2QX3A

Structure of pectate lyase ii from xanthomonas campestris pv. campestris str. atcc 33913
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
330
structure length
330
Chain Sequence
GPVGYGAATTGGGNKVPVNVATFEAMQSAIDSYSGSGGLVLNYTGKFDFGTIKDVCAQWKLPAKTVQIKNKSDVTIKGANGSAANFGIRVVGNAHNVIIQNMTIGLLQGGEDADSISLEGNSSGEPSKIWVDHNTVFASLTKCSGAGDASFDGGIDMKKGVHHVTVSYNYVYNYQKVALNGYSDSDTKNSAARTTYHHNRFENVESRVPLQRRGLSHIYNNYFNNVTTSGINVRMGGIAKIESNYFENIKNPVTSRDSSEIGYWDLINNYVGSGITWGTPDGSKPYANATNWISTKVFPESLGYIYTVTPAAQVKAKVIATAGAGKNLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A seductive method to improve the thermostability and activity of an enzyme
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Lyase
molecule keywords Pectate lyase II
total genus 130
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2007-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2qx3A00
4XLCA 2UVEA 4XLEA 2Z8GA 4XLFA 1O8EA 1DBGA 1OGMX 1KTWA 1O8KA 4MR0A 4URRA 4W8SA 4C2LA 1PE9A 2INVA 2QY1A 1IB4A 1JTAA 4XKVA 3VMWA 1KCDA 1HG8A 1RU4A 3VSUA 3KRGA 2O17A 2O0WA 4XORA 4YZQA 4YZ0A 4AVZA 3EQOA 3B90A 1O8IA 2NT9A 4HWVA 4XOTA 4EW9A 1OFMA 2PYHA 4U49A 4W8RA 4Z06A 1H80A 3FY3A 3GRHA 3WWGA 2VJJA 4OJ6A 4MXNA 2X85A 2EWEA 4YELA 1JRGA 2QX3A 2UVFA 4YZAA 4OJ5A 1GQ8A 1PXZA 1QCXA 2INUA 2PYGA 3ZSCA 1O8JA 2NZMA 1O8DA 4XL9A 2VJIA 2O1DA 5AMVA 3B4NA 4W8QA 4XN0A 1O8FA 2QXZA 3VMVA 2IQ7A 4U4BA 4XQFA 1RWRA 1WMRA 2NTBA 2ODLA 3LMWA 4OZYA 1CZFA 4XLAA 2O04A 2X3HA 1RMGA 4OJLA 4XN3A 1NHCA 2VBKA 1K5CA 2VBMA 3T9GA 3GQ7A 2O0VA 2X6WA 3JURA 4PMHA 1OOCA 1IA5A 4XKWA 2VBEA 5C1EA 3ZPPA 3GQ8A 3EQNA 4XMYA 2NTPA 4OJPA 1PLUA 3VSTA 1O8MA 1OFLA 1O8HA 2PECA 2X6YA 1BN8A 4W8TA 2NSTA 4XR6A 1IDJA 1VBLA 1OGOX 1BHEA 2NT6A 3B8YA 2BSPA 1O88A 4NK6A 3GQ9A 2X6XA 3UW0A 1IDKA 1EE6A 1X0CA 3GQAA 4XNFA 4OZZA 1DBOA 1XG2A 4Z05A 4I84A 4XM3A 4YEJA 4XONA 1QJVA 4XLHA 2NTQA 4Z03A 3SUCA 1AIRA 2NSPA 1O8LA 4YZXA 3VSVA 4XOPA 4NK8A 1O8GA 5C1CA 1KCCA 4OJOA
chains in the Genus database with same CATH superfamily
4XLCA 2UVEA 3PETA 4XLEA 2Z8GA 4XLFA 1O8EA 1DBGA 1OGMX 1KTWA 1O8KA 4MR0A 1TYWA 4URRA 4W8SA 3SQVA 1PE9A 2INVA 1QRCA 3NB2A 2QY1A 1IB4A 2VFNA 1JTAA 3BH6B 4XKVA 3VMWA 1KCDA 1HG8A 2XT2A 1RU4A 3VSUA 1KQ5A 3KRGA 4YC5A 4YEIA 2O17A 2O0WA 4XORA 4YCQA 4YZQA 4YZ0A 4AVZA 3EQOA 1CLWA 1QRBA 3B90A 1TYUA 2VFMA 3AK5A 4OM9A 1O8IA 2NT9A 4HWVA 4XOTA 1QA1A 4EW9A 1QA2A 1OFMA 2PYHA 4U49A 4W8RA 4Z06A 2B0RA 1TYVA 1H80A 2BM7A 3FY3A 3GRHA 3WWGA 2VJJA 4OJ6A 4MXNA 2X85A 1OFEA 2EWEA 4YELA 1JRGA 2QX3A 2UVFA 4YZAA 4OJ5A 5DNSA 1GQ8A 1PXZA 1QCXA 2XTXA 2BX6A 2INUA 2PYGA 3ZSCA 1O8JA 1HF2A 3H09A 2NZMA 1O8DA 1TSPA 2V5IA 4XL9A 2VJIA 2O1DA 3JX8A 5AMVA 3B4NA 3BH7B 4W8QA 1OFDA 4XN0A 3TH0A 1O8FA 4V02C 2QXZA 3SY2A 1DABA 3VMVA 2IQ7A 4U4BA 2XTWA 3LJYA 4XQFA 1EA0A 1RWRA 1WMRA 2NTBA 2ODLA 3LMWA 4OZYA 1CZFA 2F3LA 2XC1A 2O04A 2X3HA 1RMGA 4XLAA 1TYXA 4OJLA 4XN3A 1NHCA 2VBKA 1K5CA 2VBMA 3T9GA 3GQ7A 2O0VA 2XTYA 2X6WA 3JURA 4PMHA 1L1IA 1OOCA 1IA5A 4XKWA 2VBEA 3PSZA 5C1EA 4YDTA 3ZPPA 3GQ8A 3EQNA 2IOUG 1K4ZA 2J8IA 3N90A 4XMYA 3SZEA 3NAWA 2NTPA 4OJPA 1PLUA 1LM1A 3VSTA 3P4GA 1O8MA 1OFLA 1O8HA 2PECA 2X6YA 1BN8A 4W8TA 2NSTA 1EZGA 4XR6A 1IDJA 1VBLA 3SYJA 1OGOX 2O6WA 2QYUA 5JMCB 3RIQA 1BHEA 2QZAA 2G0YA 2NT6A 4Z05A 1QA3A 2J8KA 3B8YA 2BM4A 2BSPA 1O88A 4NK6A 3GQ9A 5JLVC 4OJOA 2X6XA 3PSSA 3UW0A 3ML3A 1IDKA 2W7ZA 1EE6A 2BM5A 1LLZA 3N6ZA 1X0CA 4YFOA 3GQAA 4XNFA 4OZZA 1DBOA 1XG2A 3DU1X 4I84A 4XM3A 4YEJA 3LYCA 1QJVA 4XLHA 4XONA 2NTQA 4Z03A 3SUCA 2VFQA 4OPWA 1AIRA 2BM6A 2NSPA 2YUHA 1O8LA 2XT4A 1K8FA 4JRAC 4YZXA 4KH3A 4XOPA 4NK8A 3VSVA 2VFOA 1O8GA 1LLWA 1WXRA 4C2LA 2VFPA 5C1CA 1KCCA 1QQ1A
chains in the Genus database with same CATH topology
4XLCA 2UVEA 4XLEA 2Z8GA 4XLFA 1O8EA 1DBGA 1OGMX 1KTWA 1O8KA 4MR0A 4URRA 4W8SA 4C2LA 1PE9A 2INVA 2QY1A 1IB4A 1JTAA 4XKVA 3VMWA 1KCDA 1HG8A 1RU4A 3VSUA 3KRGA 2O17A 2O0WA 4XORA 4YZQA 4YZ0A 4AVZA 3EQOA 3B90A 1O8IA 2NT9A 4HWVA 4XOTA 4EW9A 1OFMA 2PYHA 4U49A 4W8RA 4Z06A 1H80A 3FY3A 3GRHA 3WWGA 2VJJA 4OJ6A 4MXNA 2X85A 2EWEA 4YELA 1JRGA 2QX3A 2UVFA 4YZAA 4OJ5A 1GQ8A 1PXZA 1QCXA 2INUA 2PYGA 3ZSCA 1O8JA 2NZMA 1O8DA 4XL9A 2VJIA 2O1DA 5AMVA 3B4NA 4W8QA 4XN0A 1O8FA 2QXZA 3VMVA 2IQ7A 4U4BA 4XQFA 1RWRA 1WMRA 2NTBA 2ODLA 3LMWA 4OZYA 1CZFA 4XLAA 2O04A 2X3HA 1RMGA 4OJLA 4XN3A 1NHCA 2VBKA 1K5CA 2VBMA 3T9GA 3GQ7A 2O0VA 2X6WA 3JURA 4PMHA 1OOCA 1IA5A 4XKWA 2VBEA 5C1EA 3ZPPA 3GQ8A 3EQNA 4XMYA 2NTPA 4OJPA 1PLUA 3VSTA 1O8MA 1OFLA 1O8HA 2PECA 2X6YA 1BN8A 4W8TA 2NSTA 4XR6A 1IDJA 1VBLA 1OGOX 1BHEA 2NT6A 3B8YA 2BSPA 1O88A 4NK6A 3GQ9A 2X6XA 3UW0A 1IDKA 1EE6A 1X0CA 3GQAA 4XNFA 4OZZA 1DBOA 1XG2A 4Z05A 4I84A 4XM3A 4YEJA 4XONA 1QJVA 4XLHA 2NTQA 4Z03A 3SUCA 1AIRA 2NSPA 1O8LA 4YZXA 3VSVA 4XOPA 4NK8A 1O8GA 5C1CA 1KCCA 4OJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLC A;  2UVE A;  4XLE A;  2Z8G A;  4XLF A;  1O8E A;  1DBG A;  1OGM X;  1KTW A;  1O8K A;  4MR0 A;  4URR A;  4W8S A;  4C2L A;  1PE9 A;  2INV A;  2QY1 A;  1IB4 A;  1JTA A;  4XKV A;  3VMW A;  1KCD A;  1HG8 A;  1RU4 A;  3VSU A;  3KRG A;  2O17 A;  2O0W A;  4XOR A;  4YZQ A;  4YZ0 A;  4AVZ A;  3EQO A;  3B90 A;  1O8I A;  2NT9 A;  4HWV A;  4XOT A;  4EW9 A;  1OFM A;  2PYH A;  4U49 A;  4W8R A;  4Z06 A;  1H80 A;  3FY3 A;  3GRH A;  3WWG A;  2VJJ A;  4OJ6 A;  4MXN A;  2X85 A;  2EWE A;  4YEL A;  1JRG A;  2QX3 A;  2UVF A;  4YZA A;  4OJ5 A;  1GQ8 A;  1PXZ A;  1QCX A;  2INU A;  2PYG A;  3ZSC A;  1O8J A;  2NZM A;  1O8D A;  4XL9 A;  2VJI A;  2O1D A;  5AMV A;  3B4N A;  4W8Q A;  4XN0 A;  1O8F A;  2QXZ A;  3VMV A;  2IQ7 A;  4U4B A;  4XQF A;  1RWR A;  1WMR A;  2NTB A;  2ODL A;  3LMW A;  4OZY A;  1CZF A;  4XLA A;  2O04 A;  2X3H A;  1RMG A;  4OJL A;  4XN3 A;  1NHC A;  2VBK A;  1K5C A;  2VBM A;  3T9G A;  3GQ7 A;  2O0V A;  2X6W A;  3JUR A;  4PMH A;  1OOC A;  1IA5 A;  4XKW A;  2VBE A;  5C1E A;  3ZPP A;  3GQ8 A;  3EQN A;  4XMY A;  2NTP A;  4OJP A;  1PLU A;  3VST A;  1O8M A;  1OFL A;  1O8H A;  2PEC A;  2X6Y A;  1BN8 A;  4W8T A;  2NST A;  4XR6 A;  1IDJ A;  1VBL A;  1OGO X;  1BHE A;  2NT6 A;  3B8Y A;  2BSP A;  1O88 A;  4NK6 A;  3GQ9 A;  2X6X A;  3UW0 A;  1IDK A;  1EE6 A;  1X0C A;  3GQA A;  4XNF A;  4OZZ A;  1DBO A;  1XG2 A;  4Z05 A;  4I84 A;  4XM3 A;  4YEJ A;  4XON A;  1QJV A;  4XLH A;  2NTQ A;  4Z03 A;  3SUC A;  1AIR A;  2NSP A;  1O8L A;  4YZX A;  3VSV A;  4XOP A;  4NK8 A;  1O8G A;  5C1C A;  1KCC A;  4OJO A; 
#chains in the Genus database with same CATH topology
 4XLC A;  2UVE A;  3PET A;  4XLE A;  2Z8G A;  4XLF A;  1O8E A;  1DBG A;  1OGM X;  1KTW A;  1O8K A;  4MR0 A;  1TYW A;  4URR A;  4W8S A;  3SQV A;  1PE9 A;  2INV A;  1QRC A;  3NB2 A;  2QY1 A;  1IB4 A;  2VFN A;  1JTA A;  3BH6 B;  4XKV A;  3VMW A;  1KCD A;  1HG8 A;  2XT2 A;  1RU4 A;  3VSU A;  1KQ5 A;  3KRG A;  4YC5 A;  4YEI A;  2O17 A;  2O0W A;  4XOR A;  4YCQ A;  4YZQ A;  4YZ0 A;  4AVZ A;  3EQO A;  1CLW A;  1QRB A;  3B90 A;  1TYU A;  2VFM A;  3AK5 A;  4OM9 A;  1O8I A;  2NT9 A;  4HWV A;  4XOT A;  1QA1 A;  4EW9 A;  1QA2 A;  1OFM A;  2PYH A;  4U49 A;  4W8R A;  4Z06 A;  2B0R A;  1TYV A;  1H80 A;  2BM7 A;  3FY3 A;  3GRH A;  3WWG A;  2VJJ A;  4OJ6 A;  4MXN A;  2X85 A;  1OFE A;  2EWE A;  4YEL A;  1JRG A;  2QX3 A;  2UVF A;  4YZA A;  4OJ5 A;  5DNS A;  1GQ8 A;  1PXZ A;  1QCX A;  2XTX A;  2BX6 A;  2INU A;  2PYG A;  3ZSC A;  1O8J A;  1HF2 A;  3H09 A;  2NZM A;  1O8D A;  1TSP A;  2V5I A;  4XL9 A;  2VJI A;  2O1D A;  3JX8 A;  5AMV A;  3B4N A;  3BH7 B;  4W8Q A;  1OFD A;  4XN0 A;  3TH0 A;  1O8F A;  4V02 C;  2QXZ A;  3SY2 A;  1DAB A;  3VMV A;  2IQ7 A;  4U4B A;  2XTW A;  3LJY A;  4XQF A;  1EA0 A;  1RWR A;  1WMR A;  2NTB A;  2ODL A;  3LMW A;  4OZY A;  1CZF A;  2F3L A;  2XC1 A;  2O04 A;  2X3H A;  1RMG A;  4XLA A;  1TYX A;  4OJL A;  4XN3 A;  1NHC A;  2VBK A;  1K5C A;  2VBM A;  3T9G A;  3GQ7 A;  2O0V A;  2XTY A;  2X6W A;  3JUR A;  4PMH A;  1L1I A;  1OOC A;  1IA5 A;  4XKW A;  2VBE A;  3PSZ A;  5C1E A;  4YDT A;  3ZPP A;  3GQ8 A;  3EQN A;  2IOU G;  1K4Z A;  2J8I A;  3N90 A;  4XMY A;  3SZE A;  3NAW A;  2NTP A;  4OJP A;  1PLU A;  1LM1 A;  3VST A;  3P4G A;  1O8M A;  1OFL A;  1O8H A;  2PEC A;  2X6Y A;  1BN8 A;  4W8T A;  2NST A;  1EZG A;  4XR6 A;  1IDJ A;  1VBL A;  3SYJ A;  1OGO X;  2O6W A;  2QYU A;  5JMC B;  3RIQ A;  1BHE A;  2QZA A;  2G0Y A;  2NT6 A;  4Z05 A;  1QA3 A;  2J8K A;  3B8Y A;  2BM4 A;  2BSP A;  1O88 A;  4NK6 A;  3GQ9 A;  5JLV C;  4OJO A;  2X6X A;  3PSS A;  3UW0 A;  3ML3 A;  1IDK A;  2W7Z A;  1EE6 A;  2BM5 A;  1LLZ A;  3N6Z A;  1X0C A;  4YFO A;  3GQA A;  4XNF A;  4OZZ A;  1DBO A;  1XG2 A;  3DU1 X;  4I84 A;  4XM3 A;  4YEJ A;  3LYC A;  1QJV A;  4XLH A;  4XON A;  2NTQ A;  4Z03 A;  3SUC A;  2VFQ A;  4OPW A;  1AIR A;  2BM6 A;  2NSP A;  2YUH A;  1O8L A;  2XT4 A;  1K8F A;  4JRA C;  4YZX A;  4KH3 A;  4XOP A;  4NK8 A;  3VSV A;  2VFO A;  1O8G A;  1LLW A;  1WXR A;  4C2L A;  2VFP A;  5C1C A;  1KCC A;  1QQ1 A; 
#chains in the Genus database with same CATH homology
 4XLC A;  2UVE A;  4XLE A;  2Z8G A;  4XLF A;  1O8E A;  1DBG A;  1OGM X;  1KTW A;  1O8K A;  4MR0 A;  4URR A;  4W8S A;  4C2L A;  1PE9 A;  2INV A;  2QY1 A;  1IB4 A;  1JTA A;  4XKV A;  3VMW A;  1KCD A;  1HG8 A;  1RU4 A;  3VSU A;  3KRG A;  2O17 A;  2O0W A;  4XOR A;  4YZQ A;  4YZ0 A;  4AVZ A;  3EQO A;  3B90 A;  1O8I A;  2NT9 A;  4HWV A;  4XOT A;  4EW9 A;  1OFM A;  2PYH A;  4U49 A;  4W8R A;  4Z06 A;  1H80 A;  3FY3 A;  3GRH A;  3WWG A;  2VJJ A;  4OJ6 A;  4MXN A;  2X85 A;  2EWE A;  4YEL A;  1JRG A;  2QX3 A;  2UVF A;  4YZA A;  4OJ5 A;  1GQ8 A;  1PXZ A;  1QCX A;  2INU A;  2PYG A;  3ZSC A;  1O8J A;  2NZM A;  1O8D A;  4XL9 A;  2VJI A;  2O1D A;  5AMV A;  3B4N A;  4W8Q A;  4XN0 A;  1O8F A;  2QXZ A;  3VMV A;  2IQ7 A;  4U4B A;  4XQF A;  1RWR A;  1WMR A;  2NTB A;  2ODL A;  3LMW A;  4OZY A;  1CZF A;  4XLA A;  2O04 A;  2X3H A;  1RMG A;  4OJL A;  4XN3 A;  1NHC A;  2VBK A;  1K5C A;  2VBM A;  3T9G A;  3GQ7 A;  2O0V A;  2X6W A;  3JUR A;  4PMH A;  1OOC A;  1IA5 A;  4XKW A;  2VBE A;  5C1E A;  3ZPP A;  3GQ8 A;  3EQN A;  4XMY A;  2NTP A;  4OJP A;  1PLU A;  3VST A;  1O8M A;  1OFL A;  1O8H A;  2PEC A;  2X6Y A;  1BN8 A;  4W8T A;  2NST A;  4XR6 A;  1IDJ A;  1VBL A;  1OGO X;  1BHE A;  2NT6 A;  3B8Y A;  2BSP A;  1O88 A;  4NK6 A;  3GQ9 A;  2X6X A;  3UW0 A;  1IDK A;  1EE6 A;  1X0C A;  3GQA A;  4XNF A;  4OZZ A;  1DBO A;  1XG2 A;  4Z05 A;  4I84 A;  4XM3 A;  4YEJ A;  4XON A;  1QJV A;  4XLH A;  2NTQ A;  4Z03 A;  3SUC A;  1AIR A;  2NSP A;  1O8L A;  4YZX A;  3VSV A;  4XOP A;  4NK8 A;  1O8G A;  5C1C A;  1KCC A;  4OJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...