2QX0A

Crystal structure of yersinia pestis hppk (ternary complex)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
158
Chain Sequence
MIRVYIALGSNLAMPLQQVSAAREALAHLPRSRLVASPLYRTKPLGPQDQPDFLNAVVALDTSLPPEQLLDHTQAIERNQGRVRKEQRWGPRTLDLDIMLYGDQVIKTDRLTIPHYGLKAREFMLYPLADIAPDLIFPDGESLSECLKRVDKNGLVLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
publication title Structure and activity of Yersinia pestis 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase as a novel target for the development of antiplague therapeutics.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transferase
total genus 45
structure length 158
sequence length 159
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2007-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 2qx0A00
1HKAA 1DY3A 5ETSA 3KUEA 1RAOA 1RB0A 4M5JA 1RU1A 3UDEA 3UDVA 1EQ0A 4M5GA 5ETLA 1Q0NA 4AD6A 1CBKA 2CG8A 5ETPA 5ETVA 2BMBA 4CYUB 1KBRA 3KUGA 3ILIA 4M5MA 2QX0A 3HSDA 4M5IA 3HSGA 1EX8A 1EQMA 4M5NA 4CWBA 4CRJA 3ILOA 3KUHA 1TMJA 3HCXA 5ETTA 3ILJA 1RU2A 3HD1A 4PZVA 5ETKA 3IP0A 5ETOA 3HT0A 4CYUA 1G4CA 3MCMA 1HQ2A 3UD5A 5ETNA 4M5LA 5ETMA 5ETQA 3ILLA 4M5HA 3QBCA 1F9HA 1TMMA 5ETRA 3HSJA 3HSZA 3MCNA 3HD2A 3MCOA 4M5KA 2F63A 1IM6A 1RTZA 2F65A 4F7VA
chains in the Genus database with same CATH superfamily
2YKNA 4ELUA 3G6ES 3ENWA 2BQUA 2ZH3A 2MZJA 3RG6A 4OI0A 4X2BA 2DNOA 3T5LA 2RKIB 2VBYA 1FX2A 2HQCA 2O66A 3HSJA 1N5VA 2J6UA 2KJVA 3OSNA 1FDNA 4GVBB 4ECTA 1AB8A 8ATCB 3CF5Q 2V69A 1X4FA 1EX8A 4ZPCA 1JLEA 5DGAA 2ZBPA 4NLWA 2YNHA 1S99A 4PXDA 1JLAA 3WC0A 5ETSA 3GU0A 2FTRA 1RB0A 4URGA 4XAKA 1S49A 3LGHA 4ZN1A 4WP9A 1DZ5A 3OTCA 3G82B 2I1RA 3FGVA 2QYCA 1TL3A 2IC3B 2PGCA 3HHLD 4RR5A 3BBFA 5J1EB 2D3ZA 2DPIA 2OSRA 2OIHA 4OLOA 5KOWA 1HPZA 3R2DJ 2ABYA 4DPXA 4BHQA 1HD1A 4KGVB 3N4WA 4N47A 2R7UA 2CQDA 4DV3F 4K50A 1FXRA 4EFAC 3MM8A 2KZZA 4N77A 2FIUA 5DM7Q 3H2UB 3W7BA 4URQU 3CCES 2ROEA 4B9UA 3HSDA 5L9XA 4X4PA 2HS4A 4DL4A 5IWAJ 4J7CA 3NGRA 2K8GA 4ANEA 2DNPA 1RZMA 3TAMB 1JXVA 5E2QA 4A48A 3I56S 4PQAA 1S7IA 2G0JA 3GV7B 1BWEA 1HHQA 2B9EA 3GG0A 4I2PB 2EFNA 1CS4A 3PRVA 3D7SB 4M5LA 3JYTA 1RDRA 1GXTA 1IQZA 1S6QA 2LEPA 3JQJA 3IS9B 4QIEA 2EG2A 5IQ6A 3CDUA 4ECVA 3IBWA 8AT1B 4Q44A 3HCXA 2Q6BA 3NBPA 2IM3A 2NZ4A 3IA0A 4LBIA 4DG1A 1W2BR 2XSJA 4ZN3A 3O44A 2E7VA 2C28A 4MKBA 5DS7A 3DRRB 3HT0A 3OL7A 1G3OA 2R2RA 1MROA 1DBDA 1GTEA 2WBMA 4YB6A 4B3MJ 1NU4A 3CWJA 1YRXA 3NMAA 4X65J 2QTWA 4DL5A 1AYEA 1RTIB 1C0TB 2Y1RI 1DTQB 3V81A 4X66F 2ZBQA 3TEGA 1QAYA 3M2RB 2I6WA 1NDCA 4I6YA 2RT3A 3H90A 1P8GA 4PAAA 4DPTA 1GFWB 3EICA 5KG4A 1MWZA 2DHSA 1EZZB 1YHQS 2JC1A 4JBCA 4DSJA 4ZITA 2QFIA 3MUVP 3PJ9A 1EETA 3SCJE 1BGXT 3Q2SC 2HWIA 4K4SA 2CPZA 1SUQA 4RKUC 4I56A 4DPUA 2EKYA 3UDCA 3DGVA 2VG5B 3QT5A 4EZ9A 5FDLB 2QSFA 2HNZA 5A6WA 2LA6A 1N8RT 1HFEL 4ECQA 1TKTA 4LSZB 4OI4A 5BR8J 2DEJA 1FWPA 3OR2A 4CTAA 5FLXY 3NWRA 2CPFA 2ZVSA 1AA1B 3BN4A 4IDKA 3KNGA 2A18A 2MQQA 1SC1B 3M32A 4UW2A 1HBNA 1K44A 2BW7A 2W7AA 5D0GA 4MKVA 4DV5F 3IM9A 4CLKA 2FJWA 2K1RA 3BREA 2HHUA 1KQSR 2ZHBA 3IR5B 1XWLA 1HBUA 1CULB 1VGYA 2YPZA 3PYDA 2MSSA 2HWTA 2A2CA 2ZNZA 1XQIA 3GILA 2NUUG 1TFYA 4RO0A 4USKA 1HMVA 1SH2A 5A8RA 1GQEA 4CCHA 5H9FJ 4C6AA 2M88A 4CIOA 1YJVA 2GJIA 2ZWPA 1ULRA 1ZM2A 2KB2A 3SQGB 2ADBA 4MIBA 5HO4A 2PI5A 5KFXA 4U95A 1Y11A 2WVEA 2HS3A 2W4PA 2AYGA 2FJXA 4DR1J 4A47A 1UEVA 3CIZA 1L3TA 1WHXA 1WF0A 1T0TV 2UV8G 3IBCB 1ZTWA 2XMJA 1F5BA 1X5SA 1YJNS 2E7WA 1TP7A 5IT0A 3X1LB 4WYWA 5BJRA 2CZ4A 5MAOA 3BGLA 4A46A 3I4HX 4U67Q 3OHBA 1J27A 4LRDA 4F2RA 2AGQA 2NZCA 3LTOA 3OL9A 3QQCD 3HVTB 1YGYA 1T03B 3BGFA 4JI3J 2LECA 3DLKA 1ELOA 3MURP 2B7BB 1Q0NA 2QEXS 4YB5A 4K2XA 1BMQB 3RUBL 4R25A 4FYWB 4LFCF 5C24B 4LIWA 3IP0A 3W2WA 1R8HA 2FJAB 1YTYA 3H2LA 3W60A 4N8NA 2JVRA 4YDXA 3RB6A 3U27A 2HFOA 3Q86A 2IM0A 2YKQA 4J9MA 5CYQA 4RW4B 4AUKA 2QLBB 1IWAA 4NYOA 3IM8A 4DS5A 4EO6A 3GFZA 3NMRA 2HHPA 2WK4A 2V5HG 4F8RA 4DV0J 3IWLA 4ANDA 4LRBA 2E5LJ 4Y0FA 1S1WB 2XY5A 4BWJA 1NSKL 3J81U 3IGVA 1DLOB 2Z58B 3KWMA 1R0AA 2XMTA 7AT1B 2OPRA 3QWUA 2M4MA 3BKTA 2EBGA 3TWZA 9RUBA 3D68A 2E66A 4QIFA 4P52A 5M2RA 2UU9J 1D3WA 4DR6J 2ZWOA 2UUCF 3TZZA 4JI8F 4A4JA 4P10A 5DDRC 3GIKA 2E1AA 3SZ2A 1VC6A 2HRUA 1S57A 1D9FA 4AYBD 2RU9A 4WTYA 1N33F 4KGZB 2NPIA 3G87A 5L8RC 4QIVA 3MEGA 2F65A 4KKOB 2D3O1 4FYYB 2OTLS 1NK0A 1RHKB 4M5GA 4KQZA 3TYTA 3NS6A 1ZZNA 1R31A 3EWGA 3HHLC 2CQ2A 2V2QA 3JB9k 2B4PA 3CDEA 3MCMA 1DQAA 5ETQA 1JQGA 3OVSA 4OX9J 2BVZA 4B3TF 5B7WA 3IR6B 2JVOA 2BMBA 4M8LA 1U1OA 2UXBF 1NK8A 4P9SA 4B3RJ 4FP9A 1P9YA 1FESA 2A6OA 4NLRA 5LXYA 4IR9A 2DHHA 4C7QA 4DV6J 3PV8A 4WZMA 3BO2A 4N41A 4HKQA 4A8SA 4NEZA 1V5IB 3EE3A 2IBOA 4NPOA 5L39A 1Z4UA 2AD9A 1VBXA 2HZVA 3AJDA 1X4BA 1H3DA 4CLPA 2FGOA 1RT4A 2XM3A 1FKOB 2XTJP 3M6XA 1NDKA 3V6DB 1Z2ZA 2V6AA 2CYYA 3I0RB 5HVFA 4ZPDA 4O3SA 1H2TZ 2HAFA 2K7JA 3S8SA 3ZFVA 1HNXJ 3B4MA 1Q86T 4OYBA 4LFBF 1UEUA 4ELVA 4OYWA 1IQTA 1FK9A 3GSDA 2HHQA 5KFNA 1WD6A 2XSFA 4RUCA 4C8OA 2X1BA 3HT3A 4Y00A 1N52B 1WORA 2RJZA 4PYAA 2JLEA 1Q79A 3CJKB 4YUDA 3UO0A 2EI5A 1N32J 2FUG9 4UQTA 1FF2A 2LXIA 2CIMA 4X4UA 2PEBA 4K2JA 1HNVA 2ILZA 2GIRA 4OV6A 4RBVA 1MU2A 1CJKB 4LR7A 4ICLB 3NKYA 4LF7J 3HXMA 3CJ0A 4FNIA 1WI6A 2VPWB 5T7LB 2IBKA 1S9EA 1WF1A 3NNHA 5A2QY 3T1AA 4A8OA 2VQEF 1U7LA 4QW9A 4DR5F 5A8KA 3KJQB 4J9SA 2IHR1 4K5SA 3QZ7A 5LOQA 3LA0A 1ZZFA 4MK8A 1O0PA 1YJ7A 4DR3F 3G8SA 1QLNA 2CG4A 2BKOA 3FK4A 1VMBA 2I9SA 1XERA 1Q5VA 2ACMA 2R8IA 4KHPJ 1FFWB 4LRCA 1YZ7A 3HD2A 1WWHA 1N34F 1HI1A 3UW1A 3B78A 1JMTA 1N6QB 2QA4S 1Z1ZA 5THWA 2AU0A 3GJTB 2CFXA 1SL2A 1UJ5A 2RNEA 3MPWA 3GIMA 3G71S 3Q83A 3OPKA 1RJJA 4OIXA 4ZJLA 3M30A 3SCKE 1H0HB 1SC4B 2WSFC 1DRZA 1UWBA 2G2YA 4CLFA 5F41A 3EGNA 4I64A 1DQ8A 3PYGA 3FBFA 2NCKL 2W2NP 3J80Y 4TY8B 4DQPA 3OSPA 1X5PA 4DFPA 4TVAB 3KK1B 2WHOA 5E5NA 4WJBA 2CRLA 1N5SA 2C3PA 4Y2MA 3K59A 2NXEA 2X3GA 3N6MA 4Y3CA 3QBCA 1AUDA 4USMA 2FLPA 5K8OA 5KFJA 2VFTA 1BHNA 1TKXA 4WIIA 1VQ8S 1M5KC 4WF9Q 2GZOA 3UCGA 3CDAA 3JSYA 3B6BA 3MZIA 3K57A 3IAS9 4I7FB 1J5EF 3V2UC 1QVFR 3HPOA 3QAEA 1RT3A 3S01A 4A8WA 4JI0J 2HFZA 3TA2A 4IO1A 4LR8A 3W2VB 4K4WA 2Y1LB 3O6QA 1RK8A 1WACA 2EG1A 1RWPB 2EWHA 2CXEA 2CPHA 4IH6A 2JL9A 2GMHA 1HNZJ 5KFRA 2NQPA 2BDPA 5KFMA 1N0UA 1U2FA 1SL0A 2PFDA 4DUZJ 4KIAA 3PNIA 3T3FA 3MEEA 4ES1A 2WCXA 3ISNC 2Y1JA 3QJPA 3EXYA 4OHWA 5DM6Q 2EFOA 3M8PA 1OJ4A 1FJEB 3KLGB 4ED0A 2AKWB 4KBIA 3ITHA 4HHUA 3G2XA 1S97A 4DUYJ 4LF8J 4NA3A 2EK6A 3TX0A 2ZOFA 4Q8EA 1NJXA 1O5JA 2C2OB 1TL1B 2XI2A 3UE2A 3DGPA 3HHEA 4XPEA 1MMDA 2CQCA 2GGPA 4O3OA 4ZK7M 3AFGA 2X7IA 2PSZA 2XLJA 3TUJC 3HMJG 3MM7A 2AX0A 3VAJA 2QX0A 1E6YA 2HHXA 3CE8A 2B8QA 3OTOJ 3K2YA 4OI1A 3QIPB 4OFZA 3NEKA 1RWMB 1WEXA 3HJFA 2I8EA 4RW6A 3AODA 2RE1A 2FZGB 3ZZZA 3TJ9A 1RAIB 4NWBA 5HQMA 3VAGA 1RTDB 1V3RA 1NAQA 5ADZA 2CJ9A 4ED8A 2HVDA 2L08A 3Q0AA 1X9MA 5EX3A 2MZSA 3TOQA 4I6WA 3THVA 4YB7A 1VIOA 2QL9B 5KFOA 3QT7A 4RW9B 2IRUA 2CJAA 2UUAF 4WK1A 2K06A 4RNNA 4MYUA 2W2PP 3VZHA 3X3UA 2DRDA 3ZXWA 2DYAA 5IWAF 4G1QA 1MMNA 3HFKA 3IWNC 1PILA 2BZ2A 3H59A 3BBCA 4QWEA 4NLPA 2V8GA 3TW0A 1WSRA 1T9WA 2FHMA 2W25A 4PG6A 3GJQB 2RQMA 5GAGI 2VA3A 1IKVB 1PJ6A 5HMYA 4AQYJ 2FHJD 3EDRB 2PMWA 5CQGA 2GCFA 4YY3J 2JLGA 3C6UA 2QLXA 2C2RA 3C66A 3GP9A 1DY3A 5E33A 2MGZA 3CIMA 3GR1A 2EK1A 4CH0S 4B9NA 2NLWA 1FRIA 2AJQA 2HRYA 2CJYB 1MLAA 5KT7A 2H54B 4I68A 3G9CA 2J0QD 2VONA 1UAWA 3ZNJ1 1S1UA 2Y0BB 5KG7A 2ZJPQ 4X65F 3I5CA 4IOBA 1N5YB 1U6ZA 4CLZA 3POTA 1M1GA 3W9HA 2KXHA 3CVKA 1RYSA 3MAAA 2XYHB 3KLIB 1B0VA 1U6FA 5B0CA 3GG1A 2ZHAA 3RBXA 1TAQA 1KONA 3DC2A 4N76A 3SFUA 3FRYA 4F26A 3D6HB 1YBTA 3Q22A 2O3DA 4EUVA 3UR0A 2P9EA 4QYZJ 2AV5A 1HQUA 3BQ0A 4NCBA 4CLLA 2KM8C 1TTHB 3NCRA 3KK2A 1REVA 1S7HA 3CTRA 5B0AA 2FJBB 3L95X 5GVQA 1VFJA 1C4AA 1T9UA 5F8LA 4FNHA 3D6MB 5KFTA 3OHAA 2DGWA 4MJKA 2VC0A 2X1GA 3TAPA 4IG3B 4FS2A 4ES2A 4EGLA 5BR8F 2JEIA 1KN6A 2BJ3A 1UVIA 1FI4A 4ES3A 2FVCA 3V6HA 3OTDA 1A9NB 4P71A 5KFUA 3TZXA 3R8YA 3F73A 1L3SA 4LF1A 3MMCA 4ZIWA 4OZ2A 3D1HA 4ID5B 1UFWA 3MCSA 4ZVUB 2G2ZA 3CD7A 4JYAJ 3W9JA 1U45A 2ASYA 3UNYA 2XGQA 3C16B 2XYPB 3GV8B 4X64F 3NG8A 2KG0A 4WP8A 5ETTA 4PZVA 3AAWB 3MMBA 2I0XA 4DV2F 4GC7A 1RBAA 3T9NA 2HVEA 3L3CA 5T14A 1NDLA 1N54B 3EM1A 1EARA 3KMSA 3A12A 5F9NA 4NZ7A 2E5IA 3H25A 4F0HA 1YITS 2GIQA 3TZYA 3HI9A 3MR5A 1T9XA 3ZNUA 1GX6A 3MUMP 3GFXA 2K3KA 3M8SA 1BQXA 3FFIA 4PQUA 5F8IA 3NCPA 2ZJQQ 5KFLA 5KTQA 4IG0B 2FVRA 3EPIA 4Q5VA 4EYHB 1N48A 2M52A 2QT7A 4USIA 2KHCA 4H4KC 4M5NA 1Q8LA 2RDIA 3KG1A 3AD8C 2DGVA 2QSWA 4UQGA 3P5BP 2P5VA 2YKMB 4G65A 3PJWA 1HW8A 4CYUB 2FLLA 4CH7A 3SMZA 1U48A 3ZZRA 5HI7A 5C7PA 2IAJA 3QYYA 2WSEC 1HYSB 4OZNA 4PEOA 1P27B 4WKRA 2BYCA 4DCPB 2BANB 4KV8A 1N5TA 4JI3F 1LWEA 3JTNA 2V50A 5KFGA 1C1BB 2PT0A 3QLHB 1CQMA 1T9VA 4WKYA 4EZ6A 4P7VA 1NK6A 4EBEA 3M2VB 1SV5A 1EP4A 4ZPVR 1UJ4A 2VV5A 1FFGB 2H51B 4B3OA 2XC9A 2HBYB 4WIQA 4IQXA 1IKYB 1VRUB 1IM6A 1EJ7L 5HN0A 4ZVSB 2CAJA 1BUXA 3D66A 2VFUA 1C0UA 4PR6A 3V4IA 3MPUB 3O2IA 4DV0F 3ILOA 3NGUA 2ZH1A 2E5LF 1R89A 2KG1A 2DNQA 5HLFB 3FQKA 2DBBA 1RAFB 1YI2S 2FZCB 4NMXA 1UP1A 1TL7A 4L72B 1QVGR 4Z7CA 5H9FK 3SSSA 1TVRB 4LF6F 3KDOA 2X3DA 1VK3A 3H0PA 2N82B 3FQLA 1CSJA 4ZJOA 2BJEA 3IBFB 2FHJA 1ZM3A 2UU9F 2XMMA 4FF4A 4DR6F 4AD6A 4Y2CA 2DNLA 3DN9A 3PCOB 2BBEA 1GNKA 2YNHB 4O3NA 5KFAA 2W24A 1RAEB 2LQ5A 4RNMA 3PJXA 3MM5B 4USVA 2FYXA 5ETPA 2W7PA 1H38A 1JLQB 2W7OA 3SV3A 1AT1B 2V4JA 1T8EA 4ZVRB 3QMQA 1VQ7S 4NLVA 2CDQA 2CQ4A 2KM8B 3J81Y 4K4ZA 4MFBA 3WIUA 2GVZB 1CPZA 2LA4A 3I6PA 5IT4A 1VQYA 4CO3A 5M2UA 4OHVA 1W2IA 4Y2KA 2C2ZB 4OX9F 4JV0A 3RZAA 2LQ9A 3MEDA 3FEZA 4O44A 2AHOB 4MAKA 5K8MA 3ZZUA 3PIPQ 3CMAS 4CZCA 4LVNP 1MW7A 4B3RF 2KH9A 2HK3A 1S1TB 3TR5A 1V3ZA 5KG6A 3QGHA 4DV6F 4IYQA 5F0WA 1VQMS 1JLCA 3CJ2A 2QE5A 1KHVA 3GWCA 5IM0A 4ITSA 3M05A 1IBKF 3BQ1A 4B08A 4ZOSA 3QNWB 2CUYA 1CJUB 4YEAA 3SDEB 5J2PA 4L3KA 1FEHA 2LMIA 4J9RA 3BSAA 1KSPA 2HNYA 1VISA 1OPIA 3NBPB 4BWMA 5KAKA 3QIDA 2CNOB 2GVDB 3BYPA 2YNGB 4DLGA 3T6JA 4C98A 5A8WB 3EGVA 4KGKA 1PSDA 5KFSA 3EXCX 1RT1A 1VJWA 2B43A 4O3PA 1X4HA 2C3UA 3FVYA 3KUHA 4ZVEA 2AGPA 4MKYA 5D0EA 5LL6d 1HNWF 1Q8IA 3R3TA 5B08A 2UUBF 4IFVB 4U7UD 2ZC4A 2YX4A 2DPJA 2HGMA 2DRBA 3FBCA 2BJ7A 4ZCKA 3EPGA 4QJVA 2ZE2A 2GV1A 4HI2A 1MWYA 1HBMA 1EETB 2W01A 3ILJA 1BQMA 3RYLA 4LF7F 4KO0B 4M5HA 2JLFA 4PUOA 1E6VB 2WTFA 2ZH9A 2BJDA 1BWVA 1FRJA 1ROFA 2F8HA 5KFKA 4ERDA 5E41A 2HNZB 3JSMA 3NLCA 2XO7A 1XK8A 2DHXA 3DDKA 3BF4A 4ZJQA 2OP5A 3H2VE 5LJ3Y 1TKZA 2J76E 4OJHA 2W2MP 4WWSA 4ZKAA 4X4OA 4DCJB 4DZDA 3LP0A 2JOQA 3B54A 1LWCA 3LOUA 1YJRA 1M0SA 1LV5A 1Q7LB 3M32B 3DRPB 1DQ9A 3DMJA 4Y34A 3JTPA 2V9WA 3R5DA 1RCOB 2DIVA 4KHPF 3AT1B 5LMNJ 2RRAA 3VF0B 5HQLA 3BO4A 2J8AA 1XEZA 2EW9A 1YDLA 3K5NA 4IRKA 1HBUB 4O3QA 2WW4A 3CEDA 1L3VA 1F3VA 3CC4S 1RTJA 1PC5A 4DX5A 4CLWA 1JWWA 2QJ3A 1JLFB 2G1DA 4UZBA 4QCLA 1HMVB 5EDWA 4JI5F 2GJ2A 5G0RB 3H5UA 3IAM9 3J7YU 2OPPB 4CLSA 4IH5A 4UUWA 3SSQA 1F0XA 1I3OB 4QWBA 1ZAVA 2W9AA 3RBDA 1HQEB 3BGUA 3W66A 2XBPA 2CPXA 3TVKA 4RNOA 4PWDA 2YNIA 2FY8A 1XC9A 4J90A 4DN9A 2KHDA 4YN3B 1TQLA 1APSA 3QATA 1X4CA 3WQPA 1FERA 3LP1A 1PJ7A 1ZBTA 2RHSB 4O0IA 5L1LA 2NXNA 1XIQA 2IJFA 1UVLA 4RNHA 1YK9A 4DF4A 4DFJA 1F2GA 1VIXA 2DT9A 4DL7A 2HHWA 5T41A 1AFJA 2V4RA 2A3JA 4PXEA 4FBUA 7FD1A 5CD4A 3AY0A 2MEWA 4JI0F 2FVPA 2LKZA 3ETMA 1LOUA 1C1CB 2LEBA 1IBLF 1K0TA 1Q78A 4F0KA 2HKEA 2ZC3A 2ROPA 1NM2A 2PDAA 2D41A 2L3MA 3K5MA 4LMZA 2AYMA 1LXNA 4KGXB 3KMQA 1TZ0A 2POKA 2A10A 3PM9A 2F1FA 2L9NA 1SJQA 1WKLA 4WFZA 1EKSA 5HP1A 3V6KA 2Z8QA 1RT5A 4Y2IA 2ZOGA 2W2OP 3Q8YA 3L9ZA 4BLGA 1H7WA 1YJUA 1NBEB 3G8TA 2F4VJ 3PFEA 4I4BA 4LF4F 4B9MA 2P9GA 2VL1A 2VJVA 1T94A 2MHNA 3PKYA 4JI2J 3CD6S 5K8NA 3CO9A 2I5JA 4LRFA 3R9LA 3D54A 3W9IA 4UTGA 1FJGJ 4LF8F 4DV7J 1HHSA 1XR5A 3GONA 1KP6A 1M90T 4I0WA 4R0EA 3KG0A 3LUYA 3BSOA 3B8HA 2MKCA 4XO0A 4FXDA 4LRAA 3A8KA 4NYPA 3N9UC 3U1LA 1X4DA 3THPA 3NGTA 1IVZA 1FFSB 3CDBA 2WRMA 3OVAA 4RX6A 2B9WA 4PCQA 4U7UK 3ET6B 2XCPA 5MLCV 1S6PB 2W9BB 2HHTA 3UI3A 3B82A 3DI6B 3NL0A 2B4VA 4LVOP 2ZD1B 4CM2A 3W8PA 1J5OA 1RE1B 1JLGB 2IM1A 4QU6A 4BC9A 1PO6A 2G13A 2WB1D 2XMKA 3MPYA 2X1AA 5GAGU 4DU8A 4ENOA 3D1OA 4IOAQ 4TQRA 3V6JA 1W7WA 1AROP 2V94A 2E9ZA 4X4QA 1QD1A 4J37A 1OQ3A 4L6V3 1EKRA 2HMIB 1U25A 4HYKA 4TU8A 1Y3JA 3MTJA 4P73A 1Y5LB 3UVJB 2SXLA 3K89A 3KHGA 4DXLA 1UEKA 1NCLA 1WEYA 4L76A 4HVZA 2MB0B 5IT9U 3BGRB 5F8JA 2IJRA 1SQFA 4ZLLA 1QUPA 3UQSA 2J0SD 3TO8A 3FBBA 1D8ZA 2C22A 3CJRA 2DGSA 2UUCJ 3A8EA 2AJ0A 3ZZOA 4HACB 4P75A 4JI8J 4N56A 2MKHA 1LK7A 1UVJA 3T9ZA 5LSRA 2JFDA 4RU2A 4O4GB 2IIHA 2RKIA 1RHUB 5EWGA 1N33J 2G9OA 3PW7A 4TKTA 4GVBA 2E1MC 1G6BA 4N7TA 4C11B 1RXOB 5F8GA 4IR1A 2ZH8A 4DL6A 2ZH5A 4LSNB 3BZQA 3IO1A 1LK5A 1R8CA 2ASJA 1K0VA 2FVQA 2UVWA 1M1HA 3GE9A 4HTIA 2VG7A 1HL6A 3LW5C 2B4OA 1VJQA 3G82A 3CPWR 3UD5A 2AIRB 1QSSA 1J2VA 4ECYA 3WHIA 3CULA 1X4EA 1OSCA 4EWTA 2R8KA 4ZP6A 2UXBJ 1JJHA 2DNRA 1X0PA 1ACMB 5EUHA 4RZRA 1K73T 2HLTA 1K1SA 1TUWA 2HSEB 2KN4A 2B6AB 4YR0A 1LW2B 3RR7A 2OKQA 1Y0HA 1F9EB 4AXIA 3A4TA 3TJAA 2MZ1A 2QO3A 1SC3B 3PIOQ 1SJ1A 3K7RA 3TA1A 4NRTA 3TAMA 4YP3A 4BS2A 3F0NA 4JYAF 2V8PA 5C25B 1LWFB 3QZ8A 1NSQA 3W64A 4I2PA 3M9MB 1KOHA 3VR1A 2DISA 4DR2J 2MQ8A 3W63A 4J9NA 4G1IA 4WBFA 1X60A 4LSLB 3TAQA 2GW8A 2NS1B 2W4CA 5KT2A 3IS9A 2R7TA 4OHZA 4LBHA 3CC2S 1U26A 4Q43A 2JX2A 3W1YC 3DU5A 1WDDA 2J9EA 4U9RA 2Q79A 2ZNYA 4NEYA 3OLAA 3UPFA 4KHRA 2FD2A 2VBXA 3HX9A 2RF2B 5FIIA 1VQ9S 1O6XA 5KG1A 3MXHP 5GADI 3GZ7A 2AX1A 1R8PA 4QPXA 2O5DA 2ATLA 1WF2A 4JI7F 5LMUJ 1NB7A 5I3QA 3H5XA 1FXLA 3M8YA 1VS3A 4WXOA 2BV3A 3K0JA 1NKEA 1T3OA 3MOJB 1MSWD 2XI3A 2C2MB 4LUBA 1RTIA 3MCNA 2DHAA 4BDPA 1S9GB 3GV5B 5IV4A 1DTQA 4ILMA 2HBQB 4DR4F 2YX1A 3PZPA 4H4OA 4H4MA 2COLA 2E1PA 2XNQA 3M2RA 2HYIB 2J6TA 4TU9A 1HARA 3PEJA 3HP6A 4ED7A 5EX0A 1ZM4A 5HANA 3VGSA 1RWNB 3BGOP 5G4DA 1URNA 2I38A 1HWJA 4B9SA 4MK9A 1MMLA 1MN9A 2DXDA 2QLFB 4GRSA 1UETA 1T11A 4DR3J 2OAUA 3PRBA 4GKKF 1X9WA 3MDFA 2MQOA 5FDLA 4USHA 5D4OA 2HQDA 3FRZA 5J2QB 2CWKA 1Y4ZB 2RVJA 1WOOA 2DNYA 4F02A 1N34J 4M5IA 5BYSA 5F9LA 1TU0B 3G86A 2B51A 2AZ3A 2V2VA 4DDFA 1WG5A 4IOCQ 3CC7S 3UDEA 4C48A 1UVNA 1EB0A 2MJNA 3G4SS 3LGNA 5HAOA 3ITHB 5AE1A 2BE7D 3VGTA 4IRDA 1Q7YT 1RWKB 3N5BA 2DXFA 1HWKA 1IKWB 4NLXA 2CPJA 5H9EJ 3PEHA 4RWXA 1EIYB 3BH7B 1CULA 3C14A 4B17A 2OFHX 2DY9A 3M4XA 1WHVA 2D1CA 4DPOA 3G6XA 4ED2A 2MKSA 1I5OB 2QGFB 2YKAA 4ECXA 1PGZA 3VQTA 1UWAA 5KFVA 4PPZA 1WELA 3SQGA 2NREA 1J5EJ 2BW2A 4M5DB 1T05B 1QSYA 2VKRA 4X84A 3BBBA 5DDOC 1FNOA 3JAMY 3GYNA 3OV7A 2ZOMA 3RRKA 2B7CB 1NXIA 3H4BA 3RGIA 2V68A 4C97A 1OPZA 1FD8A 3DLGA 1TV6B 2V34A 4F4YA 3DDIA 5CA5A 3NS5A 1U24A 4AL7A 5LSOA 3I5BA 1NKBA 4HT5A 3I96A 1B99A 3MECB 5A76A 4CP5A 1KQFB 3OT9A 3U1NA 3E2EA 4G1QB 4HDGA 2UVUA 3T1HJ 2IDLA 1B7FA 1M5SA 1U0HA 4NMLA 1IBMJ 3HVTA 5EWFA 4X4NA 2EEYA 1X4AA 2CQ0A 1SPBP 3OUYB 4XK8C 3R97A 4K5RA 4B3SF 3I9V9 2XZWA 2DJWA 2MYFA 2KTQA 2KT5A 1AXQA 3VALA 1SIWB 1Y9OA 5C24A 3QJLA 2HHHF 5CH7B 4ZMMA 3EVOA 3N79A 3EJMA 4I2QB 3C6UB 4UT4A 4ZVQB 4OV1A 1DFDA 3HKZD 2K2PA 5I3PA 1SL1A 2D7SA 5KOXA 5F8HA 5A6PA 4A8MP 4JV1A 4QZVB 3UR3C 1WOPA 1K47A 3GIIA 2YNFB 3KLEB 1WSVA 2LQ8A 4F0MA 4NLTA 1SKRA 4MH8A 1RHQB 1FJ7A 3QRQA 1DLOA 1S1UB 1UJ6A 1WKJA 1NHUA 2R9LA 1YJWS 4DL3A 3W5XA 4NE9C 1LNQA 1AZSB 4JP8A 5CABA 3R2CJ 4EBCA 1RWVB 3ZC4A 3N6LA 4WP3A 4ED1A 2HFNA 1HBOB 1VRQC 1NPKA 3HD1A 2F9DA 2LEAA 4ZVOB 2DITA 4E2FB 5C42B 1H6KX 3D6FB 2H5IB 5KG3A 1HD0A 4OYOA 2UUAJ 1K9MT 1REVB 1OS5A 4ZVGA 1RT2B 4KKOA 3D3BJ 2GFFA 2VDHA 2CPEA 2Y8WA 4DX6A 3MMAB 3SYZA 1G2EA 4F7VA 2XS7A 2BABA 1U1QA 5GMEA 2AQ4A 3KJNB 3CCRS 4K4UA 4HDHA 3HSGA 2ERRA 2J7KA 1S4FA 4K7QA 2DK2A 3M8QB 1U0SA 2GAHC 1KLNA 2FB0A 2GNKA 5D15A 1FRMA 1NK7A 3QWPA 4TLQA 3HVRA 5E3AA 4F4ZA 2MLXA 5LMNF 2N4CA 3FUYA 5JVHQ 2N3LA 1KC8T 2IA6A 4FXWA 5D8HB 3T19A 2B5JB 3L7PA 2DR9A 5DG7A 4AXJA 4HI1A 3TA0A 1Q53A 2FY1A 3BR9A 2C1EB 3DM2B 1FKOA 2GHWA 3V6DA 3I0RA 4USUA 3MM6A 3KHLA 4I67A 4LREA 2IYIA 3FFIB 4C0OC 4PQUB 4FKXA 2DIUA 4H54A 4CLTA 4WU2A 2CA9A 2DR8A 1YSJA 3HZGA 1XNQF 1CJVA 5FLXU 2A0FB 2ADCA 1YBAA 1DJ0A 2YKPA 1G7CB 2DNGA 5U47A 1RTHB 5CZVA 4AL5A 2OPQB 1U1MA 4NXMJ 3S7RA 4WFAQ 1DHMA 3TP2A 4G1PA 5LXRA 1D9DA 3L09A 3MF5A 1TMMA 3EZOA 1KLMB 2ZHOA 2EFPA 3H5SA 2AJ1A 1YLXA 3AOBA 3KJVB 1CLFA 3CJ8A 3C19A 1CJKA 1ZA1B 4R8UA 4ICLA 2W2QP 5IV3A 3OR1A 2VJUA 1BY9A 3CMQA 1YIJS 2ZZNA 3M9NB 5JVGQ 1LWEB 4OZLA 3CCSS 5T7LA 1N56A 5ETLA 2IM2A 2OMLA 2VG6B 4OX8A 1RAAB 3IRWP 4GKJF 1NK5A 1EP4B 3DXSX 4B3OB 1H72C 4X64J 2R7QA 1LW0B 4M94A 4QR2A 2C3OA 4DV2J 5DGBA 4PG7A 3BEGB 4MKAA 3P96A 2BE2B 4J5OA 5IC6B 1CC7A 2F4VF 3UFCX 2XO6A 3D0IE 3E51A 4JI2F 4OYPA 1DTTB 1RAJA 2GS8A 2OH2A 2K3IA 1FJGF 3BR8A 3LPEA 2BUNA 1N6QA 4DV7F 3EDQB 3QSIA 3EUNA 2OD6A 3RRGA 4TY9A 2ZUAA 3FCHA 4F4KA 4BBYA 4OYAA 5KT3A 2R2TA 2FC8A 4JI4F 2Q3PA 2BQRA 4P74A 2QMUB 1BD6A 4X4VA 1Y10A 2RB7A 2ZVIA 4RUHA 4TY8A 3RBZA 3M6VA 1XR7A 2V2ZA 1NJZA 3KK1A 2MQMA 4HHJA 4OZ5A 4CO5A 1RABB 1ITPA 4CNZA 4F4WA 4Y2AA 1VQOS 4TN2A 4WYLA 2HS0A 1NEEA 4QBUA 5HROB 4YB1P 1FCAA 4DR7J 1JB0C 2RDDA 3HHLA 4I7FA 5K8PA 4Y6IA 2Z30B 4KRWA 3ISND 3HFZB 2E1CA 1NKCA 1VQ5S 1BQNA 4FKYA 2R7VA 1RT7B 3UD4P 3IN5A 4YOEA 1YWXA 6AT1B 2RD5C 6FDRA 1XTZA 2ZZTA 4J9QA 4DWIA 4HEA9 4FYDA 2LQBA 1LEOA 3PFOA 1NH7A 3CGIA 2QL7B 5ETRA 1RYRA 3MM9A 4X4TA 3GB0A 4KJIA 4NZ6A 1I94F 1U09A 2B0GA 1T9TA 3EVMA 2ZH4A 1URRA 3NGSA 2R8JA 1IJFB 1R0BG 3OXFA 4EBDA 1ZAXA 3KK3A 3ENAA 2LXUA 2HNYB 3AQPA 2I2YA 4AT1B 4K4XA 4LF6J 2C2NA 3CCZA 3IR7B 2Z2MA 2YBVA 3KLGA 4ID8A 5KG2A 3KLFB 5KFQA 1RT1B 4U8VA 1GX5A 5J2NA 4ED3A 4CT9A 5HJXA 2IMOA 3KFWX 2YKOA 2HQFA 1DURA 2HHSA 2VH7A 1XMQF 3ZZ0A 2XWXA 3ZTPA 2OHDA 4I69A 5IQQA 3TANA 5KFZA 5C5JA 4DQRA 2HQ3A 2DD8S 2PA8D 1A7GE 4NCGB 2P9CA 3GPAA 2YWKA 2ZE2B 2N7CA 3QIPA 1S59A 2LU2A 2CWXA 2AJFE 3DYAB 2RS8A 2QFJA 1S77D 3SCLE 3N28A 3R7NB 3VQSA 1HLWA 1RTDA 4P6QA 3NS7B 1ZM9A 1HNIA 4DPYA 2MTLA 1JKHA 4RW8B 3GFYA 3U7JA 2KJWA 3K17A 4ZPTR 3QSYB 3BKUA 1SJ4P 2DH8A 3KLHB 1X5TA 4WK3A 3MGJA 3TQEA 2WBRA 4G6VB 4RW9A 2MMYA 4ALZA 4ECSA 2H4WB 1FXDA 3BDEA 4ZP9A 1IBKJ 2WB4A 1S0NA 3LQVA 4KH1B 4R5PB 3LWLA 2HK2A 4OMFG 2B9XA 1JJ2R 2R7SA 1RCXB 2RMLA 3MCOA 3FEXB 3JSBA 3RAMA 1R7IA 2Y0SD 3GR0A 2XMUA 1SH3A 2H5EA 5F0UA 4DR2F 4Q2MA 1PC4A 4KT0C 5HBMB 1IKVA 4NI2B 2JEJA 2WAQD 4LIRA 5RUBA 2M0GB 5GADU 5HATA 3R5GA 4FVCA 2GQ2A 2OJ3A 4ZPAA 2CG8A 2RQKA 2LP4A 3KUGA 4XDDA 3MFHA 1HNWJ 5ITHA 4NCAA 1VRTB 2UUBJ 1CC8A 1G4CA 2CPYA 4B02A 3D2WA 1KQGB 2ATCB 3D3CJ 4PXBA 3A1YG 1WHYA 3AXKA 3IGNA 2OSQA 4KB7A 5LMUF 3W62A 3A3NB 1TKDA 4LF5J 3KYLA 3DOKA 1SXLA 5DQGA 2KFZA 4RLEA 3P8BB 3OL8A 3D1QA 1N5YA 3GQCA 2BRKA 2HVIA 3UNGC 3R1HA 5D4PA 2HNDB 3GMGA 3UCZP 1X9SA 3KLIA 2XYGB 4NZ0A 4RW7A 2APOA 2Z2LA 1PYOB 2WONB 4UOFA 3M7VA 1WC1A 2A2DA 2UXCF 2DCLA 4ZPWR 2JEFA 4C8ZA 2MJUA 4OZ3A 1G1XA 4ZA1A 4D3GA 4ZHRB 1HR0F 4Q45A 1SB6A 2G0CA 1R8AA 4O0NA 3RBEA 2R7WA 4NLSA 5IXUA 4DI6A 2WSCC 5KT6A 1CG2A 3DLJA 2PD1A 4IG3A 2YX7A 4NX9A 2F40A 3Q89A 3IC1A 1NSPA 4NASA 3J80U 3R7SB 4ID5A 2VZ9A 3GCWP 2H5JB 2HLUA 4TYAA 4JI5J 1RISA 2MKKA 3DLHA 3C16A 2M5YA 3MMJA 2KXNB 2VICA 4FYXB 4IFYB 1Q5YA 2GMLA 5F3TA 4KYZA 1FKPB 1OYDA 4ZS6A 2YVSA 2ASDA 4Q8FA 3J7YI 5D3GB 1H73A 3ILLA 1S10A 5E7OB 2YH0A 2IPOB 3Q8RB 5KFWA 1WC4A 1BE4A 4C2MA 1V3SA 3C15B 4UY85 1IN0A 1RQ0A 2VKZG 1S6UA 1WHWA 2HW3A 4P2FA 5DETA 1XNRJ 2YY3A 2ZH6A 2F63A 1UPMB 4IG0A 1KR4A 1C4CA 3M1VB 2LQJA 1OWXA 3P4UB 3VAMA 2M70A 1NK4A 5B0EA 1IBLJ 4WFYA 2DY1A 1J5OB 4LJMA 2GJFA 4ED6A 1U47A 3T1YJ 4DPWA 3KLVA 2YKMA 2JWNA 2DHGA 4CYUA 2QIFA 2QZ8A 4GO7X 4X62F 1HYSA 1R8BA 4A8FA 2UUTA 3CJ5A 2V4QA 3RAQA 3VAHA 3T1HF 1IBMF 3H4DA 3LP2A 2BANA 5IS2A 1HW9A 3ONQA 4OYMA 1B3TA 4LF4J 4C8MA 5I3UB 4GVLA 3WX4A 1C1BA 4OX7A 4X4SA 3K5LA 3Q8QB 1QUVA 2YWGA 5CYMB 3PG9A 3HF5A 3M2VA 3PXGa 3K5OA 3EGZA 2KT3A 4P2XA 2R42A 1N4LA 1U1KA 5AT1B 4L75A 1JNRB 1X5OA 3OFEA 3ISZA 3R5AA 4P7TA 4O23A 1IWGA 3HHKA 3J7AN 3MOZA 1IKYA 4WU3A 2CPDA 3MFIA 1VRUA 1VHFA 1ZPWX 2YQ1A 1CJTB 5GAEU 2DO0A 5H9EK 2XGPA 1RHJB 2ACYA 5HLFA 1F6TA 4WCEQ 2DO4A 2DH7A 3Q8PB 2W4DA 2XZDB 4ATNA 1TVRA 4OQJA 4BCAA 2XB2D 2W9CB 4WTOB 3DNCA 4V19J 2JJ4D 1FE4A 2HPUA 4F36A 1VC5A 1YBUA 2UVVA 3VV2B 2VG7B 9ATCB 1ZAWA 5A0YA 1FWLA 2KVQE 3M8RA 4OYZA 3G6YA 2PA3A 2PFFB 3EYZA 3MM5A 4FN5A 4ANCA 1YJ9S 1JLQA 4CI0B 4DV1F 2NYHA 1VDHA 5I42B 1GT8A 3PVXA 4QYRA 2YWEA 4C3MA 3MR2A 2Q6CA 2JSXA 2OPSB 4HHHA 2JEGA 5KFBA 3MD3A 4C8KA 2GVZA 2HWHA 3D5MA 1NJYA 4FF3A 2JRSA 3KJFB 3C2PA 2DNHA 1KEKA 2F4FA 2RS2A 2BOAA 3JTOA 4M5JA 2CNLB 5K14B 3SQOP 1S0OA 4DMZA 4KR0B 2W8KA 2PO4A 1H74A 3AH6A 1LQ9A 1IKXB 4JV5F 3FCVA 3GFHA 1S1TA 3V5RA 1FVQA 2WW8A 1UMJA 1RSCA 4YR2A 4LR9A 4CO2A 4RJVA 3KKFA 4RUBA 4O3RA 5IZHA 2RQCA 4Z2XA 3VHQA 3FC9A 1CJUA 3CJSA 3PTWA 2GHVC 3BDPA 2BXJA 3SDEA 5D6GA 3CCLS 1PAEX 2GVDA 4UOCA 5J2MB 4YR3A 3E01B 2YNGA 1FT8A 5A8WA 3O8WA 1NJWA 2CVIA 3DRSB 4FXVA 2CQIA 2MPUA 4P72A 4DSFA 1OYEA 1FDDA 4EYIB 5SZTA 4IFVA 1UZDA 1HWUA 3M2UA 3IG1B 2DKOB 4NXMF 4H4OB 4H4MB 3HZEA 1PYTA 4Q0BB 4DSEA 4DEZA 3HVAA 1HKAA 2AYBA 2Z0GA 3RW6A 3BYRA 4RBTA 1K8AT 4DS4A 2KFNA 4H4KA 4QOTA 1QE1B 1WC0A 1P1TA 3HVWA 4DSIA 2EXUA 3AQOA 2Y9HA 2YXLA 3N0VA 2C2EA 2KU7A 1U8SA 4FYVB 3NY0A 4KH0B 1IM4A 1PG5B 1JLBA 4KO0A 3ULHA 4FF2A 1E6VA 4PG5A 2OELA 5AXMA 1S48A 4NLOA 4E0DA 3I82A 1Q4RA 1FRXA 2CNNB 3OLBA 4LT6A 2E9TA 3R5JB 2KRRA 4OZJA 4ZLPA 5FJ4A 1P9QC 1VLOA 4KC5A 2AZ1A 2HVHA 2CZVC 1Q8KA 2LDIA 3DLEB 2H4YB 3AHPA 1FRLA 2ZDPA 3V4MA 2FGCA 3DRPA 4K8RA 1BLUA 1S1VB 1IUJA 1DARA 1EQMA 2KYXA 3BKFA 4NLYA 1NO8A 4K4TA 2JH3A 3W3SA 2Q66A 1TUVA 3W65A 2Q43A 2VPYB 2BQ3A 3OVBA 4DL0C 2EFGA 4JI7J 3CCMS 3C14B 2N3OA 1OSDA 4I1TA 2D69A 3I0SB 4USJC 1RBOB 2L9DA 1SCJB 1OO0B 1IR0A 1JLFA 3GYXB 1QJHA 4K59A 4JUZA 3CD0A 4KPCA 5G0RA 3FJ2A 4DR4J 2OPPA 2QN6B 1WG4A 2CKWA 2C2DA 4B9LA 4EEYA 1UA1A 1HQEA 5K5MA 3C6TB 2HGLA 1UFKA 2VIHA 2DRAA 4F67A 1QAJA 5E3QA 2V67A 2BX6A 2DH9A 2RIJA 4NA2A 3TX8A 3TUZC 3DLGB 2CVEA 3DHWC 3DOMB 4GKKJ 2RQ4A 3I55S 2V2KA 2B4UA 3H7HB 2K7KA 3F56A 4DR7F 1Y3KA 1I1GA 3MPDA 2MQLA 4DFMA 2Z56B 4DJBA 5HMWA 4WE1B 4QW8A 1N88A 3RR8A 3MWBA 1C1CA 1U0HB 1KTVA 5IFMA 4DV4F 1RBLA 5CCMA 1FNXH 1NH8A 2DR6A 2KRBA 1RKIA 3LGMA 3IRXB 4KFBB 2J9CA 4Q7AA 1KVJA 3CMES 4JI1F 2HZCA 4EMDA 1KQKA 3UDLA 2OMOA 2JC0A 2YKNB 3FSIA 3HHNB 2EC0A 2YQ0A 2RU3A 3CJ3A 3OBIA 2P2CB 2LDYA 3BQ2A 1Q81T 2CADA 4ZLNA 2NPFA 4JI6J 1NNDA 3DDNA 3W8GA 2PIIA 1SQEA 3WBZA 3F44A 2FQQB 1JLEB 4KAIA 3UWTA 1RLDA 3MAQA 4IQMA 2KI2A 5DZ6A 2AF6A 5KT5A 2Y1IA 2VOPA 4OYIA 1JLAB 2V0NA 2UV8A 2BJ8A 2IVFB 4J9VA 2ZZMA 5M2PA 2MXYA 3T6BA 1TL3B 2L9WA 2DR5A 2JFKA 5D78A 4D3HA 1CEZA 1FX4A 5IOLA 5KFPA 1SJ3P 3ENVA 1HPZB 1VQ6S 2AEFA 1GAOA 1WJ9A 3T5JA 2EFVA 3NXZA 3PHTA 3MM8B 2MQPA 3ET6A 2QA1A 4JV2A 2V9KA 1S6PA 5KG0A 2W9BA 1NB2A 3DI6A 4IKAA 2XMWA 1KOOA 3FZBA 3KUEA 2ZD1A 3PO5A 4FPRA 4HTJA 3MHYA 4OJ1A 2AW0A 1JLGA 5B09A 2DEIA 4B3SJ 1CS4B 2HURA 4HT7A 4NOHA 2G1HA 5D4LA 4QIWD 4XTTA 3JYTB 3M6UA 3R6LB 2HHHJ 1T95A 3RB4A 5DO2A 3QRRA 1NUEA 1S6QB 1RWXB 1SVDA 4ETZA 1LKZA 2J6SA 5HSPA 1U1PA 3MD1A 2XEXA 1OY9A 4QR0A 5EN1A 4XIUA 3CXCR 1IBCB 2IFXA 4DG1B 2IJNA 4ILRA 3I4PA 2XSJB 4M5KA 1FWKA 3LF0A 4TYBA 4KGMA 1V6HA 1UW9A 2HMIA 1MROB 1F5CA 3UVJA 2H48B 1M5HA 1RA7A 3ZZYA 3TZWA 4LBPA 4ELTA 2CJQA 1NHKL 5CHCB 4PABA 3P6YC 1XMOF 3GJRB 4R0JA 4NLQA 3BGRA 4USTA 3MM6B 5E0OA 1H7XA 3MTKA 1QAXA 3V81B 3FCWA 4HACA 2O1PA 5D77A 2ZITA 5GAHU 4PG8A 1RTZA 2JNJA 3UD3P 5K20B 5K9FA 3CCUS 1L5UA 1H98A 4O4GA 2B9YA 4LF5F 1CJVB 4CWBA 2RUGA 1B64A 5DG8A 4C8YA 4M63A 1SUQB 4K0KF 4C11A 2AMCB 1H2VZ 4CDIA 4UOGA 3C3LA 4LSNA 2JDJA 4CO0A 1GH8A 2GQQA 3TVZA 4LFAF 3TVYA 1D1UA 5E3CA 2BEFA 3K58A 1TKTB 3VAFA 1U6BA 3BB5A 2IY5B 3OR2B 1QSLA 4TLRA 4CTAB 3Q2TC 3RAXA 1T7PA 4R8UB 3QRPA 3OR1B 4TXSA 3GJSB 1RP5A 4IDKB 2QYGA 5J1NA 2IVYA 1KDNA 1S4EA 1B4SA 1HBNB 3R5CA 4WFXA 1KD1T 1WG1A 2C3MA 1TR0A 2PN6A 1N36F 2K1RB 2LLZA 3DLLQ 4FF1A 2B6AA 2DNKA 4DCOB 1LW2A 4ECWA 2ZM6F 1V5VA 2VHGA 2EBEA 2FHKA 3GCXP 3BV8A 1QM9A 2NXUA 5GMDA 5CYJA 5A8RB 4KE5A 5C25A 4F2SA 1LWFA 1D9AA 3K8VA 1QTMA 3L7UA 1WI8A 1X0FA 2DGXA 3H8YA 3FEYB 1B70B 2BACA 4DN0A 4IH7A 4C8NA 1FNMA 1TMJA 1F1BB 1RAHB 4LSLA 2NXJA 4WXWA 2R7XA 1XNQJ 4CM0A 2LU1A 1Q1KA 2KL8A 2RRNA 2YH1A 3SI8A 5L38A 2VF3A 4HH1A 5KFIA 1NPPA 1I6JA 4KTQA 2RF2A 1U4BA 2VFSA 2FDNA 3D0HE 3DXBA 3PHEA 2PMZD 1XNRF 1VQNS 1RWUA 4C0HA 2WOMA 1YX2A 2C42A 2M2BA 1S5ZA 3ZTQA 2BA9A 1OMSA 4C0BA 2VBWA 1JXLA 1OQ6A 4W92B 2EC2A 4HLBA 4ZCIA 3I32A 1RGVA 1S9GA 1RHRB 3T1YF 2FC9A 4FS1A 1VHIA 3DLKB 4ED4A 4PG4A 2V8HA 1RADB 3HHLB 4A8KA 5DLGA 4GKJJ 2OEKA 4NXNJ 3W2WB 1AUSL 2AWZA 1FDAA 2OUGA 2GO9A 1BQNB 2CZ9A 3IMQJ 1JNZB 4C3KA 3BPSP 4PXCA 4TQSA 5CYQB 3T5KA 2YWWA 5KFCA 2D9OA 3O1LA 4JB8B 3A13A 4RWWA 3E3XA 3MM9B 3M8WA 5J2QA 5L1IA 3QGIA 2PI4A 1UVKA 3OXGA 2D3UA 3LAKA 3GTYX 4N8OA 3Q23A 3TI0A 2U2FA 3KK3B 1R0AB 5DQIA 1RU2A 2UXDF 1FHTA 2OPRB 3UCUP 2BR0A 1PIEA 2HFVA 1L3KA 3MPVA 2E9RX 2ZDOA 1MNEA 4IUFA 1YVFA 5AJ3F 3PW2A 3QFWA 4JI4J 1NRKA 2CQGA 2AEMA 4Y65A 3FMWA 2QLWA 1WDTA 3WC2A 1RUSA 5J2NB 4LQ9A 1IKWA 2J5AA 1WTBA 1TFWA 1JJCB 2BJ9A 2F3JA 4I6AA 3LPYA 2QL5B 3NWGA 1FTRA 1TK5A 1NDPA 2J9DE 3DOLA 4RL1A 1UZHA 3DFEA 3MEGB 3QO9A 1X31C 4TNOA 3AD7C 1S1XA 1ZA2B 3I9ZA 4EI2A 3FMBA 4QWAA 2E1RA 1UKUA 3HFVA 5L1JA 1WC6A 4J9PA 1SQGA 3EZUA 4M5DA 4CO1A 1T05A 4E98A 2ILYA 3ADAC 2HRTA 1RT6A 3R5BA 5E3RA 1ZYQA 1Q82T 4ECZA 1TUGB 3MR7A 5AE3A 2IRXA 1HNIB 4X4RA 4OJGA 3PO4A 2QG9B 4CQ1A 1JKHB 3RU0A 1TV6A 5AE2A 3CCVS 4LF9J 4QIGA 2HFSA 3D67A 3L4BC 1FO1A 3MECA 1B0PA 1XR6A 1I94J 5DDQC 1S9FA 1Y5IB 2CQ3A 4FZVA 1PBAA 1B0TA 2OLWA 1CBKA 2X1FA 3RTVA 1RT4B 2R3VA 1AFIA 4RNFA 3OUYA 2ALYB 1KWMA 2H9ZA 1VQKS 2KXFA 2PC6A 5HMXA 2EKNA 1S0VA 3CD5A 2KKHA 5I4MA 4QQBA 1VBKA 1YKWA 1KVIA 1FK9B 4GMKA 1O8BA 3HLUA 4I2QA 5KFDA 3HSZA 1FDBA 2DNNA 4UY8T 3WDOA 1XMQJ 2RAQA 3OD2A 3J81j 2FJDB 2DGQA 3H42A 4EO8A 1VLYA 2IVMA 2YNFA 3KLEA 2YQ3A 3GIRA 2D3OR 1S12A 3J7Z5 2VU5A 2DGTA 5H1SV 1KKHA 2V8DA 1VQLS 4ER8A 1HNVB 3CO0P 3PW5A 4AL6A 4Z7YA 2B8PA 3PRDA 4B3MF 1MU2B 3DOKB 4LF2A 2VDIA 2J8SA 2IC3A 1WEZA 2J9DA 1AZSA 3D28A 2RHQB 3F41A 1SJRA 5J1EA 1OY6A 2CJBA 1S9EB 3SEOA 4RW7B 2OGUA 5CAAA 2N4DA 2IYGA 2RH3A 1HBOA 1P1LA 2NSBA 4PWUA 1NK9A 3DRYA 5L1KA 5A8KB 4MYTA 1KRPA 2X51A 3MR6A 5C42A 2RDJA 1R43A 3N01A 2EFQA 1ZPVA 1QDUB 4Q2LA 3QJJA 3HO1A 2EPIA 4ZVFA 1RT2A 3GIJA 2MHEA 3PX6A 1M5PC 3O5TB 4A8XA 5C2GA 3QGGA 2QA2A 1HWIA 5DG9A 2F9JA 2Y3YA 2NSCA 3MMAA 1SC6A 4K4YA 4YHHJ 4IO9Q 1XJWB 2DNMA 2HVZA 1CVJA 4U6PA 2AJ4A 4Z37A 2HZAA 2FLOA 4C8LA 4G3IA 3VVUA 1R6YA 2AT1B 2ZUGA 2XY6A 3TQ1A 3M8QA 1XBWA 2F8MA 3M30B 3RB3A 4U96A 3EX7B 5HVGA 1UWBB 1LFPA 2GIFA 2J0WA 4DZ6A 5DLFA 4OJ3A 2B5JA 3NCQA 2CQHA 3DRRA 3BM7A 3B4DA 4QWDA 2HIQA 2QMWA 1M1KT 3M9OB 2XZTB 2FPHX 1H2UX 2Z2YB 3BN7A 2F7VA 3DM2A 1TKXB 3UN2A 2HBZB 2GX8A 2BE9B 2DXEA 4ZP7A 1C0TA 1EHWA 4DQQA 3ENQA 1ZH5A 3QT6A 1V9OA 3PX0A 3CDWA 2VQFJ 2AGOA 2R8HA 4QYZK 4V19X 1GEHA 3NAHA 1UPPA 4PWWA 2UXCJ 5DRKA 2IMWP 4PYDA 1RT3B 4YS2A 3UN5A 2HQGA 4MIAA 3CCQS 3SIPB 4DHVA 2HEKA 4PKDB 1VBZA 1LWXA 1HR0J 4DR1F 3KDNA 3I87A 4OLPA 2DCUB 1RTHA 4F50A 4J9UE 1SJFA 2OPQA 2VG5A 4B9VA 3HHDA 1U1RA 3QPIA 4XPCA 1VBYA 1WKKA 3LANA 1F3FA 3TRGA 1R3NA 4HR2A 2GO8A 2G0IA 5J1PA 1KLMA 3NAIA 5HL7Q 1LXJA 3KJVA 5KFHA 3MEEB 1YQHA 2UUWA 4FPIA 2MY8A 3LP2B 2DR7A 2PMHA 3THTA 3IWXA 4UF4A 3M6WA 3M8PB 5E3PA 3AB2B 4V1Ak 3OQ2A 2XNRA 1GMWD 1ZETA 1MN7A 2VG6A 4QR1A 1PBUA 2MLZA 3DLBA 2ZEJA 1W26A 1Q8BA 2U1AA 1JX4A 3GYGA 1LW0A 2V63A 2YTCA 2OO4A 2BE2A 1Q95G 4DLEA 4F25A 3BH6B 3DGPB 4JI6F 4P2MA 2GGPB 2RSQA 1A6LA 2A1BA 3JAMU 2PEHA 1DTTA 3MM7B 1UVMA 1L3UA 3H98A 2ASLA 1E6YB 2KT2A 2FVSA 4NL5A 2BKNA 2AEJA 1R27B 5DQHA 3P49B 4RW6B 4C3LA 4OHYA 3W5ZA 3D0GE 2CQPA 3Q8SB 3FBEA 1HI0P 2AJ2A 2LVWA 3IFEA 3I31A 4DSLA 2P8IA 3HDSA 3L7OA 1AW0A 4DBQA 2KZMA 1NZ8A 1QTNB 1YG0A 2N7YA 4P2SA 2DVIA 1RI7A 4WFNQ 3FDSA 5A0YB 3OFGA 4ILLA 3RRHA 2UZAA 3Q8VA 3OXLA 7FDRA 2HG4A 2Q1LA 1Q16B 4X62J 3ZTSA 5HROA 2BRLA 1T03A 3P45B 4AFFA 5KG5A 4MIWA 1QY7A 4CLUA 3OW2R 3SXLA 3PACA 3G6VA 5L9NA 2D9PA 1RA6A 5IC4B 3G96A 3RW7A 1X4GA 4DU7A 3SV4A 1Z2LA 3NRBA 4CO4A 4UZCA 3PYEA 5ETVA 3MEKA 3AOCA 1PJ5A 1RT7A 1U49A 1D0EA 2FJVA 2MGZB 4RW4A 4NA1A 3O3LA 1TK0A 3SFGA 4K4VA 4DFKA 4ZCMA 2VD3A 5B0BA 4HL9A 2QC3A 2MKYA 2IDEA 3PX4A 1S1WA 2Z57B 3PYFA 2AYEA 2ZBCA 5GAEI 4YMEA 2VPXB 1O51A 3H20A 2UVRA 1F2HA 1A0OB 4LQ3A 1REGX 2Z2ZA 3CW2C 2RUSA 4URSA 3POTB 2B3TB 4ZP8A 2H65B 5BYRA 4DX8H 2R2UA 3CJ4A 4XDCA 3MAAB 4RBUA 1PAUB 3RB0A 2E29A 3KLFA 2WVFA 3FSYA 2CJKA 1U1LA 1HNXF 3G8QA 1PYSB 4OL8A 4MK7A 5FD1A 3UN3A 2M8DB 4ECRA 4FVMA 2M8HA 4ETXA 1HQUB 5JJBA 4NLDA 4L73A 2E5GA 2ZH2A 2E5HA 4DV1J 3KK2B 4DUTA 3ZTRA 3AOAA 3M2UB 4CRJA 2ZKUA 4YFUA 5HJYA 4RU9A 4NCGA 1N32F 2ZFHA 2NYIA 1D8YA 4DV3J 3Q8UA 4NYZA 1R6VA 3H40A 1KTQA 1WC3A 1KVKA 1VCTA 3DYAA 2L48A 1JLBB 3AB4B 3MMCB 1U02A 1ZS6A 4M95A 3TUPA 4N5SA 2FJEB 5AXLA 3CCTA 3FNNA 3K5PA 4FBTA 4JV5J 5D0HA 4RW8A 1SIZA 4L3NA 5HK4A 3JQKA 4YQWA 1QAIA 2CQ1A 2GA7A 1VK8A 1S79A 2XS5A 4EK2A 2FZKB 3HJVA 3AA9A 2ZH7A 3KLHA 3VGVA 1FTCA 2LFVA 2R4FA 4ZDNA 2C3YA 3MMBB 2CDRB 2L41A 4DSKA 3BPDA 2MSTA 1EAYC 2R8GA 2E5JA 4NLUA 2J7WA 2XWYA 4R5PA 1SKSA 2VOOA 2DB1A 2NXCA 4FDFA 1HI8A 5F8NA 1W25A 2NR0A 1T02A 3PR5B 1GK8A 1MG7A 2XLKA 3JXOA 3ETOA 4ZVTB 2HBRB 2FLNA 2E44A 2DGUA 3HM9A 3NGDA 5HBMA 4NI2A 1RU1A 3AD9C 4W4MA 4F3OA 1GMWA 2QMXA 5BXIA 4NRUA 3FKBA 5AXKA 1NSAA 2MKIA 3AJ1A 4KHMA 3R6GB 5ETOA 1SH0A 1M5VC 2XLIA 3LO3A 2XULA 2OEJA 1VRTA 3EMTA 1WNEA 1VR6A 1RAOA 4X66J 1M5OC 2H3EB 5EGYA 3CJKA 2OI2A 1UTAA 1FRHA 1WOSA 2YWFA 2DTJA 1UFLA 4UUXA 4ECUA 5CZXA 1RLCL 4PPDA 2IAJB 3NOCA 6FD1A 2XHWA 3ZTOA 3JQMA 4L74A 2AP6A 2RILA 1KFDA 4NLGA 4KV8B 4OI2A 2LCWA 3AJ2A 2HNDA 2VODA 4ZPBA 4CNYA 3EVWA 1MWQA 2WONA 1UCNA 3SBMA 1SV5B 4ZCLA 3MUTP 2XMVA 4WZQA 4NXNF 4QU7A 4PRFA 3ELHA 3VVTA 4JOUA 1NLKL 1S72S 1ICEB 3BSCA 4ZHRA 5EWEA 3DHXA 2GC8A 2XQCA 1UW4A 4ZLJA 1HNZF 3CCWA 4OHXA 4J9OA 1C0UB 1X7VA 1IXKA 3OFFA 2HQIA 1TL5A 5LM7E 3LWMA 4DV5J 3V4IB 4U8YA 5F3ZA 3A8JA 3FSXA 1IJEB 1FKAF 4DUZF 3D6TB 1BXNA 2CNKB 2MQNA 5F8MA 1WUUA 2MZRA 3PY8A 1KNZA 2EVZA 1TL7B 3NOGA 3BJYA 4HH0A 4U7CA 1SKWA 2KDOA 3MAHA 1JIHA 2Z4PA 3EGWB 1RAGB 4DQSA 1LFWA 4B9TA 3VCDA 3K8WA 4GC6A 4DUYF 2ALZA 1YJTA 5AXNA 4IFYA 1TAUA 1PKUA 2XMAA 1FKPA 2LYVA 2LXFA 2VFVA 3W5YA 5HMZA 1XMBA 2XY7A 2V4JB 5D3GA 1FVSA 3NNCA 4CLYA 1Y7PA 4M5MA 3C15A 2DGOA 4MFBB 3FZ2A 2HGNA 3BS9A 4Y28C 4ZVPB 4DOZA 4KPYA 4YDDB 2OD4A 3BSNA 3OTOF 4C4WA 1D09B 3OFHA 3MEDB 2J0XA 4DF8A 4O44B 5KFYA 2F5GA 2MLYA 3M1VA 4F4AA 1KFSA 3OTEA 4AE5A 1VC0A 3CSKA 3PKMA 3W2VA 2CQBA 2DNZA 3VAKA 4DV4J 3QAUA 4KSEB 1SBRA 2MZQA 4LF9F 5ETMA 4JI1J 2XS2A 1NZAA 1JLCB 4LFCJ 3VWSA 2QV6A 5IM0B 3KHHA 2XG8A 4RUAA 1KBRA 3R7BB 2KYZA 4ZVHA 2JZ5A 1U1NA 1OY8A 5J2PB 1NJIT 1F60B 4DX7A 3NNAA 4W90B 3LAMA 4OX6A 3AXMA 3ZZTA 5I3UA 2ROGA 3ILIA 1GMUA 4J91A 3OTBA 3CCJS 5CYMA 2IRYA 2IA0A 5L46A 5JUMA 2P6SA 4OZ0A 4AQYF 4USWA 1FA0A 2VPZB 3A3PB 1P6TA 3KTQA 4YY3F 2O01C 2PE8A 1VI7A 3LH2S 4J9LA 4MT1A 1TL1A 2P6TA 1JJ4A 1VQPS 1CJTA 3I5AA 2YWHA 3M8ZA 2VA2A 1NHVA 3W61A 1VQSA 3P5TL 1FEEA 3KHRA 1BC6A 5ETNA 3T5HA 3CB4A 1VYAA 1HBMB 3R27A 3UDVA 3OJSA 5IT9Y 1BQMB 3OL6A 2OFGX 2R7RA 4PUOB 3GLJA 2VB6A 2G2OA 3WZ0A 2BJ1A 5CD4H 3P3DA 1T3NA 2W9CA 2O67A 3JSMB 2GHPA 4OZ1A 3WIVA 3PDNA 2WVDA 2H1YA 3R1LA 2MY7A 2GAGC 1TKZB 2HHVA 4B3TJ 1S76D 2MZTA 3LP0B 3JSRA 1YRUA 1LWCB 4UOHA 5GMKa 3HULA 5I42A 1RHMB 3TARA 1FD2A 5DJBA 1R0CB 5D4NA 3DMJB 2BM1A 2OPSA 4YHHF 3A3OB 3PR4A 3HK2A 1N5QA 3DCAA 5C2CA 3SSRA 2M9KA 1T9YA 1KS2A 2W1BA 1WC5A 5K14A 1U8WA 1IR1A 5KFFA 1SI9A 4MTPA 3U1MA 1GTHA 4F4XA 1RTJB 1VQ4S 2HIYA 1IR2A 1IKXA 2KVIA 2Y8YA 1XMOJ 3S6EA 2HAIA 1WTFA 3NP5A 3CNQP 3CJTA 2M3DA 2VC1A 1TL4A 2FHOB 2NUHA 1JXEA 2HFUA 1RACB 4LFBJ 1CQNA 4F3MA 3A8IA 1GMVA 1Y5NB 4O4RA 1F9FA 5A2QU 4GO5X 4PWDB 2YNIB 2E7XA 3VGUA 3AA8A 1KHWA 3CUNA 1NPRA 3WX8A 2V8VA 1B7YB 3GSIA 3LP1B 4K0KJ 5B0GA 3QGPA 5J2MA 3T41A 5GAHI 4M1KA 3E01A 3NGKA 5ETKA 3CT9A 3KOAA 2CJXB 5JXSA 4WFBQ 4LFAJ 2VQFF 3DRSA 2WOMB 2ZBRA 3VZIA 3DKDA 3DRXA 5EHHA 3C46A 5KFEA 3SCIE 2RRBA 3E8OA 1ZTTA 2CPIA 4ED5A 3TJ8A 4F3QA 3IG1A 1GXUA 5LT5A 5HVHA 2QLJB 4Q0BA 4CH1A 2QA4G 3D4JA 3KXDA 5BYQA 1TELA 4DL2A 2VQEJ 1FJCA 1VOMA 1QE1A 3QFHA 4DR5J 1N36J 5CXTA 5HP1B 1RT5B 3C8YA 4A8QA 4MMOA 1NMEB 1XN9A 2ZM6J 2R2SA 5LJ5Y 2WZ1A 3PW0A 1YZ6A 3LALA 3TEHB 2W8LA 3OJUA 1Y00A 1YRTA 1GXLA 2OEMA 1TK8A 2KFYA 2I5JB 1HIYA 3JS9A 4DQIA 4C9DA 2WVBA 3RJMB 1F9HA 1FE0A 1RWOB 3BO3A 1HA1A 4QPTA 3D9BA 3PW4A 5JMNA 4OI6A 2ZKTA 3DLEA 2M7SA 3VAIA 1FRKA 5CCLA 1HHTP 2ZJRQ 1HQ2A 1S1VA 3J7ZT 2VUGA 2UP1A 2BKPA 1S6OA 4E8UA 5SUHA 3ICLA 2GMJA 2J7UA 4IRCA 1OIAA 3N5FA 2OTJS 3KNAA 2XCAA 8RUCA 3ZO7A 5DZ7A 3Q24A 3J7A1 2WVCA 3DOLB 4CT8A 3HKWA 1JK9B 5B0FA 3QO9B 1SKUB 3H5YA 5DDPC 4A8YA 2GQCA 3I0SA 4KY3A 4EU0A 1S0MA 1S1XB 2MKJA 1U2RA 4TU7A 3TNVA 1PCAA 4OI3A 2BOPA 5KT4A 1C2PA 4QWCA 2VFRA 3TUIC 3U02A 2XHCA 2F8EX 4F04B 3DU6A 2YPYA 3S1TA 4S0MA 1UL3A 5HQ8A 1RT6B 3C6TA 2B56A 1DAXA 3US5A 2R7OA 1UA0A 1X8DA 3KG4A 1RKJA 3VTIA 5B0DA 1F5AA 2G4BA 5D0RA 4WPAA 3CJQA 2VBZA 4BC7A 3ZZPA 3DOMA 4J9KA 3QLHA 2QRRA 2MDAA 2VASA 1EQ0A 2C2KB 1HWLA 2JHEA 3MI7X 1I51B 4WE1A 2BM0A 2KO1A 2D74B 2A6MA 3IXQA 2UXDJ 1N0VC 1RWWB 4ZIVA 1U2CA 1K1QA 3N6NA 4OYXA 4KFBA 3IRXA 5AJ3J 3MR3A 4W98A 5LSLA 4RPFA 1ZOTA 2ZBIA 3QT8A 3EZ5A
chains in the Genus database with same CATH topology
1HKAA 1DY3A 5ETSA 3KUEA 1RAOA 1RB0A 4M5JA 1RU1A 3UDEA 3UDVA 1EQ0A 4M5GA 5ETLA 1Q0NA 4AD6A 1CBKA 2CG8A 5ETPA 5ETVA 2BMBA 4CYUB 1KBRA 3KUGA 3ILIA 4M5MA 2QX0A 3HSDA 4M5IA 3HSGA 1EX8A 1EQMA 4M5NA 4CWBA 4CRJA 3ILOA 3KUHA 1TMJA 3HCXA 5ETTA 3ILJA 1RU2A 3HD1A 4PZVA 5ETKA 3IP0A 5ETOA 3HT0A 4CYUA 1G4CA 3MCMA 1HQ2A 3UD5A 5ETNA 4M5LA 5ETMA 5ETQA 3ILLA 4M5HA 3QBCA 1F9HA 1TMMA 5ETRA 3HSJA 3HSZA 3MCNA 3HD2A 3MCOA 4M5KA 2F63A 1IM6A 1RTZA 2F65A 4F7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKA A;  1DY3 A;  5ETS A;  3KUE A;  1RAO A;  1RB0 A;  4M5J A;  1RU1 A;  3UDE A;  3UDV A;  1EQ0 A;  4M5G A;  5ETL A;  1Q0N A;  4AD6 A;  1CBK A;  2CG8 A;  5ETP A;  5ETV A;  2BMB A;  4CYU B;  1KBR A;  3KUG A;  3ILI A;  4M5M A;  2QX0 A;  3HSD A;  4M5I A;  3HSG A;  1EX8 A;  1EQM A;  4M5N A;  4CWB A;  4CRJ A;  3ILO A;  3KUH A;  1TMJ A;  3HCX A;  5ETT A;  3ILJ A;  1RU2 A;  3HD1 A;  4PZV A;  5ETK A;  3IP0 A;  5ETO A;  3HT0 A;  4CYU A;  1G4C A;  3MCM A;  1HQ2 A;  3UD5 A;  5ETN A;  4M5L A;  5ETM A;  5ETQ A;  3ILL A;  4M5H A;  3QBC A;  1F9H A;  1TMM A;  5ETR A;  3HSJ A;  3HSZ A;  3MCN A;  3HD2 A;  3MCO A;  4M5K A;  2F63 A;  1IM6 A;  1RTZ A;  2F65 A;  4F7V A; 
#chains in the Genus database with same CATH topology
 2YKN A;  4ELU A;  3G6E S;  3ENW A;  2BQU A;  2ZH3 A;  2MZJ A;  3RG6 A;  4OI0 A;  4X2B A;  2DNO A;  3T5L A;  2RKI B;  2VBY A;  1FX2 A;  2HQC A;  2O66 A;  3HSJ A;  1N5V A;  2J6U A;  2KJV A;  3OSN A;  1FDN A;  4GVB B;  4ECT A;  1AB8 A;  8ATC B;  3CF5 Q;  2V69 A;  1X4F A;  1EX8 A;  4ZPC A;  1JLE A;  5DGA A;  2ZBP A;  4NLW A;  2YNH A;  1S99 A;  4PXD A;  1JLA A;  3WC0 A;  5ETS A;  3GU0 A;  2FTR A;  1RB0 A;  4URG A;  4XAK A;  1S49 A;  3LGH A;  4ZN1 A;  4WP9 A;  1DZ5 A;  3OTC A;  3G82 B;  2I1R A;  3FGV A;  2QYC A;  1TL3 A;  2IC3 B;  2PGC A;  3HHL D;  4RR5 A;  3BBF A;  5J1E B;  2D3Z A;  2DPI A;  2OSR A;  2OIH A;  4OLO A;  5KOW A;  1HPZ A;  3R2D J;  2ABY A;  4DPX A;  4BHQ A;  1HD1 A;  4KGV B;  3N4W A;  4N47 A;  2R7U A;  2CQD A;  4DV3 F;  4K50 A;  1FXR A;  4EFA C;  3MM8 A;  2KZZ A;  4N77 A;  2FIU A;  5DM7 Q;  3H2U B;  3W7B A;  4URQ U;  3CCE S;  2ROE A;  4B9U A;  3HSD A;  5L9X A;  4X4P A;  2HS4 A;  4DL4 A;  5IWA J;  4J7C A;  3NGR A;  2K8G A;  4ANE A;  2DNP A;  1RZM A;  3TAM B;  1JXV A;  5E2Q A;  4A48 A;  3I56 S;  4PQA A;  1S7I A;  2G0J A;  3GV7 B;  1BWE A;  1HHQ A;  2B9E A;  3GG0 A;  4I2P B;  2EFN A;  1CS4 A;  3PRV A;  3D7S B;  4M5L A;  3JYT A;  1RDR A;  1GXT A;  1IQZ A;  1S6Q A;  2LEP A;  3JQJ A;  3IS9 B;  4QIE A;  2EG2 A;  5IQ6 A;  3CDU A;  4ECV A;  3IBW A;  8AT1 B;  4Q44 A;  3HCX A;  2Q6B A;  3NBP A;  2IM3 A;  2NZ4 A;  3IA0 A;  4LBI A;  4DG1 A;  1W2B R;  2XSJ A;  4ZN3 A;  3O44 A;  2E7V A;  2C28 A;  4MKB A;  5DS7 A;  3DRR B;  3HT0 A;  3OL7 A;  1G3O A;  2R2R A;  1MRO A;  1DBD A;  1GTE A;  2WBM A;  4YB6 A;  4B3M J;  1NU4 A;  3CWJ A;  1YRX A;  3NMA A;  4X65 J;  2QTW A;  4DL5 A;  1AYE A;  1RTI B;  1C0T B;  2Y1R I;  1DTQ B;  3V81 A;  4X66 F;  2ZBQ A;  3TEG A;  1QAY A;  3M2R B;  2I6W A;  1NDC A;  4I6Y A;  2RT3 A;  3H90 A;  1P8G A;  4PAA A;  4DPT A;  1GFW B;  3EIC A;  5KG4 A;  1MWZ A;  2DHS A;  1EZZ B;  1YHQ S;  2JC1 A;  4JBC A;  4DSJ A;  4ZIT A;  2QFI A;  3MUV P;  3PJ9 A;  1EET A;  3SCJ E;  1BGX T;  3Q2S C;  2HWI A;  4K4S A;  2CPZ A;  1SUQ A;  4RKU C;  4I56 A;  4DPU A;  2EKY A;  3UDC A;  3DGV A;  2VG5 B;  3QT5 A;  4EZ9 A;  5FDL B;  2QSF A;  2HNZ A;  5A6W A;  2LA6 A;  1N8R T;  1HFE L;  4ECQ A;  1TKT A;  4LSZ B;  4OI4 A;  5BR8 J;  2DEJ A;  1FWP A;  3OR2 A;  4CTA A;  5FLX Y;  3NWR A;  2CPF A;  2ZVS A;  1AA1 B;  3BN4 A;  4IDK A;  3KNG A;  2A18 A;  2MQQ A;  1SC1 B;  3M32 A;  4UW2 A;  1HBN A;  1K44 A;  2BW7 A;  2W7A A;  5D0G A;  4MKV A;  4DV5 F;  3IM9 A;  4CLK A;  2FJW A;  2K1R A;  3BRE A;  2HHU A;  1KQS R;  2ZHB A;  3IR5 B;  1XWL A;  1HBU A;  1CUL B;  1VGY A;  2YPZ A;  3PYD A;  2MSS A;  2HWT A;  2A2C A;  2ZNZ A;  1XQI A;  3GIL A;  2NUU G;  1TFY A;  4RO0 A;  4USK A;  1HMV A;  1SH2 A;  5A8R A;  1GQE A;  4CCH A;  5H9F J;  4C6A A;  2M88 A;  4CIO A;  1YJV A;  2GJI A;  2ZWP A;  1ULR A;  1ZM2 A;  2KB2 A;  3SQG B;  2ADB A;  4MIB A;  5HO4 A;  2PI5 A;  5KFX A;  4U95 A;  1Y11 A;  2WVE A;  2HS3 A;  2W4P A;  2AYG A;  2FJX A;  4DR1 J;  4A47 A;  1UEV A;  3CIZ A;  1L3T A;  1WHX A;  1WF0 A;  1T0T V;  2UV8 G;  3IBC B;  1ZTW A;  2XMJ A;  1F5B A;  1X5S A;  1YJN S;  2E7W A;  1TP7 A;  5IT0 A;  3X1L B;  4WYW A;  5BJR A;  2CZ4 A;  5MAO A;  3BGL A;  4A46 A;  3I4H X;  4U67 Q;  3OHB A;  1J27 A;  4LRD A;  4F2R A;  2AGQ A;  2NZC A;  3LTO A;  3OL9 A;  3QQC D;  3HVT B;  1YGY A;  1T03 B;  3BGF A;  4JI3 J;  2LEC A;  3DLK A;  1ELO A;  3MUR P;  2B7B B;  1Q0N A;  2QEX S;  4YB5 A;  4K2X A;  1BMQ B;  3RUB L;  4R25 A;  4FYW B;  4LFC F;  5C24 B;  4LIW A;  3IP0 A;  3W2W A;  1R8H A;  2FJA B;  1YTY A;  3H2L A;  3W60 A;  4N8N A;  2JVR A;  4YDX A;  3RB6 A;  3U27 A;  2HFO A;  3Q86 A;  2IM0 A;  2YKQ A;  4J9M A;  5CYQ A;  4RW4 B;  4AUK A;  2QLB B;  1IWA A;  4NYO A;  3IM8 A;  4DS5 A;  4EO6 A;  3GFZ A;  3NMR A;  2HHP A;  2WK4 A;  2V5H G;  4F8R A;  4DV0 J;  3IWL A;  4AND A;  4LRB A;  2E5L J;  4Y0F A;  1S1W B;  2XY5 A;  4BWJ A;  1NSK L;  3J81 U;  3IGV A;  1DLO B;  2Z58 B;  3KWM A;  1R0A A;  2XMT A;  7AT1 B;  2OPR A;  3QWU A;  2M4M A;  3BKT A;  2EBG A;  3TWZ A;  9RUB A;  3D68 A;  2E66 A;  4QIF A;  4P52 A;  5M2R A;  2UU9 J;  1D3W A;  4DR6 J;  2ZWO A;  2UUC F;  3TZZ A;  4JI8 F;  4A4J A;  4P10 A;  5DDR C;  3GIK A;  2E1A A;  3SZ2 A;  1VC6 A;  2HRU A;  1S57 A;  1D9F A;  4AYB D;  2RU9 A;  4WTY A;  1N33 F;  4KGZ B;  2NPI A;  3G87 A;  5L8R C;  4QIV A;  3MEG A;  2F65 A;  4KKO B;  2D3O 1;  4FYY B;  2OTL S;  1NK0 A;  1RHK B;  4M5G A;  4KQZ A;  3TYT A;  3NS6 A;  1ZZN A;  1R31 A;  3EWG A;  3HHL C;  2CQ2 A;  2V2Q A;  3JB9 k;  2B4P A;  3CDE A;  3MCM A;  1DQA A;  5ETQ A;  1JQG A;  3OVS A;  4OX9 J;  2BVZ A;  4B3T F;  5B7W A;  3IR6 B;  2JVO A;  2BMB A;  4M8L A;  1U1O A;  2UXB F;  1NK8 A;  4P9S A;  4B3R J;  4FP9 A;  1P9Y A;  1FES A;  2A6O A;  4NLR A;  5LXY A;  4IR9 A;  2DHH A;  4C7Q A;  4DV6 J;  3PV8 A;  4WZM A;  3BO2 A;  4N41 A;  4HKQ A;  4A8S A;  4NEZ A;  1V5I B;  3EE3 A;  2IBO A;  4NPO A;  5L39 A;  1Z4U A;  2AD9 A;  1VBX A;  2HZV A;  3AJD A;  1X4B A;  1H3D A;  4CLP A;  2FGO A;  1RT4 A;  2XM3 A;  1FKO B;  2XTJ P;  3M6X A;  1NDK A;  3V6D B;  1Z2Z A;  2V6A A;  2CYY A;  3I0R B;  5HVF A;  4ZPD A;  4O3S A;  1H2T Z;  2HAF A;  2K7J A;  3S8S A;  3ZFV A;  1HNX J;  3B4M A;  1Q86 T;  4OYB A;  4LFB F;  1UEU A;  4ELV A;  4OYW A;  1IQT A;  1FK9 A;  3GSD A;  2HHQ A;  5KFN A;  1WD6 A;  2XSF A;  4RUC A;  4C8O A;  2X1B A;  3HT3 A;  4Y00 A;  1N52 B;  1WOR A;  2RJZ A;  4PYA A;  2JLE A;  1Q79 A;  3CJK B;  4YUD A;  3UO0 A;  2EI5 A;  1N32 J;  2FUG 9;  4UQT A;  1FF2 A;  2LXI A;  2CIM A;  4X4U A;  2PEB A;  4K2J A;  1HNV A;  2ILZ A;  2GIR A;  4OV6 A;  4RBV A;  1MU2 A;  1CJK B;  4LR7 A;  4ICL B;  3NKY A;  4LF7 J;  3HXM A;  3CJ0 A;  4FNI A;  1WI6 A;  2VPW B;  5T7L B;  2IBK A;  1S9E A;  1WF1 A;  3NNH A;  5A2Q Y;  3T1A A;  4A8O A;  2VQE F;  1U7L A;  4QW9 A;  4DR5 F;  5A8K A;  3KJQ B;  4J9S A;  2IHR 1;  4K5S A;  3QZ7 A;  5LOQ A;  3LA0 A;  1ZZF A;  4MK8 A;  1O0P A;  1YJ7 A;  4DR3 F;  3G8S A;  1QLN A;  2CG4 A;  2BKO A;  3FK4 A;  1VMB A;  2I9S A;  1XER A;  1Q5V A;  2ACM A;  2R8I A;  4KHP J;  1FFW B;  4LRC A;  1YZ7 A;  3HD2 A;  1WWH A;  1N34 F;  1HI1 A;  3UW1 A;  3B78 A;  1JMT A;  1N6Q B;  2QA4 S;  1Z1Z A;  5THW A;  2AU0 A;  3GJT B;  2CFX A;  1SL2 A;  1UJ5 A;  2RNE A;  3MPW A;  3GIM A;  3G71 S;  3Q83 A;  3OPK A;  1RJJ A;  4OIX A;  4ZJL A;  3M30 A;  3SCK E;  1H0H B;  1SC4 B;  2WSF C;  1DRZ A;  1UWB A;  2G2Y A;  4CLF A;  5F41 A;  3EGN A;  4I64 A;  1DQ8 A;  3PYG A;  3FBF A;  2NCK L;  2W2N P;  3J80 Y;  4TY8 B;  4DQP A;  3OSP A;  1X5P A;  4DFP A;  4TVA B;  3KK1 B;  2WHO A;  5E5N A;  4WJB A;  2CRL A;  1N5S A;  2C3P A;  4Y2M A;  3K59 A;  2NXE A;  2X3G A;  3N6M A;  4Y3C A;  3QBC A;  1AUD A;  4USM A;  2FLP A;  5K8O A;  5KFJ A;  2VFT A;  1BHN A;  1TKX A;  4WII A;  1VQ8 S;  1M5K C;  4WF9 Q;  2GZO A;  3UCG A;  3CDA A;  3JSY A;  3B6B A;  3MZI A;  3K57 A;  3IAS 9;  4I7F B;  1J5E F;  3V2U C;  1QVF R;  3HPO A;  3QAE A;  1RT3 A;  3S01 A;  4A8W A;  4JI0 J;  2HFZ A;  3TA2 A;  4IO1 A;  4LR8 A;  3W2V B;  4K4W A;  2Y1L B;  3O6Q A;  1RK8 A;  1WAC A;  2EG1 A;  1RWP B;  2EWH A;  2CXE A;  2CPH A;  4IH6 A;  2JL9 A;  2GMH A;  1HNZ J;  5KFR A;  2NQP A;  2BDP A;  5KFM A;  1N0U A;  1U2F A;  1SL0 A;  2PFD A;  4DUZ J;  4KIA A;  3PNI A;  3T3F A;  3MEE A;  4ES1 A;  2WCX A;  3ISN C;  2Y1J A;  3QJP A;  3EXY A;  4OHW A;  5DM6 Q;  2EFO A;  3M8P A;  1OJ4 A;  1FJE B;  3KLG B;  4ED0 A;  2AKW B;  4KBI A;  3ITH A;  4HHU A;  3G2X A;  1S97 A;  4DUY J;  4LF8 J;  4NA3 A;  2EK6 A;  3TX0 A;  2ZOF A;  4Q8E A;  1NJX A;  1O5J A;  2C2O B;  1TL1 B;  2XI2 A;  3UE2 A;  3DGP A;  3HHE A;  4XPE A;  1MMD A;  2CQC A;  2GGP A;  4O3O A;  4ZK7 M;  3AFG A;  2X7I A;  2PSZ A;  2XLJ A;  3TUJ C;  3HMJ G;  3MM7 A;  2AX0 A;  3VAJ A;  2QX0 A;  1E6Y A;  2HHX A;  3CE8 A;  2B8Q A;  3OTO J;  3K2Y A;  4OI1 A;  3QIP B;  4OFZ A;  3NEK A;  1RWM B;  1WEX A;  3HJF A;  2I8E A;  4RW6 A;  3AOD A;  2RE1 A;  2FZG B;  3ZZZ A;  3TJ9 A;  1RAI B;  4NWB A;  5HQM A;  3VAG A;  1RTD B;  1V3R A;  1NAQ A;  5ADZ A;  2CJ9 A;  4ED8 A;  2HVD A;  2L08 A;  3Q0A A;  1X9M A;  5EX3 A;  2MZS A;  3TOQ A;  4I6W A;  3THV A;  4YB7 A;  1VIO A;  2QL9 B;  5KFO A;  3QT7 A;  4RW9 B;  2IRU A;  2CJA A;  2UUA F;  4WK1 A;  2K06 A;  4RNN A;  4MYU A;  2W2P P;  3VZH A;  3X3U A;  2DRD A;  3ZXW A;  2DYA A;  5IWA F;  4G1Q A;  1MMN A;  3HFK A;  3IWN C;  1PIL A;  2BZ2 A;  3H59 A;  3BBC A;  4QWE A;  4NLP A;  2V8G A;  3TW0 A;  1WSR A;  1T9W A;  2FHM A;  2W25 A;  4PG6 A;  3GJQ B;  2RQM A;  5GAG I;  2VA3 A;  1IKV B;  1PJ6 A;  5HMY A;  4AQY J;  2FHJ D;  3EDR B;  2PMW A;  5CQG A;  2GCF A;  4YY3 J;  2JLG A;  3C6U A;  2QLX A;  2C2R A;  3C66 A;  3GP9 A;  1DY3 A;  5E33 A;  2MGZ A;  3CIM A;  3GR1 A;  2EK1 A;  4CH0 S;  4B9N A;  2NLW A;  1FRI A;  2AJQ A;  2HRY A;  2CJY B;  1MLA A;  5KT7 A;  2H54 B;  4I68 A;  3G9C A;  2J0Q D;  2VON A;  1UAW A;  3ZNJ 1;  1S1U A;  2Y0B B;  5KG7 A;  2ZJP Q;  4X65 F;  3I5C A;  4IOB A;  1N5Y B;  1U6Z A;  4CLZ A;  3POT A;  1M1G A;  3W9H A;  2KXH A;  3CVK A;  1RYS A;  3MAA A;  2XYH B;  3KLI B;  1B0V A;  1U6F A;  5B0C A;  3GG1 A;  2ZHA A;  3RBX A;  1TAQ A;  1KON A;  3DC2 A;  4N76 A;  3SFU A;  3FRY A;  4F26 A;  3D6H B;  1YBT A;  3Q22 A;  2O3D A;  4EUV A;  3UR0 A;  2P9E A;  4QYZ J;  2AV5 A;  1HQU A;  3BQ0 A;  4NCB A;  4CLL A;  2KM8 C;  1TTH B;  3NCR A;  3KK2 A;  1REV A;  1S7H A;  3CTR A;  5B0A A;  2FJB B;  3L95 X;  5GVQ A;  1VFJ A;  1C4A A;  1T9U A;  5F8L A;  4FNH A;  3D6M B;  5KFT A;  3OHA A;  2DGW A;  4MJK A;  2VC0 A;  2X1G A;  3TAP A;  4IG3 B;  4FS2 A;  4ES2 A;  4EGL A;  5BR8 F;  2JEI A;  1KN6 A;  2BJ3 A;  1UVI A;  1FI4 A;  4ES3 A;  2FVC A;  3V6H A;  3OTD A;  1A9N B;  4P71 A;  5KFU A;  3TZX A;  3R8Y A;  3F73 A;  1L3S A;  4LF1 A;  3MMC A;  4ZIW A;  4OZ2 A;  3D1H A;  4ID5 B;  1UFW A;  3MCS A;  4ZVU B;  2G2Z A;  3CD7 A;  4JYA J;  3W9J A;  1U45 A;  2ASY A;  3UNY A;  2XGQ A;  3C16 B;  2XYP B;  3GV8 B;  4X64 F;  3NG8 A;  2KG0 A;  4WP8 A;  5ETT A;  4PZV A;  3AAW B;  3MMB A;  2I0X A;  4DV2 F;  4GC7 A;  1RBA A;  3T9N A;  2HVE A;  3L3C A;  5T14 A;  1NDL A;  1N54 B;  3EM1 A;  1EAR A;  3KMS A;  3A12 A;  5F9N A;  4NZ7 A;  2E5I A;  3H25 A;  4F0H A;  1YIT S;  2GIQ A;  3TZY A;  3HI9 A;  3MR5 A;  1T9X A;  3ZNU A;  1GX6 A;  3MUM P;  3GFX A;  2K3K A;  3M8S A;  1BQX A;  3FFI A;  4PQU A;  5F8I A;  3NCP A;  2ZJQ Q;  5KFL A;  5KTQ A;  4IG0 B;  2FVR A;  3EPI A;  4Q5V A;  4EYH B;  1N48 A;  2M52 A;  2QT7 A;  4USI A;  2KHC A;  4H4K C;  4M5N A;  1Q8L A;  2RDI A;  3KG1 A;  3AD8 C;  2DGV A;  2QSW A;  4UQG A;  3P5B P;  2P5V A;  2YKM B;  4G65 A;  3PJW A;  1HW8 A;  4CYU B;  2FLL A;  4CH7 A;  3SMZ A;  1U48 A;  3ZZR A;  5HI7 A;  5C7P A;  2IAJ A;  3QYY A;  2WSE C;  1HYS B;  4OZN A;  4PEO A;  1P27 B;  4WKR A;  2BYC A;  4DCP B;  2BAN B;  4KV8 A;  1N5T A;  4JI3 F;  1LWE A;  3JTN A;  2V50 A;  5KFG A;  1C1B B;  2PT0 A;  3QLH B;  1CQM A;  1T9V A;  4WKY A;  4EZ6 A;  4P7V A;  1NK6 A;  4EBE A;  3M2V B;  1SV5 A;  1EP4 A;  4ZPV R;  1UJ4 A;  2VV5 A;  1FFG B;  2H51 B;  4B3O A;  2XC9 A;  2HBY B;  4WIQ A;  4IQX A;  1IKY B;  1VRU B;  1IM6 A;  1EJ7 L;  5HN0 A;  4ZVS B;  2CAJ A;  1BUX A;  3D66 A;  2VFU A;  1C0U A;  4PR6 A;  3V4I A;  3MPU B;  3O2I A;  4DV0 F;  3ILO A;  3NGU A;  2ZH1 A;  2E5L F;  1R89 A;  2KG1 A;  2DNQ A;  5HLF B;  3FQK A;  2DBB A;  1RAF B;  1YI2 S;  2FZC B;  4NMX A;  1UP1 A;  1TL7 A;  4L72 B;  1QVG R;  4Z7C A;  5H9F K;  3SSS A;  1TVR B;  4LF6 F;  3KDO A;  2X3D A;  1VK3 A;  3H0P A;  2N82 B;  3FQL A;  1CSJ A;  4ZJO A;  2BJE A;  3IBF B;  2FHJ A;  1ZM3 A;  2UU9 F;  2XMM A;  4FF4 A;  4DR6 F;  4AD6 A;  4Y2C A;  2DNL A;  3DN9 A;  3PCO B;  2BBE A;  1GNK A;  2YNH B;  4O3N A;  5KFA A;  2W24 A;  1RAE B;  2LQ5 A;  4RNM A;  3PJX A;  3MM5 B;  4USV A;  2FYX A;  5ETP A;  2W7P A;  1H38 A;  1JLQ B;  2W7O A;  3SV3 A;  1AT1 B;  2V4J A;  1T8E A;  4ZVR B;  3QMQ A;  1VQ7 S;  4NLV A;  2CDQ A;  2CQ4 A;  2KM8 B;  3J81 Y;  4K4Z A;  4MFB A;  3WIU A;  2GVZ B;  1CPZ A;  2LA4 A;  3I6P A;  5IT4 A;  1VQY A;  4CO3 A;  5M2U A;  4OHV A;  1W2I A;  4Y2K A;  2C2Z B;  4OX9 F;  4JV0 A;  3RZA A;  2LQ9 A;  3MED A;  3FEZ A;  4O44 A;  2AHO B;  4MAK A;  5K8M A;  3ZZU A;  3PIP Q;  3CMA S;  4CZC A;  4LVN P;  1MW7 A;  4B3R F;  2KH9 A;  2HK3 A;  1S1T B;  3TR5 A;  1V3Z A;  5KG6 A;  3QGH A;  4DV6 F;  4IYQ A;  5F0W A;  1VQM S;  1JLC A;  3CJ2 A;  2QE5 A;  1KHV A;  3GWC A;  5IM0 A;  4ITS A;  3M05 A;  1IBK F;  3BQ1 A;  4B08 A;  4ZOS A;  3QNW B;  2CUY A;  1CJU B;  4YEA A;  3SDE B;  5J2P A;  4L3K A;  1FEH A;  2LMI A;  4J9R A;  3BSA A;  1KSP A;  2HNY A;  1VIS A;  1OPI A;  3NBP B;  4BWM A;  5KAK A;  3QID A;  2CNO B;  2GVD B;  3BYP A;  2YNG B;  4DLG A;  3T6J A;  4C98 A;  5A8W B;  3EGV A;  4KGK A;  1PSD A;  5KFS A;  3EXC X;  1RT1 A;  1VJW A;  2B43 A;  4O3P A;  1X4H A;  2C3U A;  3FVY A;  3KUH A;  4ZVE A;  2AGP A;  4MKY A;  5D0E A;  5LL6 d;  1HNW F;  1Q8I A;  3R3T A;  5B08 A;  2UUB F;  4IFV B;  4U7U D;  2ZC4 A;  2YX4 A;  2DPJ A;  2HGM A;  2DRB A;  3FBC A;  2BJ7 A;  4ZCK A;  3EPG A;  4QJV A;  2ZE2 A;  2GV1 A;  4HI2 A;  1MWY A;  1HBM A;  1EET B;  2W01 A;  3ILJ A;  1BQM A;  3RYL A;  4LF7 F;  4KO0 B;  4M5H A;  2JLF A;  4PUO A;  1E6V B;  2WTF A;  2ZH9 A;  2BJD A;  1BWV A;  1FRJ A;  1ROF A;  2F8H A;  5KFK A;  4ERD A;  5E41 A;  2HNZ B;  3JSM A;  3NLC A;  2XO7 A;  1XK8 A;  2DHX A;  3DDK A;  3BF4 A;  4ZJQ A;  2OP5 A;  3H2V E;  5LJ3 Y;  1TKZ A;  2J76 E;  4OJH A;  2W2M P;  4WWS A;  4ZKA A;  4X4O A;  4DCJ B;  4DZD A;  3LP0 A;  2JOQ A;  3B54 A;  1LWC A;  3LOU A;  1YJR A;  1M0S A;  1LV5 A;  1Q7L B;  3M32 B;  3DRP B;  1DQ9 A;  3DMJ A;  4Y34 A;  3JTP A;  2V9W A;  3R5D A;  1RCO B;  2DIV A;  4KHP F;  3AT1 B;  5LMN J;  2RRA A;  3VF0 B;  5HQL A;  3BO4 A;  2J8A A;  1XEZ A;  2EW9 A;  1YDL A;  3K5N A;  4IRK A;  1HBU B;  4O3Q A;  2WW4 A;  3CED A;  1L3V A;  1F3V A;  3CC4 S;  1RTJ A;  1PC5 A;  4DX5 A;  4CLW A;  1JWW A;  2QJ3 A;  1JLF B;  2G1D A;  4UZB A;  4QCL A;  1HMV B;  5EDW A;  4JI5 F;  2GJ2 A;  5G0R B;  3H5U A;  3IAM 9;  3J7Y U;  2OPP B;  4CLS A;  4IH5 A;  4UUW A;  3SSQ A;  1F0X A;  1I3O B;  4QWB A;  1ZAV A;  2W9A A;  3RBD A;  1HQE B;  3BGU A;  3W66 A;  2XBP A;  2CPX A;  3TVK A;  4RNO A;  4PWD A;  2YNI A;  2FY8 A;  1XC9 A;  4J90 A;  4DN9 A;  2KHD A;  4YN3 B;  1TQL A;  1APS A;  3QAT A;  1X4C A;  3WQP A;  1FER A;  3LP1 A;  1PJ7 A;  1ZBT A;  2RHS B;  4O0I A;  5L1L A;  2NXN A;  1XIQ A;  2IJF A;  1UVL A;  4RNH A;  1YK9 A;  4DF4 A;  4DFJ A;  1F2G A;  1VIX A;  2DT9 A;  4DL7 A;  2HHW A;  5T41 A;  1AFJ A;  2V4R A;  2A3J A;  4PXE A;  4FBU A;  7FD1 A;  5CD4 A;  3AY0 A;  2MEW A;  4JI0 F;  2FVP A;  2LKZ A;  3ETM A;  1LOU A;  1C1C B;  2LEB A;  1IBL F;  1K0T A;  1Q78 A;  4F0K A;  2HKE A;  2ZC3 A;  2ROP A;  1NM2 A;  2PDA A;  2D41 A;  2L3M A;  3K5M A;  4LMZ A;  2AYM A;  1LXN A;  4KGX B;  3KMQ A;  1TZ0 A;  2POK A;  2A10 A;  3PM9 A;  2F1F A;  2L9N A;  1SJQ A;  1WKL A;  4WFZ A;  1EKS A;  5HP1 A;  3V6K A;  2Z8Q A;  1RT5 A;  4Y2I A;  2ZOG A;  2W2O P;  3Q8Y A;  3L9Z A;  4BLG A;  1H7W A;  1YJU A;  1NBE B;  3G8T A;  2F4V J;  3PFE A;  4I4B A;  4LF4 F;  4B9M A;  2P9G A;  2VL1 A;  2VJV A;  1T94 A;  2MHN A;  3PKY A;  4JI2 J;  3CD6 S;  5K8N A;  3CO9 A;  2I5J A;  4LRF A;  3R9L A;  3D54 A;  3W9I A;  4UTG A;  1FJG J;  4LF8 F;  4DV7 J;  1HHS A;  1XR5 A;  3GON A;  1KP6 A;  1M90 T;  4I0W A;  4R0E A;  3KG0 A;  3LUY A;  3BSO A;  3B8H A;  2MKC A;  4XO0 A;  4FXD A;  4LRA A;  3A8K A;  4NYP A;  3N9U C;  3U1L A;  1X4D A;  3THP A;  3NGT A;  1IVZ A;  1FFS B;  3CDB A;  2WRM A;  3OVA A;  4RX6 A;  2B9W A;  4PCQ A;  4U7U K;  3ET6 B;  2XCP A;  5MLC V;  1S6P B;  2W9B B;  2HHT A;  3UI3 A;  3B82 A;  3DI6 B;  3NL0 A;  2B4V A;  4LVO P;  2ZD1 B;  4CM2 A;  3W8P A;  1J5O A;  1RE1 B;  1JLG B;  2IM1 A;  4QU6 A;  4BC9 A;  1PO6 A;  2G13 A;  2WB1 D;  2XMK A;  3MPY A;  2X1A A;  5GAG U;  4DU8 A;  4ENO A;  3D1O A;  4IOA Q;  4TQR A;  3V6J A;  1W7W A;  1ARO P;  2V94 A;  2E9Z A;  4X4Q A;  1QD1 A;  4J37 A;  1OQ3 A;  4L6V 3;  1EKR A;  2HMI B;  1U25 A;  4HYK A;  4TU8 A;  1Y3J A;  3MTJ A;  4P73 A;  1Y5L B;  3UVJ B;  2SXL A;  3K89 A;  3KHG A;  4DXL A;  1UEK A;  1NCL A;  1WEY A;  4L76 A;  4HVZ A;  2MB0 B;  5IT9 U;  3BGR B;  5F8J A;  2IJR A;  1SQF A;  4ZLL A;  1QUP A;  3UQS A;  2J0S D;  3TO8 A;  3FBB A;  1D8Z A;  2C22 A;  3CJR A;  2DGS A;  2UUC J;  3A8E A;  2AJ0 A;  3ZZO A;  4HAC B;  4P75 A;  4JI8 J;  4N56 A;  2MKH A;  1LK7 A;  1UVJ A;  3T9Z A;  5LSR A;  2JFD A;  4RU2 A;  4O4G B;  2IIH A;  2RKI A;  1RHU B;  5EWG A;  1N33 J;  2G9O A;  3PW7 A;  4TKT A;  4GVB A;  2E1M C;  1G6B A;  4N7T A;  4C11 B;  1RXO B;  5F8G A;  4IR1 A;  2ZH8 A;  4DL6 A;  2ZH5 A;  4LSN B;  3BZQ A;  3IO1 A;  1LK5 A;  1R8C A;  2ASJ A;  1K0V A;  2FVQ A;  2UVW A;  1M1H A;  3GE9 A;  4HTI A;  2VG7 A;  1HL6 A;  3LW5 C;  2B4O A;  1VJQ A;  3G82 A;  3CPW R;  3UD5 A;  2AIR B;  1QSS A;  1J2V A;  4ECY A;  3WHI A;  3CUL A;  1X4E A;  1OSC A;  4EWT A;  2R8K A;  4ZP6 A;  2UXB J;  1JJH A;  2DNR A;  1X0P A;  1ACM B;  5EUH A;  4RZR A;  1K73 T;  2HLT A;  1K1S A;  1TUW A;  2HSE B;  2KN4 A;  2B6A B;  4YR0 A;  1LW2 B;  3RR7 A;  2OKQ A;  1Y0H A;  1F9E B;  4AXI A;  3A4T A;  3TJA A;  2MZ1 A;  2QO3 A;  1SC3 B;  3PIO Q;  1SJ1 A;  3K7R A;  3TA1 A;  4NRT A;  3TAM A;  4YP3 A;  4BS2 A;  3F0N A;  4JYA F;  2V8P A;  5C25 B;  1LWF B;  3QZ8 A;  1NSQ A;  3W64 A;  4I2P A;  3M9M B;  1KOH A;  3VR1 A;  2DIS A;  4DR2 J;  2MQ8 A;  3W63 A;  4J9N A;  4G1I A;  4WBF A;  1X60 A;  4LSL B;  3TAQ A;  2GW8 A;  2NS1 B;  2W4C A;  5KT2 A;  3IS9 A;  2R7T A;  4OHZ A;  4LBH A;  3CC2 S;  1U26 A;  4Q43 A;  2JX2 A;  3W1Y C;  3DU5 A;  1WDD A;  2J9E A;  4U9R A;  2Q79 A;  2ZNY A;  4NEY A;  3OLA A;  3UPF A;  4KHR A;  2FD2 A;  2VBX A;  3HX9 A;  2RF2 B;  5FII A;  1VQ9 S;  1O6X A;  5KG1 A;  3MXH P;  5GAD I;  3GZ7 A;  2AX1 A;  1R8P A;  4QPX A;  2O5D A;  2ATL A;  1WF2 A;  4JI7 F;  5LMU J;  1NB7 A;  5I3Q A;  3H5X A;  1FXL A;  3M8Y A;  1VS3 A;  4WXO A;  2BV3 A;  3K0J A;  1NKE A;  1T3O A;  3MOJ B;  1MSW D;  2XI3 A;  2C2M B;  4LUB A;  1RTI A;  3MCN A;  2DHA A;  4BDP A;  1S9G B;  3GV5 B;  5IV4 A;  1DTQ A;  4ILM A;  2HBQ B;  4DR4 F;  2YX1 A;  3PZP A;  4H4O A;  4H4M A;  2COL A;  2E1P A;  2XNQ A;  3M2R A;  2HYI B;  2J6T A;  4TU9 A;  1HAR A;  3PEJ A;  3HP6 A;  4ED7 A;  5EX0 A;  1ZM4 A;  5HAN A;  3VGS A;  1RWN B;  3BGO P;  5G4D A;  1URN A;  2I38 A;  1HWJ A;  4B9S A;  4MK9 A;  1MML A;  1MN9 A;  2DXD A;  2QLF B;  4GRS A;  1UET A;  1T11 A;  4DR3 J;  2OAU A;  3PRB A;  4GKK F;  1X9W A;  3MDF A;  2MQO A;  5FDL A;  4USH A;  5D4O A;  2HQD A;  3FRZ A;  5J2Q B;  2CWK A;  1Y4Z B;  2RVJ A;  1WOO A;  2DNY A;  4F02 A;  1N34 J;  4M5I A;  5BYS A;  5F9L A;  1TU0 B;  3G86 A;  2B51 A;  2AZ3 A;  2V2V A;  4DDF A;  1WG5 A;  4IOC Q;  3CC7 S;  3UDE A;  4C48 A;  1UVN A;  1EB0 A;  2MJN A;  3G4S S;  3LGN A;  5HAO A;  3ITH B;  5AE1 A;  2BE7 D;  3VGT A;  4IRD A;  1Q7Y T;  1RWK B;  3N5B A;  2DXF A;  1HWK A;  1IKW B;  4NLX A;  2CPJ A;  5H9E J;  3PEH A;  4RWX A;  1EIY B;  3BH7 B;  1CUL A;  3C14 A;  4B17 A;  2OFH X;  2DY9 A;  3M4X A;  1WHV A;  2D1C A;  4DPO A;  3G6X A;  4ED2 A;  2MKS A;  1I5O B;  2QGF B;  2YKA A;  4ECX A;  1PGZ A;  3VQT A;  1UWA A;  5KFV A;  4PPZ A;  1WEL A;  3SQG A;  2NRE A;  1J5E J;  2BW2 A;  4M5D B;  1T05 B;  1QSY A;  2VKR A;  4X84 A;  3BBB A;  5DDO C;  1FNO A;  3JAM Y;  3GYN A;  3OV7 A;  2ZOM A;  3RRK A;  2B7C B;  1NXI A;  3H4B A;  3RGI A;  2V68 A;  4C97 A;  1OPZ A;  1FD8 A;  3DLG A;  1TV6 B;  2V34 A;  4F4Y A;  3DDI A;  5CA5 A;  3NS5 A;  1U24 A;  4AL7 A;  5LSO A;  3I5B A;  1NKB A;  4HT5 A;  3I96 A;  1B99 A;  3MEC B;  5A76 A;  4CP5 A;  1KQF B;  3OT9 A;  3U1N A;  3E2E A;  4G1Q B;  4HDG A;  2UVU A;  3T1H J;  2IDL A;  1B7F A;  1M5S A;  1U0H A;  4NML A;  1IBM J;  3HVT A;  5EWF A;  4X4N A;  2EEY A;  1X4A A;  2CQ0 A;  1SPB P;  3OUY B;  4XK8 C;  3R97 A;  4K5R A;  4B3S F;  3I9V 9;  2XZW A;  2DJW A;  2MYF A;  2KTQ A;  2KT5 A;  1AXQ A;  3VAL A;  1SIW B;  1Y9O A;  5C24 A;  3QJL A;  2HHH F;  5CH7 B;  4ZMM A;  3EVO A;  3N79 A;  3EJM A;  4I2Q B;  3C6U B;  4UT4 A;  4ZVQ B;  4OV1 A;  1DFD A;  3HKZ D;  2K2P A;  5I3P A;  1SL1 A;  2D7S A;  5KOX A;  5F8H A;  5A6P A;  4A8M P;  4JV1 A;  4QZV B;  3UR3 C;  1WOP A;  1K47 A;  3GII A;  2YNF B;  3KLE B;  1WSV A;  2LQ8 A;  4F0M A;  4NLT A;  1SKR A;  4MH8 A;  1RHQ B;  1FJ7 A;  3QRQ A;  1DLO A;  1S1U B;  1UJ6 A;  1WKJ A;  1NHU A;  2R9L A;  1YJW S;  4DL3 A;  3W5X A;  4NE9 C;  1LNQ A;  1AZS B;  4JP8 A;  5CAB A;  3R2C J;  4EBC A;  1RWV B;  3ZC4 A;  3N6L A;  4WP3 A;  4ED1 A;  2HFN A;  1HBO B;  1VRQ C;  1NPK A;  3HD1 A;  2F9D A;  2LEA A;  4ZVO B;  2DIT A;  4E2F B;  5C42 B;  1H6K X;  3D6F B;  2H5I B;  5KG3 A;  1HD0 A;  4OYO A;  2UUA J;  1K9M T;  1REV B;  1OS5 A;  4ZVG A;  1RT2 B;  4KKO A;  3D3B J;  2GFF A;  2VDH A;  2CPE A;  2Y8W A;  4DX6 A;  3MMA B;  3SYZ A;  1G2E A;  4F7V A;  2XS7 A;  2BAB A;  1U1Q A;  5GME A;  2AQ4 A;  3KJN B;  3CCR S;  4K4U A;  4HDH A;  3HSG A;  2ERR A;  2J7K A;  1S4F A;  4K7Q A;  2DK2 A;  3M8Q B;  1U0S A;  2GAH C;  1KLN A;  2FB0 A;  2GNK A;  5D15 A;  1FRM A;  1NK7 A;  3QWP A;  4TLQ A;  3HVR A;  5E3A A;  4F4Z A;  2MLX A;  5LMN F;  2N4C A;  3FUY A;  5JVH Q;  2N3L A;  1KC8 T;  2IA6 A;  4FXW A;  5D8H B;  3T19 A;  2B5J B;  3L7P A;  2DR9 A;  5DG7 A;  4AXJ A;  4HI1 A;  3TA0 A;  1Q53 A;  2FY1 A;  3BR9 A;  2C1E B;  3DM2 B;  1FKO A;  2GHW A;  3V6D A;  3I0R A;  4USU A;  3MM6 A;  3KHL A;  4I67 A;  4LRE A;  2IYI A;  3FFI B;  4C0O C;  4PQU B;  4FKX A;  2DIU A;  4H54 A;  4CLT A;  4WU2 A;  2CA9 A;  2DR8 A;  1YSJ A;  3HZG A;  1XNQ F;  1CJV A;  5FLX U;  2A0F B;  2ADC A;  1YBA A;  1DJ0 A;  2YKP A;  1G7C B;  2DNG A;  5U47 A;  1RTH B;  5CZV A;  4AL5 A;  2OPQ B;  1U1M A;  4NXM J;  3S7R A;  4WFA Q;  1DHM A;  3TP2 A;  4G1P A;  5LXR A;  1D9D A;  3L09 A;  3MF5 A;  1TMM A;  3EZO A;  1KLM B;  2ZHO A;  2EFP A;  3H5S A;  2AJ1 A;  1YLX A;  3AOB A;  3KJV B;  1CLF A;  3CJ8 A;  3C19 A;  1CJK A;  1ZA1 B;  4R8U A;  4ICL A;  2W2Q P;  5IV3 A;  3OR1 A;  2VJU A;  1BY9 A;  3CMQ A;  1YIJ S;  2ZZN A;  3M9N B;  5JVG Q;  1LWE B;  4OZL A;  3CCS S;  5T7L A;  1N56 A;  5ETL A;  2IM2 A;  2OML A;  2VG6 B;  4OX8 A;  1RAA B;  3IRW P;  4GKJ F;  1NK5 A;  1EP4 B;  3DXS X;  4B3O B;  1H72 C;  4X64 J;  2R7Q A;  1LW0 B;  4M94 A;  4QR2 A;  2C3O A;  4DV2 J;  5DGB A;  4PG7 A;  3BEG B;  4MKA A;  3P96 A;  2BE2 B;  4J5O A;  5IC6 B;  1CC7 A;  2F4V F;  3UFC X;  2XO6 A;  3D0I E;  3E51 A;  4JI2 F;  4OYP A;  1DTT B;  1RAJ A;  2GS8 A;  2OH2 A;  2K3I A;  1FJG F;  3BR8 A;  3LPE A;  2BUN A;  1N6Q A;  4DV7 F;  3EDQ B;  3QSI A;  3EUN A;  2OD6 A;  3RRG A;  4TY9 A;  2ZUA A;  3FCH A;  4F4K A;  4BBY A;  4OYA A;  5KT3 A;  2R2T A;  2FC8 A;  4JI4 F;  2Q3P A;  2BQR A;  4P74 A;  2QMU B;  1BD6 A;  4X4V A;  1Y10 A;  2RB7 A;  2ZVI A;  4RUH A;  4TY8 A;  3RBZ A;  3M6V A;  1XR7 A;  2V2Z A;  1NJZ A;  3KK1 A;  2MQM A;  4HHJ A;  4OZ5 A;  4CO5 A;  1RAB B;  1ITP A;  4CNZ A;  4F4W A;  4Y2A A;  1VQO S;  4TN2 A;  4WYL A;  2HS0 A;  1NEE A;  4QBU A;  5HRO B;  4YB1 P;  1FCA A;  4DR7 J;  1JB0 C;  2RDD A;  3HHL A;  4I7F A;  5K8P A;  4Y6I A;  2Z30 B;  4KRW A;  3ISN D;  3HFZ B;  2E1C A;  1NKC A;  1VQ5 S;  1BQN A;  4FKY A;  2R7V A;  1RT7 B;  3UD4 P;  3IN5 A;  4YOE A;  1YWX A;  6AT1 B;  2RD5 C;  6FDR A;  1XTZ A;  2ZZT A;  4J9Q A;  4DWI A;  4HEA 9;  4FYD A;  2LQB A;  1LEO A;  3PFO A;  1NH7 A;  3CGI A;  2QL7 B;  5ETR A;  1RYR A;  3MM9 A;  4X4T A;  3GB0 A;  4KJI A;  4NZ6 A;  1I94 F;  1U09 A;  2B0G A;  1T9T A;  3EVM A;  2ZH4 A;  1URR A;  3NGS A;  2R8J A;  1IJF B;  1R0B G;  3OXF A;  4EBD A;  1ZAX A;  3KK3 A;  3ENA A;  2LXU A;  2HNY B;  3AQP A;  2I2Y A;  4AT1 B;  4K4X A;  4LF6 J;  2C2N A;  3CCZ A;  3IR7 B;  2Z2M A;  2YBV A;  3KLG A;  4ID8 A;  5KG2 A;  3KLF B;  5KFQ A;  1RT1 B;  4U8V A;  1GX5 A;  5J2N A;  4ED3 A;  4CT9 A;  5HJX A;  2IMO A;  3KFW X;  2YKO A;  2HQF A;  1DUR A;  2HHS A;  2VH7 A;  1XMQ F;  3ZZ0 A;  2XWX A;  3ZTP A;  2OHD A;  4I69 A;  5IQQ A;  3TAN A;  5KFZ A;  5C5J A;  4DQR A;  2HQ3 A;  2DD8 S;  2PA8 D;  1A7G E;  4NCG B;  2P9C A;  3GPA A;  2YWK A;  2ZE2 B;  2N7C A;  3QIP A;  1S59 A;  2LU2 A;  2CWX A;  2AJF E;  3DYA B;  2RS8 A;  2QFJ A;  1S77 D;  3SCL E;  3N28 A;  3R7N B;  3VQS A;  1HLW A;  1RTD A;  4P6Q A;  3NS7 B;  1ZM9 A;  1HNI A;  4DPY A;  2MTL A;  1JKH A;  4RW8 B;  3GFY A;  3U7J A;  2KJW A;  3K17 A;  4ZPT R;  3QSY B;  3BKU A;  1SJ4 P;  2DH8 A;  3KLH B;  1X5T A;  4WK3 A;  3MGJ A;  3TQE A;  2WBR A;  4G6V B;  4RW9 A;  2MMY A;  4ALZ A;  4ECS A;  2H4W B;  1FXD A;  3BDE A;  4ZP9 A;  1IBK J;  2WB4 A;  1S0N A;  3LQV A;  4KH1 B;  4R5P B;  3LWL A;  2HK2 A;  4OMF G;  2B9X A;  1JJ2 R;  2R7S A;  1RCX B;  2RML A;  3MCO A;  3FEX B;  3JSB A;  3RAM A;  1R7I A;  2Y0S D;  3GR0 A;  2XMU A;  1SH3 A;  2H5E A;  5F0U A;  4DR2 F;  4Q2M A;  1PC4 A;  4KT0 C;  5HBM B;  1IKV A;  4NI2 B;  2JEJ A;  2WAQ D;  4LIR A;  5RUB A;  2M0G B;  5GAD U;  5HAT A;  3R5G A;  4FVC A;  2GQ2 A;  2OJ3 A;  4ZPA A;  2CG8 A;  2RQK A;  2LP4 A;  3KUG A;  4XDD A;  3MFH A;  1HNW J;  5ITH A;  4NCA A;  1VRT B;  2UUB J;  1CC8 A;  1G4C A;  2CPY A;  4B02 A;  3D2W A;  1KQG B;  2ATC B;  3D3C J;  4PXB A;  3A1Y G;  1WHY A;  3AXK A;  3IGN A;  2OSQ A;  4KB7 A;  5LMU F;  3W62 A;  3A3N B;  1TKD A;  4LF5 J;  3KYL A;  3DOK A;  1SXL A;  5DQG A;  2KFZ A;  4RLE A;  3P8B B;  3OL8 A;  3D1Q A;  1N5Y A;  3GQC A;  2BRK A;  2HVI A;  3UNG C;  3R1H A;  5D4P A;  2HND B;  3GMG A;  3UCZ P;  1X9S A;  3KLI A;  2XYG B;  4NZ0 A;  4RW7 A;  2APO A;  2Z2L A;  1PYO B;  2WON B;  4UOF A;  3M7V A;  1WC1 A;  2A2D A;  2UXC F;  2DCL A;  4ZPW R;  2JEF A;  4C8Z A;  2MJU A;  4OZ3 A;  1G1X A;  4ZA1 A;  4D3G A;  4ZHR B;  1HR0 F;  4Q45 A;  1SB6 A;  2G0C A;  1R8A A;  4O0N A;  3RBE A;  2R7W A;  4NLS A;  5IXU A;  4DI6 A;  2WSC C;  5KT6 A;  1CG2 A;  3DLJ A;  2PD1 A;  4IG3 A;  2YX7 A;  4NX9 A;  2F40 A;  3Q89 A;  3IC1 A;  1NSP A;  4NAS A;  3J80 U;  3R7S B;  4ID5 A;  2VZ9 A;  3GCW P;  2H5J B;  2HLU A;  4TYA A;  4JI5 J;  1RIS A;  2MKK A;  3DLH A;  3C16 A;  2M5Y A;  3MMJ A;  2KXN B;  2VIC A;  4FYX B;  4IFY B;  1Q5Y A;  2GML A;  5F3T A;  4KYZ A;  1FKP B;  1OYD A;  4ZS6 A;  2YVS A;  2ASD A;  4Q8F A;  3J7Y I;  5D3G B;  1H73 A;  3ILL A;  1S10 A;  5E7O B;  2YH0 A;  2IPO B;  3Q8R B;  5KFW A;  1WC4 A;  1BE4 A;  4C2M A;  1V3S A;  3C15 B;  4UY8 5;  1IN0 A;  1RQ0 A;  2VKZ G;  1S6U A;  1WHW A;  2HW3 A;  4P2F A;  5DET A;  1XNR J;  2YY3 A;  2ZH6 A;  2F63 A;  1UPM B;  4IG0 A;  1KR4 A;  1C4C A;  3M1V B;  2LQJ A;  1OWX A;  3P4U B;  3VAM A;  2M70 A;  1NK4 A;  5B0E A;  1IBL J;  4WFY A;  2DY1 A;  1J5O B;  4LJM A;  2GJF A;  4ED6 A;  1U47 A;  3T1Y J;  4DPW A;  3KLV A;  2YKM A;  2JWN A;  2DHG A;  4CYU A;  2QIF A;  2QZ8 A;  4GO7 X;  4X62 F;  1HYS A;  1R8B A;  4A8F A;  2UUT A;  3CJ5 A;  2V4Q A;  3RAQ A;  3VAH A;  3T1H F;  1IBM F;  3H4D A;  3LP2 A;  2BAN A;  5IS2 A;  1HW9 A;  3ONQ A;  4OYM A;  1B3T A;  4LF4 J;  4C8M A;  5I3U B;  4GVL A;  3WX4 A;  1C1B A;  4OX7 A;  4X4S A;  3K5L A;  3Q8Q B;  1QUV A;  2YWG A;  5CYM B;  3PG9 A;  3HF5 A;  3M2V A;  3PXG a;  3K5O A;  3EGZ A;  2KT3 A;  4P2X A;  2R42 A;  1N4L A;  1U1K A;  5AT1 B;  4L75 A;  1JNR B;  1X5O A;  3OFE A;  3ISZ A;  3R5A A;  4P7T A;  4O23 A;  1IWG A;  3HHK A;  3J7A N;  3MOZ A;  1IKY A;  4WU3 A;  2CPD A;  3MFI A;  1VRU A;  1VHF A;  1ZPW X;  2YQ1 A;  1CJT B;  5GAE U;  2DO0 A;  5H9E K;  2XGP A;  1RHJ B;  2ACY A;  5HLF A;  1F6T A;  4WCE Q;  2DO4 A;  2DH7 A;  3Q8P B;  2W4D A;  2XZD B;  4ATN A;  1TVR A;  4OQJ A;  4BCA A;  2XB2 D;  2W9C B;  4WTO B;  3DNC A;  4V19 J;  2JJ4 D;  1FE4 A;  2HPU A;  4F36 A;  1VC5 A;  1YBU A;  2UVV A;  3VV2 B;  2VG7 B;  9ATC B;  1ZAW A;  5A0Y A;  1FWL A;  2KVQ E;  3M8R A;  4OYZ A;  3G6Y A;  2PA3 A;  2PFF B;  3EYZ A;  3MM5 A;  4FN5 A;  4ANC A;  1YJ9 S;  1JLQ A;  4CI0 B;  4DV1 F;  2NYH A;  1VDH A;  5I42 B;  1GT8 A;  3PVX A;  4QYR A;  2YWE A;  4C3M A;  3MR2 A;  2Q6C A;  2JSX A;  2OPS B;  4HHH A;  2JEG A;  5KFB A;  3MD3 A;  4C8K A;  2GVZ A;  2HWH A;  3D5M A;  1NJY A;  4FF3 A;  2JRS A;  3KJF B;  3C2P A;  2DNH A;  1KEK A;  2F4F A;  2RS2 A;  2BOA A;  3JTO A;  4M5J A;  2CNL B;  5K14 B;  3SQO P;  1S0O A;  4DMZ A;  4KR0 B;  2W8K A;  2PO4 A;  1H74 A;  3AH6 A;  1LQ9 A;  1IKX B;  4JV5 F;  3FCV A;  3GFH A;  1S1T A;  3V5R A;  1FVQ A;  2WW8 A;  1UMJ A;  1RSC A;  4YR2 A;  4LR9 A;  4CO2 A;  4RJV A;  3KKF A;  4RUB A;  4O3R A;  5IZH A;  2RQC A;  4Z2X A;  3VHQ A;  3FC9 A;  1CJU A;  3CJS A;  3PTW A;  2GHV C;  3BDP A;  2BXJ A;  3SDE A;  5D6G A;  3CCL S;  1PAE X;  2GVD A;  4UOC A;  5J2M B;  4YR3 A;  3E01 B;  2YNG A;  1FT8 A;  5A8W A;  3O8W A;  1NJW A;  2CVI A;  3DRS B;  4FXV A;  2CQI A;  2MPU A;  4P72 A;  4DSF A;  1OYE A;  1FDD A;  4EYI B;  5SZT A;  4IFV A;  1UZD A;  1HWU A;  3M2U A;  3IG1 B;  2DKO B;  4NXM F;  4H4O B;  4H4M B;  3HZE A;  1PYT A;  4Q0B B;  4DSE A;  4DEZ A;  3HVA A;  1HKA A;  2AYB A;  2Z0G A;  3RW6 A;  3BYR A;  4RBT A;  1K8A T;  4DS4 A;  2KFN A;  4H4K A;  4QOT A;  1QE1 B;  1WC0 A;  1P1T A;  3HVW A;  4DSI A;  2EXU A;  3AQO A;  2Y9H A;  2YXL A;  3N0V A;  2C2E A;  2KU7 A;  1U8S A;  4FYV B;  3NY0 A;  4KH0 B;  1IM4 A;  1PG5 B;  1JLB A;  4KO0 A;  3ULH A;  4FF2 A;  1E6V A;  4PG5 A;  2OEL A;  5AXM A;  1S48 A;  4NLO A;  4E0D A;  3I82 A;  1Q4R A;  1FRX A;  2CNN B;  3OLB A;  4LT6 A;  2E9T A;  3R5J B;  2KRR A;  4OZJ A;  4ZLP A;  5FJ4 A;  1P9Q C;  1VLO A;  4KC5 A;  2AZ1 A;  2HVH A;  2CZV C;  1Q8K A;  2LDI A;  3DLE B;  2H4Y B;  3AHP A;  1FRL A;  2ZDP A;  3V4M A;  2FGC A;  3DRP A;  4K8R A;  1BLU A;  1S1V B;  1IUJ A;  1DAR A;  1EQM A;  2KYX A;  3BKF A;  4NLY A;  1NO8 A;  4K4T A;  2JH3 A;  3W3S A;  2Q66 A;  1TUV A;  3W65 A;  2Q43 A;  2VPY B;  2BQ3 A;  3OVB A;  4DL0 C;  2EFG A;  4JI7 J;  3CCM S;  3C14 B;  2N3O A;  1OSD A;  4I1T A;  2D69 A;  3I0S B;  4USJ C;  1RBO B;  2L9D A;  1SCJ B;  1OO0 B;  1IR0 A;  1JLF A;  3GYX B;  1QJH A;  4K59 A;  4JUZ A;  3CD0 A;  4KPC A;  5G0R A;  3FJ2 A;  4DR4 J;  2OPP A;  2QN6 B;  1WG4 A;  2CKW A;  2C2D A;  4B9L A;  4EEY A;  1UA1 A;  1HQE A;  5K5M A;  3C6T B;  2HGL A;  1UFK A;  2VIH A;  2DRA A;  4F67 A;  1QAJ A;  5E3Q A;  2V67 A;  2BX6 A;  2DH9 A;  2RIJ A;  4NA2 A;  3TX8 A;  3TUZ C;  3DLG B;  2CVE A;  3DHW C;  3DOM B;  4GKK J;  2RQ4 A;  3I55 S;  2V2K A;  2B4U A;  3H7H B;  2K7K A;  3F56 A;  4DR7 F;  1Y3K A;  1I1G A;  3MPD A;  2MQL A;  4DFM A;  2Z56 B;  4DJB A;  5HMW A;  4WE1 B;  4QW8 A;  1N88 A;  3RR8 A;  3MWB A;  1C1C A;  1U0H B;  1KTV A;  5IFM A;  4DV4 F;  1RBL A;  5CCM A;  1FNX H;  1NH8 A;  2DR6 A;  2KRB A;  1RKI A;  3LGM A;  3IRX B;  4KFB B;  2J9C A;  4Q7A A;  1KVJ A;  3CME S;  4JI1 F;  2HZC A;  4EMD A;  1KQK A;  3UDL A;  2OMO A;  2JC0 A;  2YKN B;  3FSI A;  3HHN B;  2EC0 A;  2YQ0 A;  2RU3 A;  3CJ3 A;  3OBI A;  2P2C B;  2LDY A;  3BQ2 A;  1Q81 T;  2CAD A;  4ZLN A;  2NPF A;  4JI6 J;  1NND A;  3DDN A;  3W8G A;  2PII A;  1SQE A;  3WBZ A;  3F44 A;  2FQQ B;  1JLE B;  4KAI A;  3UWT A;  1RLD A;  3MAQ A;  4IQM A;  2KI2 A;  5DZ6 A;  2AF6 A;  5KT5 A;  2Y1I A;  2VOP A;  4OYI A;  1JLA B;  2V0N A;  2UV8 A;  2BJ8 A;  2IVF B;  4J9V A;  2ZZM A;  5M2P A;  2MXY A;  3T6B A;  1TL3 B;  2L9W A;  2DR5 A;  2JFK A;  5D78 A;  4D3H A;  1CEZ A;  1FX4 A;  5IOL A;  5KFP A;  1SJ3 P;  3ENV A;  1HPZ B;  1VQ6 S;  2AEF A;  1GAO A;  1WJ9 A;  3T5J A;  2EFV A;  3NXZ A;  3PHT A;  3MM8 B;  2MQP A;  3ET6 A;  2QA1 A;  4JV2 A;  2V9K A;  1S6P A;  5KG0 A;  2W9B A;  1NB2 A;  3DI6 A;  4IKA A;  2XMW A;  1KOO A;  3FZB A;  3KUE A;  2ZD1 A;  3PO5 A;  4FPR A;  4HTJ A;  3MHY A;  4OJ1 A;  2AW0 A;  1JLG A;  5B09 A;  2DEI A;  4B3S J;  1CS4 B;  2HUR A;  4HT7 A;  4NOH A;  2G1H A;  5D4L A;  4QIW D;  4XTT A;  3JYT B;  3M6U A;  3R6L B;  2HHH J;  1T95 A;  3RB4 A;  5DO2 A;  3QRR A;  1NUE A;  1S6Q B;  1RWX B;  1SVD A;  4ETZ A;  1LKZ A;  2J6S A;  5HSP A;  1U1P A;  3MD1 A;  2XEX A;  1OY9 A;  4QR0 A;  5EN1 A;  4XIU A;  3CXC R;  1IBC B;  2IFX A;  4DG1 B;  2IJN A;  4ILR A;  3I4P A;  2XSJ B;  4M5K A;  1FWK A;  3LF0 A;  4TYB A;  4KGM A;  1V6H A;  1UW9 A;  2HMI A;  1MRO B;  1F5C A;  3UVJ A;  2H48 B;  1M5H A;  1RA7 A;  3ZZY A;  3TZW A;  4LBP A;  4ELT A;  2CJQ A;  1NHK L;  5CHC B;  4PAB A;  3P6Y C;  1XMO F;  3GJR B;  4R0J A;  4NLQ A;  3BGR A;  4UST A;  3MM6 B;  5E0O A;  1H7X A;  3MTK A;  1QAX A;  3V81 B;  3FCW A;  4HAC A;  2O1P A;  5D77 A;  2ZIT A;  5GAH U;  4PG8 A;  1RTZ A;  2JNJ A;  3UD3 P;  5K20 B;  5K9F A;  3CCU S;  1L5U A;  1H98 A;  4O4G A;  2B9Y A;  4LF5 F;  1CJV B;  4CWB A;  2RUG A;  1B64 A;  5DG8 A;  4C8Y A;  4M63 A;  1SUQ B;  4K0K F;  4C11 A;  2AMC B;  1H2V Z;  4CDI A;  4UOG A;  3C3L A;  4LSN A;  2JDJ A;  4CO0 A;  1GH8 A;  2GQQ A;  3TVZ A;  4LFA F;  3TVY A;  1D1U A;  5E3C A;  2BEF A;  3K58 A;  1TKT B;  3VAF A;  1U6B A;  3BB5 A;  2IY5 B;  3OR2 B;  1QSL A;  4TLR A;  4CTA B;  3Q2T C;  3RAX A;  1T7P A;  4R8U B;  3QRP A;  3OR1 B;  4TXS A;  3GJS B;  1RP5 A;  4IDK B;  2QYG A;  5J1N A;  2IVY A;  1KDN A;  1S4E A;  1B4S A;  1HBN B;  3R5C A;  4WFX A;  1KD1 T;  1WG1 A;  2C3M A;  1TR0 A;  2PN6 A;  1N36 F;  2K1R B;  2LLZ A;  3DLL Q;  4FF1 A;  2B6A A;  2DNK A;  4DCO B;  1LW2 A;  4ECW A;  2ZM6 F;  1V5V A;  2VHG A;  2EBE A;  2FHK A;  3GCX P;  3BV8 A;  1QM9 A;  2NXU A;  5GMD A;  5CYJ A;  5A8R B;  4KE5 A;  5C25 A;  4F2S A;  1LWF A;  1D9A A;  3K8V A;  1QTM A;  3L7U A;  1WI8 A;  1X0F A;  2DGX A;  3H8Y A;  3FEY B;  1B70 B;  2BAC A;  4DN0 A;  4IH7 A;  4C8N A;  1FNM A;  1TMJ A;  1F1B B;  1RAH B;  4LSL A;  2NXJ A;  4WXW A;  2R7X A;  1XNQ J;  4CM0 A;  2LU1 A;  1Q1K A;  2KL8 A;  2RRN A;  2YH1 A;  3SI8 A;  5L38 A;  2VF3 A;  4HH1 A;  5KFI A;  1NPP A;  1I6J A;  4KTQ A;  2RF2 A;  1U4B A;  2VFS A;  2FDN A;  3D0H E;  3DXB A;  3PHE A;  2PMZ D;  1XNR F;  1VQN S;  1RWU A;  4C0H A;  2WOM A;  1YX2 A;  2C42 A;  2M2B A;  1S5Z A;  3ZTQ A;  2BA9 A;  1OMS A;  4C0B A;  2VBW A;  1JXL A;  1OQ6 A;  4W92 B;  2EC2 A;  4HLB A;  4ZCI A;  3I32 A;  1RGV A;  1S9G A;  1RHR B;  3T1Y F;  2FC9 A;  4FS1 A;  1VHI A;  3DLK B;  4ED4 A;  4PG4 A;  2V8H A;  1RAD B;  3HHL B;  4A8K A;  5DLG A;  4GKJ J;  2OEK A;  4NXN J;  3W2W B;  1AUS L;  2AWZ A;  1FDA A;  2OUG A;  2GO9 A;  1BQN B;  2CZ9 A;  3IMQ J;  1JNZ B;  4C3K A;  3BPS P;  4PXC A;  4TQS A;  5CYQ B;  3T5K A;  2YWW A;  5KFC A;  2D9O A;  3O1L A;  4JB8 B;  3A13 A;  4RWW A;  3E3X A;  3MM9 B;  3M8W A;  5J2Q A;  5L1I A;  3QGI A;  2PI4 A;  1UVK A;  3OXG A;  2D3U A;  3LAK A;  3GTY X;  4N8O A;  3Q23 A;  3TI0 A;  2U2F A;  3KK3 B;  1R0A B;  5DQI A;  1RU2 A;  2UXD F;  1FHT A;  2OPR B;  3UCU P;  2BR0 A;  1PIE A;  2HFV A;  1L3K A;  3MPV A;  2E9R X;  2ZDO A;  1MNE A;  4IUF A;  1YVF A;  5AJ3 F;  3PW2 A;  3QFW A;  4JI4 J;  1NRK A;  2CQG A;  2AEM A;  4Y65 A;  3FMW A;  2QLW A;  1WDT A;  3WC2 A;  1RUS A;  5J2N B;  4LQ9 A;  1IKW A;  2J5A A;  1WTB A;  1TFW A;  1JJC B;  2BJ9 A;  2F3J A;  4I6A A;  3LPY A;  2QL5 B;  3NWG A;  1FTR A;  1TK5 A;  1NDP A;  2J9D E;  3DOL A;  4RL1 A;  1UZH A;  3DFE A;  3MEG B;  3QO9 A;  1X31 C;  4TNO A;  3AD7 C;  1S1X A;  1ZA2 B;  3I9Z A;  4EI2 A;  3FMB A;  4QWA A;  2E1R A;  1UKU A;  3HFV A;  5L1J A;  1WC6 A;  4J9P A;  1SQG A;  3EZU A;  4M5D A;  4CO1 A;  1T05 A;  4E98 A;  2ILY A;  3ADA C;  2HRT A;  1RT6 A;  3R5B A;  5E3R A;  1ZYQ A;  1Q82 T;  4ECZ A;  1TUG B;  3MR7 A;  5AE3 A;  2IRX A;  1HNI B;  4X4R A;  4OJG A;  3PO4 A;  2QG9 B;  4CQ1 A;  1JKH B;  3RU0 A;  1TV6 A;  5AE2 A;  3CCV S;  4LF9 J;  4QIG A;  2HFS A;  3D67 A;  3L4B C;  1FO1 A;  3MEC A;  1B0P A;  1XR6 A;  1I94 J;  5DDQ C;  1S9F A;  1Y5I B;  2CQ3 A;  4FZV A;  1PBA A;  1B0T A;  2OLW A;  1CBK A;  2X1F A;  3RTV A;  1RT4 B;  2R3V A;  1AFI A;  4RNF A;  3OUY A;  2ALY B;  1KWM A;  2H9Z A;  1VQK S;  2KXF A;  2PC6 A;  5HMX A;  2EKN A;  1S0V A;  3CD5 A;  2KKH A;  5I4M A;  4QQB A;  1VBK A;  1YKW A;  1KVI A;  1FK9 B;  4GMK A;  1O8B A;  3HLU A;  4I2Q A;  5KFD A;  3HSZ A;  1FDB A;  2DNN A;  4UY8 T;  3WDO A;  1XMQ J;  2RAQ A;  3OD2 A;  3J81 j;  2FJD B;  2DGQ A;  3H42 A;  4EO8 A;  1VLY A;  2IVM A;  2YNF A;  3KLE A;  2YQ3 A;  3GIR A;  2D3O R;  1S12 A;  3J7Z 5;  2VU5 A;  2DGT A;  5H1S V;  1KKH A;  2V8D A;  1VQL S;  4ER8 A;  1HNV B;  3CO0 P;  3PW5 A;  4AL6 A;  4Z7Y A;  2B8P A;  3PRD A;  4B3M F;  1MU2 B;  3DOK B;  4LF2 A;  2VDI A;  2J8S A;  2IC3 A;  1WEZ A;  2J9D A;  1AZS A;  3D28 A;  2RHQ B;  3F41 A;  1SJR A;  5J1E A;  1OY6 A;  2CJB A;  1S9E B;  3SEO A;  4RW7 B;  2OGU A;  5CAA A;  2N4D A;  2IYG A;  2RH3 A;  1HBO A;  1P1L A;  2NSB A;  4PWU A;  1NK9 A;  3DRY A;  5L1K A;  5A8K B;  4MYT A;  1KRP A;  2X51 A;  3MR6 A;  5C42 A;  2RDJ A;  1R43 A;  3N01 A;  2EFQ A;  1ZPV A;  1QDU B;  4Q2L A;  3QJJ A;  3HO1 A;  2EPI A;  4ZVF A;  1RT2 A;  3GIJ A;  2MHE A;  3PX6 A;  1M5P C;  3O5T B;  4A8X A;  5C2G A;  3QGG A;  2QA2 A;  1HWI A;  5DG9 A;  2F9J A;  2Y3Y A;  2NSC A;  3MMA A;  1SC6 A;  4K4Y A;  4YHH J;  4IO9 Q;  1XJW B;  2DNM A;  2HVZ A;  1CVJ A;  4U6P A;  2AJ4 A;  4Z37 A;  2HZA A;  2FLO A;  4C8L A;  4G3I A;  3VVU A;  1R6Y A;  2AT1 B;  2ZUG A;  2XY6 A;  3TQ1 A;  3M8Q A;  1XBW A;  2F8M A;  3M30 B;  3RB3 A;  4U96 A;  3EX7 B;  5HVG A;  1UWB B;  1LFP A;  2GIF A;  2J0W A;  4DZ6 A;  5DLF A;  4OJ3 A;  2B5J A;  3NCQ A;  2CQH A;  3DRR A;  3BM7 A;  3B4D A;  4QWD A;  2HIQ A;  2QMW A;  1M1K T;  3M9O B;  2XZT B;  2FPH X;  1H2U X;  2Z2Y B;  3BN7 A;  2F7V A;  3DM2 A;  1TKX B;  3UN2 A;  2HBZ B;  2GX8 A;  2BE9 B;  2DXE A;  4ZP7 A;  1C0T A;  1EHW A;  4DQQ A;  3ENQ A;  1ZH5 A;  3QT6 A;  1V9O A;  3PX0 A;  3CDW A;  2VQF J;  2AGO A;  2R8H A;  4QYZ K;  4V19 X;  1GEH A;  3NAH A;  1UPP A;  4PWW A;  2UXC J;  5DRK A;  2IMW P;  4PYD A;  1RT3 B;  4YS2 A;  3UN5 A;  2HQG A;  4MIA A;  3CCQ S;  3SIP B;  4DHV A;  2HEK A;  4PKD B;  1VBZ A;  1LWX A;  1HR0 J;  4DR1 F;  3KDN A;  3I87 A;  4OLP A;  2DCU B;  1RTH A;  4F50 A;  4J9U E;  1SJF A;  2OPQ A;  2VG5 A;  4B9V A;  3HHD A;  1U1R A;  3QPI A;  4XPC A;  1VBY A;  1WKK A;  3LAN A;  1F3F A;  3TRG A;  1R3N A;  4HR2 A;  2GO8 A;  2G0I A;  5J1P A;  1KLM A;  3NAI A;  5HL7 Q;  1LXJ A;  3KJV A;  5KFH A;  3MEE B;  1YQH A;  2UUW A;  4FPI A;  2MY8 A;  3LP2 B;  2DR7 A;  2PMH A;  3THT A;  3IWX A;  4UF4 A;  3M6W A;  3M8P B;  5E3P A;  3AB2 B;  4V1A k;  3OQ2 A;  2XNR A;  1GMW D;  1ZET A;  1MN7 A;  2VG6 A;  4QR1 A;  1PBU A;  2MLZ A;  3DLB A;  2ZEJ A;  1W26 A;  1Q8B A;  2U1A A;  1JX4 A;  3GYG A;  1LW0 A;  2V63 A;  2YTC A;  2OO4 A;  2BE2 A;  1Q95 G;  4DLE A;  4F25 A;  3BH6 B;  3DGP B;  4JI6 F;  4P2M A;  2GGP B;  2RSQ A;  1A6L A;  2A1B A;  3JAM U;  2PEH A;  1DTT A;  3MM7 B;  1UVM A;  1L3U A;  3H98 A;  2ASL A;  1E6Y B;  2KT2 A;  2FVS A;  4NL5 A;  2BKN A;  2AEJ A;  1R27 B;  5DQH A;  3P49 B;  4RW6 B;  4C3L A;  4OHY A;  3W5Z A;  3D0G E;  2CQP A;  3Q8S B;  3FBE A;  1HI0 P;  2AJ2 A;  2LVW A;  3IFE A;  3I31 A;  4DSL A;  2P8I A;  3HDS A;  3L7O A;  1AW0 A;  4DBQ A;  2KZM A;  1NZ8 A;  1QTN B;  1YG0 A;  2N7Y A;  4P2S A;  2DVI A;  1RI7 A;  4WFN Q;  3FDS A;  5A0Y B;  3OFG A;  4ILL A;  3RRH A;  2UZA A;  3Q8V A;  3OXL A;  7FDR A;  2HG4 A;  2Q1L A;  1Q16 B;  4X62 J;  3ZTS A;  5HRO A;  2BRL A;  1T03 A;  3P45 B;  4AFF A;  5KG5 A;  4MIW A;  1QY7 A;  4CLU A;  3OW2 R;  3SXL A;  3PAC A;  3G6V A;  5L9N A;  2D9P A;  1RA6 A;  5IC4 B;  3G96 A;  3RW7 A;  1X4G A;  4DU7 A;  3SV4 A;  1Z2L A;  3NRB A;  4CO4 A;  4UZC A;  3PYE A;  5ETV A;  3MEK A;  3AOC A;  1PJ5 A;  1RT7 A;  1U49 A;  1D0E A;  2FJV A;  2MGZ B;  4RW4 A;  4NA1 A;  3O3L A;  1TK0 A;  3SFG A;  4K4V A;  4DFK A;  4ZCM A;  2VD3 A;  5B0B A;  4HL9 A;  2QC3 A;  2MKY A;  2IDE A;  3PX4 A;  1S1W A;  2Z57 B;  3PYF A;  2AYE A;  2ZBC A;  5GAE I;  4YME A;  2VPX B;  1O51 A;  3H20 A;  2UVR A;  1F2H A;  1A0O B;  4LQ3 A;  1REG X;  2Z2Z A;  3CW2 C;  2RUS A;  4URS A;  3POT B;  2B3T B;  4ZP8 A;  2H65 B;  5BYR A;  4DX8 H;  2R2U A;  3CJ4 A;  4XDC A;  3MAA B;  4RBU A;  1PAU B;  3RB0 A;  2E29 A;  3KLF A;  2WVF A;  3FSY A;  2CJK A;  1U1L A;  1HNX F;  3G8Q A;  1PYS B;  4OL8 A;  4MK7 A;  5FD1 A;  3UN3 A;  2M8D B;  4ECR A;  4FVM A;  2M8H A;  4ETX A;  1HQU B;  5JJB A;  4NLD A;  4L73 A;  2E5G A;  2ZH2 A;  2E5H A;  4DV1 J;  3KK2 B;  4DUT A;  3ZTR A;  3AOA A;  3M2U B;  4CRJ A;  2ZKU A;  4YFU A;  5HJY A;  4RU9 A;  4NCG A;  1N32 F;  2ZFH A;  2NYI A;  1D8Y A;  4DV3 J;  3Q8U A;  4NYZ A;  1R6V A;  3H40 A;  1KTQ A;  1WC3 A;  1KVK A;  1VCT A;  3DYA A;  2L48 A;  1JLB B;  3AB4 B;  3MMC B;  1U02 A;  1ZS6 A;  4M95 A;  3TUP A;  4N5S A;  2FJE B;  5AXL A;  3CCT A;  3FNN A;  3K5P A;  4FBT A;  4JV5 J;  5D0H A;  4RW8 A;  1SIZ A;  4L3N A;  5HK4 A;  3JQK A;  4YQW A;  1QAI A;  2CQ1 A;  2GA7 A;  1VK8 A;  1S79 A;  2XS5 A;  4EK2 A;  2FZK B;  3HJV A;  3AA9 A;  2ZH7 A;  3KLH A;  3VGV A;  1FTC A;  2LFV A;  2R4F A;  4ZDN A;  2C3Y A;  3MMB B;  2CDR B;  2L41 A;  4DSK A;  3BPD A;  2MST A;  1EAY C;  2R8G A;  2E5J A;  4NLU A;  2J7W A;  2XWY A;  4R5P A;  1SKS A;  2VOO A;  2DB1 A;  2NXC A;  4FDF A;  1HI8 A;  5F8N A;  1W25 A;  2NR0 A;  1T02 A;  3PR5 B;  1GK8 A;  1MG7 A;  2XLK A;  3JXO A;  3ETO A;  4ZVT B;  2HBR B;  2FLN A;  2E44 A;  2DGU A;  3HM9 A;  3NGD A;  5HBM A;  4NI2 A;  1RU1 A;  3AD9 C;  4W4M A;  4F3O A;  1GMW A;  2QMX A;  5BXI A;  4NRU A;  3FKB A;  5AXK A;  1NSA A;  2MKI A;  3AJ1 A;  4KHM A;  3R6G B;  5ETO A;  1SH0 A;  1M5V C;  2XLI A;  3LO3 A;  2XUL A;  2OEJ A;  1VRT A;  3EMT A;  1WNE A;  1VR6 A;  1RAO A;  4X66 J;  1M5O C;  2H3E B;  5EGY A;  3CJK A;  2OI2 A;  1UTA A;  1FRH A;  1WOS A;  2YWF A;  2DTJ A;  1UFL A;  4UUX A;  4ECU A;  5CZX A;  1RLC L;  4PPD A;  2IAJ B;  3NOC A;  6FD1 A;  2XHW A;  3ZTO A;  3JQM A;  4L74 A;  2AP6 A;  2RIL A;  1KFD A;  4NLG A;  4KV8 B;  4OI2 A;  2LCW A;  3AJ2 A;  2HND A;  2VOD A;  4ZPB A;  4CNY A;  3EVW A;  1MWQ A;  2WON A;  1UCN A;  3SBM A;  1SV5 B;  4ZCL A;  3MUT P;  2XMV A;  4WZQ A;  4NXN F;  4QU7 A;  4PRF A;  3ELH A;  3VVT A;  4JOU A;  1NLK L;  1S72 S;  1ICE B;  3BSC A;  4ZHR A;  5EWE A;  3DHX A;  2GC8 A;  2XQC A;  1UW4 A;  4ZLJ A;  1HNZ F;  3CCW A;  4OHX A;  4J9O A;  1C0U B;  1X7V A;  1IXK A;  3OFF A;  2HQI A;  1TL5 A;  5LM7 E;  3LWM A;  4DV5 J;  3V4I B;  4U8Y A;  5F3Z A;  3A8J A;  3FSX A;  1IJE B;  1FKA F;  4DUZ F;  3D6T B;  1BXN A;  2CNK B;  2MQN A;  5F8M A;  1WUU A;  2MZR A;  3PY8 A;  1KNZ A;  2EVZ A;  1TL7 B;  3NOG A;  3BJY A;  4HH0 A;  4U7C A;  1SKW A;  2KDO A;  3MAH A;  1JIH A;  2Z4P A;  3EGW B;  1RAG B;  4DQS A;  1LFW A;  4B9T A;  3VCD A;  3K8W A;  4GC6 A;  4DUY F;  2ALZ A;  1YJT A;  5AXN A;  4IFY A;  1TAU A;  1PKU A;  2XMA A;  1FKP A;  2LYV A;  2LXF A;  2VFV A;  3W5Y A;  5HMZ A;  1XMB A;  2XY7 A;  2V4J B;  5D3G A;  1FVS A;  3NNC A;  4CLY A;  1Y7P A;  4M5M A;  3C15 A;  2DGO A;  4MFB B;  3FZ2 A;  2HGN A;  3BS9 A;  4Y28 C;  4ZVP B;  4DOZ A;  4KPY A;  4YDD B;  2OD4 A;  3BSN A;  3OTO F;  4C4W A;  1D09 B;  3OFH A;  3MED B;  2J0X A;  4DF8 A;  4O44 B;  5KFY A;  2F5G A;  2MLY A;  3M1V A;  4F4A A;  1KFS A;  3OTE A;  4AE5 A;  1VC0 A;  3CSK A;  3PKM A;  3W2V A;  2CQB A;  2DNZ A;  3VAK A;  4DV4 J;  3QAU A;  4KSE B;  1SBR A;  2MZQ A;  4LF9 F;  5ETM A;  4JI1 J;  2XS2 A;  1NZA A;  1JLC B;  4LFC J;  3VWS A;  2QV6 A;  5IM0 B;  3KHH A;  2XG8 A;  4RUA A;  1KBR A;  3R7B B;  2KYZ A;  4ZVH A;  2JZ5 A;  1U1N A;  1OY8 A;  5J2P B;  1NJI T;  1F60 B;  4DX7 A;  3NNA A;  4W90 B;  3LAM A;  4OX6 A;  3AXM A;  3ZZT A;  5I3U A;  2ROG A;  3ILI A;  1GMU A;  4J91 A;  3OTB A;  3CCJ S;  5CYM A;  2IRY A;  2IA0 A;  5L46 A;  5JUM A;  2P6S A;  4OZ0 A;  4AQY F;  4USW A;  1FA0 A;  2VPZ B;  3A3P B;  1P6T A;  3KTQ A;  4YY3 F;  2O01 C;  2PE8 A;  1VI7 A;  3LH2 S;  4J9L A;  4MT1 A;  1TL1 A;  2P6T A;  1JJ4 A;  1VQP S;  1CJT A;  3I5A A;  2YWH A;  3M8Z A;  2VA2 A;  1NHV A;  3W61 A;  1VQS A;  3P5T L;  1FEE A;  3KHR A;  1BC6 A;  5ETN A;  3T5H A;  3CB4 A;  1VYA A;  1HBM B;  3R27 A;  3UDV A;  3OJS A;  5IT9 Y;  1BQM B;  3OL6 A;  2OFG X;  2R7R A;  4PUO B;  3GLJ A;  2VB6 A;  2G2O A;  3WZ0 A;  2BJ1 A;  5CD4 H;  3P3D A;  1T3N A;  2W9C A;  2O67 A;  3JSM B;  2GHP A;  4OZ1 A;  3WIV A;  3PDN A;  2WVD A;  2H1Y A;  3R1L A;  2MY7 A;  2GAG C;  1TKZ B;  2HHV A;  4B3T J;  1S76 D;  2MZT A;  3LP0 B;  3JSR A;  1YRU A;  1LWC B;  4UOH A;  5GMK a;  3HUL A;  5I42 A;  1RHM B;  3TAR A;  1FD2 A;  5DJB A;  1R0C B;  5D4N A;  3DMJ B;  2BM1 A;  2OPS A;  4YHH F;  3A3O B;  3PR4 A;  3HK2 A;  1N5Q A;  3DCA A;  5C2C A;  3SSR A;  2M9K A;  1T9Y A;  1KS2 A;  2W1B A;  1WC5 A;  5K14 A;  1U8W A;  1IR1 A;  5KFF A;  1SI9 A;  4MTP A;  3U1M A;  1GTH A;  4F4X A;  1RTJ B;  1VQ4 S;  2HIY A;  1IR2 A;  1IKX A;  2KVI A;  2Y8Y A;  1XMO J;  3S6E A;  2HAI A;  1WTF A;  3NP5 A;  3CNQ P;  3CJT A;  2M3D A;  2VC1 A;  1TL4 A;  2FHO B;  2NUH A;  1JXE A;  2HFU A;  1RAC B;  4LFB J;  1CQN A;  4F3M A;  3A8I A;  1GMV A;  1Y5N B;  4O4R A;  1F9F A;  5A2Q U;  4GO5 X;  4PWD B;  2YNI B;  2E7X A;  3VGU A;  3AA8 A;  1KHW A;  3CUN A;  1NPR A;  3WX8 A;  2V8V A;  1B7Y B;  3GSI A;  3LP1 B;  4K0K J;  5B0G A;  3QGP A;  5J2M A;  3T41 A;  5GAH I;  4M1K A;  3E01 A;  3NGK A;  5ETK A;  3CT9 A;  3KOA A;  2CJX B;  5JXS A;  4WFB Q;  4LFA J;  2VQF F;  3DRS A;  2WOM B;  2ZBR A;  3VZI A;  3DKD A;  3DRX A;  5EHH A;  3C46 A;  5KFE A;  3SCI E;  2RRB A;  3E8O A;  1ZTT A;  2CPI A;  4ED5 A;  3TJ8 A;  4F3Q A;  3IG1 A;  1GXU A;  5LT5 A;  5HVH A;  2QLJ B;  4Q0B A;  4CH1 A;  2QA4 G;  3D4J A;  3KXD A;  5BYQ A;  1TEL A;  4DL2 A;  2VQE J;  1FJC A;  1VOM A;  1QE1 A;  3QFH A;  4DR5 J;  1N36 J;  5CXT A;  5HP1 B;  1RT5 B;  3C8Y A;  4A8Q A;  4MMO A;  1NME B;  1XN9 A;  2ZM6 J;  2R2S A;  5LJ5 Y;  2WZ1 A;  3PW0 A;  1YZ6 A;  3LAL A;  3TEH B;  2W8L A;  3OJU A;  1Y00 A;  1YRT A;  1GXL A;  2OEM A;  1TK8 A;  2KFY A;  2I5J B;  1HIY A;  3JS9 A;  4DQI A;  4C9D A;  2WVB A;  3RJM B;  1F9H A;  1FE0 A;  1RWO B;  3BO3 A;  1HA1 A;  4QPT A;  3D9B A;  3PW4 A;  5JMN A;  4OI6 A;  2ZKT A;  3DLE A;  2M7S A;  3VAI A;  1FRK A;  5CCL A;  1HHT P;  2ZJR Q;  1HQ2 A;  1S1V A;  3J7Z T;  2VUG A;  2UP1 A;  2BKP A;  1S6O A;  4E8U A;  5SUH A;  3ICL A;  2GMJ A;  2J7U A;  4IRC A;  1OIA A;  3N5F A;  2OTJ S;  3KNA A;  2XCA A;  8RUC A;  3ZO7 A;  5DZ7 A;  3Q24 A;  3J7A 1;  2WVC A;  3DOL B;  4CT8 A;  3HKW A;  1JK9 B;  5B0F A;  3QO9 B;  1SKU B;  3H5Y A;  5DDP C;  4A8Y A;  2GQC A;  3I0S A;  4KY3 A;  4EU0 A;  1S0M A;  1S1X B;  2MKJ A;  1U2R A;  4TU7 A;  3TNV A;  1PCA A;  4OI3 A;  2BOP A;  5KT4 A;  1C2P A;  4QWC A;  2VFR A;  3TUI C;  3U02 A;  2XHC A;  2F8E X;  4F04 B;  3DU6 A;  2YPY A;  3S1T A;  4S0M A;  1UL3 A;  5HQ8 A;  1RT6 B;  3C6T A;  2B56 A;  1DAX A;  3US5 A;  2R7O A;  1UA0 A;  1X8D A;  3KG4 A;  1RKJ A;  3VTI A;  5B0D A;  1F5A A;  2G4B A;  5D0R A;  4WPA A;  3CJQ A;  2VBZ A;  4BC7 A;  3ZZP A;  3DOM A;  4J9K A;  3QLH A;  2QRR A;  2MDA A;  2VAS A;  1EQ0 A;  2C2K B;  1HWL A;  2JHE A;  3MI7 X;  1I51 B;  4WE1 A;  2BM0 A;  2KO1 A;  2D74 B;  2A6M A;  3IXQ A;  2UXD J;  1N0V C;  1RWW B;  4ZIV A;  1U2C A;  1K1Q A;  3N6N A;  4OYX A;  4KFB A;  3IRX A;  5AJ3 J;  3MR3 A;  4W98 A;  5LSL A;  4RPF A;  1ZOT A;  2ZBI A;  3QT8 A;  3EZ5 A; 
#chains in the Genus database with same CATH homology
 1HKA A;  1DY3 A;  5ETS A;  3KUE A;  1RAO A;  1RB0 A;  4M5J A;  1RU1 A;  3UDE A;  3UDV A;  1EQ0 A;  4M5G A;  5ETL A;  1Q0N A;  4AD6 A;  1CBK A;  2CG8 A;  5ETP A;  5ETV A;  2BMB A;  4CYU B;  1KBR A;  3KUG A;  3ILI A;  4M5M A;  2QX0 A;  3HSD A;  4M5I A;  3HSG A;  1EX8 A;  1EQM A;  4M5N A;  4CWB A;  4CRJ A;  3ILO A;  3KUH A;  1TMJ A;  3HCX A;  5ETT A;  3ILJ A;  1RU2 A;  3HD1 A;  4PZV A;  5ETK A;  3IP0 A;  5ETO A;  3HT0 A;  4CYU A;  1G4C A;  3MCM A;  1HQ2 A;  3UD5 A;  5ETN A;  4M5L A;  5ETM A;  5ETQ A;  3ILL A;  4M5H A;  3QBC A;  1F9H A;  1TMM A;  5ETR A;  3HSJ A;  3HSZ A;  3MCN A;  3HD2 A;  3MCO A;  4M5K A;  2F63 A;  1IM6 A;  1RTZ A;  2F65 A;  4F7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...