2QX3A

Structure of pectate lyase ii from xanthomonas campestris pv. campestris str. atcc 33913
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
330
structure length
330
Chain Sequence
GPVGYGAATTGGGNKVPVNVATFEAMQSAIDSYSGSGGLVLNYTGKFDFGTIKDVCAQWKLPAKTVQIKNKSDVTIKGANGSAANFGIRVVGNAHNVIIQNMTIGLLQGGEDADSISLEGNSSGEPSKIWVDHNTVFASLTKCSGAGDASFDGGIDMKKGVHHVTVSYNYVYNYQKVALNGYSDSDTKNSAARTTYHHNRFENVESRVPLQRRGLSHIYNNYFNNVTTSGINVRMGGIAKIESNYFENIKNPVTSRDSSEIGYWDLINNYVGSGITWGTPDGSKPYANATNWISTKVFPESLGYIYTVTPAAQVKAKVIATAGAGKNLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A seductive method to improve the thermostability and activity of an enzyme
rcsb
molecule keywords Pectate lyase II
molecule tags Lyase
source organism Xanthomonas campestris pv. campestris
total genus 130
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2007-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2qx3A00
4OJPA 2VBMA 4U4BA 1KTWA 1OGMX 5AMVA 1AIRA 4W8SA 1O8JA 1O88A 4XLEA 1PLUA 1QCXA 3FY3A 1WMRA 3LMWA 4XONA 3WWGA 4XN0A 4EW9A 1OFMA 3GQ7A 4YELA 4YZ0A 1QJVA 4W8QA 4PMHA 2O1DA 2QX3A 1PE9A 4XOTA 1JTAA 1VBLA 2VJJA 1IDKA 3T9GA 1X0CA 3B90A 1JRGA 4OZYA 1O8FA 2NZMA 2NTQA 4XNFA 4Z06A 4YEJA 1KCCA 4XQFA 3GQAA 4NK6A 1O8IA 1NHCA 1BN8A 1XG2A 4I84A 1GQ8A 4HWVA 2INUA 1O8LA 4C2LA 2NTBA 4MR0A 3VSTA 1O8DA 4OJOA 1K5CA 4YZQA 2BSPA 2O0VA 1PXZA 4XKWA 2X6XA 4XMYA 2VBEA 2O04A 3SUCA 2O0WA 1RMGA 2NSPA 1IB4A 4OZZA 5C1EA 1OFLA 1OOCA 2X6YA 3GRHA 3VSUA 2PYGA 3EQOA 4XORA 3VMVA 4Z05A 1O8GA 2X3HA 3JURA 4XLFA 4W8TA 4OJLA 2X85A 2ODLA 4XR6A 3VMWA 4U49A 1RU4A 2VJIA 2IQ7A 4Z03A 4XM3A 1OGOX 1IDJA 1O8EA 2QXZA 2PYHA 5C1CA 4XLCA 4URRA 3VSVA 2Z8GA 3KRGA 4OJ6A 1BHEA 4XN3A 3UW0A 3ZSCA 1RWRA 1EE6A 4XLHA 4AVZA 3GQ8A 4XLAA 1KCDA 3B8YA 4W8RA 2EWEA 4MXNA 4XOPA 1H80A 1O8KA 1HG8A 1DBGA 1IA5A 1DBOA 2UVEA 3B4NA 2NSTA 4YZXA 2X6WA 4OJ5A 3EQNA 2NTPA 1O8HA 2NT9A 2QY1A 2INVA 1O8MA 2NT6A 4XKVA 2PECA 4XL9A 4NK8A 2UVFA 3ZPPA 1CZFA 2VBKA 4YZAA 2O17A 3GQ9A
chains in the Genus database with same CATH superfamily
1KQ5A 3BH7B 4OJPA 1TSPA 2VBMA 4V02C 4U4BA 3SYJA 1WXRA 1KTWA 2F3LA 1OGMX 5AMVA 5JLVC 1TYWA 1EA0A 1TYVA 1AIRA 4W8SA 1O8JA 4YEIA 5JMCB 1O88A 4XLEA 1PLUA 2G0YA 1QCXA 3PSZA 3FY3A 2J8KA 1WMRA 2W7ZA 4YDTA 3LMWA 3NB2A 4XONA 3WWGA 4YFOA 1TYXA 4XN0A 4EW9A 1OFMA 2O6WA 3GQ7A 4YELA 4YZ0A 1QJVA 4W8QA 1DABA 1QRBA 4PMHA 3SQVA 2O1DA 2QZAA 2QX3A 1PE9A 4XOTA 1JTAA 1VBLA 2VJJA 1IDKA 3T9GA 1X0CA 3B90A 1JRGA 4OZYA 3SZEA 1O8FA 4YCQA 3BH6B 2XTXA 2NZMA 2NTQA 4XNFA 3ML3A 2XTWA 4YEJA 3N90A 4Z06A 1OFDA 1KCCA 4XQFA 3GQAA 4NK6A 1O8IA 1K8FA 1BN8A 1NHCA 2XT4A 1XG2A 4I84A 1GQ8A 4HWVA 2INUA 1O8LA 4C2LA 2NTBA 3LYCA 4MR0A 3VSTA 1O8DA 4OJOA 1K5CA 4YZQA 2BSPA 2O0VA 2VFQA 1PXZA 4XKWA 1EZGA 2X6XA 4XMYA 3PSSA 1QA1A 2VBEA 1TYUA 2O04A 3SUCA 3PETA 1HF2A 2O0WA 4OPWA 2XT2A 2IOUG 3H09A 1QRCA 3DU1X 3SY2A 1RMGA 4JRAC 2NSPA 1IB4A 4OZZA 5C1EA 1OFLA 1OOCA 2X6YA 1QA3A 3GRHA 2J8IA 3VSUA 5DNSA 1QA2A 2PYGA 3EQOA 3P4GA 4XORA 2VFMA 3VMVA 4Z05A 1O8GA 2X3HA 3JURA 2VFOA 4XLFA 4W8TA 1LLWA 4OJLA 1QQ1A 2X85A 1CLWA 2ODLA 4XR6A 3VMWA 4U49A 1RU4A 2VJIA 4YC5A 2IQ7A 2BM6A 2BX6A 4OM9A 4Z03A 2VFPA 4XM3A 1OGOX 1IDJA 1O8EA 3RIQA 2PYHA 2QXZA 1K4ZA 3JX8A 3LJYA 4XLCA 5C1CA 4URRA 3VSVA 2Z8GA 3KRGA 4OJ6A 1BHEA 2BM5A 2QYUA 4XN3A 1RWRA 1EE6A 3UW0A 3ZSCA 2V5IA 4XLHA 3AK5A 4AVZA 3GQ8A 4XLAA 1KCDA 2BM7A 3B8YA 4W8RA 2EWEA 2XC1A 4MXNA 4XOPA 1H80A 1O8KA 1HG8A 1DBGA 2B0RA 1DBOA 2UVEA 3B4NA 2NSTA 3N6ZA 4YZXA 1IA5A 2BM4A 2X6WA 4OJ5A 3EQNA 2NTPA 1O8HA 2NT9A 2VFNA 1OFEA 1LM1A 2YUHA 1L1IA 3NAWA 2QY1A 2INVA 1O8MA 2NT6A 4XKVA 2PECA 4XL9A 3TH0A 4NK8A 2UVFA 1LLZA 3ZPPA 4KH3A 1CZFA 2VBKA 4YZAA 2XTYA 2O17A 3GQ9A
chains in the Genus database with same CATH topology
4OJPA 2VBMA 4U4BA 1KTWA 1OGMX 5AMVA 1AIRA 4W8SA 1O8JA 1O88A 4XLEA 1PLUA 1QCXA 3FY3A 1WMRA 3LMWA 4XONA 3WWGA 4XN0A 4EW9A 1OFMA 3GQ7A 4YELA 4YZ0A 1QJVA 4W8QA 4PMHA 2O1DA 2QX3A 1PE9A 4XOTA 1JTAA 1VBLA 2VJJA 1IDKA 3T9GA 1X0CA 3B90A 1JRGA 4OZYA 1O8FA 2NZMA 2NTQA 4XNFA 4Z06A 4YEJA 1KCCA 4XQFA 3GQAA 4NK6A 1O8IA 1NHCA 1BN8A 1XG2A 4I84A 1GQ8A 4HWVA 2INUA 1O8LA 4C2LA 2NTBA 4MR0A 3VSTA 1O8DA 4OJOA 1K5CA 4YZQA 2BSPA 2O0VA 1PXZA 4XKWA 2X6XA 4XMYA 2VBEA 2O04A 3SUCA 2O0WA 1RMGA 2NSPA 1IB4A 4OZZA 5C1EA 1OFLA 1OOCA 2X6YA 3GRHA 3VSUA 2PYGA 3EQOA 4XORA 3VMVA 4Z05A 1O8GA 2X3HA 3JURA 4XLFA 4W8TA 4OJLA 2X85A 2ODLA 4XR6A 3VMWA 4U49A 1RU4A 2VJIA 2IQ7A 4Z03A 4XM3A 1OGOX 1IDJA 1O8EA 2QXZA 2PYHA 5C1CA 4XLCA 4URRA 3VSVA 2Z8GA 3KRGA 4OJ6A 1BHEA 4XN3A 3UW0A 3ZSCA 1RWRA 1EE6A 4XLHA 4AVZA 3GQ8A 4XLAA 1KCDA 3B8YA 4W8RA 2EWEA 4MXNA 4XOPA 1H80A 1O8KA 1HG8A 1DBGA 1IA5A 1DBOA 2UVEA 3B4NA 2NSTA 4YZXA 2X6WA 4OJ5A 3EQNA 2NTPA 1O8HA 2NT9A 2QY1A 2INVA 1O8MA 2NT6A 4XKVA 2PECA 4XL9A 4NK8A 2UVFA 3ZPPA 1CZFA 2VBKA 4YZAA 2O17A 3GQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJP A;  2VBM A;  4U4B A;  1KTW A;  1OGM X;  5AMV A;  1AIR A;  4W8S A;  1O8J A;  1O88 A;  4XLE A;  1PLU A;  1QCX A;  3FY3 A;  1WMR A;  3LMW A;  4XON A;  3WWG A;  4XN0 A;  4EW9 A;  1OFM A;  3GQ7 A;  4YEL A;  4YZ0 A;  1QJV A;  4W8Q A;  4PMH A;  2O1D A;  2QX3 A;  1PE9 A;  4XOT A;  1JTA A;  1VBL A;  2VJJ A;  1IDK A;  3T9G A;  1X0C A;  3B90 A;  1JRG A;  4OZY A;  1O8F A;  2NZM A;  2NTQ A;  4XNF A;  4Z06 A;  4YEJ A;  1KCC A;  4XQF A;  3GQA A;  4NK6 A;  1O8I A;  1NHC A;  1BN8 A;  1XG2 A;  4I84 A;  1GQ8 A;  4HWV A;  2INU A;  1O8L A;  4C2L A;  2NTB A;  4MR0 A;  3VST A;  1O8D A;  4OJO A;  1K5C A;  4YZQ A;  2BSP A;  2O0V A;  1PXZ A;  4XKW A;  2X6X A;  4XMY A;  2VBE A;  2O04 A;  3SUC A;  2O0W A;  1RMG A;  2NSP A;  1IB4 A;  4OZZ A;  5C1E A;  1OFL A;  1OOC A;  2X6Y A;  3GRH A;  3VSU A;  2PYG A;  3EQO A;  4XOR A;  3VMV A;  4Z05 A;  1O8G A;  2X3H A;  3JUR A;  4XLF A;  4W8T A;  4OJL A;  2X85 A;  2ODL A;  4XR6 A;  3VMW A;  4U49 A;  1RU4 A;  2VJI A;  2IQ7 A;  4Z03 A;  4XM3 A;  1OGO X;  1IDJ A;  1O8E A;  2QXZ A;  2PYH A;  5C1C A;  4XLC A;  4URR A;  3VSV A;  2Z8G A;  3KRG A;  4OJ6 A;  1BHE A;  4XN3 A;  3UW0 A;  3ZSC A;  1RWR A;  1EE6 A;  4XLH A;  4AVZ A;  3GQ8 A;  4XLA A;  1KCD A;  3B8Y A;  4W8R A;  2EWE A;  4MXN A;  4XOP A;  1H80 A;  1O8K A;  1HG8 A;  1DBG A;  1IA5 A;  1DBO A;  2UVE A;  3B4N A;  2NST A;  4YZX A;  2X6W A;  4OJ5 A;  3EQN A;  2NTP A;  1O8H A;  2NT9 A;  2QY1 A;  2INV A;  1O8M A;  2NT6 A;  4XKV A;  2PEC A;  4XL9 A;  4NK8 A;  2UVF A;  3ZPP A;  1CZF A;  2VBK A;  4YZA A;  2O17 A;  3GQ9 A; 
#chains in the Genus database with same CATH topology
 1KQ5 A;  3BH7 B;  4OJP A;  1TSP A;  2VBM A;  4V02 C;  4U4B A;  3SYJ A;  1WXR A;  1KTW A;  2F3L A;  1OGM X;  5AMV A;  5JLV C;  1TYW A;  1EA0 A;  1TYV A;  1AIR A;  4W8S A;  1O8J A;  4YEI A;  5JMC B;  1O88 A;  4XLE A;  1PLU A;  2G0Y A;  1QCX A;  3PSZ A;  3FY3 A;  2J8K A;  1WMR A;  2W7Z A;  4YDT A;  3LMW A;  3NB2 A;  4XON A;  3WWG A;  4YFO A;  1TYX A;  4XN0 A;  4EW9 A;  1OFM A;  2O6W A;  3GQ7 A;  4YEL A;  4YZ0 A;  1QJV A;  4W8Q A;  1DAB A;  1QRB A;  4PMH A;  3SQV A;  2O1D A;  2QZA A;  2QX3 A;  1PE9 A;  4XOT A;  1JTA A;  1VBL A;  2VJJ A;  1IDK A;  3T9G A;  1X0C A;  3B90 A;  1JRG A;  4OZY A;  3SZE A;  1O8F A;  4YCQ A;  3BH6 B;  2XTX A;  2NZM A;  2NTQ A;  4XNF A;  3ML3 A;  2XTW A;  4YEJ A;  3N90 A;  4Z06 A;  1OFD A;  1KCC A;  4XQF A;  3GQA A;  4NK6 A;  1O8I A;  1K8F A;  1BN8 A;  1NHC A;  2XT4 A;  1XG2 A;  4I84 A;  1GQ8 A;  4HWV A;  2INU A;  1O8L A;  4C2L A;  2NTB A;  3LYC A;  4MR0 A;  3VST A;  1O8D A;  4OJO A;  1K5C A;  4YZQ A;  2BSP A;  2O0V A;  2VFQ A;  1PXZ A;  4XKW A;  1EZG A;  2X6X A;  4XMY A;  3PSS A;  1QA1 A;  2VBE A;  1TYU A;  2O04 A;  3SUC A;  3PET A;  1HF2 A;  2O0W A;  4OPW A;  2XT2 A;  2IOU G;  3H09 A;  1QRC A;  3DU1 X;  3SY2 A;  1RMG A;  4JRA C;  2NSP A;  1IB4 A;  4OZZ A;  5C1E A;  1OFL A;  1OOC A;  2X6Y A;  1QA3 A;  3GRH A;  2J8I A;  3VSU A;  5DNS A;  1QA2 A;  2PYG A;  3EQO A;  3P4G A;  4XOR A;  2VFM A;  3VMV A;  4Z05 A;  1O8G A;  2X3H A;  3JUR A;  2VFO A;  4XLF A;  4W8T A;  1LLW A;  4OJL A;  1QQ1 A;  2X85 A;  1CLW A;  2ODL A;  4XR6 A;  3VMW A;  4U49 A;  1RU4 A;  2VJI A;  4YC5 A;  2IQ7 A;  2BM6 A;  2BX6 A;  4OM9 A;  4Z03 A;  2VFP A;  4XM3 A;  1OGO X;  1IDJ A;  1O8E A;  3RIQ A;  2PYH A;  2QXZ A;  1K4Z A;  3JX8 A;  3LJY A;  4XLC A;  5C1C A;  4URR A;  3VSV A;  2Z8G A;  3KRG A;  4OJ6 A;  1BHE A;  2BM5 A;  2QYU A;  4XN3 A;  1RWR A;  1EE6 A;  3UW0 A;  3ZSC A;  2V5I A;  4XLH A;  3AK5 A;  4AVZ A;  3GQ8 A;  4XLA A;  1KCD A;  2BM7 A;  3B8Y A;  4W8R A;  2EWE A;  2XC1 A;  4MXN A;  4XOP A;  1H80 A;  1O8K A;  1HG8 A;  1DBG A;  2B0R A;  1DBO A;  2UVE A;  3B4N A;  2NST A;  3N6Z A;  4YZX A;  1IA5 A;  2BM4 A;  2X6W A;  4OJ5 A;  3EQN A;  2NTP A;  1O8H A;  2NT9 A;  2VFN A;  1OFE A;  1LM1 A;  2YUH A;  1L1I A;  3NAW A;  2QY1 A;  2INV A;  1O8M A;  2NT6 A;  4XKV A;  2PEC A;  4XL9 A;  3TH0 A;  4NK8 A;  2UVF A;  1LLZ A;  3ZPP A;  4KH3 A;  1CZF A;  2VBK A;  4YZA A;  2XTY A;  2O17 A;  3GQ9 A; 
#chains in the Genus database with same CATH homology
 4OJP A;  2VBM A;  4U4B A;  1KTW A;  1OGM X;  5AMV A;  1AIR A;  4W8S A;  1O8J A;  1O88 A;  4XLE A;  1PLU A;  1QCX A;  3FY3 A;  1WMR A;  3LMW A;  4XON A;  3WWG A;  4XN0 A;  4EW9 A;  1OFM A;  3GQ7 A;  4YEL A;  4YZ0 A;  1QJV A;  4W8Q A;  4PMH A;  2O1D A;  2QX3 A;  1PE9 A;  4XOT A;  1JTA A;  1VBL A;  2VJJ A;  1IDK A;  3T9G A;  1X0C A;  3B90 A;  1JRG A;  4OZY A;  1O8F A;  2NZM A;  2NTQ A;  4XNF A;  4Z06 A;  4YEJ A;  1KCC A;  4XQF A;  3GQA A;  4NK6 A;  1O8I A;  1NHC A;  1BN8 A;  1XG2 A;  4I84 A;  1GQ8 A;  4HWV A;  2INU A;  1O8L A;  4C2L A;  2NTB A;  4MR0 A;  3VST A;  1O8D A;  4OJO A;  1K5C A;  4YZQ A;  2BSP A;  2O0V A;  1PXZ A;  4XKW A;  2X6X A;  4XMY A;  2VBE A;  2O04 A;  3SUC A;  2O0W A;  1RMG A;  2NSP A;  1IB4 A;  4OZZ A;  5C1E A;  1OFL A;  1OOC A;  2X6Y A;  3GRH A;  3VSU A;  2PYG A;  3EQO A;  4XOR A;  3VMV A;  4Z05 A;  1O8G A;  2X3H A;  3JUR A;  4XLF A;  4W8T A;  4OJL A;  2X85 A;  2ODL A;  4XR6 A;  3VMW A;  4U49 A;  1RU4 A;  2VJI A;  2IQ7 A;  4Z03 A;  4XM3 A;  1OGO X;  1IDJ A;  1O8E A;  2QXZ A;  2PYH A;  5C1C A;  4XLC A;  4URR A;  3VSV A;  2Z8G A;  3KRG A;  4OJ6 A;  1BHE A;  4XN3 A;  3UW0 A;  3ZSC A;  1RWR A;  1EE6 A;  4XLH A;  4AVZ A;  3GQ8 A;  4XLA A;  1KCD A;  3B8Y A;  4W8R A;  2EWE A;  4MXN A;  4XOP A;  1H80 A;  1O8K A;  1HG8 A;  1DBG A;  1IA5 A;  1DBO A;  2UVE A;  3B4N A;  2NST A;  4YZX A;  2X6W A;  4OJ5 A;  3EQN A;  2NTP A;  1O8H A;  2NT9 A;  2QY1 A;  2INV A;  1O8M A;  2NT6 A;  4XKV A;  2PEC A;  4XL9 A;  4NK8 A;  2UVF A;  3ZPP A;  1CZF A;  2VBK A;  4YZA A;  2O17 A;  3GQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...