2QX3A

Structure of pectate lyase ii from xanthomonas campestris pv. campestris str. atcc 33913
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
330
structure length
330
Chain Sequence
b'GPVGYGAATTGGGNKVPVNVATFEAMQSAIDSYSGSGGLVLNYTGKFDFGTIKDVCAQWKLPAKTVQIKNKSDVTIKGANGSAANFGIRVVGNAHNVIIQNMTIGLLQGGEDADSISLEGNSSGEPSKIWVDHNTVFASLTKCSGAGDASFDGGIDMKKGVHHVTVSYNYVYNYQKVALNGYSDSDTKNSAARTTYHHNRFENVESRVPLQRRGLSHIYNNYFNNVTTSGINVRMGGIAKIESNYFENIKNPVTSRDSSEIGYWDLINNYVGSGITWGTPDGSKPYANATNWISTKVFPESLGYIYTVTPAAQVKAKVIATAGAGKNLAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase II
molecule tags Lyase
source organism Xanthomonas campestris pv. campestris
publication title A seductive method to improve the thermostability and activity of an enzyme
rcsb
total genus 130
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2007-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2qx3A00
1O8IA 4C2LA 4XOPA 1O8JA 1DBGA 3JURA 4XLHA 2EWEA 1IA5A 1CZFA 4XN0A 2QXZA 2NTQA 1PXZA 2X6YA 3GQAA 1EE6A 1OFLA 1HG8A 1RU4A 3GQ7A 2QY1A 2PYGA 3FY3A 2O0WA 3B90A 1O8GA 1DBOA 3EQNA 2O17A 1KCCA 4PMHA 1O8DA 1OGOX 1QCXA 1JRGA 1X0CA 4OJ6A 2NSTA 4YZAA 3EQOA 4XL9A 1H80A 5C1EA 4XLFA 2IQ7A 4HWVA 4XLCA 4YZXA 1NHCA 4AVZA 3LMWA 2VJJA 4XM3A 1O8LA 2O1DA 4U49A 3B8YA 4OZZA 4OJ5A 3VMVA 4XKWA 4XLAA 4W8SA 2X6WA 4YZ0A 3B4NA 1PLUA 4XNFA 4XONA 3KRGA 4OJLA 1BN8A 4W8TA 2INUA 1O8MA 1JTAA 4XN3A 2QX3A 1O8EA 1RMGA 2VBMA 2PYHA 2O0VA 1BHEA 2X3HA 3ZPPA 1XG2A 4U4BA 1AIRA 4OZYA 1O8KA 4MXNA 3VSTA 1OFMA 4Z06A 1IDJA 2VBEA 4URRA 4YELA 3SUCA 3T9GA 1IB4A 4W8QA 2ODLA 4W8RA 2BSPA 4YEJA 1O88A 3GQ8A 2VJIA 3UW0A 4XQFA 2VBKA 2INVA 1WMRA 2NSPA 2NZMA 4XORA 3GRHA 1GQ8A 2NT9A 4XMYA 4Z05A 2O04A 4XOTA 1VBLA 4XR6A 2UVFA 2NTBA 2Z8GA 4XKVA 1K5CA 4XLEA 1O8HA 4NK6A 1KTWA 3VMWA 2X85A 3WWGA 4I84A 3VSUA 5AMVA 5C1CA 4MR0A 2NT6A 1QJVA 1KCDA 1RWRA 4Z03A 1O8FA 4EW9A 2PECA 4OJOA 1OGMX 2X6XA 1OOCA 2NTPA 2UVEA 3VSVA 1IDKA 3GQ9A 4NK8A 3ZSCA 1PE9A 4YZQA 4OJPA
chains in the Genus database with same CATH superfamily
1O8IA 4C2LA 1QA3A 3NB2A 4XOPA 3PSZA 1O8JA 3TH0A 1DBGA 3JURA 3AK5A 4XLHA 2EWEA 1IA5A 3RIQA 1CZFA 4XN0A 2QXZA 2NTQA 1PXZA 2VFPA 2X6YA 2G0YA 3GQAA 3LYCA 1OFDA 2BM5A 2QZAA 1EE6A 1OFLA 1HG8A 1RU4A 5JLVC 3GQ7A 1TYXA 2QY1A 2PYGA 1QQ1A 4OPWA 3FY3A 2O0WA 3B90A 1O8GA 1DBOA 1LLZA 3EQNA 2O17A 1KCCA 4PMHA 3SYJA 1O8DA 1OGOX 1HF2A 1QCXA 1JRGA 1X0CA 2BM6A 4OJ6A 2NSTA 4YZAA 3EQOA 4XL9A 1H80A 5C1EA 1LM1A 4XLFA 2IQ7A 4HWVA 4XLCA 4YZXA 1TYUA 1KQ5A 1NHCA 4AVZA 2YUHA 2VJJA 3LMWA 4KH3A 4XM3A 1EZGA 1O8LA 2O1DA 3N90A 3SQVA 4U49A 3B8YA 4OZZA 4OJ5A 2VFQA 4XKWA 2BX6A 2O6WA 3VMVA 4XLAA 4W8SA 2X6WA 4YZ0A 3B4NA 1PLUA 2J8IA 4XNFA 4XONA 2IOUG 1CLWA 3KRGA 1BN8A 4OJLA 4W8TA 3SY2A 2INUA 1JTAA 1O8MA 1TSPA 2VFNA 4XN3A 2QX3A 3JX8A 4YFOA 4XQFA 1O8EA 1QRBA 1RMGA 2VBMA 2XTYA 1LLWA 2PYHA 2O0VA 3NAWA 3BH6B 1BHEA 2X3HA 3DU1X 3PSSA 3ZPPA 1XG2A 4U4BA 1AIRA 4YDTA 2BM4A 4OZYA 3PETA 1O8KA 4MXNA 3VSTA 2J8KA 3LJYA 1OFMA 3H09A 4Z06A 2V5IA 2XT2A 1IDJA 2VBEA 2XT4A 2W7ZA 4URRA 4YELA 3SUCA 5DNSA 3T9GA 1K4ZA 1IB4A 1WXRA 1QRCA 2ODLA 4W8QA 2BSPA 4W8RA 2XC1A 4YC5A 4YEJA 1O88A 1OFEA 2VJIA 1K8FA 3GQ8A 2VBKA 2INVA 3P4GA 1WMRA 3UW0A 2BM7A 2NSPA 2QYUA 3N6ZA 2NZMA 4XORA 3GRHA 1GQ8A 2NT9A 3ML3A 4XMYA 2O04A 4Z05A 4XOTA 1EA0A 2XTWA 1L1IA 1VBLA 4XR6A 2XTXA 2VFMA 1TYWA 2UVFA 2NTBA 1QA1A 2Z8GA 4XKVA 4YEIA 4XLEA 1O8HA 4NK6A 2F3LA 1K5CA 1KTWA 1QA2A 3VMWA 2X85A 3WWGA 1DABA 4I84A 3VSUA 1TYVA 3BH7B 5AMVA 5C1CA 3SZEA 4V02C 4MR0A 2NT6A 1QJVA 2VFOA 1KCDA 1RWRA 4Z03A 1O8FA 4EW9A 2PECA 5JMCB 4OJOA 1OGMX 2NTPA 1OOCA 2UVEA 2X6XA 2B0RA 3VSVA 4YCQA 1IDKA 3GQ9A 4NK8A 3ZSCA 1PE9A 4JRAC 4YZQA 4OM9A 4OJPA
chains in the Genus database with same CATH topology
1O8IA 4C2LA 4XOPA 1O8JA 1DBGA 3JURA 4XLHA 2EWEA 1IA5A 1CZFA 4XN0A 2QXZA 2NTQA 1PXZA 2X6YA 3GQAA 1EE6A 1OFLA 1HG8A 1RU4A 3GQ7A 2QY1A 2PYGA 3FY3A 2O0WA 3B90A 1O8GA 1DBOA 3EQNA 2O17A 1KCCA 4PMHA 1O8DA 1OGOX 1QCXA 1JRGA 1X0CA 4OJ6A 2NSTA 4YZAA 3EQOA 4XL9A 1H80A 5C1EA 4XLFA 2IQ7A 4HWVA 4XLCA 4YZXA 1NHCA 4AVZA 3LMWA 2VJJA 4XM3A 1O8LA 2O1DA 4U49A 3B8YA 4OZZA 4OJ5A 3VMVA 4XKWA 4XLAA 4W8SA 2X6WA 4YZ0A 3B4NA 1PLUA 4XNFA 4XONA 3KRGA 4OJLA 1BN8A 4W8TA 2INUA 1O8MA 1JTAA 4XN3A 2QX3A 1O8EA 1RMGA 2VBMA 2PYHA 2O0VA 1BHEA 2X3HA 3ZPPA 1XG2A 4U4BA 1AIRA 4OZYA 1O8KA 4MXNA 3VSTA 1OFMA 4Z06A 1IDJA 2VBEA 4URRA 4YELA 3SUCA 3T9GA 1IB4A 4W8QA 2ODLA 4W8RA 2BSPA 4YEJA 1O88A 3GQ8A 2VJIA 3UW0A 4XQFA 2VBKA 2INVA 1WMRA 2NSPA 2NZMA 4XORA 3GRHA 1GQ8A 2NT9A 4XMYA 4Z05A 2O04A 4XOTA 1VBLA 4XR6A 2UVFA 2NTBA 2Z8GA 4XKVA 1K5CA 4XLEA 1O8HA 4NK6A 1KTWA 3VMWA 2X85A 3WWGA 4I84A 3VSUA 5AMVA 5C1CA 4MR0A 2NT6A 1QJVA 1KCDA 1RWRA 4Z03A 1O8FA 4EW9A 2PECA 4OJOA 1OGMX 2X6XA 1OOCA 2NTPA 2UVEA 3VSVA 1IDKA 3GQ9A 4NK8A 3ZSCA 1PE9A 4YZQA 4OJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8I A;  4C2L A;  4XOP A;  1O8J A;  1DBG A;  3JUR A;  4XLH A;  2EWE A;  1IA5 A;  1CZF A;  4XN0 A;  2QXZ A;  2NTQ A;  1PXZ A;  2X6Y A;  3GQA A;  1EE6 A;  1OFL A;  1HG8 A;  1RU4 A;  3GQ7 A;  2QY1 A;  2PYG A;  3FY3 A;  2O0W A;  3B90 A;  1O8G A;  1DBO A;  3EQN A;  2O17 A;  1KCC A;  4PMH A;  1O8D A;  1OGO X;  1QCX A;  1JRG A;  1X0C A;  4OJ6 A;  2NST A;  4YZA A;  3EQO A;  4XL9 A;  1H80 A;  5C1E A;  4XLF A;  2IQ7 A;  4HWV A;  4XLC A;  4YZX A;  1NHC A;  4AVZ A;  3LMW A;  2VJJ A;  4XM3 A;  1O8L A;  2O1D A;  4U49 A;  3B8Y A;  4OZZ A;  4OJ5 A;  3VMV A;  4XKW A;  4XLA A;  4W8S A;  2X6W A;  4YZ0 A;  3B4N A;  1PLU A;  4XNF A;  4XON A;  3KRG A;  4OJL A;  1BN8 A;  4W8T A;  2INU A;  1O8M A;  1JTA A;  4XN3 A;  2QX3 A;  1O8E A;  1RMG A;  2VBM A;  2PYH A;  2O0V A;  1BHE A;  2X3H A;  3ZPP A;  1XG2 A;  4U4B A;  1AIR A;  4OZY A;  1O8K A;  4MXN A;  3VST A;  1OFM A;  4Z06 A;  1IDJ A;  2VBE A;  4URR A;  4YEL A;  3SUC A;  3T9G A;  1IB4 A;  4W8Q A;  2ODL A;  4W8R A;  2BSP A;  4YEJ A;  1O88 A;  3GQ8 A;  2VJI A;  3UW0 A;  4XQF A;  2VBK A;  2INV A;  1WMR A;  2NSP A;  2NZM A;  4XOR A;  3GRH A;  1GQ8 A;  2NT9 A;  4XMY A;  4Z05 A;  2O04 A;  4XOT A;  1VBL A;  4XR6 A;  2UVF A;  2NTB A;  2Z8G A;  4XKV A;  1K5C A;  4XLE A;  1O8H A;  4NK6 A;  1KTW A;  3VMW A;  2X85 A;  3WWG A;  4I84 A;  3VSU A;  5AMV A;  5C1C A;  4MR0 A;  2NT6 A;  1QJV A;  1KCD A;  1RWR A;  4Z03 A;  1O8F A;  4EW9 A;  2PEC A;  4OJO A;  1OGM X;  2X6X A;  1OOC A;  2NTP A;  2UVE A;  3VSV A;  1IDK A;  3GQ9 A;  4NK8 A;  3ZSC A;  1PE9 A;  4YZQ A;  4OJP A; 
#chains in the Genus database with same CATH topology
 1O8I A;  4C2L A;  1QA3 A;  3NB2 A;  4XOP A;  3PSZ A;  1O8J A;  3TH0 A;  1DBG A;  3JUR A;  3AK5 A;  4XLH A;  2EWE A;  1IA5 A;  3RIQ A;  1CZF A;  4XN0 A;  2QXZ A;  2NTQ A;  1PXZ A;  2VFP A;  2X6Y A;  2G0Y A;  3GQA A;  3LYC A;  1OFD A;  2BM5 A;  2QZA A;  1EE6 A;  1OFL A;  1HG8 A;  1RU4 A;  5JLV C;  3GQ7 A;  1TYX A;  2QY1 A;  2PYG A;  1QQ1 A;  4OPW A;  3FY3 A;  2O0W A;  3B90 A;  1O8G A;  1DBO A;  1LLZ A;  3EQN A;  2O17 A;  1KCC A;  4PMH A;  3SYJ A;  1O8D A;  1OGO X;  1HF2 A;  1QCX A;  1JRG A;  1X0C A;  2BM6 A;  4OJ6 A;  2NST A;  4YZA A;  3EQO A;  4XL9 A;  1H80 A;  5C1E A;  1LM1 A;  4XLF A;  2IQ7 A;  4HWV A;  4XLC A;  4YZX A;  1TYU A;  1KQ5 A;  1NHC A;  4AVZ A;  2YUH A;  2VJJ A;  3LMW A;  4KH3 A;  4XM3 A;  1EZG A;  1O8L A;  2O1D A;  3N90 A;  3SQV A;  4U49 A;  3B8Y A;  4OZZ A;  4OJ5 A;  2VFQ A;  4XKW A;  2BX6 A;  2O6W A;  3VMV A;  4XLA A;  4W8S A;  2X6W A;  4YZ0 A;  3B4N A;  1PLU A;  2J8I A;  4XNF A;  4XON A;  2IOU G;  1CLW A;  3KRG A;  1BN8 A;  4OJL A;  4W8T A;  3SY2 A;  2INU A;  1JTA A;  1O8M A;  1TSP A;  2VFN A;  4XN3 A;  2QX3 A;  3JX8 A;  4YFO A;  4XQF A;  1O8E A;  1QRB A;  1RMG A;  2VBM A;  2XTY A;  1LLW A;  2PYH A;  2O0V A;  3NAW A;  3BH6 B;  1BHE A;  2X3H A;  3DU1 X;  3PSS A;  3ZPP A;  1XG2 A;  4U4B A;  1AIR A;  4YDT A;  2BM4 A;  4OZY A;  3PET A;  1O8K A;  4MXN A;  3VST A;  2J8K A;  3LJY A;  1OFM A;  3H09 A;  4Z06 A;  2V5I A;  2XT2 A;  1IDJ A;  2VBE A;  2XT4 A;  2W7Z A;  4URR A;  4YEL A;  3SUC A;  5DNS A;  3T9G A;  1K4Z A;  1IB4 A;  1WXR A;  1QRC A;  2ODL A;  4W8Q A;  2BSP A;  4W8R A;  2XC1 A;  4YC5 A;  4YEJ A;  1O88 A;  1OFE A;  2VJI A;  1K8F A;  3GQ8 A;  2VBK A;  2INV A;  3P4G A;  1WMR A;  3UW0 A;  2BM7 A;  2NSP A;  2QYU A;  3N6Z A;  2NZM A;  4XOR A;  3GRH A;  1GQ8 A;  2NT9 A;  3ML3 A;  4XMY A;  2O04 A;  4Z05 A;  4XOT A;  1EA0 A;  2XTW A;  1L1I A;  1VBL A;  4XR6 A;  2XTX A;  2VFM A;  1TYW A;  2UVF A;  2NTB A;  1QA1 A;  2Z8G A;  4XKV A;  4YEI A;  4XLE A;  1O8H A;  4NK6 A;  2F3L A;  1K5C A;  1KTW A;  1QA2 A;  3VMW A;  2X85 A;  3WWG A;  1DAB A;  4I84 A;  3VSU A;  1TYV A;  3BH7 B;  5AMV A;  5C1C A;  3SZE A;  4V02 C;  4MR0 A;  2NT6 A;  1QJV A;  2VFO A;  1KCD A;  1RWR A;  4Z03 A;  1O8F A;  4EW9 A;  2PEC A;  5JMC B;  4OJO A;  1OGM X;  2NTP A;  1OOC A;  2UVE A;  2X6X A;  2B0R A;  3VSV A;  4YCQ A;  1IDK A;  3GQ9 A;  4NK8 A;  3ZSC A;  1PE9 A;  4JRA C;  4YZQ A;  4OM9 A;  4OJP A; 
#chains in the Genus database with same CATH homology
 1O8I A;  4C2L A;  4XOP A;  1O8J A;  1DBG A;  3JUR A;  4XLH A;  2EWE A;  1IA5 A;  1CZF A;  4XN0 A;  2QXZ A;  2NTQ A;  1PXZ A;  2X6Y A;  3GQA A;  1EE6 A;  1OFL A;  1HG8 A;  1RU4 A;  3GQ7 A;  2QY1 A;  2PYG A;  3FY3 A;  2O0W A;  3B90 A;  1O8G A;  1DBO A;  3EQN A;  2O17 A;  1KCC A;  4PMH A;  1O8D A;  1OGO X;  1QCX A;  1JRG A;  1X0C A;  4OJ6 A;  2NST A;  4YZA A;  3EQO A;  4XL9 A;  1H80 A;  5C1E A;  4XLF A;  2IQ7 A;  4HWV A;  4XLC A;  4YZX A;  1NHC A;  4AVZ A;  3LMW A;  2VJJ A;  4XM3 A;  1O8L A;  2O1D A;  4U49 A;  3B8Y A;  4OZZ A;  4OJ5 A;  3VMV A;  4XKW A;  4XLA A;  4W8S A;  2X6W A;  4YZ0 A;  3B4N A;  1PLU A;  4XNF A;  4XON A;  3KRG A;  4OJL A;  1BN8 A;  4W8T A;  2INU A;  1O8M A;  1JTA A;  4XN3 A;  2QX3 A;  1O8E A;  1RMG A;  2VBM A;  2PYH A;  2O0V A;  1BHE A;  2X3H A;  3ZPP A;  1XG2 A;  4U4B A;  1AIR A;  4OZY A;  1O8K A;  4MXN A;  3VST A;  1OFM A;  4Z06 A;  1IDJ A;  2VBE A;  4URR A;  4YEL A;  3SUC A;  3T9G A;  1IB4 A;  4W8Q A;  2ODL A;  4W8R A;  2BSP A;  4YEJ A;  1O88 A;  3GQ8 A;  2VJI A;  3UW0 A;  4XQF A;  2VBK A;  2INV A;  1WMR A;  2NSP A;  2NZM A;  4XOR A;  3GRH A;  1GQ8 A;  2NT9 A;  4XMY A;  4Z05 A;  2O04 A;  4XOT A;  1VBL A;  4XR6 A;  2UVF A;  2NTB A;  2Z8G A;  4XKV A;  1K5C A;  4XLE A;  1O8H A;  4NK6 A;  1KTW A;  3VMW A;  2X85 A;  3WWG A;  4I84 A;  3VSU A;  5AMV A;  5C1C A;  4MR0 A;  2NT6 A;  1QJV A;  1KCD A;  1RWR A;  4Z03 A;  1O8F A;  4EW9 A;  2PEC A;  4OJO A;  1OGM X;  2X6X A;  1OOC A;  2NTP A;  2UVE A;  3VSV A;  1IDK A;  3GQ9 A;  4NK8 A;  3ZSC A;  1PE9 A;  4YZQ A;  4OJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...