2QX3A

Structure of pectate lyase ii from xanthomonas campestris pv. campestris str. atcc 33913
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
330
structure length
330
Chain Sequence
b'GPVGYGAATTGGGNKVPVNVATFEAMQSAIDSYSGSGGLVLNYTGKFDFGTIKDVCAQWKLPAKTVQIKNKSDVTIKGANGSAANFGIRVVGNAHNVIIQNMTIGLLQGGEDADSISLEGNSSGEPSKIWVDHNTVFASLTKCSGAGDASFDGGIDMKKGVHHVTVSYNYVYNYQKVALNGYSDSDTKNSAARTTYHHNRFENVESRVPLQRRGLSHIYNNYFNNVTTSGINVRMGGIAKIESNYFENIKNPVTSRDSSEIGYWDLINNYVGSGITWGTPDGSKPYANATNWISTKVFPESLGYIYTVTPAAQVKAKVIATAGAGKNLAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase II
publication title A seductive method to improve the thermostability and activity of an enzyme
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Lyase
total genus 130
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2007-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2qx3A00
2O04A 4PMHA 2NZMA 4W8TA 1AIRA 2VBKA 2VJIA 2PECA 1HG8A 1OOCA 1PXZA 4W8RA 3GQAA 1O8EA 3KRGA 4EW9A 2VJJA 4Z05A 3T9GA 1DBGA 2O1DA 2INUA 1O8LA 1OFLA 2EWEA 4U49A 4XLHA 2IQ7A 2BSPA 4OZYA 4XORA 2UVEA 2NT6A 4Z03A 2X6XA 2X6WA 1RMGA 3VMWA 3JURA 4XLAA 2QY1A 4XONA 2UVFA 4YZ0A 4XR6A 5C1CA 1PLUA 4XNFA 2O0VA 1O8GA 3WWGA 1WMRA 4OJOA 4C2LA 1O8FA 1RWRA 2O0WA 2VBMA 4YZAA 3VSUA 1RU4A 4YEJA 5AMVA 4XOTA 4OJ6A 4URRA 1VBLA 1GQ8A 1H80A 3B8YA 4HWVA 4XM3A 1QJVA 1IDKA 4MR0A 4NK6A 1O8IA 1IA5A 1K5CA 3VMVA 1XG2A 1O88A 2X85A 4XLFA 2NSTA 2X6YA 1KTWA 3LMWA 4I84A 4W8SA 4MXNA 4OJLA 4YZQA 2ODLA 4XN3A 4YELA 5C1EA 4U4BA 2PYGA 4NK8A 2VBEA 1IDJA 4XLEA 4XQFA 4OJPA 3EQNA 4XKVA 1CZFA 4XN0A 3VSVA 4W8QA 2PYHA 3FY3A 2INVA 4Z06A 3ZSCA 1IB4A 3GQ9A 1O8KA 4OZZA 4XKWA 1O8HA 1PE9A 1KCCA 3GQ7A 3GQ8A 3ZPPA 1O8DA 3EQOA 4YZXA 4XLCA 1O8MA 2Z8GA 1QCXA 2QX3A 2O17A 1OGMX 2NSPA 1BHEA 4XL9A 2NTBA 3GRHA 3B4NA 2NT9A 3VSTA 1JRGA 1X0CA 4AVZA 3B90A 3SUCA 1O8JA 1EE6A 4XOPA 2NTPA 1OGOX 1OFMA 1BN8A 2NTQA 4XMYA 3UW0A 4OJ5A 1NHCA 1DBOA 2QXZA 2X3HA 1KCDA 1JTAA
chains in the Genus database with same CATH superfamily
2W7ZA 2O04A 3SY2A 4PMHA 2XC1A 2NZMA 4W8TA 1AIRA 2VBKA 2VJIA 2PECA 1TYWA 1HG8A 1OOCA 1PXZA 4W8RA 1KQ5A 3GQAA 3RIQA 1O8EA 3KRGA 4YCQA 1DABA 4EW9A 3NB2A 2F3LA 2VJJA 1WXRA 4Z05A 3T9GA 1DBGA 2O1DA 2INUA 1O8LA 1OFLA 3H09A 1LLZA 5JLVC 2EWEA 4U49A 1OFDA 4XLHA 2IQ7A 3PSSA 2XTWA 2BSPA 2G0YA 4OZYA 4XORA 2J8IA 2UVEA 2NT6A 4Z03A 1EA0A 2X6XA 2VFOA 1RMGA 2X6WA 1QA2A 4JRAC 3VMWA 2XTYA 3JURA 4XLAA 3PSZA 2QY1A 4XONA 2UVFA 5DNSA 4YEIA 4YC5A 4YZ0A 4XR6A 3BH6B 5C1CA 1PLUA 3AK5A 4XNFA 2O0VA 1O8GA 3N90A 2BX6A 3WWGA 1WMRA 4OJOA 4C2LA 1O8FA 1RWRA 2O0WA 2VBMA 2J8KA 4YZAA 3VSUA 1RU4A 4YEJA 5AMVA 4XOTA 4OJ6A 4URRA 1VBLA 2QZAA 1GQ8A 1H80A 3B8YA 4HWVA 4KH3A 4OM9A 1QJVA 4XM3A 1IDKA 4MR0A 4NK6A 1O8IA 3BH7B 1IA5A 1TYXA 1QA1A 1EZGA 1K5CA 2QYUA 3VMVA 1TYVA 1O88A 1XG2A 2X85A 4XLFA 2NSTA 4V02C 2X6YA 1KTWA 2VFPA 3LMWA 4I84A 4W8SA 1L1IA 4MXNA 4OJLA 4YZQA 2ODLA 4XN3A 4YDTA 4YELA 5C1EA 3SZEA 1QRBA 2BM6A 1LLWA 2BM7A 2PYGA 4U4BA 4NK8A 2VFQA 2VBEA 1IDJA 4XLEA 4XQFA 1TSPA 2B0RA 2BM4A 3EQNA 4OJPA 4XKVA 1CZFA 4XN0A 3VSVA 2BM5A 3SYJA 4W8QA 2PYHA 1OFEA 2IOUG 3FY3A 2INVA 4YFOA 4Z06A 3ZSCA 1IB4A 3GQ9A 1O8KA 1CLWA 4OZZA 3JX8A 4XKWA 1O8HA 1PE9A 2XT4A 1KCCA 3GQ7A 3GQ8A 3ZPPA 2XTXA 1O8DA 3EQOA 4YZXA 3LYCA 2O6WA 4XLCA 1O8MA 2V5IA 3DU1X 2Z8GA 3NAWA 1QCXA 3PETA 2QX3A 2O17A 3SQVA 1OGMX 1HF2A 1BHEA 2NSPA 4XL9A 2NTBA 2YUHA 1QRCA 3ML3A 3GRHA 3TH0A 3B4NA 2NT9A 5JMCB 3VSTA 1JRGA 1LM1A 1X0CA 1JTAA 4AVZA 3B90A 3SUCA 1O8JA 1QQ1A 1EE6A 2XT2A 4XOPA 2NTPA 1OGOX 1OFMA 1BN8A 2NTQA 3P4GA 3N6ZA 4XMYA 3UW0A 4OJ5A 1NHCA 1DBOA 2VFMA 3LJYA 2QXZA 2X3HA 1TYUA 1K4ZA 2VFNA 1KCDA 1QA3A 1K8FA 4OPWA
chains in the Genus database with same CATH topology
2O04A 4PMHA 2NZMA 4W8TA 1AIRA 2VBKA 2VJIA 2PECA 1HG8A 1OOCA 1PXZA 4W8RA 3GQAA 1O8EA 3KRGA 4EW9A 2VJJA 4Z05A 3T9GA 1DBGA 2O1DA 2INUA 1O8LA 1OFLA 2EWEA 4U49A 4XLHA 2IQ7A 2BSPA 4OZYA 4XORA 2UVEA 2NT6A 4Z03A 2X6XA 2X6WA 1RMGA 3VMWA 3JURA 4XLAA 2QY1A 4XONA 2UVFA 4YZ0A 4XR6A 5C1CA 1PLUA 4XNFA 2O0VA 1O8GA 3WWGA 1WMRA 4OJOA 4C2LA 1O8FA 1RWRA 2O0WA 2VBMA 4YZAA 3VSUA 1RU4A 4YEJA 5AMVA 4XOTA 4OJ6A 4URRA 1VBLA 1GQ8A 1H80A 3B8YA 4HWVA 4XM3A 1QJVA 1IDKA 4MR0A 4NK6A 1O8IA 1IA5A 1K5CA 3VMVA 1XG2A 1O88A 2X85A 4XLFA 2NSTA 2X6YA 1KTWA 3LMWA 4I84A 4W8SA 4MXNA 4OJLA 4YZQA 2ODLA 4XN3A 4YELA 5C1EA 4U4BA 2PYGA 4NK8A 2VBEA 1IDJA 4XLEA 4XQFA 4OJPA 3EQNA 4XKVA 1CZFA 4XN0A 3VSVA 4W8QA 2PYHA 3FY3A 2INVA 4Z06A 3ZSCA 1IB4A 3GQ9A 1O8KA 4OZZA 4XKWA 1O8HA 1PE9A 1KCCA 3GQ7A 3GQ8A 3ZPPA 1O8DA 3EQOA 4YZXA 4XLCA 1O8MA 2Z8GA 1QCXA 2QX3A 2O17A 1OGMX 2NSPA 1BHEA 4XL9A 2NTBA 3GRHA 3B4NA 2NT9A 3VSTA 1JRGA 1X0CA 4AVZA 3B90A 3SUCA 1O8JA 1EE6A 4XOPA 2NTPA 1OGOX 1OFMA 1BN8A 2NTQA 4XMYA 3UW0A 4OJ5A 1NHCA 1DBOA 2QXZA 2X3HA 1KCDA 1JTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O04 A;  4PMH A;  2NZM A;  4W8T A;  1AIR A;  2VBK A;  2VJI A;  2PEC A;  1HG8 A;  1OOC A;  1PXZ A;  4W8R A;  3GQA A;  1O8E A;  3KRG A;  4EW9 A;  2VJJ A;  4Z05 A;  3T9G A;  1DBG A;  2O1D A;  2INU A;  1O8L A;  1OFL A;  2EWE A;  4U49 A;  4XLH A;  2IQ7 A;  2BSP A;  4OZY A;  4XOR A;  2UVE A;  2NT6 A;  4Z03 A;  2X6X A;  2X6W A;  1RMG A;  3VMW A;  3JUR A;  4XLA A;  2QY1 A;  4XON A;  2UVF A;  4YZ0 A;  4XR6 A;  5C1C A;  1PLU A;  4XNF A;  2O0V A;  1O8G A;  3WWG A;  1WMR A;  4OJO A;  4C2L A;  1O8F A;  1RWR A;  2O0W A;  2VBM A;  4YZA A;  3VSU A;  1RU4 A;  4YEJ A;  5AMV A;  4XOT A;  4OJ6 A;  4URR A;  1VBL A;  1GQ8 A;  1H80 A;  3B8Y A;  4HWV A;  4XM3 A;  1QJV A;  1IDK A;  4MR0 A;  4NK6 A;  1O8I A;  1IA5 A;  1K5C A;  3VMV A;  1XG2 A;  1O88 A;  2X85 A;  4XLF A;  2NST A;  2X6Y A;  1KTW A;  3LMW A;  4I84 A;  4W8S A;  4MXN A;  4OJL A;  4YZQ A;  2ODL A;  4XN3 A;  4YEL A;  5C1E A;  4U4B A;  2PYG A;  4NK8 A;  2VBE A;  1IDJ A;  4XLE A;  4XQF A;  4OJP A;  3EQN A;  4XKV A;  1CZF A;  4XN0 A;  3VSV A;  4W8Q A;  2PYH A;  3FY3 A;  2INV A;  4Z06 A;  3ZSC A;  1IB4 A;  3GQ9 A;  1O8K A;  4OZZ A;  4XKW A;  1O8H A;  1PE9 A;  1KCC A;  3GQ7 A;  3GQ8 A;  3ZPP A;  1O8D A;  3EQO A;  4YZX A;  4XLC A;  1O8M A;  2Z8G A;  1QCX A;  2QX3 A;  2O17 A;  1OGM X;  2NSP A;  1BHE A;  4XL9 A;  2NTB A;  3GRH A;  3B4N A;  2NT9 A;  3VST A;  1JRG A;  1X0C A;  4AVZ A;  3B90 A;  3SUC A;  1O8J A;  1EE6 A;  4XOP A;  2NTP A;  1OGO X;  1OFM A;  1BN8 A;  2NTQ A;  4XMY A;  3UW0 A;  4OJ5 A;  1NHC A;  1DBO A;  2QXZ A;  2X3H A;  1KCD A;  1JTA A; 
#chains in the Genus database with same CATH topology
 2W7Z A;  2O04 A;  3SY2 A;  4PMH A;  2XC1 A;  2NZM A;  4W8T A;  1AIR A;  2VBK A;  2VJI A;  2PEC A;  1TYW A;  1HG8 A;  1OOC A;  1PXZ A;  4W8R A;  1KQ5 A;  3GQA A;  3RIQ A;  1O8E A;  3KRG A;  4YCQ A;  1DAB A;  4EW9 A;  3NB2 A;  2F3L A;  2VJJ A;  1WXR A;  4Z05 A;  3T9G A;  1DBG A;  2O1D A;  2INU A;  1O8L A;  1OFL A;  3H09 A;  1LLZ A;  5JLV C;  2EWE A;  4U49 A;  1OFD A;  4XLH A;  2IQ7 A;  3PSS A;  2XTW A;  2BSP A;  2G0Y A;  4OZY A;  4XOR A;  2J8I A;  2UVE A;  2NT6 A;  4Z03 A;  1EA0 A;  2X6X A;  2VFO A;  1RMG A;  2X6W A;  1QA2 A;  4JRA C;  3VMW A;  2XTY A;  3JUR A;  4XLA A;  3PSZ A;  2QY1 A;  4XON A;  2UVF A;  5DNS A;  4YEI A;  4YC5 A;  4YZ0 A;  4XR6 A;  3BH6 B;  5C1C A;  1PLU A;  3AK5 A;  4XNF A;  2O0V A;  1O8G A;  3N90 A;  2BX6 A;  3WWG A;  1WMR A;  4OJO A;  4C2L A;  1O8F A;  1RWR A;  2O0W A;  2VBM A;  2J8K A;  4YZA A;  3VSU A;  1RU4 A;  4YEJ A;  5AMV A;  4XOT A;  4OJ6 A;  4URR A;  1VBL A;  2QZA A;  1GQ8 A;  1H80 A;  3B8Y A;  4HWV A;  4KH3 A;  4OM9 A;  1QJV A;  4XM3 A;  1IDK A;  4MR0 A;  4NK6 A;  1O8I A;  3BH7 B;  1IA5 A;  1TYX A;  1QA1 A;  1EZG A;  1K5C A;  2QYU A;  3VMV A;  1TYV A;  1O88 A;  1XG2 A;  2X85 A;  4XLF A;  2NST A;  4V02 C;  2X6Y A;  1KTW A;  2VFP A;  3LMW A;  4I84 A;  4W8S A;  1L1I A;  4MXN A;  4OJL A;  4YZQ A;  2ODL A;  4XN3 A;  4YDT A;  4YEL A;  5C1E A;  3SZE A;  1QRB A;  2BM6 A;  1LLW A;  2BM7 A;  2PYG A;  4U4B A;  4NK8 A;  2VFQ A;  2VBE A;  1IDJ A;  4XLE A;  4XQF A;  1TSP A;  2B0R A;  2BM4 A;  3EQN A;  4OJP A;  4XKV A;  1CZF A;  4XN0 A;  3VSV A;  2BM5 A;  3SYJ A;  4W8Q A;  2PYH A;  1OFE A;  2IOU G;  3FY3 A;  2INV A;  4YFO A;  4Z06 A;  3ZSC A;  1IB4 A;  3GQ9 A;  1O8K A;  1CLW A;  4OZZ A;  3JX8 A;  4XKW A;  1O8H A;  1PE9 A;  2XT4 A;  1KCC A;  3GQ7 A;  3GQ8 A;  3ZPP A;  2XTX A;  1O8D A;  3EQO A;  4YZX A;  3LYC A;  2O6W A;  4XLC A;  1O8M A;  2V5I A;  3DU1 X;  2Z8G A;  3NAW A;  1QCX A;  3PET A;  2QX3 A;  2O17 A;  3SQV A;  1OGM X;  1HF2 A;  1BHE A;  2NSP A;  4XL9 A;  2NTB A;  2YUH A;  1QRC A;  3ML3 A;  3GRH A;  3TH0 A;  3B4N A;  2NT9 A;  5JMC B;  3VST A;  1JRG A;  1LM1 A;  1X0C A;  1JTA A;  4AVZ A;  3B90 A;  3SUC A;  1O8J A;  1QQ1 A;  1EE6 A;  2XT2 A;  4XOP A;  2NTP A;  1OGO X;  1OFM A;  1BN8 A;  2NTQ A;  3P4G A;  3N6Z A;  4XMY A;  3UW0 A;  4OJ5 A;  1NHC A;  1DBO A;  2VFM A;  3LJY A;  2QXZ A;  2X3H A;  1TYU A;  1K4Z A;  2VFN A;  1KCD A;  1QA3 A;  1K8F A;  4OPW A; 
#chains in the Genus database with same CATH homology
 2O04 A;  4PMH A;  2NZM A;  4W8T A;  1AIR A;  2VBK A;  2VJI A;  2PEC A;  1HG8 A;  1OOC A;  1PXZ A;  4W8R A;  3GQA A;  1O8E A;  3KRG A;  4EW9 A;  2VJJ A;  4Z05 A;  3T9G A;  1DBG A;  2O1D A;  2INU A;  1O8L A;  1OFL A;  2EWE A;  4U49 A;  4XLH A;  2IQ7 A;  2BSP A;  4OZY A;  4XOR A;  2UVE A;  2NT6 A;  4Z03 A;  2X6X A;  2X6W A;  1RMG A;  3VMW A;  3JUR A;  4XLA A;  2QY1 A;  4XON A;  2UVF A;  4YZ0 A;  4XR6 A;  5C1C A;  1PLU A;  4XNF A;  2O0V A;  1O8G A;  3WWG A;  1WMR A;  4OJO A;  4C2L A;  1O8F A;  1RWR A;  2O0W A;  2VBM A;  4YZA A;  3VSU A;  1RU4 A;  4YEJ A;  5AMV A;  4XOT A;  4OJ6 A;  4URR A;  1VBL A;  1GQ8 A;  1H80 A;  3B8Y A;  4HWV A;  4XM3 A;  1QJV A;  1IDK A;  4MR0 A;  4NK6 A;  1O8I A;  1IA5 A;  1K5C A;  3VMV A;  1XG2 A;  1O88 A;  2X85 A;  4XLF A;  2NST A;  2X6Y A;  1KTW A;  3LMW A;  4I84 A;  4W8S A;  4MXN A;  4OJL A;  4YZQ A;  2ODL A;  4XN3 A;  4YEL A;  5C1E A;  4U4B A;  2PYG A;  4NK8 A;  2VBE A;  1IDJ A;  4XLE A;  4XQF A;  4OJP A;  3EQN A;  4XKV A;  1CZF A;  4XN0 A;  3VSV A;  4W8Q A;  2PYH A;  3FY3 A;  2INV A;  4Z06 A;  3ZSC A;  1IB4 A;  3GQ9 A;  1O8K A;  4OZZ A;  4XKW A;  1O8H A;  1PE9 A;  1KCC A;  3GQ7 A;  3GQ8 A;  3ZPP A;  1O8D A;  3EQO A;  4YZX A;  4XLC A;  1O8M A;  2Z8G A;  1QCX A;  2QX3 A;  2O17 A;  1OGM X;  2NSP A;  1BHE A;  4XL9 A;  2NTB A;  3GRH A;  3B4N A;  2NT9 A;  3VST A;  1JRG A;  1X0C A;  4AVZ A;  3B90 A;  3SUC A;  1O8J A;  1EE6 A;  4XOP A;  2NTP A;  1OGO X;  1OFM A;  1BN8 A;  2NTQ A;  4XMY A;  3UW0 A;  4OJ5 A;  1NHC A;  1DBO A;  2QXZ A;  2X3H A;  1KCD A;  1JTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...