IYD J;  3ONQ A;  5ILV A;  3I59 B;  2GIV A;  4X0G A;  1ONV A;  3B73 A;  3IAS 2;  1W0U A;  2XAQ A;  3ELK A;  3DEU A;  3K4M A;  2OC6 A;  4ZJZ A;  1X2M A;  3WGG A;  4CA0 A;  5IP7 J;  1TZL A;  3OYL A;  1FJL A;  4XIC A;  3DCF A;  1SFK A;  1USS A;  2Z5U A;  3VFZ A;  4I76 A;  1WI9 A;  1D5Y A;  3L2Q A;  1N77 A;  4RGS A;  1YIO A;  2W85 A;  1GV2 A;  2DT6 A;  4Z6Y A;  3GLL A;  4F91 B;  2MH2 A;  4LJZ F;  4U0W A;  2NVT J;  1MDM A;  2VQC A;  3DBH B;  5CVU A;  1MBG A;  5EG0 B;  1HA8 A;  3FXJ A;  4EJO A;  3I4M J;  3DBL B;  4LG0 A;  1PJR A;  1VQO I;  1OR7 C;  2IBD A;  4D1Q A;  2A6H F;  5F08 A;  1QVU A;  3GEZ A;  1AU7 A;  1B8I B;  3AG4 H;  3HKZ N;  3F21 A;  1MJ9 A;  3DPU A;  1OCC H;  2ID3 A;  4BEH A;  2XF6 A;  5C4J J;  1RZ4 A;  1K79 A;  1ZRC A;  2AS5 F;  3WGI A;  1S29 A;  3MFK A;  2FRH A;  1MSF C;  1TNT A;  2JUC A;  4ON0 A;  1D0Y A;  1LDJ A;  4BAY A;  2XDV A;  3I71 A;  4B09 A;  3O8G A;  3DKY A;  3EET A;  3C2H A;  4KNY A;  2R7S A;  2TRT A;  3OYE A;  1G59 A;  2JA6 J;  2PX9 A;  3PSF A;  4IHV A;  2JTV A;  1ULY A;  3SEQ A;  1FY7 A;  1LUJ B;  2JA8 J;  1WJD A;  4R1H A;  2VT3 A;  1Z7L A;  3BG9 A;  3OSG A;  2L5Q A;  5GTH C;  2ELJ A;  3IAM 2;  1ZLK A;  3S3O A;  2IGM A;  3IRQ A;  2BHZ A;  3DF8 A;  3PUB A;  4NDL A;  1MZB A;  2EFN A;  4BQO A;  4ZTJ A;  2F5D A;  3EYY A;  1MBK A;  4PJN A;  4BUP A;  3IV5 A;  3W6V A;  5HDN A;  3CZ6 A;  3OYC A;  1Q1H A;  3FXR A;  1WI3 A;  2CUE A;  3OYK A;  5F04 A;  3GTJ J;  2GXG A;  2KRH A;  1DU6 A;  4UB6 C;  2AQE A;  3SZT A;  3FXQ A;  4B1R A;  1BBY A;  3QPL A;  1MJA A;  2MSY A;  4XOR A;  2LBF A;  1FYK A;  4I7H A;  3PNV A;  4IVN A;  4BNC A;  5E3N A;  3M7G A;  5F27 A;  2QYO A;  2XV4 S;  3I64 A;  2LD5 A;  3H3Z A;  2QSF X;  2JVG A;  2ETH A;  2NS7 A;  2WAF A;  3RIR A;  4L9V A;  1J75 A;  4JX4 A;  4BDZ A;  5IPA A;  5F1J A;  4Y15 A;  1R6R A;  5TJJ A;  3I0T A;  1JKQ C;  2DMT A;  4I99 C;  1X3U A;  2BGC A;  1LDD A;  1FSE A;  1GHC A;  2PG4 A;  3ROU A;  4C3J J;  4N4O B;  2A3S A;  4XID A;  2LRE A;  3E5U A;  4KIG A;  3VYT B;  2W7N A;  3Q0U A;  3P7N A;  1H9T A;  3TED A;  4Q48 A;  2N8G A;  1IO2 A;  3L1P A;  2NNY A;  3PJR A;  5FFZ A;  2CMP A;  1YW7 A;  4M3F A;  4RAF A;  4XLF A;  1OCP A;  1WPK A;  3KLN A;  5E1Z B;  1FX7 A;  2LFB A;  2QF7 A;  2Y48 A;  5D4R A;  3DLA A;  3KZZ A;  1ZTR A;  3Q0V A;  5HNH A;  1MBH A;  3KZY A;  2NOJ B;  1IDY A;  1S72 I;  3PL8 A;  1FP1 D;  3W3C A;  4BS9 A;  3CMA I;  1RES A;  1ITY A;  3A02 A;  1GT0 C;  3ABM H;  4HX8 A;  2WB1 N;  3CCY A;  2DN0 A;  1KU3 A;  3H3U A;  4PJJ A;  3ESW B;  2Y0M A;  1YFH A;  2ADU A;  4FIS A;  2V1N A;  3H5R A;  3V7R A;  4EV0 A;  5FJ8 J;  2CQX A;  3JRG A;  1KQ0 A;  3L2V A;  4BQQ A;  3KEO A;  2H8W A;  4BQN A;  5FRO A;  5JVG F;  4X6A J;  4D0P A;  1Y0N A;  1N78 A;  3CJN A;  3KYC B;  3PIO F;  3F23 A;  3L2R A;  2R7T A;  4P5O A;  2HKO A;  3CLO A;  2GXB A;  1OLT A;  5ICC A;  2F5E A;  3WTX C;  1UB9 A;  5K5Q A;  5LGT A;  4CCM A;  4BL0 B;  3J7Y J;  3GFM A;  1B8I A;  2LNB A;  1J59 A;  3O6B B;  1XDS A;  4OWR B;  1FYM A;  2JSP A;  4IRH A;  2CW8 A;  1IRZ A;  2JMW A;  3BOQ A;  3OR2 C;  1D1A A;  3BZ6 A;  3I54 A;  5EZG A;  2FEZ A;  5CKT A;  1SVM A;  2CSO A;  2O61 A;  5ILU A;  4A3B J;  4UVA A;  1W36 D;  2NS0 A;  3HJE A;  3KLO A;  4C2M J;  1VZ0 A;  1ZQ3 P;  2R0Q C;  4M74 A;  3CES A;  3E1S A;  3JAM Z;  1XTA A;  2L4M A;  4FHT A;  4BJT A;  4F55 A;  1IGN A;  3CCS I;  1PVE A;  3REO A;  4I0B A;  3S3N A;  1ETX A;  2L7Z A;  4Q4Z F;  1EH8 A;  3K4K A;  3GVA A;  2DDB A;  3C1D A;  4LK0 F;  3CC7 I;  2M4K A;  4BJ5 C;  1WGX A;  3ERM A;  4DJA A;  2CQQ A;  1IRX A;  3ZMZ A;  4BXF A;  5K7F A;  3H9J A;  5HOD A;  3HIF A;  5JVT A;  4S0H B;  2BV6 A;  2CU7 A;  2IJL A;  1XN7 A;  3FKJ A;  4AWX B;  5GAH J;  2G9W A;  3LQR A;  2ZJP F;  4KA4 A;  1K7A A;  5ED4 A;  5AON A;  2CV1 A;  1FBU A;  4KJZ A;  4QPQ A;  4ETS A;  2DU9 A;  4G12 A;  2IS4 A;  4R79 A;  4W1U A;  2IAI A;  3LFU A;  5EF6 A;  1UST A;  4HOB A;  2GAU A;  3C2B A;  3GCM A;  4XQF A;  2IPQ X;  2MBF A;  3S2H J;  3SEZ A;  2L01 A;  3CCQ I;  4ENJ A;  9ANT A;  3T8R A;  2D5V A;  1IXS B;  1RRJ A;  4IJA A;  4ESB A;  2HVR A;  1QPI A;  1R49 A;  1ZG3 A;  5IYC J;  1QBJ A;  2LH9 A;  5F64 A;  1JE8 A;  3J81 K;  3RQI A;  3HRS A;  5K5R A;  3F0C A;  2BYV E;  2R7D A;  4CSW A;  2KKO A;  4XLC A;  4XMY A;  5ICG A;  3S2D J;  3PM1 A;  1IZ1 A;  5KVR A;  4F93 B;  1SFO J;  2VXD A;  4E7Z A;  1V4R A;  4IL6 C;  4XKV A;  1QPM A;  1JHH A;  2O3F A;  1S7A A;  3H36 A;  4KFC A;  3WOD F;  4IO9 F;  1HQC A;  1U3E M;  1IV8 A;  1G2H A;  3QOE A;  1Z1D A;  4L0Z B;  4IHS A;  1O3Q A;  1O57 A;  2LTP A;  3M1E A;  5FLM J;  5J1R A;  3DQV C;  3VOE A;  1VQ7 I;  3D5S C;  6PAX A;  3PQK A;  4RGU A;  2WAQ A;  1YS6 A;  3BJ6 A;  1VQ5 I;  2CV0 A;  1S3J A;  1ZG1 A;  1QA6 A;  2BY0 A;  2Z3Y A;  4GRI A;  3TOB A;  4HBL A;  4A3M J;  2Y9Z A;  2XGE A;  3FIS A;  4XL9 A;  1O4X A;  4R8H A;  3WHC A;  3VSL A;  1D1C A;  4HYE A;  5JHF A;  3DTI A;  2VC0 A;  3D5L A;  2OZU A;  1Y0U A;  2GA2 A;  5KCM A;  2ISZ A;  4XR6 A;  4CYC B;  5A2Q K;  2GIZ A;  4QTR A;  4I2O A;  1WZ2 A;  3CF5 F;  4RA2 A;  1YRN B;  4EMS A;  1T56 A;  2FSW A;  3LSP A;  2FBI A;  2O03 A;  5HLG A;  3HL2 A;  1J0R A;  4RBO A;  1DUX C;  1W7P A;  3E5X A;  2XAJ A;  3QAH A;  4MTE A;  1YS7 A;  2BEO A;  1KGS A;  4XKC A;  2OV7 A;  2IEK A;  3J7A O;  1AKH B;  5DS9 A;  1JUP A;  2C6Y A;  1I6X A;  3F8F A;  5BNG A;  5H20 A;  1XGO A;  3OYB A;  1MMA A;  3V7C A;  3TDU C;  2DMQ A;  5EZH A;  4LLN A;  1R7J A;  1ODD A;  4Y7N J;  2YR2 A;  3S8P A;  2AXL A;  3HHH A;  2ZXJ A;  3B02 A;  4XRS A;  1ZLJ A;  4KN7 X;  5LRS A;  2WTE A;  3OYD A;  1SFE A;  1TW3 A;  1JGS A;  1TQM A;  2EWN A;  1X1D A;  3GW2 A;  3WU0 A;  2LF7 A;  2LY1 A;  2WY7 Q;  3JRE A;  1ZK8 A;  4HNU A;  2LG4 A;  1FNN A;  2DLL A;  2EK5 A;  3LQQ A;  5DV5 A;  5K7Z A;  3QPH A;  4IRI A;  3F9K A;  3GLX A;  2CW0 F;  2FMY A;  4OIP F;  1X1B A;  2E5Z A;  4EVI A;  3IH3 A;  3ZQF A;  2M7B A;  4UB8 C;  1XCV A;  5J40 A;  1MMD A;  4M3B A;  4XRF A;  1MBE A;  4FT8 A;  3JRF A;  3R61 A;  2MD0 A;  1F9N A;  5EG0 A;  2R4G A;  1A31 A;  1R5I D;  1IUF A;  4C2T A;  4AVP A;  2DA1 A;  4HX7 A;  4MTD A;  1FIA A;  4HF0 A;  1BA5 A;  2HFH A;  2PEX A;  3K2A A;  2ME0 A;  3LA7 A;  2YPR A;  3N4M A;  2P6S A;  1YE9 A;  2CUJ A;  2F6C A;  5CQE A;  4A3F J;  5LHI A;  5E1X A;  1K6Y A;  2M8G X;  4UV9 A;  3CMY A;  4LIV A;  3PNY A;  2F4I A;  2VOD A;  2HZD A;  1Y8Q B;  3OIO A;  1T33 A;  3T0Y A;  2G7H A;  4Y4R A;  3GWZ A;  4Q5S F;  1T95 A;  1PP8 F;  2Y0S A;  1H0M A;  4IKF A;  1XD7 A;  3BG3 A;  3HGY A;  1YX3 A;  2ZNY A;  1JT0 A;  1HW5 A;  2VJI A;  1MBF A;  3KEY A;  1ZRE A;  3OS0 A;  2HKX A;  3KFW X;  2L02 A;  1YJW I;  3K70 D;  2X9D A;  1A5J A;  2M3A A;  4JP0 A;  4MEY F;  2L9V A;  1W36 C;  5E8G A;  3GBG A;  2IVM A;  3QOD A;  3GF2 A;  1XMA A;  3Q9V A;  2X48 A;  2YS9 A;  3LSR A;  2DT7 B;  2ELK A;  1PYV A;  1WHU A;  3I55 I;  1WH7 A;  4Y3O A;  4B8X A;  3Q3S A;  4HQM A;  4C3H J;  3COA C;  2HOT A;  2R92 J;  3AL0 B;  3BG5 A;  2W4S A;  2X85 A;  3C18 A;  2PN6 A;  3W6K B;  3I53 A;  3WE3 A;  1Z6R A;  5EGO A;  4XOT A;  1W5T A;  1T0F C;  2R7Z J;  1H9G A;  3HHG A;  3OSF A;  1IN7 A;  2QSG X;  3GTL J;  1K4T A;  3NEU A;  1B72 B;  5KAI C;  3TGN A;  1U9O A;  1TTY A;  4M9S A;  2LBF B;  2Z9O A;  4DQ2 A;  5TGT A;  5LLQ A;  2ZFW A;  5BMZ A;  5M5Y J;  4BY7 J;  2F4M B;  3ZRG A;  1EH7 A;  2VOO A;  2X6O A;  2VKH A;  1XDU A;  1BOA A;  1STZ A;  4HPQ A;  4XSZ F;  3CO6 C;  1RPW A;  5F0C A;  2FML A;  3S32 A;  5E3O A;  4EJW A;  4W97 A;  4ZDL A;  1EH6 A;  2QKM B;  3BR0 A;  1IJW C;  1YRN A;  2DI3 A;  2CH0 A;  2XUB A;  3LSM A;  3RPU A;  4WF2 A;  1QZE A;  3ZOB A;  4XLN F;  4I09 A;  2A05 A;  3SJM A;  1YI2 I;  3E6C C;  2VUM J;  2KIS A;  2L3D A;  2E35 A;  2L9N A;  3SDB A;  3CCR I;  4HDU A;  2CJJ A;  1VTN C;  3ASO H;  2X6W A;  4GYG A;  2ZXW H;  4RGX A;  3RQ4 A;  1BW5 A;  1JUS A;  1U2W A;  1VQN I;  1UFM A;  5FFX A;  2YSR A;  2X51 A;  2R7U A;  1IRG A;  2Z2S B;  2JA5 J;  5E79 C;  3LAP A;  1MKM A;  1OKR A;  5KHD A;  2BBY A;  2HGC A;  5CVI A;  1Z9C A;  2LR8 A;  4QPO A;  2EA2 A;  4RB2 C;  4WX9 A;  3OYM A;  4WXH A;  5D6E A;  1SVO A;  2K02 A;  3HG9 A;  4U0Y A;  2TCT A;  3LA3 A;  3NQO A;  1Z05 A;  3D5R C;  3EUK L;  1FSH A;  1K78 B;  2A69 F;  2L7K A;  3ISP A;  1BR1 A;  3KYD B;  2Q8K A;  1T39 A;  1E3P A;  2K5C A;  1WFX A;  3L2U A;  3K2Z A;  3ZGK A;  1B9N A;  1BJA A;  2KDO A;  2RDP A;  5E1W A;  4YFX F;  2PMU A;  3J80 K;  3H0G J;  4EJU A;  3F8N A;  3LFK A;  3JSO A;  3CUO A;  4OIN F;  1MND A;  3I59 A;  3SXY A;  2G0E A;  2FE3 A;  2VXZ A;  1VQ6 I;  2E34 A;  1R1U A;  2FF4 A;  3UNG C;  1I3Q J;  4PFO A;  1LFP A;  3QOP A;  1OQY A;  3ECH A;  3QU6 A;  1SVL A;  1W5S A;  1B1B A;  2RVC A;  1HST A;  4C9Y A;  5K5O A;  3CCU I;  4U87 A;  5JR3 A;  2O9L A;  1S9H A;  2MLK A;  2KMU A;  1VQM I;  3GZ5 A;  2XAH A;  3I4P A;  3ABL H;  3KET A;  3FBN B;  1O7F A;  2J5P A;  3HTU A;  4F7Z A;  2H6C A;  3R60 A;  2OPT A;  2Y75 A;  2DFE A;  3KP6 A;  5EEH A;  1ETY A;  1Z77 A;  1W0T A;  1WRJ A;  3L2W A;  3GFI A;  3X2Q H;  4BEH B;  2IW5 A;  3KP3 A;  1K6O A;  4RLF A;  2FD5 A;  4G9Y A;  2AQF A;  2DTZ A;  3MKZ A;  1FBQ A;  3HOU J;  4PDK A;  2GOM A;  4A0Y A;  4ZYG A;  3H3V K;  2FNP A;  4A3K J;  2OUM A;  3L7W A;  4IOA F;  3F3X A;  2K27 A;  3DTK A;  3OL3 A;  4IEJ A;  3WTY C;  4G7H F;  2JQ7 A;  4QSH A;  3KP7 A;  4PJM A;  4CZC A;  2P7V B;  3G73 A;  3K9T A;  4HF2 A;  2K40 A;  3Q9S A;  2JK3 A;  4B4C A;  1SAU A;  5F6F A;  4CYD A;  1D3Y A;  1V54 H;  4JBA A;  2UWM A;  1G6N A;  1DP7 P;  2PJP A;  5EGO B;  1XGM A;  4ZYA A;  3A2K A;  2XRL A;  1GDT A;  1ZGA A;  1XMK A;  4E4H A;  3G1M A;  2R7F A;  4X1E A;  2OZ6 A;  1R23 A;  4UVB A;  3KP5 A;  5L3G A;  2A5W A;  1OYI A;  3JW4 A;  2ZSI B;  1G8X A;  1MGT A;  2OCC H;  2OQG A;  2Y31 A;  1RC9 A;  4BXX J;  4BKX A;  2ZSH B;  4HLX A;  1VFC A;  5B66 C;  1T8I A;  3BJO A;  4IHY A;  3TOA A;  4OIR F;  4IHX A;  2ZC2 A;  4HG2 A;  2M45 A;  2HXI A;  2H09 A;  3H9G A;  3J7Z I;  3K4N A;  4DIQ A;  2KDZ A;  4A12 A;  2IP2 A;  3GXO A;  2VJ4 A;  2VPR A;  2ZME A;  1P7J A;  2BY3 A;  3KPH A;  2ACJ A;  1ORK A;  1QO0 D;  4OAZ A;  4BE2 A;  4CZZ A;  3ERE D;  2DFF A;  4XON A;  3RZD J;  4S05 A;  2M5W A;  2LOO A;  4WXD A;  2JRT A;  3OR1 C;  4D7M A;  2FJ1 A;  3BR6 A;  5JI6 A;  4RS8 A;  1R58 A;  2ICW G;  1WJA A;  1RIO H;  2R7W A;  5K7H A;  3N05 A;  3MMY B;  1D8J A;  4L9J A;  1MSE C;  5FLX K;  4EGZ A;  5GP9 A;  2CS3 A;  4HF1 A;  1MIJ A;  2DDA A;  3V4G A;  3TO6 A;  2CRG A;  1NK2 P;  2OTL I;  4A0Z A;  3E7L A;  1T2K A;  5DDG A;  2DOE A;  1WJC A;  2LMD A;  3CJR B;  3VSK A;  1P9Q C;  3FXK A;  2HTJ A;  5DUI A;  2HQR A;  3BTC A;  3GTK J;  2CUF A;  5HLH A;  2M2E A;  1XGN A;  2PMZ A;  3CP8 A;  1SD7 A;  4AUX A;  4WXC A;  1I1S A;  2XVC A;  2FBK A;  3JRD A;  2RAE A;  2VON A;  5CLS A;  2UZK A;  1IXR C;  1S6L A;  4E7S A;  3CUQ B;  2WA0 A;  4NC8 A;  1J7K A;  1LPQ A;  2ZNZ A;  1NK3 P;  3HUG A;  5D4S A;  1I27 A;  2P0W A;  2HQ5 A;  5KK1 A;  2VKV A;  2WWY A;  1LE8 A;  1HSJ A;  3RDI A;  2K3P A;  4B3A A;  5B5E C;  5H6R A;  5DUK A;  1AKH A;  1S7O A;  2B7E A;  2LP0 A;  3JRH A;  4HAM A;  4UUS A;  3HRT A;  4LG3 A;  2W48 A;  1WJF A;  1WJ5 A;  2NVY J;  5CYV A;  3OS1 A;  3BR3 A;  1ZYR F;  4J00 A;  4MIM A;  4BU2 A;  3FMR A;  2D2W A;  2V9K A;  3SZP A;  3OYJ A;  2DBB A;  3KZI C;  2DA6 A;  3AL0 C;  5FB2 A;  3I9V 2;  4P1W A;  3U1D A;  1G3T A;  4Z2Y A;  2KIU A;  3R6S A;  1IDZ A;  4ZC3 A;  3ZQH A;  3BG6 A;  3NAU A;  4OOI A;  3JAM K;  1UZC A;  2E1M B;  2W57 A;  2Q2E A;  2DYS H;  1BM9 A;  2M4G A;  2E1N A;  3GTP J;  4PZJ A;  2P5K A;  2QQ8 A;  3SFZ A;  3AKZ A;  4BE1 A;  5FKK A;  4DBQ A;  3AFH A;  4N9H A;  5F0H A;  2COM A;  3PIP F;  3HPG A;  1X1A A;  1X2N A;  4HSR A;  2UXX A;  4E7H A;  1H89 C;  5D5X B;  3MCZ A;  2VQH A;  2DPU A;  2P5L C;  3V7S A;  1PP7 U;  2LKX A;  1O3T A;  1QGP A;  2EIL H;  4JOM A;  3CCM I;  4F92 B;  3R0J A;  2Z99 A;  1JI8 A;  4DYC A;  2R7X A;  3FMS A;  3MKL A;  2DXI A;  1ETQ A;  2EV5 A;  4L0Y B;  2Y69 H;  3ZMD A;  1BI3 A;  4ZYD A;  2UUZ A;  5AIQ A;  1WJE A;  2R7Q A;  1XSX A;  2LK2 A;  2A6T A;  2EQR A;  1TQP A;  3AAF A;  1N25 A;  3W2A A;  3DBR B;  2GZW A;  4GDF A;  3H5A A;  5CVV A;  4ENK A;  2H27 A;  3QYF A;  3TBI A;  3JRC A;  4LG0 B;  2KZG A;  3VPR A;  2L9S A;  1YHQ I;  4A3G J;  3QPT A;  4EJT A;  3HOV J;  3TP0 A;  2IA1 A;  2XC7 A;  3HOY J;  3FM3 A;  3U21 A;  3T1B A;  4V2F A;  3CO7 C;  2VJ5 A;  3TMO A;  5HNF A;  2H1K A;  2VOP A;  4F3Q A;  1DPU A;  3VOD A;  2ZME B;  1DU0 A;  1HOM A;  2VKE A;  3S3M A;  3ZMS A;  4HV5 A;  1JJ8 C;  4A5N A;  1HXD A;  2RQQ A;  3BR2 A;  2NXN B;  2RGV A;  3HZJ A;  3OY9 A;  2Y9Y A;  2MC4 A;  4AYB A;  5EJC A;  3EQL F;  2EIJ H;  1VQP I;  1KQ9 A;  4XRM A;  1SFU A;  3IL2 A;  1OPC A;  3QPS A;  4PJ0 C;  3P9C A;  4UNO A;  4NQW A;  3RPQ A;  3OYF A;  2M8E A;  1X58 A;  2BY2 A;  3CUQ C;  5GPC A;  2FU4 A;  1ACI A;  1B72 A;  1K83 J;  4BJ6 C;  3TW7 A;  2CW7 A;  4GO1 A;  4YG2 F;  1BC7 C;  1EJ9 A;  1R4M B;  1IC8 A;  1YG2 A;  2XGC A;  3S1M J;  2R7O A;  2QQ9 A;  3H92 A;  2VJJ A;  1Z3X A;  2FA5 A;  1YX5 A;  1DDN A;  2PQ8 A;  2A5Y B;  5LHG A;  2YX4 A;  3ZMT A;  3A01 B;  2VLA A;  4J19 A;  4OU0 A;  2H94 A;  3ZR8 X;  3OOP A;  3ABK H;  1BW6 A;  3RYR A;  3DU6 A;  1UG2 A;  4BY1 J;  2XSJ C;  4BQA A;  2EV6 A;  2HTS A;  2MLG A;  3K7A J;  4B47 A;  4U7B A;  4DYR A;  1LE8 B;  5HVQ C;  2HU9 A;  2E19 A;  1HW1 A;  1NH3 A;  2IT0 A;  4KIB A;  4CYC A;  4U0V A;  4I6Z A;  5E8I A;  4PGG A;  3FXO A;  2QKL B;  3QQA A;  2HYG D;  1EV7 A;  2FBH A;  4BDY A;  3IHU A;  4HRI A;  1RNL A;  2OBP A;  4HLY A;  2HQN A;  1E2X A;  1WH5 A;  4E7K A;  4KIT B;  4BH9 A;  1F5T A;  3RKW A;  2EZI A;  2GM4 A;  3TKY A;  2L9R A;  1RUO A;  3CQZ J;  2W84 A;  1VQ9 I;  1FOX A;  2NOG A;  3BQY A;  2CQK A;  2LVS A;  5C4X J;  3KEQ A;  4LB5 A;  1U9N A;  2H8R A;  1IUY A;  2QBY B;  4BHC A;  3HGG A;  2V1X A;  5CJ9 A;  4CCN A;  1O3R A;  3MWM A;  1QQI A;  4PSX A;  4F52 A;  1SC7 A;  3M8J A;  1G4D A;  1UMQ A;  3LA2 A;  2FOW A;  3LSI A;  2R5Y A;  3BCA A;  2HOA A;  2JWT A;  2EZH A;  1FWZ A;  4Y52 J;  5EEG A;  3MN2 A;  2ZXI A;  3HYI A;  3OYG A;  2XPV A;  1FOW A;  2HPM A;  4GGG A;  1SAX A;  3BTJ A;  4S04 A;  3VYS B;  1P4X A;  2OAZ A;  1R5H A;  1PUF B;  4XN0 A;  1P7I A;  1SD5 A;  4B43 A;  3BRO A;  4CCL A;  3FXL A;  1J2X A;  2B0L A;  2WC2 A;  3MVP A;  1VI0 A;  2LY2 A;  2KJB A;  1W5C C;  3G6E I;  1ZAO A;  4DW6 A;  1HKT A;  5IY5 H;  3VEP A;  1WVR A;  2HPI A;  4Y17 A;  3SZG A;  4MEX F;  4FCY A;  2EIK H;  2F48 A;  2VN2 A;  5GAD J;  2ECC A;  3FHN A;  3HOX J;  2ESN A;  4HQE A;  3FDY A;  1ETO A;  4P9F A;  3VYU B;  4G7O F;  4K2E A;  2DQL A;  1JHF A;  5BQT A;  2OJE D;  4U7D A;  2QM3 A;  5J1Y A;  1KYW A;  2B63 J;  2F4O B;  2VKD A;  2V79 A;  4RB1 A;  3DP7 A;  4IOC F;  4B44 A;  2Y30 A;  4KMU X;  1XS9 A;  3J7A Y;  2BVL A;  3E6M A;  5FKL A;  3K10 A;  1LEA A;  2PJR B;  1E3O C;  3LST A;  2NVU B;  1GV5 A;  4L18 B;  2CFX A;  4Y13 A;  1P4W A;  1TBX A;  1A6Q A;  3CMM A;  3HKZ A;  2K85 A;  4NQW B;  2QA4 I;  4HX4 A;  4I02 A;  2JSC A;  1GXQ A;  5FO5 A;  4AC0 A;  3RZO J;  4OIQ F;  3H0D A;  1X4P A;  1TLH B;  3BT9 A;  3QP6 A;  3FXU A;  3TQN A;  2ME6 A;  1CF7 A;  2R93 J;  2V6C A;  2IGO A;  2XKO A;  2EV0 A;  3R4K A;  2DJI A;  4AIK A;  3WTT C;  3I56 I;  1U8R A;  5J4Y A;  4DNC A;  2ZJR F;  4LFU A;  2O5R A;  4A6E A;  2ZCW A;  1J09 A;  2NVX J;  2EPF A;  1ZKG A;  4G8X A;  2CWE A;  1TWA J;  2MYS A;  3GFL A;  3PFI A;  4EEF G;  5IP9 J;  1MH4 A;  4M72 A;  3ZQL A;  4LOC A;  4OMY A;  1UHS A;  3IKT A;  1Y6I A;  4AVZ A;  2K9L A;  5HLI A;  4BHB A;  2IA2 A;  1FOK A;  2YU9 J;  2QVO A;  2HQA A;  2XHK A;  2DO7 A;  3WTW C;  2HOE A;  3F72 A;  4CUG A;  2DJN A;  4HZF A;  2K7L A;  1Z91 A;  5C3E J;  2FQ3 A;  1A35 A;  4V2G A;  2OF7 A;  1F1Z A;  2QEN A;  4IRG A;  1IW7 F;  3HTS B;  3DU5 A;  4AD9 A;  2DA2 A;  3I3L A;  2QLZ A;  3WGH A;  1MD0 A;  3DFG A;  1S5L C;  2LKP A;  4LD5 A;  1FOY A;  2W1O A;  2XB5 A;  3FZV A;  1BI0 A;  2VB6 A;  4MO7 A;  2QEX I;  2P4W A;  4CIC A;  3LMM A;  1YOV B;  4L9N A;  3HDD A;  3LSH A;  1UCR A;  3HRM A;  2WAQ N;  4RM2 A;  2YUS A;  3TO9 A;  2JZY A;  2P7C B;  3S1N J;  4BBS J;  3BPX A;  3L09 A;  2KRC A;  3ZP5 A;  5DCF A;  1I5Z A;  4XLA A;  4L5J A;  4I0A A;  3NWT A;  4M3E A;  2VE8 A;  3NWS A;  3DTE A;  3KE2 A;  3M9A A;  3TL4 X;  2JT1 A;  1X3Z B;  3SDG A;  4AIJ A;  5FRM A;  4ASN A;  1XX5 A;  1Q1V A;  4PGH A;  1ETV A;  3GZN B;  4BHP A;  3HSF A;  2BXY A;  3CME I;  1NG7 A;  1R5G A;  3ZCO A;  2DPD A;  3QYE A;  5FRN A;  2DK8 A;  2HYJ A;  4O5V A;  2E2I J;  2HI3 A;  4ESF A;  1TP4 A;  1ZRD A;  3K6G A;  4QIW N;  3MKY B;  1M1E B;  1W7P B;  2PMH A;  2XIG A;  2TDX A;  4NNJ A;  2VBW A;  3A0B C;  2PI0 A;  3P9I A;  1FTZ A;  2P8T A;  5LEJ A;  2VE9 A;  1U5T C;  5D8K B;  1SMT A;  3BC8 A;  2M0C A;  4ITV A;  1IG7 A;  4RM3 A;  1F43 A;  3G3Z A;  3IWF A;  1D1B A;  2GBY A;  2Q2E B;  5CVJ A;  3S2W A;  3K0L A;  1YTY A;  5LBQ A;  3GUD A;  4BXU A;  3WTV C;  1YIJ I;  4H4K C;  5DYM A;  4JX5 A;  1LVK A;  1LKX A;  3OOU A;  4DOZ A;  1XSV A;  1ON1 A;  3SFI A;  1FIP A;  2JPC A;  2K3F A;  3W2V A;  2CO5 A;  1OFC X;  2O0Y A;  3DPL C;  4II3 A;  2V6E A;  2EZK A;  3IP4 B;  5J6X A;  3WU2 C;  1HF0 A;  2X1C A;  1FEX A;  5F0F A;  3MAJ A;  1BJZ A;  2DA7 A;  4L5I A;  3KCC A;  4A3I J;  3DEE A;  2M9H A;  4AU7 A;  4U88 A;  1UHW A;  2NYX A;  3C7J A;  3H1C A;  3C3W A;  2KIQ A;  2HNH A;  4EGY A;  3GTQ J;  3K1N A;  1Y1W J;  1KON A;  4LMY A;  2HEO A;  3FBI B;  3J81 Z;  3RKQ A;  3QWL A;  1QHG A;  3I5U A;  1CQT A;  5D5V B;  3D0S A;  3HPH A;  3K4J A;  3M8F A;  5J8F A;  1LQ1 A;  3WU1 B;  3ZQ7 A;  3KP2 A;  3OV8 A;  4CHU A;  2LYC A;  1Y1V J;  1VF9 A;  2DCE A;  3DPT A;  1Y39 A;  2XGD A;  2DFH A;  3HXL A;  3RPU D;  4MFD A;  1ON2 A;  5LEK A;  1E0E A;  3M1C A;  2WAE A;  2IRF G;  3T8T A;  2A6E F;  2CG4 A;  3ABT A;  2HYF A;  1HDP A;  4EM0 B;  4XLH A;  2K9M A;  2EFQ A;  2NS8 A;  3QYB A;  3H5N A;  4NUB A;  4RAG A;  4RDU A;  1X1P A;  4A0X A;  2DYR H;  3I58 A;  1X4O A;  1N75 A;  3AG3 H;  2UV1 A;  1JJ6 C;  1JKO C;  4HEA 2;  2IS6 A;  3RJP A;  3O8H A;  3CDH A;  4CCK A;  2E2J J;  4LLL A;  4UY8 I;  2BVM A;  3ECO A;  2X0L A;  5GPA A;  3PNT A;  1MMG A;  1G3W A;  4D5F A;  1P4A A;  3ZQQ A;  2R3S A;  1QRY A;  4GXO A;  3RCO A;  1QNT A;  1YW9 A;  2BXZ A;  4FET A;  4KIC A;  2HS5 A;  2QSH X;  2DQR A;  3B6A A;  3RKX A;  4BYY A;  5FLX Z;  4FX4 A;  1BL0 A;  1MH3 A;  1H88 C;  3TP3 A;  4XKW A;  1Z7U A;  4AM3 A;  2W25 A;  3ULQ B;  1IN8 A;  3SHF A;  3ASN H;  4IF4 A;  2EIM H;  2WV0 A;  4EJV A;  3FX3 A;  5E17 F;  1LEB A;  2KQR A;  2XPU A;  3OWT A;  3JSP A;  1HKS A;  3BR5 A;  4IQ4 A;  1YJ9 I;  2CUZ A;  4M9X A;  2RRE A;  1GVJ A;  3ZQI A;  3UKG A;  1VQ4 I;  2M0M A;  3GME A;  4M71 A;  4AID A;  1R1V A;  1L3L A;  2B9S A;  3WHB A;  1V5F A;  3R0A A;  2JN6 A;  2M34 A;  3U9G A;  1AHD P;  4RLQ A;  1WJB A;  5DCM B;  3KP4 A;  4RB3 C;  1P6R A;  2AHQ A;  1FMV A;  5FLV A;  2D45 A;  3DXJ F;  4FAS D;  2W82 A;  3BPV A;  3F6O A;  2NNN A;  4MNU A;  4XKB A;  4HA8 A;  2CQ7 A;  3HM5 A;  1F36 A;  1WCM J;  3K4C A;  3CCL I;  2DOA A;  1YW8 A;  1LNW A;  4FTH A;  4ZYE A;  2KIM A;  3MZH A;  1D0X A;  1ZHF A;  1ETK A;  2FOK A;  1YO5 C;  2V4J C;  5CPR B;  4ZYH A;  4ZH4 F;  5DM7 F;  2MC3 A;  4ZZD A;  2FNA A;  4KT5 C;  1V5G A;  4PCQ A;  3BJA A;  2VC1 A;  4A2U A;  2RNJ A;  3PQJ A;  3HOZ J;  1U0J A;  3L2C A;  1RR8 C;  4CCJ A;  4KIF A;  3OYA A;  1ZR2 A;  1ZN2 A;  1B4A A;  4BE0 A;  1RKW A;  2XF5 A;  5B3S H;  5H6Q A;  4IX7 A;  5IT9 K;  3RTR A;  1I6H J;  2M30 A;  4E7I A;  4C30 A;  4UUS B;  1X3W B;  2J5O A;  5LHH A;  1NHA A;  5BPI A;  4M6Y A;  2HDD A;  1OCO H;  1HW2 A;  3BQZ A;  2UXN A;  3V8J A;  3LAJ A;  1BC8 C;  2OA4 A;  2DOD A;  1R71 A;  1R36 A;  4EQQ A;  4A3D J;  1K78 A;  1DGR M;  3Q0W A;  2DAO A;  2AXT C;  2BW3 A;  1JTY A;  3FK7 A;  3K69 A;  3HOS A;  2HDC A;  2DA3 A;  1SFX A;  1GUU A;  2RV8 A;  3BTI A;  4IHW A;  4KMF A;  2MA3 A;  1T38 A;  4JK1 X;  3K70 C;  2ZB9 A;  2KLO A;  2EFP A;  2X4H A;  2QGU A;  1HBX G;  5A2Q Z;  4BAC A;  1O7L A;  1MNM C;  1RI7 A;  2EZL A;  3GTO J;  1W7P D;  3SYT A;  3HBL A;  3MQ0 A;  4PSW A;  1TC3 C;  2VI6 A;  1OMI A;  1TQI A;  4YIF A;  3IRR A;  1A6I A;  4KN4 X;  4FE4 A;  2XAS A;  4XRS G;  3KX2 A;  3OYI A;  2YX7 A;  3EUA A;  4JX6 A;  3MKW B;  1BN5 A;  1APL C;  1VQK I;  1I39 A;  3E5Q A;  4M73 A;  4RGR A;  2HOS A;  4ENN A;  3OYN A;  2EBI A;  3CCJ I;  3F8B A;  1CGP A;  1YQA A;  2ISY A;  3P9K A;  2PFB A;  3W6J B;  2OU2 A;  1FLI A;  1RUN A;  2QQA A;  2WV1 A;  3BP8 A;  3S1R J;  2NAZ A;  2KT0 A;  2F5C A;  2PBI A;  1UJ8 A;  4I01 A;  5TRD A;  1AA7 A;  3OL4 A;  4I98 B;  4DZP A;  2L7M P;  2X1E A;  2DA5 A;  4O6J A;  5LGN A;  3EPZ A;  3FMQ A;  5E3M A;  3JRI A;  3HSR A;  2IXS A;  4P9U A;  5KAF C;  4N0B A;  2VQL A;  3LWF A;  1Z0X A;  2LY9 A;  3ZQC A;  3CD6 I;  1FBS A;  1B6A A;  1QZY A;  3HRU A;  2X6Y A;  3BLY A;  4QWQ A;  1FC3 A;  1JUM A;  2EIN H;  1YLF A;  4KDP A;  1ZGJ A;  1SAN A;  4YFN F;  3F8M A;  1KA8 A;  1OYW A;  2OQR A;  2Y0S N;  5FGM A;  1GVD A;  5L3F A;  1OCZ H;  2EJR A;  2M87 A;  3AG2 H;  4G94 A;  2V1D A;  3S14 J;  2LLK A;  5LRR A;  3AG1 H;  2MH9 A;  1GLN A;  3S15 J;  3IWZ A;  4YII A;  2O8K A;  4M9Z A;  5DCM A;  2K9N A;  2VT2 A;  3LL7 A;  4O3M A;  1R9T J;  5D5W B;  4L9T A;  1B9M A;  1OYY A;  4MQV A;  3S93 A;  3QU3 A;  2F2E A;  4UV8 A;  5BS6 A;  5DD4 A;  1I1G A;  3JR9 A;  1ZH5 A;  1I3A A;  1Y8R B;  3WE2 A;  2JA2 A;  5GAE J;  1KU7 A;  1MMS A;  3ZMU A;  3V42 A;  1Z21 A;  3QP5 A;  3RYP A;  5CVR A;  4WWC A;  2L2O A;  2QWW A;  1GXP A;  3EYI A;  2NVQ J;  3F6V A;  2KL4 A;  2P6T A;  1IN5 A;  2O7O A;  3A03 A;  5FD6 A;  1EKE A;  1H8A C;  1JTX A;  4ENM A;  3CLQ A;  5LD2 C;  3BTL A;  1ETW A;  2R5Z A;  2A61 A;  3K1M A;  1RKT A;  5IYB J;  3JTG A;  4PUS A;  4IQJ A;  1WSU A;  3K1P A;  3BDD A;  1E17 A;  2E1O A;  3CTA A;  4M3D A;  2GA1 A;  1X19 A;  1LDK B;  4YEJ A;  3DV8 A;  2HVQ A;  2DFI A;  1A04 A;  3U1K A;  2W00 A;  2JVH A;  5CQG A;  3BWG A;  1UHM A;  1IRF A;  1R22 A;  2KRF A;  4XSX F;  5GAG J;  4RMN A;  5M3M J;  2A07 F;  4MQ9 F;  3JTH A;  2V1U A;  1ZGW A;  3OS2 A;  2RC4 A;  5LFA A;  3PO3 J;  2A68 F;  3ZMV A;  4LK1 F;  1BI1 A;  2DA4 A;  5JLW A;  2BY1 A;  3CUQ A;  2QBY A;  3CDI A;  3LSG A;  3FHZ A;  4P55 A;  3HB9 A;  3E97 A;  4RB0 A;  2KHM A;  3HUG B;  5FD5 A;  2GLO A;  4RAY A;  5ICF A;  3HOT A;  5ERI A;  4XM3 A;  1LVA A;  1J5Y A;  4NC6 A;  1ZRF A;  3O3K A;  4KYW A;  4Y33 A;  4KIS A;  1XGS A;  3G2B A;  3NAR A;  2QUF A;  1FT9 A;  4A6D A;  3V8L A;  3G1L A;  3DLL F;  3FWE A;  2VBY A;  2ZFU A;  3W2W A;  1FTT A;  4D9J A;  1IAW A;  2DMN A;  2XGX A;  2STT A;  1WQ2 A;  2KIF A;  2F5V A;  1OR7 A;  4MLO A;  3GTM J;  5M3F J;  3Q5F A;  3DWL E;  3WG7 H;  1PUF A;  4OMZ A;  1KU2 A;  3HEF A;  4TV7 A;  3GX4 X;  1W1W E;  3LOC A;  2ELH A;  4V19 K;  2LDU A;  2RNG A;  3IUO A;  1TWG J;  1BIA A;  5HDK A;  3GZ6 A;  2VQG A;  1MBJ A;  2MW8 A;  1MDM B;  5GTI C;  2DW4 A;  4FX0 A;  1V5E A;  3G71 I;  1REP C;  5EDN A;  3UR3 C;  4CXF A;  2BZT A;  2P81 A;  3H35 A;  2LSO A;  3F22 A;  2RQP A;  3VYR B;  2QCO A;  1DP3 A;  3E0J B;  1YIT I;  2DK5 A;  1P92 A;  5AIP A;  2H6B A;  2K4B A;  4CCO A;  3IKV A;  2NRA C;  4LB6 B;  1LJ9 A;  4EAT A;  3J80 Z;  4NHJ A;  1BR2 A;  2Z1D A;  2ZO4 A;  4M3G A;  3BY6 A;  2XSD C;  3FF5 A;  2MGQ A;  2CQN A;  3M8E A;  3TW6 A;  1C0W A;  3I4N J;  2E60 A;  1P2F A;  1TT0 A;  3DKW A;  2COB A;  3JCU C;  3PFY A;  2QQB A;  2PJR A;  3ABU A;  1T98 A;  3EUH C;  5L3C A;  1POG A;  1J9I A;  5E20 A;  5KNL A;  1TL8 A;  1FPQ A;  1FYL A;  4UXN A;  3ZN1 A;  2XAU A;  1S7E A;  3D1N I;  2BOL A;  1TWH J;  2ZXH A;  4YFK F;  4KUM A;  4M6X A;  3T5X A;  1SD4 A;  2E7W A;  1ZG5 A;  1R1T A;  3B6C A;  2X6X A;  4E6K G;  2K86 A;  4ZTF A;  2Q0O A;  3M07 A;  2LC2 A;  1MW7 A;  2D1V A;  3L9F A;  4ZZL A;  3G1O A;  1CF7 B;  1KZH A;  4OIO F;  4UUV A;  3DEW A;  1JXS A;  4N9I A;  3IH2 A;  4P96 A;  2XB0 X;  1LFU P;  2E1C A;  4LLG F;  2E71 A;  2DTR A;  1T08 B;  5DM6 F;  2R7V A;  2E1M C;  4AYB N;  1JGG A;  4CGZ A;  1R4N B;  2GXA A;  2KPM A;  1D0Z A;  2DOF A;  1YJN I;  5IT3 A;  1NG6 A;  4N4N B;  3A1Y A;  2EA4 A;  4CH7 A;  2W24 A;  4DYQ A;  5ICE A;  4XLP F;  4G6D A;  3TDZ C;  2VIX A;  1X1C A;  2E2H J;  2GQQ A;  1MNE A;  1JKR C;  2MAB A;  3MEX A;  3WTU C;  3JRB A;  1BI2 A;  1G3S A;  1O3S A;  4UVC A;  2ZJ2 A;  1RET A;  2M1B A;  3ZQG A;  1AWC A;  3RSN A;  2V9P A;  1W4M A;  3MD2 A;  4H0E A;  1HCR A;  2R5Z B;  1LB2 A;  2X1D A;  5D8L B;  2HWV A;  4FE7 A;  5B1B H;  3FIW A;  2K9S A;  3MZ8 A;  4L5E A;  4HV6 A;  3PSI A;  1OCT C;  3ML6 A;  3E6B A;  4DZJ A;  1QHH D;  2JUG A;  1FP2 A;  2LF8 A;  4EM1 A;  2WAD A;  3CC2 I;  1TT5 B;  3EUH A;  3BZK A;  3K4L A;  4FQG A;  3G4S I;  2ESH A;  1Z67 A;  1KQ8 A;  2G7U A;  2JRM A;  5E3L A;  4IZZ A;  2XF7 A;  2O8X A;  3FK6 A;  2EFO A;  3CC4 I;  3E3V A;  3CDL A;  2E5N A;  4XNF A;  1IN6 A;  3A01 A;  4JQF A;  4AIH A;  3GTG J;  2VBZ A; 
#chains in the Genus database with same CATH homology
 2XAF A;  4MGR A;  5JFR A;  4MHG A;  2EFW A;  1XSD A;  5HOO A;  1DPR A;  2RKH A;  2O6G E;  3VB2 A;  1BIB A;  1AOY A;  1S8N A;  5ILS A;  5JHU A;  4G7Z F;  1SD6 A;  3GYH X;  1IN4 A;  5HS8 A;  3ZPL A;  2D1H A;  2XAG A;  4LGW A;  5L3D A;  1TW2 A;  3ZN0 A;  1U5T B;  3FM5 A;  4IHT A;  1V3F A;  4Q47 A;  1G3Y A;  1YYV A;  3GFJ A;  4GCV A;  5J8C A;  1XB4 A;  4IPA A;  5L3E A;  2ZBK A;  1U6G A;  1IF1 A;  5HDG A;  3V8K A;  2YU3 A;  4NB5 A;  1PDN C;  1KU9 A;  4WK8 F;  3HSE A;  5DEQ A;  4HDV A;  2XRO A;  4IXA A;  5D5U B;  2CYY A;  4QLC U;  4HW0 A;  3EDP A;  2FXA A;  5D6F A;  3TO7 A;  2P5V A;  5F1R A;  1R00 A;  3NRV A;  4EM2 A;  4ESJ A;  1T0F A;  2CGP A;  2RN7 A;  1IXC A;  2BE5 F;  3MZY A;  4CDG A;  2KJC A;  2OD5 A;  2PLY A;  1B59 A;  2F5F A;  2E7X A;  5L3B A;  3WTZ A;  2EB7 A;  2MD5 A;  2STW A;  1KYZ A;  3RI4 A;  4GYI A;  3QRF F;  2IA0 A;  5K1Y A;  1U78 A;  4E70 A;  3F8C A;  3RKY A;  1MJB A;  3N97 A;  1D5V A;  1WWX A;  2HZT A;  3WTS C;  1F4K A;  1Z6T A;  3O2P E;  3SQN A;  1TNS A;  5BPD A;  4A5M A;  2VBX A;  5E18 F;  1FZP B;  1QZZ A;  2K4J A;  2V9V A;  4WCG A;  1T6S A;  1ZAR A;  4RAZ A;  5IT9 Z;  2QZ8 A;  1L0O C;  4G6Q A;  2Z33 A;  1SMY F;  2HR3 A;  3L00 A;  4CO8 A;  3IC7 A;  3U2R A;  4UHT A;  5HS9 A;  2DT5 A;  1XCB A;  3GO5 A;  2GWR A;  3E6D A;  4XBF A;  2JPB A;  2XRN A;  1HKQ A;  1U5T A;  1WKM A;  5LGU A;  2L54 A;  2L4A A;  3WG9 A;  1D8K A;  2ZKZ A;  1PUE E;  5DD8 A;  5BOX A;  5HS7 A;  2XKP A;  5ILV A;  3I59 B;  2GIV A;  1ONV A;  3B73 A;  2XAQ A;  3ELK A;  3DEU A;  3WGG A;  1USS A;  2Z5U A;  3VFZ A;  1WI9 A;  4RGS A;  1YIO A;  2W85 A;  2MH2 A;  4LJZ F;  4U0W A;  1MDM A;  5CVU A;  4EJO A;  4LG0 A;  2A6H F;  3GEZ A;  3F21 A;  1MJ9 A;  1ZRC A;  1RZ4 A;  1K79 A;  2AS5 F;  3WGI A;  1S29 A;  3MFK A;  2FRH A;  1TNT A;  4ON0 A;  1LDJ A;  4BAY A;  3I71 A;  4B09 A;  3EET A;  4KNY A;  2JTV A;  1ULY A;  1FY7 A;  4R1H A;  2VT3 A;  1ZLK A;  3IRQ A;  3DF8 A;  1MZB A;  2EFN A;  2F5D A;  3EYY A;  5HDN A;  1Q1H A;  3FXR A;  2GXG A;  3SZT A;  3FXQ A;  1BBY A;  1MJA A;  1FYK A;  4I7H A;  4IVN A;  4BNC A;  3M7G A;  2QYO A;  2XV4 S;  3I64 A;  3H3Z A;  2ETH A;  3RIR A;  4L9V A;  1J75 A;  4Y15 A;  5TJJ A;  3I0T A;  1X3U A;  2BGC A;  1LDD A;  1FSE A;  1GHC A;  2PG4 A;  3ROU A;  2A3S A;  3E5U A;  4KIG A;  3P7N A;  1H9T A;  4Q48 A;  2NNY A;  5FFZ A;  1YW7 A;  3KLN A;  5E1Z B;  1FX7 A;  2Y48 A;  5D4R A;  3KZZ A;  3KZY A;  1FP1 D;  4HX8 A;  1KU3 A;  3H3U A;  2Y0M A;  1YFH A;  2ADU A;  3V7R A;  4EV0 A;  1KQ0 A;  3KEO A;  4D0P A;  3CJN A;  3F23 A;  4P5O A;  2HKO A;  3CLO A;  2GXB A;  5ICC A;  2F5E A;  3WTX C;  1UB9 A;  5K5Q A;  5LGT A;  3GFM A;  2LNB A;  1J59 A;  3O6B B;  1XDS A;  1FYM A;  4IRH A;  3BOQ A;  3BZ6 A;  3I54 A;  2FEZ A;  2CSO A;  2O61 A;  5ILU A;  4UVA A;  2NS0 A;  3KLO A;  4M74 A;  3JAM Z;  2L4M A;  4FHT A;  3REO A;  4I0B A;  4Q4Z F;  1EH8 A;  3GVA A;  3C1D A;  4LK0 F;  3ZMZ A;  3HIF A;  5JVT A;  2BV6 A;  2IJL A;  1XN7 A;  4AWX B;  2G9W A;  3LQR A;  1K7A A;  4KA4 A;  5ED4 A;  5AON A;  1FBU A;  4ETS A;  2DU9 A;  4R79 A;  1UST A;  4HOB A;  2GAU A;  2IPQ X;  2MBF A;  2L01 A;  4ENJ A;  3T8R A;  1IXS B;  4IJA A;  4ESB A;  1ZG3 A;  1QBJ A;  5F64 A;  1JE8 A;  3J81 K;  3HRS A;  5K5R A;  2BYV E;  2R7D A;  2KKO A;  5ICG A;  1IZ1 A;  5KVR A;  1V4R A;  1QPM A;  1JHH A;  2O3F A;  1S7A A;  4KFC A;  3WOD F;  1HQC A;  1U3E M;  1Z1D A;  4L0Z B;  4IHS A;  1O3Q A;  1O57 A;  3M1E A;  3DQV C;  3VOE A;  6PAX A;  3PQK A;  4RGU A;  1YS6 A;  3BJ6 A;  1S3J A;  1ZG1 A;  2Z3Y A;  3TOB A;  4HBL A;  4R8H A;  4HYE A;  3D5L A;  2VC0 A;  2OZU A;  2GA2 A;  1Y0U A;  2ISZ A;  5A2Q K;  4I2O A;  4EMS A;  2FSW A;  2FBI A;  2O03 A;  5HLG A;  1DUX C;  1J0R A;  1W7P A;  3E5X A;  2XAJ A;  3QAH A;  4MTE A;  1YS7 A;  2BEO A;  1KGS A;  3J7A O;  2C6Y A;  1I6X A;  3F8F A;  5H20 A;  1XGO A;  3V7C A;  3TDU C;  4LLN A;  1R7J A;  1ODD A;  2YR2 A;  2AXL A;  3HHH A;  2ZXJ A;  3B02 A;  1ZLJ A;  4KN7 X;  5LRS A;  2WTE A;  1SFE A;  1TW3 A;  1JGS A;  1TQM A;  2EWN A;  3GW2 A;  3WU0 A;  2LF7 A;  1FNN A;  2DLL A;  2EK5 A;  3LQQ A;  5DV5 A;  3QPH A;  4IRI A;  3GLX A;  2CW0 F;  2FMY A;  4OIP F;  4EVI A;  1XCV A;  4XRF A;  4FT8 A;  3R61 A;  1F9N A;  4AVP A;  4HX7 A;  4MTD A;  4HF0 A;  2HFH A;  2PEX A;  3LA7 A;  3N4M A;  2YPR A;  2P6S A;  5LHI A;  5E1X A;  4UV9 A;  2VOD A;  3T0Y A;  2G7H A;  4Q5S F;  3GWZ A;  1PP8 F;  1H0M A;  1XD7 A;  2ZNY A;  1HW5 A;  1ZRE A;  2HKX A;  3KFW X;  2L02 A;  4MEY F;  5E8G A;  2IVM A;  3GF2 A;  1XMA A;  3Q9V A;  4B8X A;  3COA C;  4HQM A;  3C18 A;  2PN6 A;  3W6K B;  3I53 A;  3WE3 A;  1Z6R A;  1W5T A;  1H9G A;  3HHG A;  1IN7 A;  3NEU A;  3TGN A;  1TTY A;  4M9S A;  2Z9O A;  4DQ2 A;  5LLQ A;  2ZFW A;  5BMZ A;  1EH7 A;  2VOO A;  1XDU A;  1BOA A;  1STZ A;  4XSZ F;  3CO6 C;  2FML A;  4EJW A;  1EH6 A;  2DI3 A;  2XUB A;  3RPU A;  4WF2 A;  4XLN F;  4I09 A;  3E6C C;  2L3D A;  4HDU A;  1VTN C;  4GYG A;  4RGX A;  1U2W A;  1UFM A;  5FFX A;  2YSR A;  1IRG A;  3LAP A;  1MKM A;  1OKR A;  2BBY A;  2HGC A;  5CVI A;  1Z9C A;  2EA2 A;  4RB2 C;  4WX9 A;  4WXH A;  5D6E A;  2K02 A;  4U0Y A;  3LA3 A;  3NQO A;  1Z05 A;  1FSH A;  1K78 B;  2A69 F;  3ISP A;  2Q8K A;  1T39 A;  3K2Z A;  1B9N A;  1BJA A;  4YFX F;  2RDP A;  5E1W A;  3J80 K;  2PMU A;  4EJU A;  3F8N A;  3LFK A;  3JSO A;  3CUO A;  4OIN F;  3I59 A;  3SXY A;  2FE3 A;  2VXZ A;  1R1U A;  2FF4 A;  3QOP A;  3ECH A;  3QU6 A;  1W5S A;  1B1B A;  2RVC A;  1HST A;  5K5O A;  5JR3 A;  2MLK A;  3GZ5 A;  2XAH A;  3I4P A;  3KET A;  1O7F A;  2J5P A;  3HTU A;  4F7Z A;  2H6C A;  3R60 A;  2Y75 A;  3KP6 A;  5EEH A;  1WRJ A;  3GFI A;  2IW5 A;  3KP3 A;  1K6O A;  4G9Y A;  1FBQ A;  4PDK A;  4A0Y A;  4ZYG A;  2FNP A;  3L7W A;  3F3X A;  2K27 A;  3WTY C;  4G7H F;  3KP7 A;  2P7V B;  3G73 A;  3K9T A;  4HF2 A;  3Q9S A;  5F6F A;  4CYD A;  1D3Y A;  4JBA A;  2UWM A;  1G6N A;  1DP7 P;  2PJP A;  1XGM A;  1ZGA A;  1XMK A;  2R7F A;  2OZ6 A;  1R23 A;  4UVB A;  3KP5 A;  5L3G A;  1OYI A;  3JW4 A;  1MGT A;  2OQG A;  4HLX A;  3BJO A;  3TOA A;  4OIR F;  2M45 A;  2H09 A;  4A12 A;  2IP2 A;  3GXO A;  2ZME A;  2ACJ A;  1QO0 D;  4CZZ A;  3ERE D;  4S05 A;  2M5W A;  4WXD A;  2JRT A;  5JI6 A;  4RS8 A;  1R58 A;  1RIO H;  1D8J A;  4L9J A;  5FLX K;  4EGZ A;  4HF1 A;  3V4G A;  3TO6 A;  4A0Z A;  1T2K A;  5DDG A;  5DUI A;  2HTJ A;  2HQR A;  5HLH A;  1XGN A;  1SD7 A;  4WXC A;  1I1S A;  2XVC A;  2FBK A;  2VON A;  5CLS A;  2UZK A;  1IXR C;  1S6L A;  3CUQ B;  1J7K A;  2ZNZ A;  3HUG A;  5D4S A;  1I27 A;  5KK1 A;  2WWY A;  1HSJ A;  3RDI A;  5H6R A;  5DUK A;  1S7O A;  4HAM A;  3HRT A;  5CYV A;  1ZYR F;  3FMR A;  2D2W A;  3SZP A;  2DBB A;  5FB2 A;  3U1D A;  1G3T A;  4Z2Y A;  2KIU A;  3R6S A;  3JAM K;  4OOI A;  2W57 A;  2Q2E A;  1BM9 A;  2E1N A;  4PZJ A;  2P5K A;  3SFZ A;  4N9H A;  2COM A;  2UXX A;  5D5X B;  3MCZ A;  2DPU A;  2P5L C;  3V7S A;  1PP7 U;  1O3T A;  1QGP A;  3R0J A;  2Z99 A;  3FMS A;  2EV5 A;  4L0Y B;  3ZMD A;  1BI3 A;  4ZYD A;  5AIQ A;  1XSX A;  3AAF A;  1TQP A;  2GZW A;  5CVV A;  4ENK A;  2H27 A;  4LG0 B;  3QPT A;  4EJT A;  2IA1 A;  3FM3 A;  3T1B A;  3CO7 C;  2VOP A;  1DPU A;  3VOD A;  2ZME B;  3ZMS A;  4HV5 A;  4A5N A;  1HXD A;  2RGV A;  3EQL F;  1KQ9 A;  1SFU A;  3IL2 A;  1OPC A;  4UNO A;  3P9C A;  4NQW A;  3RPQ A;  2M8E A;  3CUQ C;  2FU4 A;  4GO1 A;  4YG2 F;  1BC7 C;  1YG2 A;  2QQ9 A;  3H92 A;  2FA5 A;  1DDN A;  2PQ8 A;  2A5Y B;  5LHG A;  2YX4 A;  3ZMT A;  4OU0 A;  2H94 A;  3OOP A;  3RYR A;  4BQA A;  2EV6 A;  2HTS A;  2MLG A;  4U7B A;  5HVQ C;  1HW1 A;  2IT0 A;  4KIB A;  4U0V A;  5E8I A;  4PGG A;  2HYG D;  1EV7 A;  2FBH A;  3IHU A;  1RNL A;  2OBP A;  4HLY A;  2HQN A;  1E2X A;  4BH9 A;  1F5T A;  3RKW A;  3TKY A;  1RUO A;  2W84 A;  2CQK A;  3KEQ A;  4LB5 A;  1IUY A;  2QBY B;  4BHC A;  2V1X A;  5CJ9 A;  1O3R A;  3MWM A;  1QQI A;  1G4D A;  3LA2 A;  1FWZ A;  5EEG A;  3HYI A;  4GGG A;  1SAX A;  4S04 A;  1P4X A;  2OAZ A;  1R5H A;  1SD5 A;  3BRO A;  1J2X A;  2B0L A;  2WC2 A;  2KJB A;  1ZAO A;  1HKT A;  3VEP A;  4Y17 A;  4MEX F;  2VN2 A;  2ESN A;  4HQE A;  4P9F A;  4G7O F;  4K2E A;  2DQL A;  1JHF A;  5BQT A;  4U7D A;  2QM3 A;  1KYW A;  2V79 A;  4RB1 A;  3DP7 A;  4KMU X;  3E6M A;  1LEA A;  3LST A;  4L18 B;  2CFX A;  4Y13 A;  1P4W A;  1TBX A;  4HX4 A;  4I02 A;  2JSC A;  1GXQ A;  5FO5 A;  4OIQ F;  1TLH B;  3QP6 A;  3FXU A;  3TQN A;  1CF7 A;  2V6C A;  2XKO A;  2EV0 A;  3R4K A;  4AIK A;  3WTT C;  1U8R A;  4DNC A;  4LFU A;  4A6E A;  2ZCW A;  4G8X A;  2CWE A;  3GFL A;  3PFI A;  4M72 A;  4OMY A;  3IKT A;  4BHB A;  5HLI A;  2IA2 A;  1FOK A;  2QVO A;  2XHK A;  2DO7 A;  3WTW C;  2HOE A;  3F72 A;  4HZF A;  2K7L A;  1Z91 A;  2FQ3 A;  1F1Z A;  2QEN A;  4IRG A;  1IW7 F;  3HTS B;  4AD9 A;  2QLZ A;  3WGH A;  1MD0 A;  3DFG A;  2LKP A;  4LD5 A;  3FZV A;  1BI0 A;  2P4W A;  4CIC A;  4L9N A;  1UCR A;  3HRM A;  3TO9 A;  2JZY A;  2P7C B;  3BPX A;  3L09 A;  3ZP5 A;  5DCF A;  1I5Z A;  4L5J A;  4I0A A;  2VE8 A;  3KE2 A;  3M9A A;  2JT1 A;  4AIJ A;  4ASN A;  4PGH A;  4BHP A;  3HSF A;  1R5G A;  2DPD A;  2DK8 A;  4O5V A;  4ESF A;  1ZRD A;  1W7P B;  2XIG A;  2PMH A;  2TDX A;  2VBW A;  2PI0 A;  3P9I A;  2P8T A;  5LEJ A;  2VE9 A;  1U5T C;  5D8K B;  1SMT A;  3G3Z A;  3IWF A;  5CVJ A;  3S2W A;  1YTY A;  3K0L A;  5LBQ A;  3GUD A;  4BXU A;  3WTV C;  5DYM A;  1XSV A;  1ON1 A;  2JPC A;  2CO5 A;  2O0Y A;  3DPL C;  5J6X A;  3MAJ A;  4L5I A;  3KCC A;  4U88 A;  1UHW A;  2NYX A;  3C7J A;  3C3W A;  4EGY A;  3K1N A;  4LMY A;  2HEO A;  3J81 Z;  3I5U A;  5D5V B;  3D0S A;  3M8F A;  1LQ1 A;  5J8F A;  3WU1 B;  3ZQ7 A;  3KP2 A;  3OV8 A;  4CHU A;  3DPT A;  1ON2 A;  5LEK A;  2IRF G;  3T8T A;  2A6E F;  2CG4 A;  3ABT A;  2HYF A;  4EM0 B;  2EFQ A;  4A0X A;  3I58 A;  3RJP A;  3CDH A;  4LLL A;  3ECO A;  2X0L A;  1G3W A;  1P4A A;  2R3S A;  4GXO A;  1QNT A;  1YW9 A;  4KIC A;  2HS5 A;  2DQR A;  3RKX A;  4BYY A;  5FLX Z;  4FX4 A;  1Z7U A;  2W25 A;  3ULQ B;  1IN8 A;  3SHF A;  4IF4 A;  2WV0 A;  4EJV A;  3FX3 A;  5E17 F;  1LEB A;  3JSP A;  1HKS A;  4M9X A;  1GVJ A;  4M71 A;  1R1V A;  1L3L A;  3R0A A;  3U9G A;  5DCM B;  3KP4 A;  4RB3 C;  1P6R A;  2D45 A;  3DXJ F;  3BPV A;  3F6O A;  2NNN A;  4MNU A;  4HA8 A;  1YW8 A;  1LNW A;  4ZYE A;  2KIM A;  3MZH A;  1ZHF A;  2FOK A;  1YO5 C;  4ZYH A;  4ZH4 F;  2MC3 A;  4ZZD A;  2FNA A;  4KT5 C;  4PCQ A;  3BJA A;  2VC1 A;  4A2U A;  2RNJ A;  3PQJ A;  3L2C A;  4KIF A;  1ZN2 A;  1B4A A;  5H6Q A;  5IT9 K;  3RTR A;  2M30 A;  2J5O A;  5LHH A;  1NHA A;  5BPI A;  4M6Y A;  1HW2 A;  2UXN A;  3V8J A;  3LAJ A;  1BC8 C;  2OA4 A;  1R36 A;  4EQQ A;  1K78 A;  2DAO A;  3K69 A;  3HOS A;  2HDC A;  1SFX A;  2RV8 A;  4KMF A;  2MA3 A;  1T38 A;  4JK1 X;  2EFP A;  2X4H A;  1HBX G;  5A2Q Z;  1O7L A;  1RI7 A;  1W7P D;  3MQ0 A;  1OMI A;  1TQI A;  4YIF A;  3IRR A;  4KN4 X;  2XAS A;  2YX7 A;  1BN5 A;  3E5Q A;  4RGR A;  4M73 A;  4ENN A;  3F8B A;  1CGP A;  1YQA A;  2ISY A;  3P9K A;  2PFB A;  3W6J B;  2OU2 A;  1FLI A;  1RUN A;  2QQA A;  3BP8 A;  2NAZ A;  2F5C A;  2PBI A;  4I01 A;  5TRD A;  4I98 B;  4O6J A;  5LGN A;  3FMQ A;  3HSR A;  4P9U A;  4N0B A;  3LWF A;  1FBS A;  1B6A A;  1QZY A;  3HRU A;  4QWQ A;  1FC3 A;  1YLF A;  4KDP A;  1ZGJ A;  4YFN F;  3F8M A;  1KA8 A;  1OYW A;  2OQR A;  5FGM A;  5L3F A;  2EJR A;  2M87 A;  4G94 A;  2V1D A;  5LRR A;  2MH9 A;  3IWZ A;  4YII A;  4M9Z A;  5DCM A;  2VT2 A;  4O3M A;  5D5W B;  4L9T A;  1B9M A;  1OYY A;  4MQV A;  5BS6 A;  2F2E A;  3QU3 A;  4UV8 A;  5DD4 A;  1I1G A;  1ZH5 A;  3WE2 A;  1KU7 A;  3ZMU A;  3QP5 A;  3RYP A;  5CVR A;  4WWC A;  2QWW A;  1GXP A;  3EYI A;  3F6V A;  2P6T A;  1IN5 A;  5FD6 A;  4ENM A;  2A61 A;  3K1M A;  3JTG A;  1WSU A;  3K1P A;  3BDD A;  1E17 A;  3CTA A;  2GA1 A;  1LDK B;  3DV8 A;  2DFI A;  1A04 A;  3BWG A;  1UHM A;  1IRF A;  1R22 A;  2KRF A;  4XSX F;  2A07 F;  4MQ9 F;  3JTH A;  2V1U A;  2RC4 A;  2A68 F;  3ZMV A;  4LK1 F;  1BI1 A;  3CUQ A;  2QBY A;  3FHZ A;  4P55 A;  4RB0 A;  3E97 A;  5FD5 A;  4RAY A;  5ICF A;  3HOT A;  5ERI A;  1LVA A;  1J5Y A;  1ZRF A;  3O3K A;  4KYW A;  1XGS A;  2QUF A;  1FT9 A;  4A6D A;  3V8L A;  3FWE A;  2VBY A;  1IAW A;  2XGX A;  2STT A;  1WQ2 A;  2KIF A;  1OR7 A;  3Q5F A;  4OMZ A;  1KU2 A;  4TV7 A;  3GX4 X;  2ELH A;  2LDU A;  5HDK A;  1BIA A;  3GZ6 A;  1MDM B;  2DW4 A;  4FX0 A;  1REP C;  4CXF A;  2LSO A;  3F22 A;  2RQP A;  2DK5 A;  1P92 A;  5AIP A;  2H6B A;  2K4B A;  3IKV A;  2NRA C;  4LB6 B;  1LJ9 A;  3J80 Z;  4NHJ A;  2ZO4 A;  3BY6 A;  3FF5 A;  3M8E A;  1C0W A;  1P2F A;  3DKW A;  2QQB A;  3ABU A;  1T98 A;  5L3C A;  1J9I A;  5E20 A;  1FYL A;  1FPQ A;  4UXN A;  3ZN1 A;  4YFK F;  4KUM A;  4M6X A;  3T5X A;  1SD4 A;  2E7W A;  1ZG5 A;  1R1T A;  2K86 A;  2Q0O A;  2D1V A;  3L9F A;  4ZZL A;  1CF7 B;  4OIO F;  4UUV A;  1JXS A;  4N9I A;  4P96 A;  2E1C A;  4LLG F;  2DTR A;  4CGZ A;  5IT3 A;  2EA4 A;  5ICE A;  2W24 A;  4XLP F;  4G6D A;  3TDZ C;  2GQQ A;  3MEX A;  3WTU C;  1BI2 A;  1G3S A;  1O3S A;  4UVC A;  2ZJ2 A;  2M1B A;  1AWC A;  1W4M A;  4H0E A;  1LB2 A;  5D8L B;  2HWV A;  4HV6 A;  3ML6 A;  3E6B A;  1FP2 A;  2LF8 A;  4EM1 A;  3EUH A;  2ESH A;  1KQ8 A;  2G7U A;  2O8X A;  2EFO A;  3E3V A;  1IN6 A;  4JQF A;  4AIH A;  2VBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...