2QX3A

Structure of pectate lyase ii from xanthomonas campestris pv. campestris str. atcc 33913
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
330
structure length
330
Chain Sequence
GPVGYGAATTGGGNKVPVNVATFEAMQSAIDSYSGSGGLVLNYTGKFDFGTIKDVCAQWKLPAKTVQIKNKSDVTIKGANGSAANFGIRVVGNAHNVIIQNMTIGLLQGGEDADSISLEGNSSGEPSKIWVDHNTVFASLTKCSGAGDASFDGGIDMKKGVHHVTVSYNYVYNYQKVALNGYSDSDTKNSAARTTYHHNRFENVESRVPLQRRGLSHIYNNYFNNVTTSGINVRMGGIAKIESNYFENIKNPVTSRDSSEIGYWDLINNYVGSGITWGTPDGSKPYANATNWISTKVFPESLGYIYTVTPAAQVKAKVIATAGAGKNLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase II
publication title A seductive method to improve the thermostability and activity of an enzyme
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Lyase
total genus 130
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2007-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2qx3A00
1JTAA 2PYHA 3GQ7A 2QXZA 2VBEA 3LMWA 3VMWA 1H80A 4XLEA 2Z8GA 4Z05A 1OFMA 3JURA 1EE6A 4XLAA 4OZYA 2NTPA 4Z03A 2X6YA 4OJ6A 2O1DA 2O17A 3B90A 2VJIA 1HG8A 4W8TA 4HWVA 4XQFA 4W8QA 4MR0A 1O8GA 3UW0A 4OZZA 1O8LA 2NT9A 4YZAA 1NHCA 1IDKA 4C2LA 2NZMA 1O8JA 2VBMA 4XOPA 3ZSCA 3EQNA 2PYGA 4EW9A 1O8EA 2NSPA 4XL9A 4YZQA 2NT6A 4XR6A 2X3HA 2O0VA 1K5CA 4U4BA 1PE9A 1QJVA 4NK6A 1QCXA 5C1EA 2NSTA 1O8FA 1PXZA 4XKVA 2PECA 2O04A 1RU4A 2INUA 4NK8A 1O8MA 1XG2A 3VSTA 4OJPA 2X6WA 2QX3A 4OJOA 3VSVA 1WMRA 3ZPPA 3VMVA 4YEJA 4XOTA 3T9GA 1CZFA 1KCDA 2ODLA 1BHEA 1O8HA 1DBOA 2NTQA 2QY1A 2UVEA 4PMHA 4XONA 4Z06A 1RWRA 2O0WA 1VBLA 5AMVA 3FY3A 1IDJA 2VJJA 1O88A 4W8RA 4XLHA 1IB4A 1O8KA 1O8DA 4OJLA 4MXNA 4XN3A 1JRGA 1AIRA 4AVZA 3GRHA 1O8IA 1OOCA 2IQ7A 2UVFA 1KCCA 2VBKA 3GQ8A 1X0CA 4XLFA 3B8YA 3GQAA 3B4NA 4XORA 1PLUA 1OGMX 1DBGA 4XLCA 4YZXA 4W8SA 2X6XA 2INVA 3VSUA 3EQOA 4XMYA 4I84A 5C1CA 4XM3A 4URRA 4XN0A 3SUCA 1OFLA 2EWEA 3GQ9A 1GQ8A 3KRGA 4XNFA 4YZ0A 4U49A 2BSPA 2X85A 1IA5A 1BN8A 3WWGA 2NTBA 1KTWA 1RMGA 4OJ5A 4XKWA 1OGOX 4YELA
chains in the Genus database with same CATH superfamily
4YC5A 1JTAA 2PYHA 4KH3A 1CLWA 3GQ7A 3PSSA 2BM6A 2QXZA 2VBEA 4YEIA 3LMWA 3PETA 3VMWA 3NAWA 4YCQA 1H80A 4XLEA 2Z8GA 4Z05A 1OFMA 3JURA 1EE6A 2VFPA 2F3LA 4XLAA 3DU1X 4OZYA 2NTPA 4Z03A 2X6YA 4JRAC 4OJ6A 2O1DA 2O17A 2YUHA 3B90A 1EZGA 3H09A 2VJIA 3SY2A 1HG8A 4W8TA 3LJYA 4HWVA 3SZEA 4XQFA 5JMCB 3SQVA 4W8QA 4MR0A 1O8GA 3UW0A 4OZZA 1O8LA 2B0RA 2NT9A 4YZAA 1NHCA 1IDKA 2V5IA 4C2LA 1KQ5A 2NZMA 1O8JA 2VBMA 1K4ZA 1QRBA 4XOPA 3ZSCA 3EQNA 2PYGA 2QYUA 4EW9A 1O8EA 2NSPA 4XL9A 4YZQA 1K8FA 1TYUA 2NT6A 3N6ZA 3AK5A 4XR6A 2X3HA 2O0VA 1K5CA 4U4BA 1PE9A 1QJVA 3N90A 4NK6A 1QCXA 1IB4A 2G0YA 2O6WA 2J8KA 2NSTA 5C1EA 1O8FA 1PXZA 3NB2A 4OM9A 4XKVA 5DNSA 2PECA 2O04A 1RU4A 2INUA 4NK8A 1QA3A 2J8IA 1O8MA 1XG2A 3VSTA 4OJPA 2IOUG 3P4GA 2X6WA 1LLZA 1QA2A 2QX3A 4OJOA 2XTXA 3VSVA 1WMRA 3JX8A 1L1IA 3ZPPA 2XTWA 1TYWA 3VMVA 2VFNA 1QQ1A 4YEJA 4XOTA 3T9GA 1CZFA 3ML3A 1KCDA 1BHEA 1O8HA 1DBOA 2NTQA 2ODLA 2QY1A 2UVEA 4PMHA 2XC1A 4XLHA 1TYXA 3RIQA 4XONA 4Z06A 2XT2A 1RWRA 2O0WA 1VBLA 2VFOA 5AMVA 2QZAA 1HF2A 3FY3A 4V02C 1TSPA 1IDJA 2VJJA 1O88A 1TYVA 2XT4A 4W8RA 1O8KA 1LLWA 2BM4A 1O8DA 1LM1A 2VFQA 3PSZA 4OJLA 4MXNA 4XN3A 1OFDA 1JRGA 1AIRA 4AVZA 3GRHA 1O8IA 1OOCA 1OFEA 2BM5A 2IQ7A 2UVFA 1KCCA 2VBKA 3TH0A 3GQ8A 3LYCA 1X0CA 4XLFA 1QRCA 3B8YA 4YFOA 3GQAA 3B4NA 4XORA 4YDTA 2W7ZA 1PLUA 1QA1A 1OGMX 1DBGA 2BX6A 1DABA 2XTYA 4XLCA 4YZXA 4W8SA 2X6XA 2INVA 3VSUA 3EQOA 2VFMA 4XMYA 3SYJA 4I84A 5C1CA 4XM3A 4URRA 4XN0A 1WXRA 3SUCA 3BH7B 1OFLA 3BH6B 2EWEA 3GQ9A 1GQ8A 2BM7A 3KRGA 4XNFA 4YZ0A 4U49A 2BSPA 2X85A 1IA5A 1EA0A 1BN8A 3WWGA 2NTBA 1KTWA 4OPWA 1RMGA 4OJ5A 4XKWA 1OGOX 4YELA 5JLVC
chains in the Genus database with same CATH topology
1JTAA 2PYHA 3GQ7A 2QXZA 2VBEA 3LMWA 3VMWA 1H80A 4XLEA 2Z8GA 4Z05A 1OFMA 3JURA 1EE6A 4XLAA 4OZYA 2NTPA 4Z03A 2X6YA 4OJ6A 2O1DA 2O17A 3B90A 2VJIA 1HG8A 4W8TA 4HWVA 4XQFA 4W8QA 4MR0A 1O8GA 3UW0A 4OZZA 1O8LA 2NT9A 4YZAA 1NHCA 1IDKA 4C2LA 2NZMA 1O8JA 2VBMA 4XOPA 3ZSCA 3EQNA 2PYGA 4EW9A 1O8EA 2NSPA 4XL9A 4YZQA 2NT6A 4XR6A 2X3HA 2O0VA 1K5CA 4U4BA 1PE9A 1QJVA 4NK6A 1QCXA 5C1EA 2NSTA 1O8FA 1PXZA 4XKVA 2PECA 2O04A 1RU4A 2INUA 4NK8A 1O8MA 1XG2A 3VSTA 4OJPA 2X6WA 2QX3A 4OJOA 3VSVA 1WMRA 3ZPPA 3VMVA 4YEJA 4XOTA 3T9GA 1CZFA 1KCDA 2ODLA 1BHEA 1O8HA 1DBOA 2NTQA 2QY1A 2UVEA 4PMHA 4XONA 4Z06A 1RWRA 2O0WA 1VBLA 5AMVA 3FY3A 1IDJA 2VJJA 1O88A 4W8RA 4XLHA 1IB4A 1O8KA 1O8DA 4OJLA 4MXNA 4XN3A 1JRGA 1AIRA 4AVZA 3GRHA 1O8IA 1OOCA 2IQ7A 2UVFA 1KCCA 2VBKA 3GQ8A 1X0CA 4XLFA 3B8YA 3GQAA 3B4NA 4XORA 1PLUA 1OGMX 1DBGA 4XLCA 4YZXA 4W8SA 2X6XA 2INVA 3VSUA 3EQOA 4XMYA 4I84A 5C1CA 4XM3A 4URRA 4XN0A 3SUCA 1OFLA 2EWEA 3GQ9A 1GQ8A 3KRGA 4XNFA 4YZ0A 4U49A 2BSPA 2X85A 1IA5A 1BN8A 3WWGA 2NTBA 1KTWA 1RMGA 4OJ5A 4XKWA 1OGOX 4YELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTA A;  2PYH A;  3GQ7 A;  2QXZ A;  2VBE A;  3LMW A;  3VMW A;  1H80 A;  4XLE A;  2Z8G A;  4Z05 A;  1OFM A;  3JUR A;  1EE6 A;  4XLA A;  4OZY A;  2NTP A;  4Z03 A;  2X6Y A;  4OJ6 A;  2O1D A;  2O17 A;  3B90 A;  2VJI A;  1HG8 A;  4W8T A;  4HWV A;  4XQF A;  4W8Q A;  4MR0 A;  1O8G A;  3UW0 A;  4OZZ A;  1O8L A;  2NT9 A;  4YZA A;  1NHC A;  1IDK A;  4C2L A;  2NZM A;  1O8J A;  2VBM A;  4XOP A;  3ZSC A;  3EQN A;  2PYG A;  4EW9 A;  1O8E A;  2NSP A;  4XL9 A;  4YZQ A;  2NT6 A;  4XR6 A;  2X3H A;  2O0V A;  1K5C A;  4U4B A;  1PE9 A;  1QJV A;  4NK6 A;  1QCX A;  5C1E A;  2NST A;  1O8F A;  1PXZ A;  4XKV A;  2PEC A;  2O04 A;  1RU4 A;  2INU A;  4NK8 A;  1O8M A;  1XG2 A;  3VST A;  4OJP A;  2X6W A;  2QX3 A;  4OJO A;  3VSV A;  1WMR A;  3ZPP A;  3VMV A;  4YEJ A;  4XOT A;  3T9G A;  1CZF A;  1KCD A;  2ODL A;  1BHE A;  1O8H A;  1DBO A;  2NTQ A;  2QY1 A;  2UVE A;  4PMH A;  4XON A;  4Z06 A;  1RWR A;  2O0W A;  1VBL A;  5AMV A;  3FY3 A;  1IDJ A;  2VJJ A;  1O88 A;  4W8R A;  4XLH A;  1IB4 A;  1O8K A;  1O8D A;  4OJL A;  4MXN A;  4XN3 A;  1JRG A;  1AIR A;  4AVZ A;  3GRH A;  1O8I A;  1OOC A;  2IQ7 A;  2UVF A;  1KCC A;  2VBK A;  3GQ8 A;  1X0C A;  4XLF A;  3B8Y A;  3GQA A;  3B4N A;  4XOR A;  1PLU A;  1OGM X;  1DBG A;  4XLC A;  4YZX A;  4W8S A;  2X6X A;  2INV A;  3VSU A;  3EQO A;  4XMY A;  4I84 A;  5C1C A;  4XM3 A;  4URR A;  4XN0 A;  3SUC A;  1OFL A;  2EWE A;  3GQ9 A;  1GQ8 A;  3KRG A;  4XNF A;  4YZ0 A;  4U49 A;  2BSP A;  2X85 A;  1IA5 A;  1BN8 A;  3WWG A;  2NTB A;  1KTW A;  1RMG A;  4OJ5 A;  4XKW A;  1OGO X;  4YEL A; 
#chains in the Genus database with same CATH topology
 4YC5 A;  1JTA A;  2PYH A;  4KH3 A;  1CLW A;  3GQ7 A;  3PSS A;  2BM6 A;  2QXZ A;  2VBE A;  4YEI A;  3LMW A;  3PET A;  3VMW A;  3NAW A;  4YCQ A;  1H80 A;  4XLE A;  2Z8G A;  4Z05 A;  1OFM A;  3JUR A;  1EE6 A;  2VFP A;  2F3L A;  4XLA A;  3DU1 X;  4OZY A;  2NTP A;  4Z03 A;  2X6Y A;  4JRA C;  4OJ6 A;  2O1D A;  2O17 A;  2YUH A;  3B90 A;  1EZG A;  3H09 A;  2VJI A;  3SY2 A;  1HG8 A;  4W8T A;  3LJY A;  4HWV A;  3SZE A;  4XQF A;  5JMC B;  3SQV A;  4W8Q A;  4MR0 A;  1O8G A;  3UW0 A;  4OZZ A;  1O8L A;  2B0R A;  2NT9 A;  4YZA A;  1NHC A;  1IDK A;  2V5I A;  4C2L A;  1KQ5 A;  2NZM A;  1O8J A;  2VBM A;  1K4Z A;  1QRB A;  4XOP A;  3ZSC A;  3EQN A;  2PYG A;  2QYU A;  4EW9 A;  1O8E A;  2NSP A;  4XL9 A;  4YZQ A;  1K8F A;  1TYU A;  2NT6 A;  3N6Z A;  3AK5 A;  4XR6 A;  2X3H A;  2O0V A;  1K5C A;  4U4B A;  1PE9 A;  1QJV A;  3N90 A;  4NK6 A;  1QCX A;  1IB4 A;  2G0Y A;  2O6W A;  2J8K A;  2NST A;  5C1E A;  1O8F A;  1PXZ A;  3NB2 A;  4OM9 A;  4XKV A;  5DNS A;  2PEC A;  2O04 A;  1RU4 A;  2INU A;  4NK8 A;  1QA3 A;  2J8I A;  1O8M A;  1XG2 A;  3VST A;  4OJP A;  2IOU G;  3P4G A;  2X6W A;  1LLZ A;  1QA2 A;  2QX3 A;  4OJO A;  2XTX A;  3VSV A;  1WMR A;  3JX8 A;  1L1I A;  3ZPP A;  2XTW A;  1TYW A;  3VMV A;  2VFN A;  1QQ1 A;  4YEJ A;  4XOT A;  3T9G A;  1CZF A;  3ML3 A;  1KCD A;  1BHE A;  1O8H A;  1DBO A;  2NTQ A;  2ODL A;  2QY1 A;  2UVE A;  4PMH A;  2XC1 A;  4XLH A;  1TYX A;  3RIQ A;  4XON A;  4Z06 A;  2XT2 A;  1RWR A;  2O0W A;  1VBL A;  2VFO A;  5AMV A;  2QZA A;  1HF2 A;  3FY3 A;  4V02 C;  1TSP A;  1IDJ A;  2VJJ A;  1O88 A;  1TYV A;  2XT4 A;  4W8R A;  1O8K A;  1LLW A;  2BM4 A;  1O8D A;  1LM1 A;  2VFQ A;  3PSZ A;  4OJL A;  4MXN A;  4XN3 A;  1OFD A;  1JRG A;  1AIR A;  4AVZ A;  3GRH A;  1O8I A;  1OOC A;  1OFE A;  2BM5 A;  2IQ7 A;  2UVF A;  1KCC A;  2VBK A;  3TH0 A;  3GQ8 A;  3LYC A;  1X0C A;  4XLF A;  1QRC A;  3B8Y A;  4YFO A;  3GQA A;  3B4N A;  4XOR A;  4YDT A;  2W7Z A;  1PLU A;  1QA1 A;  1OGM X;  1DBG A;  2BX6 A;  1DAB A;  2XTY A;  4XLC A;  4YZX A;  4W8S A;  2X6X A;  2INV A;  3VSU A;  3EQO A;  2VFM A;  4XMY A;  3SYJ A;  4I84 A;  5C1C A;  4XM3 A;  4URR A;  4XN0 A;  1WXR A;  3SUC A;  3BH7 B;  1OFL A;  3BH6 B;  2EWE A;  3GQ9 A;  1GQ8 A;  2BM7 A;  3KRG A;  4XNF A;  4YZ0 A;  4U49 A;  2BSP A;  2X85 A;  1IA5 A;  1EA0 A;  1BN8 A;  3WWG A;  2NTB A;  1KTW A;  4OPW A;  1RMG A;  4OJ5 A;  4XKW A;  1OGO X;  4YEL A;  5JLV C; 
#chains in the Genus database with same CATH homology
 1JTA A;  2PYH A;  3GQ7 A;  2QXZ A;  2VBE A;  3LMW A;  3VMW A;  1H80 A;  4XLE A;  2Z8G A;  4Z05 A;  1OFM A;  3JUR A;  1EE6 A;  4XLA A;  4OZY A;  2NTP A;  4Z03 A;  2X6Y A;  4OJ6 A;  2O1D A;  2O17 A;  3B90 A;  2VJI A;  1HG8 A;  4W8T A;  4HWV A;  4XQF A;  4W8Q A;  4MR0 A;  1O8G A;  3UW0 A;  4OZZ A;  1O8L A;  2NT9 A;  4YZA A;  1NHC A;  1IDK A;  4C2L A;  2NZM A;  1O8J A;  2VBM A;  4XOP A;  3ZSC A;  3EQN A;  2PYG A;  4EW9 A;  1O8E A;  2NSP A;  4XL9 A;  4YZQ A;  2NT6 A;  4XR6 A;  2X3H A;  2O0V A;  1K5C A;  4U4B A;  1PE9 A;  1QJV A;  4NK6 A;  1QCX A;  5C1E A;  2NST A;  1O8F A;  1PXZ A;  4XKV A;  2PEC A;  2O04 A;  1RU4 A;  2INU A;  4NK8 A;  1O8M A;  1XG2 A;  3VST A;  4OJP A;  2X6W A;  2QX3 A;  4OJO A;  3VSV A;  1WMR A;  3ZPP A;  3VMV A;  4YEJ A;  4XOT A;  3T9G A;  1CZF A;  1KCD A;  2ODL A;  1BHE A;  1O8H A;  1DBO A;  2NTQ A;  2QY1 A;  2UVE A;  4PMH A;  4XON A;  4Z06 A;  1RWR A;  2O0W A;  1VBL A;  5AMV A;  3FY3 A;  1IDJ A;  2VJJ A;  1O88 A;  4W8R A;  4XLH A;  1IB4 A;  1O8K A;  1O8D A;  4OJL A;  4MXN A;  4XN3 A;  1JRG A;  1AIR A;  4AVZ A;  3GRH A;  1O8I A;  1OOC A;  2IQ7 A;  2UVF A;  1KCC A;  2VBK A;  3GQ8 A;  1X0C A;  4XLF A;  3B8Y A;  3GQA A;  3B4N A;  4XOR A;  1PLU A;  1OGM X;  1DBG A;  4XLC A;  4YZX A;  4W8S A;  2X6X A;  2INV A;  3VSU A;  3EQO A;  4XMY A;  4I84 A;  5C1C A;  4XM3 A;  4URR A;  4XN0 A;  3SUC A;  1OFL A;  2EWE A;  3GQ9 A;  1GQ8 A;  3KRG A;  4XNF A;  4YZ0 A;  4U49 A;  2BSP A;  2X85 A;  1IA5 A;  1BN8 A;  3WWG A;  2NTB A;  1KTW A;  1RMG A;  4OJ5 A;  4XKW A;  1OGO X;  4YEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...